US20220251526A1 - Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof - Google Patents
Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof Download PDFInfo
- Publication number
- US20220251526A1 US20220251526A1 US17/728,359 US202217728359A US2022251526A1 US 20220251526 A1 US20220251526 A1 US 20220251526A1 US 202217728359 A US202217728359 A US 202217728359A US 2022251526 A1 US2022251526 A1 US 2022251526A1
- Authority
- US
- United States
- Prior art keywords
- formulation
- concentration
- subject
- administration
- decline
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 102000004190 Enzymes Human genes 0.000 title claims abstract description 115
- 108090000790 Enzymes Proteins 0.000 title claims abstract description 115
- 102000037865 fusion proteins Human genes 0.000 title claims abstract description 114
- 108020001507 fusion proteins Proteins 0.000 title claims abstract description 114
- 230000002132 lysosomal effect Effects 0.000 title claims abstract description 90
- 239000000203 mixture Substances 0.000 title claims description 233
- 238000009472 formulation Methods 0.000 title claims description 189
- 230000001225 therapeutic effect Effects 0.000 title abstract description 106
- 238000000034 method Methods 0.000 claims abstract description 109
- 208000015439 Lysosomal storage disease Diseases 0.000 claims abstract description 33
- 208000005340 mucopolysaccharidosis III Diseases 0.000 claims description 80
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 74
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 72
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 claims description 69
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 claims description 66
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 claims description 66
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 claims description 66
- 210000001519 tissue Anatomy 0.000 claims description 57
- 230000007423 decrease Effects 0.000 claims description 56
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 claims description 56
- 229920002971 Heparan sulfate Polymers 0.000 claims description 46
- 208000024891 symptom Diseases 0.000 claims description 41
- 229920001213 Polysorbate 20 Polymers 0.000 claims description 37
- 229940068977 polysorbate 20 Drugs 0.000 claims description 37
- 239000011780 sodium chloride Substances 0.000 claims description 36
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 claims description 35
- 210000003712 lysosome Anatomy 0.000 claims description 33
- 230000001868 lysosomic effect Effects 0.000 claims description 33
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 32
- 230000009467 reduction Effects 0.000 claims description 31
- BBMHARZCALWXSL-UHFFFAOYSA-M sodium dihydrogenphosphate monohydrate Chemical compound O.[Na+].OP(O)([O-])=O BBMHARZCALWXSL-UHFFFAOYSA-M 0.000 claims description 31
- 229920002683 Glycosaminoglycan Polymers 0.000 claims description 30
- PYLIXCKOHOHGKQ-UHFFFAOYSA-L disodium;hydrogen phosphate;heptahydrate Chemical compound O.O.O.O.O.O.O.[Na+].[Na+].OP([O-])([O-])=O PYLIXCKOHOHGKQ-UHFFFAOYSA-L 0.000 claims description 30
- 210000003169 central nervous system Anatomy 0.000 claims description 29
- 239000003795 chemical substances by application Substances 0.000 claims description 26
- 230000003442 weekly effect Effects 0.000 claims description 25
- 239000012634 fragment Substances 0.000 claims description 21
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 claims description 20
- 230000006870 function Effects 0.000 claims description 20
- 238000000185 intracerebroventricular administration Methods 0.000 claims description 20
- 239000003814 drug Substances 0.000 claims description 19
- 238000007913 intrathecal administration Methods 0.000 claims description 18
- 230000002829 reductive effect Effects 0.000 claims description 18
- 238000003860 storage Methods 0.000 claims description 18
- 210000004027 cell Anatomy 0.000 claims description 16
- 210000000278 spinal cord Anatomy 0.000 claims description 16
- 210000001638 cerebellum Anatomy 0.000 claims description 14
- 230000003920 cognitive function Effects 0.000 claims description 13
- 238000011161 development Methods 0.000 claims description 10
- 230000018109 developmental process Effects 0.000 claims description 10
- 239000003792 electrolyte Substances 0.000 claims description 10
- 230000006872 improvement Effects 0.000 claims description 10
- 230000008449 language Effects 0.000 claims description 10
- DHRRIBDTHFBPNG-UHFFFAOYSA-L magnesium dichloride hexahydrate Chemical compound O.O.O.O.O.O.[Mg+2].[Cl-].[Cl-] DHRRIBDTHFBPNG-UHFFFAOYSA-L 0.000 claims description 10
- 210000002569 neuron Anatomy 0.000 claims description 10
- 239000001103 potassium chloride Substances 0.000 claims description 10
- 235000011164 potassium chloride Nutrition 0.000 claims description 10
- 239000006172 buffering agent Substances 0.000 claims description 9
- 229940050906 magnesium chloride hexahydrate Drugs 0.000 claims description 9
- 101800001707 Spacer peptide Proteins 0.000 claims description 8
- 210000004885 white matter Anatomy 0.000 claims description 8
- 230000003044 adaptive effect Effects 0.000 claims description 7
- LLSDKQJKOVVTOJ-UHFFFAOYSA-L calcium chloride dihydrate Chemical compound O.O.[Cl-].[Cl-].[Ca+2] LLSDKQJKOVVTOJ-UHFFFAOYSA-L 0.000 claims description 7
- 229940052299 calcium chloride dihydrate Drugs 0.000 claims description 7
- 239000003463 adsorbent Substances 0.000 claims description 6
- 230000006999 cognitive decline Effects 0.000 claims description 5
- 208000010877 cognitive disease Diseases 0.000 claims description 5
- 230000001815 facial effect Effects 0.000 claims description 5
- 230000007659 motor function Effects 0.000 claims description 5
- 206010001488 Aggression Diseases 0.000 claims description 4
- 210000004884 grey matter Anatomy 0.000 claims description 4
- 239000002052 molecular layer Substances 0.000 claims description 4
- 210000002637 putamen Anatomy 0.000 claims description 4
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 claims description 3
- 210000003710 cerebral cortex Anatomy 0.000 claims description 3
- 230000008131 children development Effects 0.000 claims description 3
- 208000013403 hyperactivity Diseases 0.000 claims description 3
- 210000002418 meninge Anatomy 0.000 claims description 3
- 210000001259 mesencephalon Anatomy 0.000 claims description 3
- 210000000478 neocortex Anatomy 0.000 claims description 3
- 229960002816 potassium chloride Drugs 0.000 claims description 3
- 208000019116 sleep disease Diseases 0.000 claims description 3
- 208000022925 sleep disturbance Diseases 0.000 claims description 3
- 206010011878 Deafness Diseases 0.000 claims description 2
- 239000001110 calcium chloride Substances 0.000 claims description 2
- 229960002713 calcium chloride Drugs 0.000 claims description 2
- 229910001628 calcium chloride Inorganic materials 0.000 claims description 2
- 239000011521 glass Substances 0.000 claims description 2
- 230000010370 hearing loss Effects 0.000 claims description 2
- 231100000888 hearing loss Toxicity 0.000 claims description 2
- 208000016354 hearing loss disease Diseases 0.000 claims description 2
- 239000000843 powder Substances 0.000 claims description 2
- 229960002668 sodium chloride Drugs 0.000 claims description 2
- 239000012669 liquid formulation Substances 0.000 abstract description 35
- 241000124008 Mammalia Species 0.000 abstract description 3
- 235000018102 proteins Nutrition 0.000 description 64
- 102000004169 proteins and genes Human genes 0.000 description 64
- 108090000623 proteins and genes Proteins 0.000 description 64
- 201000010099 disease Diseases 0.000 description 40
- 241000282472 Canis lupus familiaris Species 0.000 description 38
- 230000000694 effects Effects 0.000 description 33
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 28
- 235000001014 amino acid Nutrition 0.000 description 26
- 150000001413 amino acids Chemical class 0.000 description 22
- 102100038968 WAP four-disulfide core domain protein 1 Human genes 0.000 description 19
- 230000015572 biosynthetic process Effects 0.000 description 18
- 210000004556 brain Anatomy 0.000 description 17
- 208000011580 syndromic disease Diseases 0.000 description 17
- 230000008685 targeting Effects 0.000 description 17
- 238000001802 infusion Methods 0.000 description 14
- 108010009380 alpha-N-acetyl-D-glucosaminidase Proteins 0.000 description 13
- 238000004458 analytical method Methods 0.000 description 13
- 238000002347 injection Methods 0.000 description 13
- 239000007924 injection Substances 0.000 description 13
- 239000002245 particle Substances 0.000 description 13
- 239000008194 pharmaceutical composition Substances 0.000 description 13
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 12
- 208000035475 disorder Diseases 0.000 description 12
- 230000001965 increasing effect Effects 0.000 description 12
- NBSCHQHZLSJFNQ-QTVWNMPRSA-N D-Mannose-6-phosphate Chemical compound OC1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H](O)[C@@H]1O NBSCHQHZLSJFNQ-QTVWNMPRSA-N 0.000 description 11
- 239000000546 pharmaceutical excipient Substances 0.000 description 11
- 150000003839 salts Chemical class 0.000 description 10
- 102100034561 Alpha-N-acetylglucosaminidase Human genes 0.000 description 9
- 102000003746 Insulin Receptor Human genes 0.000 description 9
- 108010001127 Insulin Receptor Proteins 0.000 description 9
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 9
- 210000004720 cerebrum Anatomy 0.000 description 9
- 239000003381 stabilizer Substances 0.000 description 9
- 101001076292 Homo sapiens Insulin-like growth factor II Proteins 0.000 description 8
- 102000038460 IGF Type 2 Receptor Human genes 0.000 description 8
- 108010031792 IGF Type 2 Receptor Proteins 0.000 description 8
- 238000005516 engineering process Methods 0.000 description 8
- 102000057877 human IGF2 Human genes 0.000 description 8
- 230000000750 progressive effect Effects 0.000 description 8
- 125000006850 spacer group Chemical group 0.000 description 8
- 238000012360 testing method Methods 0.000 description 8
- 239000003981 vehicle Substances 0.000 description 8
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 7
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 description 7
- 108010009491 Lysosomal-Associated Membrane Protein 2 Proteins 0.000 description 7
- 102000009565 Lysosomal-Associated Membrane Protein 2 Human genes 0.000 description 7
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 7
- 230000002490 cerebral effect Effects 0.000 description 7
- 230000003247 decreasing effect Effects 0.000 description 7
- 230000003292 diminished effect Effects 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 230000003285 pharmacodynamic effect Effects 0.000 description 7
- 230000002265 prevention Effects 0.000 description 7
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- 102000004961 Furin Human genes 0.000 description 6
- 108090001126 Furin Proteins 0.000 description 6
- 101000924350 Homo sapiens Alpha-N-acetylglucosaminidase Proteins 0.000 description 6
- 238000009825 accumulation Methods 0.000 description 6
- 230000002411 adverse Effects 0.000 description 6
- 230000001149 cognitive effect Effects 0.000 description 6
- 230000007812 deficiency Effects 0.000 description 6
- -1 mannose carbohydrate Chemical class 0.000 description 6
- 229920001542 oligosaccharide Polymers 0.000 description 6
- 102000005962 receptors Human genes 0.000 description 6
- 108020003175 receptors Proteins 0.000 description 6
- 239000004475 Arginine Substances 0.000 description 5
- 208000008955 Mucolipidoses Diseases 0.000 description 5
- 208000025820 Sanfilippo syndrome type B Diseases 0.000 description 5
- 238000004220 aggregation Methods 0.000 description 5
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 5
- 210000000133 brain stem Anatomy 0.000 description 5
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 5
- 230000002526 effect on cardiovascular system Effects 0.000 description 5
- 238000002641 enzyme replacement therapy Methods 0.000 description 5
- 150000002270 gangliosides Chemical class 0.000 description 5
- 235000011187 glycerol Nutrition 0.000 description 5
- 208000036709 mucopolysaccharidosis type 3B Diseases 0.000 description 5
- 208000012227 mucopolysaccharidosis type IIIB Diseases 0.000 description 5
- 230000001537 neural effect Effects 0.000 description 5
- 230000007935 neutral effect Effects 0.000 description 5
- 150000002482 oligosaccharides Chemical class 0.000 description 5
- 239000002243 precursor Substances 0.000 description 5
- 239000003755 preservative agent Substances 0.000 description 5
- 238000005086 pumping Methods 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 5
- 239000011232 storage material Substances 0.000 description 5
- 235000000346 sugar Nutrition 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 4
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 4
- 229920000045 Dermatan sulfate Polymers 0.000 description 4
- 206010061818 Disease progression Diseases 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 4
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical group CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 4
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 4
- 108010076504 Protein Sorting Signals Proteins 0.000 description 4
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 4
- 229930006000 Sucrose Natural products 0.000 description 4
- 230000002776 aggregation Effects 0.000 description 4
- 230000006399 behavior Effects 0.000 description 4
- 150000001720 carbohydrates Chemical class 0.000 description 4
- 235000014633 carbohydrates Nutrition 0.000 description 4
- 239000000969 carrier Substances 0.000 description 4
- AVJBPWGFOQAPRH-FWMKGIEWSA-L dermatan sulfate Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@H](OS([O-])(=O)=O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](C([O-])=O)O1 AVJBPWGFOQAPRH-FWMKGIEWSA-L 0.000 description 4
- 229940051593 dermatan sulfate Drugs 0.000 description 4
- 230000005750 disease progression Effects 0.000 description 4
- 238000012377 drug delivery Methods 0.000 description 4
- 239000008103 glucose Substances 0.000 description 4
- 230000013595 glycosylation Effects 0.000 description 4
- 238000006206 glycosylation reaction Methods 0.000 description 4
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 102000004196 processed proteins & peptides Human genes 0.000 description 4
- 239000000600 sorbitol Substances 0.000 description 4
- 235000010356 sorbitol Nutrition 0.000 description 4
- 238000001370 static light scattering Methods 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 239000005720 sucrose Substances 0.000 description 4
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 208000036632 Brain mass Diseases 0.000 description 3
- 102000014914 Carrier Proteins Human genes 0.000 description 3
- 108010078791 Carrier Proteins Proteins 0.000 description 3
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 3
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 3
- 102000004627 Iduronidase Human genes 0.000 description 3
- 108010003381 Iduronidase Proteins 0.000 description 3
- 229920000288 Keratan sulfate Polymers 0.000 description 3
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 3
- 241000282567 Macaca fascicularis Species 0.000 description 3
- 229930195725 Mannitol Natural products 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 239000003708 ampul Substances 0.000 description 3
- 238000010171 animal model Methods 0.000 description 3
- 239000003963 antioxidant agent Substances 0.000 description 3
- 235000006708 antioxidants Nutrition 0.000 description 3
- 229960005070 ascorbic acid Drugs 0.000 description 3
- 235000010323 ascorbic acid Nutrition 0.000 description 3
- 239000011668 ascorbic acid Substances 0.000 description 3
- 230000003542 behavioural effect Effects 0.000 description 3
- 210000004289 cerebral ventricle Anatomy 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 238000004891 communication Methods 0.000 description 3
- 230000007547 defect Effects 0.000 description 3
- 239000008121 dextrose Substances 0.000 description 3
- 238000009826 distribution Methods 0.000 description 3
- 231100000673 dose–response relationship Toxicity 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 235000019441 ethanol Nutrition 0.000 description 3
- GIVLTTJNORAZON-HDBOBKCLSA-N ganglioside GM2 (18:0) Chemical compound O[C@@H]1[C@@H](O)[C@H](OC[C@H](NC(=O)CCCCCCCCCCCCCCCCC)[C@H](O)\C=C\CCCCCCCCCCCCC)O[C@H](CO)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@]2(O[C@H]([C@H](NC(C)=O)[C@@H](O)C2)[C@H](O)[C@H](O)CO)C(O)=O)[C@@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](CO)O1 GIVLTTJNORAZON-HDBOBKCLSA-N 0.000 description 3
- 210000001320 hippocampus Anatomy 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 210000003016 hypothalamus Anatomy 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- KXCLCNHUUKTANI-RBIYJLQWSA-N keratan Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@H](COS(O)(=O)=O)O[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@H](O[C@@H](O[C@H]3[C@H]([C@@H](COS(O)(=O)=O)O[C@@H](O)[C@@H]3O)O)[C@H](NC(C)=O)[C@H]2O)COS(O)(=O)=O)O[C@H](COS(O)(=O)=O)[C@@H]1O KXCLCNHUUKTANI-RBIYJLQWSA-N 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 238000009593 lumbar puncture Methods 0.000 description 3
- 238000002595 magnetic resonance imaging Methods 0.000 description 3
- 239000000594 mannitol Substances 0.000 description 3
- 235000010355 mannitol Nutrition 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 229930182817 methionine Natural products 0.000 description 3
- 108010062973 mitochondrial ATPase subunit c Proteins 0.000 description 3
- 229950006780 n-acetylglucosamine Drugs 0.000 description 3
- 210000004498 neuroglial cell Anatomy 0.000 description 3
- 239000000825 pharmaceutical preparation Substances 0.000 description 3
- 230000002335 preservative effect Effects 0.000 description 3
- 235000004252 protein component Nutrition 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 231100000419 toxicity Toxicity 0.000 description 3
- 230000001988 toxicity Effects 0.000 description 3
- 230000001755 vocal effect Effects 0.000 description 3
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 2
- 102000013455 Amyloid beta-Peptides Human genes 0.000 description 2
- 108010090849 Amyloid beta-Peptides Proteins 0.000 description 2
- 101710124976 Beta-hexosaminidase A Proteins 0.000 description 2
- 102100022548 Beta-hexosaminidase subunit alpha Human genes 0.000 description 2
- 241000282465 Canis Species 0.000 description 2
- 206010008027 Cerebellar atrophy Diseases 0.000 description 2
- 206010011469 Crying Diseases 0.000 description 2
- 206010012289 Dementia Diseases 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 208000032007 Glycogen storage disease due to acid maltase deficiency Diseases 0.000 description 2
- 206010053185 Glycogen storage disease type II Diseases 0.000 description 2
- 102000010956 Glypican Human genes 0.000 description 2
- 108050001154 Glypican Proteins 0.000 description 2
- 108010000540 Hexosaminidases Proteins 0.000 description 2
- 102000002268 Hexosaminidases Human genes 0.000 description 2
- 101000746373 Homo sapiens Granulocyte-macrophage colony-stimulating factor Proteins 0.000 description 2
- 108010031794 IGF Type 1 Receptor Proteins 0.000 description 2
- 208000026350 Inborn Genetic disease Diseases 0.000 description 2
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- LEVWYRKDKASIDU-IMJSIDKUSA-N L-cystine Chemical compound [O-]C(=O)[C@@H]([NH3+])CSSC[C@H]([NH3+])C([O-])=O LEVWYRKDKASIDU-IMJSIDKUSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 102100033448 Lysosomal alpha-glucosidase Human genes 0.000 description 2
- 108010009254 Lysosomal-Associated Membrane Protein 1 Proteins 0.000 description 2
- 102100035133 Lysosome-associated membrane glycoprotein 1 Human genes 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 206010072927 Mucolipidosis type I Diseases 0.000 description 2
- 208000002678 Mucopolysaccharidoses Diseases 0.000 description 2
- 206010056886 Mucopolysaccharidosis I Diseases 0.000 description 2
- 206010028095 Mucopolysaccharidosis IV Diseases 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 238000013019 agitation Methods 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 230000003078 antioxidant effect Effects 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 2
- 230000002238 attenuated effect Effects 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 235000019445 benzyl alcohol Nutrition 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- 102000005936 beta-Galactosidase Human genes 0.000 description 2
- 108010085377 beta-N-Acetylhexosaminidases Proteins 0.000 description 2
- 102000007478 beta-N-Acetylhexosaminidases Human genes 0.000 description 2
- 239000000090 biomarker Substances 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 210000005013 brain tissue Anatomy 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 210000000748 cardiovascular system Anatomy 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 235000012000 cholesterol Nutrition 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 210000003703 cisterna magna Anatomy 0.000 description 2
- 230000001054 cortical effect Effects 0.000 description 2
- 229960003067 cystine Drugs 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 229940126534 drug product Drugs 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 210000002950 fibroblast Anatomy 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 238000012395 formulation development Methods 0.000 description 2
- 208000016361 genetic disease Diseases 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 229960005150 glycerol Drugs 0.000 description 2
- 201000004502 glycogen storage disease II Diseases 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 238000000099 in vitro assay Methods 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 238000005462 in vivo assay Methods 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- JJWLVOIRVHMVIS-UHFFFAOYSA-N isopropylamine Chemical compound CC(C)N JJWLVOIRVHMVIS-UHFFFAOYSA-N 0.000 description 2
- 230000000366 juvenile effect Effects 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 239000006193 liquid solution Substances 0.000 description 2
- 239000012931 lyophilized formulation Substances 0.000 description 2
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 2
- 235000019359 magnesium stearate Nutrition 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- PJUIMOJAAPLTRJ-UHFFFAOYSA-N monothioglycerol Chemical compound OCC(O)CS PJUIMOJAAPLTRJ-UHFFFAOYSA-N 0.000 description 2
- 206010028093 mucopolysaccharidosis Diseases 0.000 description 2
- 208000022018 mucopolysaccharidosis type 2 Diseases 0.000 description 2
- 208000011045 mucopolysaccharidosis type 3 Diseases 0.000 description 2
- 208000025919 mucopolysaccharidosis type 7 Diseases 0.000 description 2
- 210000003205 muscle Anatomy 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 230000007170 pathology Effects 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 210000004786 perivascular cell Anatomy 0.000 description 2
- 239000008177 pharmaceutical agent Substances 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- 230000004845 protein aggregation Effects 0.000 description 2
- 210000000449 purkinje cell Anatomy 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 210000002345 respiratory system Anatomy 0.000 description 2
- 210000003625 skull Anatomy 0.000 description 2
- 230000007958 sleep Effects 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 238000001179 sorption measurement Methods 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 238000010189 synthetic method Methods 0.000 description 2
- 210000001103 thalamus Anatomy 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 229940035024 thioglycerol Drugs 0.000 description 2
- GETQZCLCWQTVFV-UHFFFAOYSA-N trimethylamine Chemical compound CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 2
- 230000002861 ventricular Effects 0.000 description 2
- 229920002554 vinyl polymer Polymers 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- MIJDSYMOBYNHOT-UHFFFAOYSA-N 2-(ethylamino)ethanol Chemical compound CCNCCO MIJDSYMOBYNHOT-UHFFFAOYSA-N 0.000 description 1
- SPCKHVPPRJWQRZ-UHFFFAOYSA-N 2-benzhydryloxy-n,n-dimethylethanamine;2-hydroxypropane-1,2,3-tricarboxylic acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O.C=1C=CC=CC=1C(OCCN(C)C)C1=CC=CC=C1 SPCKHVPPRJWQRZ-UHFFFAOYSA-N 0.000 description 1
- SQDAZGGFXASXDW-UHFFFAOYSA-N 5-bromo-2-(trifluoromethoxy)pyridine Chemical compound FC(F)(F)OC1=CC=C(Br)C=N1 SQDAZGGFXASXDW-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 102000006772 Acid Ceramidase Human genes 0.000 description 1
- 108020005296 Acid Ceramidase Proteins 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 208000029602 Alpha-N-acetylgalactosaminidase deficiency Diseases 0.000 description 1
- 208000031277 Amaurotic familial idiocy Diseases 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 229920000856 Amylose Polymers 0.000 description 1
- 206010002091 Anaesthesia Diseases 0.000 description 1
- 102100022146 Arylsulfatase A Human genes 0.000 description 1
- 102100031491 Arylsulfatase B Human genes 0.000 description 1
- 206010068220 Aspartylglucosaminuria Diseases 0.000 description 1
- 206010003591 Ataxia Diseases 0.000 description 1
- 102100032487 Beta-mannosidase Human genes 0.000 description 1
- 208000024806 Brain atrophy Diseases 0.000 description 1
- YDNKGFDKKRUKPY-JHOUSYSJSA-N C16 ceramide Natural products CCCCCCCCCCCCCCCC(=O)N[C@@H](CO)[C@H](O)C=CCCCCCCCCCCCCC YDNKGFDKKRUKPY-JHOUSYSJSA-N 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- 108010059081 Cathepsin A Proteins 0.000 description 1
- 102000005572 Cathepsin A Human genes 0.000 description 1
- 102100037182 Cation-independent mannose-6-phosphate receptor Human genes 0.000 description 1
- 101710145225 Cation-independent mannose-6-phosphate receptor Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 108010036867 Cerebroside-Sulfatase Proteins 0.000 description 1
- 229920001287 Chondroitin sulfate Polymers 0.000 description 1
- YASYEJJMZJALEJ-UHFFFAOYSA-N Citric acid monohydrate Chemical compound O.OC(=O)CC(O)(C(O)=O)CC(O)=O YASYEJJMZJALEJ-UHFFFAOYSA-N 0.000 description 1
- 208000032170 Congenital Abnormalities Diseases 0.000 description 1
- 206010010904 Convulsion Diseases 0.000 description 1
- 208000006069 Corneal Opacity Diseases 0.000 description 1
- 206010011777 Cystinosis Diseases 0.000 description 1
- XBPCUCUWBYBCDP-UHFFFAOYSA-N Dicyclohexylamine Chemical compound C1CCCCC1NC1CCCCC1 XBPCUCUWBYBCDP-UHFFFAOYSA-N 0.000 description 1
- 206010066054 Dysmorphism Diseases 0.000 description 1
- 208000024720 Fabry Disease Diseases 0.000 description 1
- 208000001948 Farber Lipogranulomatosis Diseases 0.000 description 1
- 208000033149 Farber disease Diseases 0.000 description 1
- 208000001905 GM2 Gangliosidoses Diseases 0.000 description 1
- 201000008905 GM2 gangliosidosis Diseases 0.000 description 1
- 102100028496 Galactocerebrosidase Human genes 0.000 description 1
- 208000017462 Galactosialidosis Diseases 0.000 description 1
- 108010042681 Galactosylceramidase Proteins 0.000 description 1
- IAJILQKETJEXLJ-UHFFFAOYSA-N Galacturonsaeure Natural products O=CC(O)C(O)C(O)C(O)C(O)=O IAJILQKETJEXLJ-UHFFFAOYSA-N 0.000 description 1
- 102100023364 Ganglioside GM2 activator Human genes 0.000 description 1
- 208000015872 Gaucher disease Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 208000010055 Globoid Cell Leukodystrophy Diseases 0.000 description 1
- 102000004547 Glucosylceramidase Human genes 0.000 description 1
- 108010017544 Glucosylceramidase Proteins 0.000 description 1
- 102000053187 Glucuronidase Human genes 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- 229920002527 Glycogen Polymers 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 108050009377 Glypican-5 Proteins 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 239000012981 Hank's balanced salt solution Substances 0.000 description 1
- 101001045440 Homo sapiens Beta-hexosaminidase subunit alpha Proteins 0.000 description 1
- 101000685969 Homo sapiens Ganglioside GM2 activator Proteins 0.000 description 1
- 101000934372 Homo sapiens Macrosialin Proteins 0.000 description 1
- 208000015178 Hurler syndrome Diseases 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- 102000004157 Hydrolases Human genes 0.000 description 1
- 108090000604 Hydrolases Proteins 0.000 description 1
- 208000013016 Hypoglycemia Diseases 0.000 description 1
- 108010053927 Iduronate Sulfatase Proteins 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 206010023230 Joint stiffness Diseases 0.000 description 1
- 208000028226 Krabbe disease Diseases 0.000 description 1
- 102000004882 Lipase Human genes 0.000 description 1
- 108090001060 Lipase Proteins 0.000 description 1
- 108010064171 Lysosome-Associated Membrane Glycoproteins Proteins 0.000 description 1
- 102000014944 Lysosome-Associated Membrane Glycoproteins Human genes 0.000 description 1
- 102100038225 Lysosome-associated membrane glycoprotein 2 Human genes 0.000 description 1
- 101710116771 Lysosome-associated membrane glycoprotein 2 Proteins 0.000 description 1
- 102100025136 Macrosialin Human genes 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-L Malonate Chemical compound [O-]C(=O)CC([O-])=O OFOBLEOULBTSOW-UHFFFAOYSA-L 0.000 description 1
- 208000007650 Meningeal Carcinomatosis Diseases 0.000 description 1
- 206010051696 Metastases to meninges Diseases 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 208000019430 Motor disease Diseases 0.000 description 1
- 206010072928 Mucolipidosis type II Diseases 0.000 description 1
- 206010056893 Mucopolysaccharidosis VII Diseases 0.000 description 1
- 101001095964 Mus musculus Patatin-like phospholipase domain-containing protein 7 Proteins 0.000 description 1
- 108010027520 N-Acetylgalactosamine-4-Sulfatase Proteins 0.000 description 1
- OVRNDRQMDRJTHS-RTRLPJTCSA-N N-acetyl-D-glucosamine Chemical compound CC(=O)N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-RTRLPJTCSA-N 0.000 description 1
- CRJGESKKUOMBCT-VQTJNVASSA-N N-acetylsphinganine Chemical compound CCCCCCCCCCCCCCC[C@@H](O)[C@H](CO)NC(C)=O CRJGESKKUOMBCT-VQTJNVASSA-N 0.000 description 1
- YLLUGDKHOCGIFR-JPLGWGRCSA-N N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(=O)C1(O)[C@H](N)[C@@H](O)[C@H](O)[C@H](O1)CO)C(=O)O Chemical compound N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(=O)C1(O)[C@H](N)[C@@H](O)[C@H](O)[C@H](O1)CO)C(=O)O YLLUGDKHOCGIFR-JPLGWGRCSA-N 0.000 description 1
- 101000652829 Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) Exo-alpha-sialidase Proteins 0.000 description 1
- 208000008457 Neurologic Manifestations Diseases 0.000 description 1
- 208000002537 Neuronal Ceroid-Lipofuscinoses Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 102000005327 Palmitoyl protein thioesterase Human genes 0.000 description 1
- 108020002591 Palmitoyl protein thioesterase Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 241001482237 Pica Species 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 102100036197 Prosaposin Human genes 0.000 description 1
- 101710152403 Prosaposin Proteins 0.000 description 1
- 208000013608 Salla disease Diseases 0.000 description 1
- 208000021811 Sandhoff disease Diseases 0.000 description 1
- 201000002883 Scheie syndrome Diseases 0.000 description 1
- 241000978776 Senegalia senegal Species 0.000 description 1
- 208000000828 Sialic Acid Storage Disease Diseases 0.000 description 1
- 208000017460 Sialidosis type 2 Diseases 0.000 description 1
- 201000001828 Sly syndrome Diseases 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 108010061312 Sphingomyelin Phosphodiesterase Proteins 0.000 description 1
- 241001222723 Sterna Species 0.000 description 1
- 102000005262 Sulfatase Human genes 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric Acid Chemical class [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- 208000022292 Tay-Sachs disease Diseases 0.000 description 1
- 206010044565 Tremor Diseases 0.000 description 1
- 108010039203 Tripeptidyl-Peptidase 1 Proteins 0.000 description 1
- 102100034197 Tripeptidyl-peptidase 1 Human genes 0.000 description 1
- 108700001567 Type I Schindler Disease Proteins 0.000 description 1
- 102000044159 Ubiquitin Human genes 0.000 description 1
- 108090000848 Ubiquitin Proteins 0.000 description 1
- 208000026589 Wolman disease Diseases 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- LEBBDRXHHNYZIA-LDUWYPJVSA-N [(2s,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl] n-[(z)-1,3-dihydroxyoctadec-4-en-2-yl]carbamate Chemical compound CCCCCCCCCCCCC\C=C/C(O)C(CO)NC(=O)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O LEBBDRXHHNYZIA-LDUWYPJVSA-N 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 102000005421 acetyltransferase Human genes 0.000 description 1
- 108020002494 acetyltransferase Proteins 0.000 description 1
- 102000010126 acid sphingomyelin phosphodiesterase activity proteins Human genes 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 208000012761 aggressive behavior Diseases 0.000 description 1
- 230000016571 aggressive behavior Effects 0.000 description 1
- 150000001294 alanine derivatives Chemical class 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- IAJILQKETJEXLJ-QTBDOELSSA-N aldehydo-D-glucuronic acid Chemical compound O=C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C(O)=O IAJILQKETJEXLJ-QTBDOELSSA-N 0.000 description 1
- 108010030291 alpha-Galactosidase Proteins 0.000 description 1
- 102000005840 alpha-Galactosidase Human genes 0.000 description 1
- 102000012086 alpha-L-Fucosidase Human genes 0.000 description 1
- 108010061314 alpha-L-Fucosidase Proteins 0.000 description 1
- 108010012864 alpha-Mannosidase Proteins 0.000 description 1
- 102000019199 alpha-Mannosidase Human genes 0.000 description 1
- 201000008333 alpha-mannosidosis Diseases 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 210000004727 amygdala Anatomy 0.000 description 1
- 230000037005 anaesthesia Effects 0.000 description 1
- 229940125715 antihistaminic agent Drugs 0.000 description 1
- 239000000739 antihistaminic agent Substances 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 125000000613 asparagine group Chemical class N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 210000001130 astrocyte Anatomy 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 239000012752 auxiliary agent Substances 0.000 description 1
- 210000004227 basal ganglia Anatomy 0.000 description 1
- 231100000871 behavioral problem Toxicity 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 150000003938 benzyl alcohols Chemical class 0.000 description 1
- 108010055059 beta-Mannosidase Proteins 0.000 description 1
- 201000006486 beta-mannosidosis Diseases 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000007321 biological mechanism Effects 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 239000005388 borosilicate glass Substances 0.000 description 1
- 210000004958 brain cell Anatomy 0.000 description 1
- 229920005557 bromobutyl Polymers 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 229960005069 calcium Drugs 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000003560 cancer drug Substances 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 229940106189 ceramide Drugs 0.000 description 1
- ZVEQCJWYRWKARO-UHFFFAOYSA-N ceramide Natural products CCCCCCCCCCCCCCC(O)C(=O)NC(CO)C(O)C=CCCC=C(C)CCCCCCCCC ZVEQCJWYRWKARO-UHFFFAOYSA-N 0.000 description 1
- 210000003591 cerebellar nuclei Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 229940059329 chondroitin sulfate Drugs 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 229960002303 citric acid monohydrate Drugs 0.000 description 1
- 230000019771 cognition Effects 0.000 description 1
- 230000003930 cognitive ability Effects 0.000 description 1
- 230000008133 cognitive development Effects 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 230000001351 cycling effect Effects 0.000 description 1
- 210000000172 cytosol Anatomy 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 210000001947 dentate gyrus Anatomy 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 210000002451 diencephalon Anatomy 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 1
- 238000000113 differential scanning calorimetry Methods 0.000 description 1
- 238000002598 diffusion tensor imaging Methods 0.000 description 1
- 229960000520 diphenhydramine Drugs 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 229910000397 disodium phosphate Inorganic materials 0.000 description 1
- 235000019800 disodium phosphate Nutrition 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 229920001971 elastomer Polymers 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 230000002121 endocytic effect Effects 0.000 description 1
- 230000032050 esterification Effects 0.000 description 1
- 238000005886 esterification reaction Methods 0.000 description 1
- 230000000763 evoking effect Effects 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 229920002313 fluoropolymer Polymers 0.000 description 1
- 239000004811 fluoropolymer Substances 0.000 description 1
- 201000008049 fucosidosis Diseases 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000002873 global sequence alignment Methods 0.000 description 1
- 150000002298 globosides Chemical class 0.000 description 1
- 210000001905 globus pallidus Anatomy 0.000 description 1
- 235000001727 glucose Nutrition 0.000 description 1
- 150000002305 glucosylceramides Chemical class 0.000 description 1
- 229940097043 glucuronic acid Drugs 0.000 description 1
- 229940096919 glycogen Drugs 0.000 description 1
- 208000007345 glycogen storage disease Diseases 0.000 description 1
- 201000008977 glycoproteinosis Diseases 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 108010089932 heparan sulfate sulfatase Proteins 0.000 description 1
- 206010019847 hepatosplenomegaly Diseases 0.000 description 1
- 150000004688 heptahydrates Chemical class 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 150000004679 hydroxides Chemical class 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 230000002218 hypoglycaemic effect Effects 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 229960003444 immunosuppressant agent Drugs 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000010874 in vitro model Methods 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 238000013383 initial experiment Methods 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- 208000017476 juvenile neuronal ceroid lipofuscinosis Diseases 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000003140 lateral ventricle Anatomy 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 208000036546 leukodystrophy Diseases 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004705 lumbosacral region Anatomy 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- ZLNQQNXFFQJAID-UHFFFAOYSA-L magnesium carbonate Chemical compound [Mg+2].[O-]C([O-])=O ZLNQQNXFFQJAID-UHFFFAOYSA-L 0.000 description 1
- 239000001095 magnesium carbonate Substances 0.000 description 1
- 229910000021 magnesium carbonate Inorganic materials 0.000 description 1
- 229960002337 magnesium chloride Drugs 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000009061 membrane transport Effects 0.000 description 1
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 230000003458 metachromatic effect Effects 0.000 description 1
- 210000002891 metencephalon Anatomy 0.000 description 1
- 229960004452 methionine Drugs 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- 210000000274 microglia Anatomy 0.000 description 1
- 235000010755 mineral Nutrition 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 208000020460 mucolipidosis II alpha/beta Diseases 0.000 description 1
- 208000020468 mucolipidosis III alpha/beta Diseases 0.000 description 1
- 201000002273 mucopolysaccharidosis II Diseases 0.000 description 1
- 208000012253 mucopolysaccharidosis IVA Diseases 0.000 description 1
- 208000036710 mucopolysaccharidosis type 3A Diseases 0.000 description 1
- 208000036707 mucopolysaccharidosis type 3C Diseases 0.000 description 1
- 208000027333 mucopolysaccharidosis type IIID Diseases 0.000 description 1
- 208000012091 mucopolysaccharidosis type IVB Diseases 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 230000007106 neurocognition Effects 0.000 description 1
- 230000007472 neurodevelopment Effects 0.000 description 1
- 230000016273 neuron death Effects 0.000 description 1
- 201000007607 neuronal ceroid lipofuscinosis 3 Diseases 0.000 description 1
- VVGIYYKRAMHVLU-UHFFFAOYSA-N newbouldiamide Natural products CCCCCCCCCCCCCCCCCCCC(O)C(O)C(O)C(CO)NC(=O)CCCCCCCCCCCCCCCCC VVGIYYKRAMHVLU-UHFFFAOYSA-N 0.000 description 1
- 231100001079 no serious adverse effect Toxicity 0.000 description 1
- 238000010606 normalization Methods 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 210000000956 olfactory bulb Anatomy 0.000 description 1
- 210000004248 oligodendroglia Anatomy 0.000 description 1
- 210000001328 optic nerve Anatomy 0.000 description 1
- 210000005112 optic tract Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000002304 perfume Substances 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 210000003446 pia mater Anatomy 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 230000002028 premature Effects 0.000 description 1
- 238000002203 pretreatment Methods 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000004952 protein activity Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000009325 pulmonary function Effects 0.000 description 1
- HNJBEVLQSNELDL-UHFFFAOYSA-N pyrrolidin-2-one Chemical compound O=C1CCCN1 HNJBEVLQSNELDL-UHFFFAOYSA-N 0.000 description 1
- 238000001525 receptor binding assay Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 239000012266 salt solution Substances 0.000 description 1
- 210000004761 scalp Anatomy 0.000 description 1
- 208000011985 sialidosis Diseases 0.000 description 1
- RMAQACBXLXPBSY-UHFFFAOYSA-N silicic acid Chemical compound O[Si](O)(O)O RMAQACBXLXPBSY-UHFFFAOYSA-N 0.000 description 1
- 235000012239 silicon dioxide Nutrition 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 229960004249 sodium acetate Drugs 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 229960000999 sodium citrate dihydrate Drugs 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 230000000392 somatic effect Effects 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 239000008227 sterile water for injection Substances 0.000 description 1
- 210000000495 subthalamus Anatomy 0.000 description 1
- 239000012906 subvisible particle Substances 0.000 description 1
- 150000005846 sugar alcohols Chemical class 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 108060007951 sulfatase Proteins 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 230000009747 swallowing Effects 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 231100000057 systemic toxicity Toxicity 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 238000010809 targeting technique Methods 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 231100000155 toxicity by organ Toxicity 0.000 description 1
- 230000007675 toxicity by organ Effects 0.000 description 1
- 231100000041 toxicology testing Toxicity 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 210000004785 virchow-robin space Anatomy 0.000 description 1
- 239000012905 visible particle Substances 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/47—Hydrolases (3) acting on glycosyl compounds (3.2), e.g. cellulases, lactases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/02—Inorganic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/65—Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0085—Brain, e.g. brain implants; Spinal cord
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/08—Solutions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
- A61K9/19—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles lyophilised, i.e. freeze-dried, solutions or dispersions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/65—Insulin-like growth factors, i.e. somatomedins, e.g. IGF-1, IGF-2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/0105—Alpha-N-acetylglucosaminidase (3.2.1.50)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the present disclosure relates, in general, to therapeutic lysosomal enzyme fusion proteins useful for treating lysosomal storage diseases, formulations comprising such therapeutic lysosomal enzyme fusion proteins and associated methods for treating lysosomal storage diseases in mammals.
- mammalian lysosomal enzymes are synthesized in the cytosol and traverse the ER where they are glycosylated with N-linked, high mannose type carbohydrate.
- the high mannose carbohydrate is modified on lysosomal enzymes by the addition of mannose-6-phosphate (M6P) which targets these proteins to the lysosome.
- M6P-modified enzymes are then delivered to the lysosome via interaction with either/both of two M6P receptors.
- LSDs lysosomal storage diseases
- Enzyme replacement therapy for LSDs is being actively pursued.
- Therapy generally requires that LSD proteins be taken up and delivered to the lysosomes of a variety of cell types in an M6P-dependent fashion.
- One possible approach involves purifying an LSD protein and modifying it to incorporate a carbohydrate moiety with M6P. This modified material may be taken up by the cells more efficiently than unmodified LSD proteins due to interaction with M6P receptors on the cell surface.
- Glycosylation Independent Lysosomal Targeting GILT
- M6P Glycosylation Independent Lysosomal Targeting
- the present disclosure provides further improved compositions, formulations and methods for efficient lysosomal targeting of therapeutic fusion proteins based on the GILT technology.
- the present disclosure provides methods and compositions for targeting therapeutic lysosomal enzymes to lysosomes using lysosomal targeting peptides for the treatment of lysosomal storage disorders.
- the present disclosure also provides methods and compositions for targeting lysosomal enzymes to lysosomes using a lysosomal targeting peptide that has reduced or diminished binding affinity for the IGF-I receptor and/or reduced or diminished binding affinity for the insulin receptor, and/or is resistant to furin cleavage.
- the present disclosure also provides targeted lysosomal enzyme fusion proteins comprising a lysosomal enzyme and IGF-II and spacer peptides that provide for improved production and uptake into lysosomes of the lysosomal enzyme fusion protein.
- Exemplary lysosomal enzymes useful for incorporation into the therapeutic fusion proteins of the present disclosure and the associated diseases to be treated with those fusion proteins are set out in Table 1 below.
- the lysosomal enzyme is a mature human alpha-N-acetylglucosaminidase (Naglu) enzyme and the lysosomal storage disorder is Mucopolysaccharidosis Type IIIB (MPS IIIB; Sanfilippo B Syndrome).
- the therapeutic fusion protein of the present disclosure comprises a functional ⁇ -N-acetylglucosaminidase enzyme that exhibits detectable enzyme activity and has an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of the mature human Naglu protein shown in FIG. 1 (SEQ ID NO:1).
- the disclosure is directed to a fragment of the mature human Naglu protein shown in FIG. 1 (SEQ ID NO:1) that retains detectable Naglu enzyme activity.
- the therapeutic fusion protein of the present disclosure comprises a peptide tag having an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of amino acids 8-67 of mature human IGF-II.
- amino acids 8-67 of mature human IGF-II has the following amino acid sequence: LCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE (SEQ ID NO:2).
- the targeted therapeutic fusion protein of the present disclosure comprises a peptide tag having an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of amino acids 8-67 of mature human IGF-II having an alanine for arginine substitution at amino acid position 37.
- the peptide tag has the following amino acid sequence: LCGGELVDTLQFVCGDRGFYFSRPASRVSARSRGIVEECCFRSCDLALLETYCATPAKSE (SEQ ID NO:3).
- the substitution of alanine for arginine at amino acid position 37 has previously been reported to abolish at least one furin protease cleavage site (see, e.g., U.S. Pat. No. 8,563,691).
- the therapeutic fusion protein of the present disclosure comprises a spacer peptide located between and linking the lysosomal enzyme and the peptide tag.
- the spacer/linker peptide has an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of a 31 amino acid rigid linker peptide having the following amino acid sequence: GAPGGGSPAPAPTPAPAPTPAPAGGGPSGAP (SEQ ID NO:4).
- the spacer peptide is from about 25-37, 26-36, 27-35, 28-34, 29-33 or 30-32 amino acids in length and represents a variant of SEQ ID NO:4 wherein 1, 2, 3, 4, 5 or 6 specific amino acids of SEQ ID NO:4 are substituted, added or deleted.
- the therapeutic fusion protein of the present disclosure comprises (i) a functional ⁇ -N-acetylglucosaminidase enzyme having an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of the mature human Naglu protein shown in FIG.
- SEQ ID NO:1 (SEQ ID NO:1), (ii) a peptide tag having an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:3, and (iii) a spacer/linker peptide located between the enzyme and the peptide tag having an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of the 31 amino acid rigid linker peptide shown herein as SEQ ID NO:4.
- the therapeutic fusion protein of the present disclosure comprises (i) a functional mature human ⁇ -N-acetylglucosaminidase (Naglu) enzyme having the amino acid sequence shown in FIG. 1 (SEQ ID NO:1), (ii) a spacer/linker peptide having the amino acid sequence shown herein as SEQ ID NO:4, and (iii) an IGF-II peptide tag having the amino acid sequence of SEQ ID NO:3.
- FIG. 2 SEQ ID NO:5
- the disclosure provides pharmaceutical compositions useful for treating a lysosomal storage disorder in a mammal, wherein said compositions comprise a therapeutic fusion protein of the present disclosure.
- the pharmaceutical composition is a formulation that comprises (a) a fusion protein comprising a lysosomal enzyme or functional fragment thereof, a peptide tag having at least 90% sequence identity to SEQ ID NO:2, and a spacer peptide located between said lysosomal enzyme or functional fragment thereof and said peptide tag, said spacer peptide having at least 90% sequence identity to SEQ ID NO:4; and (b) one or more components selected from the group consisting of a buffering agent, an isotonicity agent and an electrolyte agent.
- the formulations of the present disclosure may be liquid formulations, lyophilized formulations or liquid formulations that were reconstituted from previously lyophilized formulations. In various embodiments, the formulations of the present disclosure are stable.
- the formulations or compositions of matter of the present disclosure may comprise a lysosomal enzyme or functional fragment thereof that comprises the amino acid sequence of SEQ ID NO:1.
- the formulations of the present disclosure may comprise a fusion protein that comprises or consists of the amino acid sequence of SEQ ID NO:5.
- the formulations of the present disclosure may comprise a fusion protein comprising the amino acid sequence of SEQ ID NO:5, a buffering agent, an isotonicity agent, an electrolyte agent, and an anti-adsorption agent.
- the formulations of the present disclosure comprise a fusion protein comprising the amino acid sequence of SEQ ID NO:5, sodium phosphate dibasic heptahydrate, sodium phosphate monobasic monohydrate, sodium chloride, and trehalose.
- the formulations of the present disclosure comprise a fusion protein comprising the amino acid sequence of SEQ ID NO:5 at a concentration of from about 25 mg/ml to about 35 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of from about 0.15 mg/ml to about 0.25 mg/ml, sodium phosphate monobasic monohydrate at a concentration of from about 0.03 mg/ml to about 0.05 mg/ml, sodium chloride at a concentration of from about 0.8 mg/ml to about 1 mg/ml, and trehalose is at a concentration of from about 7% to about 9%, said formulation having a pH in the range of about 6.5 to about 7.5.
- a formulation of the present disclosure comprises a fusion protein comprising the amino acid sequence of SEQ ID NO:5 at a concentration of about 30 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of about 0.19 mg/ml, sodium phosphate monobasic monohydrate at a concentration of about 0.04 mg/ml, sodium chloride at a concentration of about 0.88 mg/ml, and the trehalose concentration at about 8%, said formulation having a pH of about 7.0.
- These formulations may be in either aqueous or dry/lyophilized form.
- the formulations of the present disclosure comprise a fusion protein comprising the amino acid sequence of SEQ ID NO:5, sodium phosphate dibasic heptahydrate, sodium phosphate monobasic monohydrate, sodium chloride, trehalose, and polysorbate 20.
- the formulations of the present disclosure comprise a fusion protein comprising the amino acid sequence of SEQ ID NO:5 at a concentration of from about 25 mg/ml to about 35 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of from about 0.15 mg/ml to about 0.25 mg/ml, sodium phosphate monobasic monohydrate at a concentration of from about 0.03 mg/ml to about 0.05 mg/ml, sodium chloride at a concentration of from about 4.5 mg/ml to about 5.5 mg/ml, trehalose is at a concentration of from about 3% to about 5%, and the polysorbate 20 is at a concentration from about 0.0025% to about 0.0075%, said formulation having a pH in the range of about 6.5 to about 7.5.
- a formulation of the present disclosure comprises a fusion protein comprising the amino acid sequence of SEQ ID NO:5 at a concentration of about 30 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of about 0.19 mg/ml, sodium phosphate monobasic monohydrate at a concentration of about 0.04 mg/ml, sodium chloride at a concentration of about 5 mg/ml, the trehalose concentration at about 4%, and the polysorbate 20 concentration at about 0.005% said formulation having a pH of about 7.0.
- These formulations may be in either aqueous or dry/lyophilized form.
- the formulations of the disclosure comprise sodium phosphate dibasic heptahydrate, sodium phosphate monobasic monohydrate, sodium chloride, potassium chloride, magnesium chloride hexahydrate and calcium chloride dehydrate, and wherein the fusion protein comprises the amino acid sequence of SEQ ID NO:5.
- the formulations of the present disclosure comprise a fusion protein comprising the amino acid sequence of SEQ ID NO:5 at a concentration of from about 25 mg/ml to about 35 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of from about 0.15 mg/ml to about 0.25 mg/ml, sodium phosphate monobasic monohydrate at a concentration of from about 0.03 mg/ml to about 0.05 mg/ml, sodium chloride at a concentration of from about 8 mg/ml to about 9 mg/ml, potassium chloride at a concentration of from about 0.15 mg/ml to about 0.3 mg/ml, magnesium chloride hexahydrate at a concentration of from about 0.1 mg/ml to about 0.2 mg/ml and calcium chloride dihydrate at a concentration of from about 0.15 mg/ml to about 0.3 mg/ml, said formulation having a pH in the range of about 6.5 to about 7.5.
- a formulation of the present disclosure comprises a fusion protein comprising the amino acid sequence of SEQ ID NO:5 at a concentration of about 30 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of about 0.19 mg/ml, sodium phosphate monobasic monohydrate at a concentration of about 0.04 mg/ml, sodium chloride at a concentration of about 8.66 mg/ml, potassium chloride at a concentration of about 0.22 mg/ml, magnesium chloride hexahydrate at a concentration of about 0.16 mg/ml and calcium chloride dihydrate at a concentration of about 0.21 mg/ml, said formulation having a pH of about 7.0.
- These formulations may be in either aqueous or dry/lyophilized form.
- the present disclosure is directed to methods for treating lysosomal storage diseases in subjects suffering therefrom, wherein those methods comprise the step of administering a composition of matter or formulation described herein.
- the present disclosure is directed to a method of treating MPS IIIB disease in a subject suffering therefrom, wherein the method comprises the step of administering a therapeutic fusion protein having Naglu enzyme activity, or a formulation comprising the same, as described herein.
- the formulation is administered intrathecally, intracerebroventricularly or directly to the CSF via lumbar puncture, which may be either non-volumetric or isovolumetric.
- Administration of a therapeutic formulation of the present disclosure may occur over a period of from about 5 minutes to about 240 minutes or more, or from about 5 minutes to about 10 minutes.
- administration of a formulation for the treatment of MPS IIIB may occur weekly for a period of at least 24 weeks, preferably at least 48 weeks.
- administration of a therapeutically effective amount of a therapeutic fusion protein or formulation of the present disclosure results in reduced severity, intensity or frequency, or delayed onset of at least one symptom or feature of MPS IIIB disease.
- the present disclosure is directed to a method for slowing the rate of decline, or preventing decline, of at least one symptom of MPS IIIB disease in a subject suffering therefrom, wherein the method comprises the step of administering to the subject a therapeutic fusion protein having Naglu activity or a formulation comprising the same.
- the formulation is administered intracerebroventricularly, wherein the intracerebroventricular administration is isovolumetric.
- Administration of a therapeutic formulation of the present disclosure may occur over a period of from about 5 minutes to about 240 minutes or more, or from about 5 minutes to about 10 minutes.
- administration of a formulation for the treatment of MPS IIIB may occur weekly for a period of at least 24 weeks, preferably at least 48 weeks.
- the at least one symptom of MPS IIIB disease can be selected from the group consisting of cognitive decline, decline in language function, decline in motor function, decline in social-emotional function, decline in adaptive function, decline in conceptual thinking, decline in facial recognition, decline in story completion capability, decline in hand function/dexterity, hearing loss, hyperactivity, aggressiveness, or sleep disturbances.
- the reduction in the rate of decline, or prevention of decline, of said at least one symptom may be determined by: (a) determining the rate of decline of said symptom prior to said administration, and (b) determining the rate of decline of said symptom subsequent to said administration; wherein a lower rate of decline of said symptom subsequent to said administration as compared to prior to said administration is indicative of a reduction in said rate of decline.
- These methods may further comprise the steps of determining a development quotient (DQ) for said subject prior to said administration and determining a DQ for said subject subsequent to said administration, wherein a higher DQ for said subject subsequent to said administration as compared to prior to said administration is indicative of a reduction in said rate of decline.
- DQ development quotient
- the present disclosure is directed to methods for stabilizing or reducing the decline of a DQ quotient in a subject suffering from MPS IIIB disease, wherein the methods comprise administering to the subject a therapeutic fusion protein or formulation comprising the same.
- Development quotients may be determined using the BSID-III or KABC-II tool as described herein and known in the art.
- the present disclosure is directed to slowing the rate of decline of a cognitive function in a subject suffering from MPS IIIB disease, wherein the method comprises the step of administering to said subject a therapeutically effective amount of a therapeutic fusion protein of the present disclosure, or a formulation thereof, as described herein.
- the fusion protein or formulation thereof may be administered IT, ICV or via lumbar puncture, wherein the administration may be isovolumetric.
- Administration of a therapeutic formulation of the present disclosure may occur over a period of from about 5 minutes to about 240 minutes or more, or from about 5 minutes to about 10 minutes.
- administration of a formulation for the treatment of MPS IIIB may occur weekly for a period of at least 24 weeks, or for at least 48 weeks.
- the present disclosure is directed to methods for reducing or preventing GAG storage in one or more tissues of the CNS of a subject suffering from a lysosomal storage disorder, wherein the methods comprise administering a therapeutically effective amount of a therapeutic fusion protein or formulation described herein.
- the GAG is heparan sulfate and the lysosomal storage disorder is MPS IIIB.
- the administration may be intracerebroventricular, which may be isovolumetric.
- GAG storage is reduced in the lysosomes of cells of one or more tissues of the CNS including, for example, gray matter, white matter, periventricular areas, meninges, pia-arachnoid, deep tissues in the cerebral cortex, neocortex, cerebellum, caudate/putamen region, molecular layer, deep regions of the pons or medulla, midbrain, or combinations of two or more of the above.
- the therapeutic fusion protein is delivered to neurons, glial cells, perivascular cells, meningeal cells, and/or neurons of the spinal cord.
- administration of the therapeutic fusion protein or formulation comprising the same results in reduction of GAG storage in one or more of the brain target tissues or spinal cord neurons by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 1-fold, 1.5-fold or 2-fold or more as compared to an appropriate control (e.g., the pre-treatment GAG storage in the subject).
- FIG. 1 depicts the amino acid sequence (SEQ ID NO:1) of the mature human Naglu protein.
- FIG. 2 depicts the amino acid sequence (SEQ ID NO:5) of the BMN001 therapeutic fusion protein.
- FIG. 3 is a set of graphs showing Heparan Sulfate (HS) levels in central nervous system tissue (CNS) (upper graph) and cerebrospinal fluid (CSF) (lower graph) in control heterozygous Naglu dogs and homozygous Naglu null affected MPS IIIB dogs treated with vehicle, 12 mg BMN001, or 48 mg BMN001.
- CNS central nervous system tissue
- CSF cerebrospinal fluid
- FIG. 5 is a western blot of canine cerebellum from wild-type dogs, untreated MPS IIIB dogs, and BMN001 treated MPS IIIB dogs probed with an antibody specific for canine LAMP2 protein, showing that LAMP2 levels are elevated in untreated MPS IIIB dogs relative to wild-type and that treatment with BMN001 reduces LAMP2 to wild-type levels in treated MPS IIIB dogs.
- FIG. 6 is a graph showing Heparan Sulfate (HS) levels in cerebellum in control heterozygous Naglu dogs and homozygous Naglu null affected MPS IIIB dogs treated with vehicle, 12 mg BMN001, or 48 mg BMN001.
- HS Heparan Sulfate
- FIG. 7 is a graph showing cerebellar mean diffusivity in control heterozygous Naglu dogs and homozygous Naglu null affected MPS MB dogs treated with vehicle, 12 mg BMN001, or 48 mg BMN001.
- FIG. 8 is a set of MRI images of the cerebellum of wild type vehicle treated dogs and MPS IIIB dogs treated with vehicle or BMN001.
- FIG. 9 is a bar graph showing that untreated MPS IIIB patients have elevated Heparan Sulfate (HS) and MPS IIIB-specific HS non-reducing end (NRE) in the cerebrospinal fluid (CSF).
- the dashed vertical lines show the average normal CSF levels of HS and NRE (0.05 mg/L and 0.0025 mg/L respectively). This data was collected over a period of at least 24 weeks to understand the natural history of the disease. Where available data from early and late time-points in the natural history are shown.
- FIG. 10 is a set of graphs showing the reduction of HS and NRE in the CSF of two subjects treated with BMN001.
- FIGS. 11A and 11B are graphs showing the effects of trehalose and trehalose—polysorbate 20 combination on aggregate particle formation following pumping stress of BMN001 containing formulations.
- FIG. 12 is a graph showing the effects of trehalose and trehalose—polysorbate 20 combination on aggregate particle formation following freeze thaw stress of BMN001 containing formulations.
- Artificial cerebrospinal fluid (aCSF) is BMN001 formulated without trehalose or polysorbate 20.
- lysosomal storage diseases refer to a group of genetic disorders that result from deficiency in at least one of the enzymes (e.g., acid hydrolases) that are required to break macromolecules down to peptides, amino acids, monosaccharides, nucleic acids and fatty acids in lysosomes. As a result, individuals suffering from a lysosomal storage disease have accumulated materials in lysosomes. Exemplary lysosomal storage diseases are listed in Table 1.
- lysosomal enzyme refers to any enzyme that is capable of reducing accumulated materials in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms.
- Lysosomal enzymes suitable for the disclosure include both wild-type or modified lysosomal enzymes and can be produced using recombinant and synthetic methods or purified from nature sources. Exemplary lysosomal enzymes are listed in Table 1, wherein such lysosomal enzymes may be incorporated into the therapeutic fusion proteins described herein.
- human alpha-N-acetylglucosaminidase refers to precursor (i.e., containing the native signal peptide sequence) or processed (i.e., lacking the native signal peptide sequence) wild-type form of human alpha-N-acetylglucosaminidase, or a functional fragment or variant thereof, that is capable of reducing glycosaminoglycan (GAG) levels in mammalian lysosomes or that can rescue or ameliorate one or more MPS IIIB (Sanfilippo B Syndrome) symptoms.
- a human Naglu enzyme that finds use herein comprises or consists of the amino acid sequence shown in FIG. 1 (SEQ ID NO:1).
- the term “functional” as it relates to a lysosomal enzyme, a fusion protein comprising a lysosomal enzyme or fragment of either refers to a polypeptide having the capability of being taken up by mammalian lysosomes and having sufficient enzymatic activity to reduce storage material, i.e., glycosaminoglycan (GAG), in the mammalian lysosome.
- GAG glycosaminoglycan
- spacer refers to a peptide sequence located between two protein moieties in a fusion protein.
- a spacer is generally designed to be flexible or to interpose a structure, such as an alpha-helix, between the two protein moieties.
- a spacer can be of variable length, such as, for example, 10-50, 20-40, or 25-35 amino acids in length. Exemplary spacer sequences are disclosed in greater detail in this specification.
- control individual is an individual afflicted with the same form of lysosomal storage disease (e.g., MPS IIIB (Sanfilippo B Syndrome)) as the individual being treated, who is about the same age as the individual being treated (to ensure that the stages of the disease in the treated individual and the control individual(s) are comparable).
- MPS IIIB Sanfilippo B Syndrome
- the terms “ameliorate”, “amelioration”, and grammatical equivalents thereof are meant the prevention, reduction or palliation of a state or disease symptom, the stabilization from decline of a state or disease symptom, or the improvement of a state or disease symptom of/in a subject.
- Amelioration includes, but does not require complete recovery or complete prevention of a disease condition.
- amelioration includes reduction of accumulated materials inside lysosomes of relevant lysosomal storage disease tissues.
- the terms “subject,” “individual” or “patient” refer to a human or a non-human mammalian subject.
- the individual (also referred to as “patient” or “subject”) being treated is an individual (fetus, infant, child, adolescent, or adult human) suffering from a lysosomal storage disease, e.g., MPS IIIB (Sanfilippo B Syndrome) (i.e., either infantile-, juvenile-, or adult-onset or severe/classical type or attenuated type MPS IIIB (Sanfilippo B Syndrome)) or having the potential to develop a lysosomal storage disease (e.g., MPS IIIB (Sanfilippo B Syndrome)).
- MPS IIIB Sanfilippo B Syndrome
- the term “therapeutically effective amount” or “effective amount” refers to an amount of a targeted therapeutic fusion protein (or formulation comprising it) which confers a therapeutic effect on the treated subject, at a reasonable benefit/risk ratio applicable to any medical treatment.
- the therapeutic effect may be objective (i.e., measurable by some test or marker) or subjective (i.e., subject gives an indication of or feels an effect).
- the “therapeutically effective amount” refers to an amount of a therapeutic fusion protein or associated pharmaceutical composition effective to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease.
- a therapeutically effective amount is commonly administered in a dosing regimen that may comprise multiple unit doses.
- a therapeutically effective amount (and/or an appropriate unit dose within an effective dosing regimen) may vary, for example, depending on route of administration, on combination with other pharmaceutical agents.
- the specific therapeutically effective amount (and/or unit dose) for any particular patient may depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific pharmaceutical agent employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and/or rate of excretion or metabolism of the specific fusion protein employed; the duration of the treatment; and like factors as is well known in the medical arts.
- treatment refers to any administration of a therapeutic fusion protein or pharmaceutical composition comprising said therapeutic fusion protein that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of a particular disease, disorder, and/or condition.
- Such treatment may be of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition.
- treatment may be of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition.
- treatment can refer to improvement of cardiac status (e.g., increase of end-diastolic and/or end-systolic volumes, or reduction, amelioration or prevention of the progressive cardiomyopathy that is typically found in, e.g., Pompe disease) or of pulmonary function (e.g., increase in crying vital capacity over baseline capacity, and/or normalization of oxygen desaturation during crying); improvement in neurodevelopment and/or motor skills (e.g., increase in AIMS score); reduction of storage (e.g., glycosaminoglycan (GAG)) levels in tissue of the individual affected by the disease; or any combination of these effects.
- GAG glycosaminoglycan
- treatment includes improvement of GAG clearance, particularly in reduction or prevention of MPS IIIB (Sanfilippo B Syndrome)-associated neuronal symptoms.
- a “stable” or “stabilized” protein-containing formulation is one in which the protein component therein essentially retains its physical, functional and/or chemical stability upon storage over time. Stability can be measured at a selected temperature for a selected time period. Preferably, the formulation is stable at room temperature (about 30° C.) or at 40° C. for at least 1, 3, 6 or 12 months or more, stable at about 2-8° C. for at least 1, 3, 6, 12, 18, 24, 30, 36, 42 or 48 months or more, or stable at either ⁇ 30° C., ⁇ 40° C. or ⁇ 60° C. for at least 1, 3, 6, 12, 18, 24, 30, 36, 42 or 48 months or more. In one aspect, the extent of protein degradation or aggregation during storage can be used as an indicator of protein stability.
- a “stable” formulation may be one wherein less than about 20%, more preferably less than about 10%, and most preferably less than about 5%, 4%, 3%, 2% or 1% of the protein component is present in a non-degraded or non-aggregated form in the formulation. “Stable” formulations retain essentially the same functional or therapeutic characteristics, or same physical and/or chemical integrity of the newly prepared formulation.
- Various analytical techniques for measuring protein stability are available in the art and are reviewed, for example, in Peptide and Protein Drug Delivery, 247-301, Vincent Lee Ed., Marcel Dekker, Inc., New York, N.Y., Pubs. (1991) and Jones, A. Adv. Drug Delivery Rev. 10: 29-90 (1993).
- volumetric in relation to intrathecal administration of a pharmaceutical composition to the CSF of a subject is meant that prior to administration of a specified volume of the pharmaceutical composition, approximately the same volume of CSF is removed from the subject, thereby maintaining approximately the same volume of fluid in the CSF compartment of the subject being treated.
- the present disclosure provides compositions, formulations and methods for efficient lysosomal targeting of therapeutic fusion proteins based on the GILT technology.
- the present disclosure provides methods and compositions for targeting therapeutic lysosomal enzymes to lysosomes using lysosomal targeting peptides for the treatment of lysosomal storage disorders.
- the present disclosure also provides methods and compositions for targeting lysosomal enzymes to lysosomes using a lysosomal targeting peptide that has reduced or diminished binding affinity for the IGF-I receptor and/or reduced or diminished binding affinity for the insulin receptor, and/or is resistant to furin cleavage.
- the present disclosure also provides targeted lysosomal enzyme fusion proteins comprising a lysosomal enzyme and IGF-II and spacer peptides that provide for improved production and uptake into lysosomes of the lysosomal enzyme fusion protein.
- the present disclosure also provides formulations that comprise a targeted lysosomal enzyme fusion protein and use thereof for the treatment or prevention of a lysosomal storage disease.
- a lysosomal enzyme suitable for incorporation into the therapeutic fusion proteins or formulations of the disclosure includes any enzyme that is capable of reducing accumulated materials in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms.
- Suitable lysosomal enzymes include both wild-type or modified lysosomal enzymes (and functional fragments thereof) and can be produced using recombinant or synthetic methods or purified from natural sources. Exemplary lysosomal enzymes are listed in Table 1.
- Glycolipidosis Disorders GM1 Gangliodsidosis ⁇ -Galactosidase GM1 gangliosides Tay-Sachs Disease ⁇ -Hexosaminidase A GM2 ganglioside GM2 Gangliosidosis: AB GM2 Activator Protein GM2 ganglioside Variant Sandhoff Disease ⁇ -Hexosaminidase A&B GM2 ganglioside Fabry Disease ⁇ -Galactosidase A Globosides Gaucher Disease Glucocerebrosidase Glucosylceramide Metachromatic Arylsulfatase A Sulphatides Leukodystrophy Krabbe Disease Galactosylceramidase Galactocerebroside Niemann-Pick, Types A & B Acid Sphingomyelinase Sphingomyelin (SM) Niemann-Pick, Type C Cholesterol Esterification SM Defect Niemann
- Oligosaccharide/Glycoprotein Disorders ⁇ -Mannosidosis ⁇ -Mannosidase Mannose/Oligosaccharides ⁇ -Mannosidosis ⁇ -Mannosidase Mannose/Oligosaccharides Fucosidosis ⁇ -L-Fucosidase Fucosyl Oligosaccharides Aspartylglucosaminuria N-Aspartyl- ⁇ - Aspartylglucosamine Glucosaminidase Asparagines Sialidosis (Mucolipidosis I) ⁇ -Neuraminidase Sialyloligosaccharides Galactosialidosis (Goldberg Lysosomal Protective Protein Sialyloligosaccharides Syndrome) Deficiency Schindler Disease ⁇ -N-Acetyl- Various Galactosaminidase E.
- Lysosomal Enzyme Transport Disorders Mucolipidosis II I-Cell N-Acetylglucosamine-1- HS Disease
- Phosphotransferase Mucolipidosis III Phosphotransferase Mucolipidosis III (Pseudo- Same as ML II HS Hurler Polydystrophv)
- G Lysosomal Membrane Transport Disorders Cystinosis Cystine Transport Protein Free cystine Salla Disease Sialic Acid Transport Protein Free sialic acid and glucuronic acid
- a lysosomal enzyme contemplated herein has an amino acid sequence having from about 90% to about 100%, including 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and 100%, sequence identity to the naturally-occurring amino acid sequence of a human enzyme shown in Table 1, or the mature form thereof, while still encoding a protein that is functional, i.e., capable of reducing accumulated materials, e.g., GAG, in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms. Sequences of the above enzymes are known to those of skill in the art and are available through public databases, such as the National Center for Biotechnology Information maintained by the U.S. National Library of Medicine.
- Percent (%) amino acid sequence identity with respect to subject and reference amino acid sequences is defined as the percentage of amino acid residues in a subject sequence that are identical with the amino acid residues in the associated reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- the WU-BLAST-2 software is used to determine amino acid sequence identity (Altschul et al., Methods in Enzymology 266, 460-480 (1996).
- WU-BLAST-2 uses several search parameters, most of which are set to the default values.
- HSP score (S) and HSP S2 parameters are dynamic values and are established by the program itself, depending upon the composition of the particular sequence, however, the minimum values may be adjusted and are set as indicated above.
- % sequence identity between two nucleic acid or amino acid sequences can be determined using the Needle (EMBOSS) or Stretcher (EMBOSS) global sequence alignment tools available at http://www.ebi.ac.uk/Tools/psa/ using the default parameters incorporated therein (incorporated in their entirety by reference herein).
- EMBOSS Needle
- EMBOSS Stretcher
- Alpha-N-acetylglucosaminidase, Naglu is produced as a precursor molecule that is processed to a mature form. This process generally occurs by removing the 23 amino acid signal peptide as the protein enters the endoplasmic reticulum. Typically, the precursor form is also referred to as full-length precursor or full-length Naglu protein, which contains 743 amino acids. The N-terminal 23 amino acids are cleaved as the precursor protein enters the endoplasmic reticulum, resulting in a processed or mature form. Thus, it is contemplated that the N-terminal 23 amino acids of the native full-length human Naglu protein are generally not required for the Naglu protein activity.
- the amino acid sequence of the mature form of the human Naglu protein is shown in FIG. 1 and set out in SEQ ID NO:1.
- the mRNA sequence of human Naglu is described in Genbank Accession number NM_000263.
- the Naglu is human Naglu, with (amino acids 1-743) or without (amino acids 24-743) the associated signal sequence.
- the Naglu lysosomal enzyme incorporated in a therapeutic fusion protein has the amino acid sequence shown in FIG. 1 (SEQ ID NO:1).
- the Naglu-containing fusion protein has the amino acid sequence shown in FIG. 2 (SEQ ID NO:5).
- the fusion protein contains a functional fragment of the mature human Naglu protein, wherein the fragment is generally at least 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650 or 700 or more amino acids in length.
- MPS IIIB Mucopolysaccharidosis III B
- Sanfilippo B Syndrome is a rare autosomal recessive genetic disorder that is characterized by a deficiency of the enzyme alpha-N-acetyl-glucosaminidase (Naglu).
- GAG glycosaminoglycans
- GAG heparan sulfate glycosaminoglycans
- partially degraded GAG molecules cannot be cleared from the body and accumulate in lysosomes of various tissues, resulting in progressive widespread somatic dysfunction (Kakkis et al., N Engl J Med. 344(3):182-8 (2001)). It has been shown that GAGs accumulate in lysosomes of neurons and glial cells, with lesser accumulation outside the brain.
- MPS IIIA represents a deficiency in one of four enzymes involved in the degradation of the GAG heparan sulfate. All forms include varying degrees of the same clinical symptoms, including coarse facial features, hepatosplenomegaly, corneal clouding and skeletal deformities. Most notably, however, is the severe and progressive loss of cognitive ability, which is tied not only to the accumulation of heparan sulfate in neurons, but also the subsequent elevation of the gangliosides GM2, GM3 and GD2 caused by primary GAG accumulation (Walkley et al., Ann N Y Acad Sci. 845:188-99 (1998)).
- a characteristic clinical feature of Sanfilippo B Syndrome is central nervous system (CNS) degeneration, which results in loss of, or failure to attain, major developmental milestones.
- CNS central nervous system
- the progressive cognitive decline culminates in dementia and premature mortality.
- the disease typically manifests itself in young children, and the lifespan of an affected individual generally does not extend beyond late teens to early twenties.
- MPS III diseases all have similar symptoms that typically manifest in young children. Affected infants are apparently normal, although some mild facial dysmorphism may be noticeable. The stiff joints, hirsuteness and coarse hair typical of other mucopolysaccharidoses are usually not present until late in the disease. After an initial symptom-free interval, patients usually present with a slowing of development and/or behavioral problems, followed by progressive intellectual decline resulting in severe dementia and progressive motor disease. Acquisition of speech is often slow and incomplete. The disease progresses to increasing behavioral disturbance including temper tantrums, hyperactivity, destructiveness, aggressive behavior, pica and sleep disturbance. As affected children have normal muscle strength and mobility, the behavioral disturbances are very difficult to manage. In the final phase of the illness, children become increasingly immobile and unresponsive, often require wheelchairs, and develop swallowing difficulties and seizures. The life-span of an affected child does not usually extend beyond late teens to early twenties.
- An alpha-N-acetylglucosaminidase enzyme suitable for treating MPS IIIB includes a wild-type human alpha-N-acetylglucosaminidase, a functional fragment or sequence variant thereof which retains the ability to be taken up into mammalian lysosomes and to hydrolyze alpha, 1,4 linkages at the terminal N-acetyl-D-glucosamine residue in linear oligosaccharides or a targeted therapeutic fusion protein that comprises the wild-type human Naglu enzyme or functional fragment thereof.
- proteins comprising or consisting of the amino acid sequences of SEQ ID NO:1 or SEQ ID NO:5 will find use for the treatment of MPS IIIB.
- Efficacy of treatment of MPS IIIB using targeted therapeutic fusion proteins as described herein can be measured using techniques known in the art, as well as by analysis of lysosomal and neuronal biomarkers.
- Initial experiments are conducted on Naglu knock-out animals (see Li et al., Proc Nall Acad Sci USA 96:14505-510 (1999)).
- Naglu knockouts present with large amounts of heparan sulfate in the liver and kidney and elevation of gangliosides in the brain.
- Assays include analysis of the activity of and biodistribution of the exogenous enzyme, reduction of GAG storage in the lysosomes, particularly in brain cells, and activation of astrocytes and microglia.
- Levels of various lysosomal or neuronal biomarkers include, but are not limited to, Lysosomal-associated membrane protein 1 (LAMP1), glypican, gangliosides, cholesterol, Subunit c of Mitochondrial ATP Synthase (SCMAS), ubiquitin, P-GSK3b, beta amyloid and P-tau. Survival and behavioral analysis is also performed using techniques known in the field.
- treatment of a lysosomal storage disease refers to decreased lysosomal storage (e.g., of GAG) in various tissues.
- treatment refers to decreased lysosomal storage in brain target tissues, spinal cord neurons, and/or peripheral target tissues.
- lysosomal storage is decreased by about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100% or more as compared to an untreated control subject.
- lysosomal storage is decreased by at least 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold or more as compared to a control subject.
- treatment refers to increased enzyme activity in various tissues.
- treatment refers to increased enzyme activity in brain target tissues, spinal cord neurons and/or peripheral target tissues.
- enzyme activity is increased by about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 200%, 300%, 400%, 500%, 600%, 700%, 800%, 900%, 1000% or more as compared to a control.
- enzyme activity is increased by at least 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold or more as compared to a control.
- increased enzymatic activity is at least approximately 10 nmol/hr/mg, 20 nmol/hr/mg, 40 nmol/hr/mg, 50 nmol/hr/mg, 60 nmol/hr/mg, 70 nmol/hr/mg, 80 nmol/hr/mg, 90 nmol/hr/mg, 100 nmol/hr/mg, 150 nmol/hr/mg, 200 nmol/hr/mg, 250 nmol/hr/mg, 300 nmol/hr/mg, 350 nmol/hr/mg, 400 nmol/hr/mg, 450 nmol/hr/mg, 500 nmol/hr/m
- Enzyme replacement therapy is a therapeutic strategy to correct an enzyme deficiency by infusing the missing enzyme into the bloodstream or other body tissue of the patient.
- enzyme is taken up by cells and transported to the lysosome, where the enzyme acts to eliminate material that has accumulated in the lysosomes due to the enzyme deficiency.
- the therapeutic enzyme must be delivered to lysosomes in the appropriate cells in tissues where the storage defect is manifest.
- Conventional lysosomal enzyme replacement therapeutics are delivered using carbohydrates naturally attached to the protein to engage specific receptors on the surface of the target cells.
- One receptor, the cation-independent M6P receptor (CI-MPR) is particularly useful for targeting replacement lysosomal enzymes because the CI-MPR is present on the surface of most cell types.
- CGF-MPR ation-independent mannose-6-phosphate receptor
- M6P/IGF-II receptor CI-MPR/IGF-II receptor
- IGF-II receptor IGF-II receptor
- IGF2 Receptor IGF2 Receptor
- Glycosylation Independent Lysosomal Targeting technology was developed to target therapeutic enzymes to lysosomes.
- the GILT technology uses a peptide tag instead of M6P to engage the CI-MPR for lysosomal targeting.
- a GILT tag is a protein, peptide, or other moiety that binds the CI-MPR in a mannose-6-phosphate-independent manner.
- this technology mimics the normal biological mechanism for uptake of lysosomal enzymes, yet does so in a manner independent of mannose-6-phosphate.
- a preferred GILT tag is derived from human insulin-like growth factor II (IGF-II).
- Human IGF-II is a high affinity ligand for the CI-MPR, which is also referred to as IGF-II receptor. Binding of GILT-tagged therapeutic enzymes to the M6P/IGF-II receptor targets the protein to the lysosome via the endocytic pathway. This method has numerous advantages over methods involving glycosylation including simplicity and cost effectiveness, because once the protein is isolated, no further modifications need be made.
- GILT technology and GILT tags can be found in U.S. Application Publication Nos. 2003-0082176, 2004-0006008, 2003-0072761, 2005-0281805, 2005-0244400, U.S. Pat. Nos. 8,492,337 and 8,563,691, and International Publications WO 03/032913, WO 03/032727, WO 02/087510, WO 03/102583, WO 2005/078077, WO 2009/137721 and WO 2014/085621, the disclosures of all of which are hereby incorporated by reference.
- the GILT tag is a furin-resistant GILT tag having the amino acid sequence shown herein as SEQ ID NO:3 (see, e.g., U.S. Pat. No. 8,563,691).
- IGF-II muteins including furin-resistant IGF-II muteins, have reduced or diminished binding affinity for the insulin receptor.
- a peptide tag suitable for the disclosure has reduced or diminished binding affinity for the insulin receptor relative to the affinity of naturally-occurring human IGF-II for the insulin receptor.
- peptide tags with reduced or diminished binding affinity for the insulin receptor suitable for the disclosure include peptide tags having a binding affinity for the insulin receptor that is more than 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 12-fold, 14-fold, 16-fold, 18-fold, 20-fold, 30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, or 100-fold less than that of the wild-type mature human IGF-II.
- the binding affinity for the insulin receptor can be measured using various in vitro and in vivo assays known in the art.
- a therapeutic fusion protein of the disclosure is typically administered to the individual alone, or in compositions or medicaments comprising the therapeutic protein (e.g., in the manufacture of a medicament for the treatment of the disease), as described herein.
- the compositions can be formulated with one or more physiologically acceptable carriers or excipients to prepare a pharmaceutical composition.
- the carriers and compositions can be sterile. The formulation should suit the mode of administration.
- Suitable pharmaceutically acceptable carriers include but are not limited to water, salt solutions (e.g., NaCl), saline, buffered saline, alcohols, glycerol, ethanol, gum arabic, vegetable oils, benzyl alcohols, polyethylene glycols, gelatin, carbohydrates such as lactose, amylose or starch, sugars such as mannitol, sucrose, or others, dextrose, magnesium stearate, talc, silicic acid, viscous paraffin, perfume oil, fatty acid esters, hydroxymethylcellulose, polyvinyl pyrolidone, etc., as well as combinations thereof.
- salt solutions e.g., NaCl
- saline e.g., buffered saline
- alcohols e.glycerol
- ethanol glycerol
- gum arabic vegetable oils
- benzyl alcohols polyethylene glycols
- gelatin carbohydrates such as lactose, amylose or starch
- the pharmaceutical preparations can, if desired, be mixed with auxiliary agents (e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, flavoring and/or aromatic substances and the like) which do not deleteriously react with the active compounds or interference with their activity.
- auxiliary agents e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, flavoring and/or aromatic substances and the like
- composition or medicament can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
- the composition can be a liquid solution, suspension, emulsion, tablet, pill, capsule, sustained release formulation, or powder.
- the composition can also be formulated as a suppository, with traditional binders and carriers such as triglycerides.
- Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, polyvinyl pyrollidone, sodium saccharine, cellulose, magnesium carbonate, etc.
- the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampule or sachette indicating the quantity of active agent.
- a hermetically sealed container such as an ampule or sachette indicating the quantity of active agent.
- the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water, saline or dextrose/water.
- an ampule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
- the therapeutic protein can be formulated as neutral or salt forms.
- Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
- a therapeutic protein (or a composition or medicament containing a therapeutic protein) is administered by any appropriate route.
- a therapeutic protein is administered intravenously.
- a therapeutic protein is administered by direct administration to a target tissue, such as heart or muscle (e.g., intramuscular), or nervous system (e.g., direct injection into the brain, CNS, CSF; intracerebroventricularly; intrathecally).
- a therapeutic protein is administered intrathecally.
- Methods for the intrathecal administration of therapeutic fusion proteins are known in the art (see, e.g., U.S. Pat. Nos. 7,442,372 and 9,044,473).
- a therapeutic protein (or a composition or medicament containing a therapeutic protein) can be administered parenterally, transdermally, or transmucosally (e.g., orally or nasally). More than one route can be used concurrently, if desired, e.g., a therapeutic protein is administered intravenously and intrathecally. Concurrent intravenous and intrathecal administration need not be simultaneous, but can be sequential.
- a therapeutic protein (or a composition or medicament containing a therapeutic protein) can be administered alone, or in conjunction with other agents, such as antihistamines (e.g., diphenhydramine) or immunosuppressants or other immunotherapeutic agents which counteract anti-GILT-tagged lysosomal enzyme antibodies.
- agents such as antihistamines (e.g., diphenhydramine) or immunosuppressants or other immunotherapeutic agents which counteract anti-GILT-tagged lysosomal enzyme antibodies.
- antihistamines e.g., diphenhydramine
- immunosuppressants e.g., anti-GILT-tagged lysosomal enzyme antibodies
- the agent can be mixed into a composition containing the therapeutic protein, and thereby administered contemporaneously with the therapeutic protein; alternatively, the agent can be administered contemporaneously, without mixing (e.g., by “piggybacking” delivery of the agent on the intravenous line by which the therapeutic protein is also administered, or vice versa).
- the agent can be administered separately (e.g., not admixed), but within a short time frame (e.g., within 24 hours) of administration of the therapeutic protein.
- the therapeutic protein (or composition or medicament containing the therapeutic protein) is administered in a therapeutically effective amount (i.e., a dosage amount that, when administered at regular intervals, is sufficient to treat the disease, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease, as described above).
- a therapeutically effective amount i.e., a dosage amount that, when administered at regular intervals, is sufficient to treat the disease, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease, as described above.
- the dose which will be therapeutically effective for the treatment of the disease will depend on the nature and extent of the disease's effects, and can be determined by standard clinical techniques.
- in vitro or in vivo assays may optionally be employed to help identify optimal dosage ranges using methods known in the art.
- the precise dose to be employed will also depend on the route of administration, and the seriousness of the disease, and should be decided according to the judgment of a practitioner and each patient's circumstances. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
- the therapeutically effective dosage amount can be, for example, about 0.1-1 mg/kg, about 1-5 mg/kg, about 2.5-20 mg/kg, about 5-20 mg/kg, about 20-50 mg/kg, or about 20-100 mg/kg or about 50-200 mg/kg, or about 2.5 to 20 mg/kg of body weight.
- the effective dose for a particular individual can be varied (e.g., increased or decreased) over time, depending on the needs of the individual. For example, in times of physical illness or stress, or if disease symptoms worsen, the dosage amount can be increased.
- the therapeutically effective amount of the therapeutic protein is administered at regular intervals, depending on the nature and extent of the disease's effects, and on an ongoing basis.
- the term “bimonthly” means administration once per two months (i.e., once every two months); the term “monthly” means administration once per month; the term “triweekly” means administration once per three weeks (i.e., once every three weeks); the term “biweekly” means administration once per two weeks (i.e., once every two weeks); the term “weekly” means administration once per week; and the term “daily” means administration once per day.
- the disclosure additionally pertains to a pharmaceutical composition
- a pharmaceutical composition comprising a therapeutic protein, as described herein, in a container (e.g., a vial, bottle, bag for intravenous administration, syringe, etc.) with a label containing instructions for administration of the composition for treatment of Mucopolysaccharidosis Type TIM (Sanfilippo B Syndrome), such as by the methods described herein.
- a container e.g., a vial, bottle, bag for intravenous administration, syringe, etc.
- a label containing instructions for administration of the composition for treatment of Mucopolysaccharidosis Type TIM (Sanfilippo B Syndrome), such as by the methods described herein.
- the present disclosure is directed to formulations comprising a lysosomal enzyme, a targeted therapeutic lysosomal enzyme fusion protein or a functional fragment thereof.
- such formulations are liquid formulations, preferably liquid formulations appropriate for intrathecal administration.
- the formulation may be a lyophilized formulation or may be a liquid formulation that was reconstituted from a previously lyophilized formulation.
- the formulations of the present disclosure comprise a lysosomal enzyme, a targeted therapeutic lysosomal enzyme fusion protein or a functional fragment thereof in a concentration range of from about 0.1 mg/ml to about 300 mg/ml, or from about 1 mg/ml to about 75 mg/ml, or from about 5 mg/ml to about 50 mg/ml, or from about 10 mg/ml to about 40 mg/ml, or from about 20 mg/ml to about 40 mg/ml, or from about 25 mg/ml to about 35 mg/ml.
- the lysosomal enzyme, fusion protein or fragment thereof may be present at or up to a concentration of about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200, 250 or 300 mg/ml or greater.
- the formulations of the present disclosure comprise a lysosomal enzyme, a targeted therapeutic lysosomal enzyme fusion protein or a functional fragment thereof at a concentration of about 30 mg/ml.
- the lysosomal enzyme, targeted therapeutic lysosomal enzyme fusion protein or functional fragment thereof has at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater sequence identity to the amino acid sequence shown in FIG. 2 (SEQ ID NO:5). More preferably, the lysosomal enzyme, targeted therapeutic lysosomal enzyme fusion protein or functional fragment thereof is BMN001 having the amino acid sequence shown in FIG. 2 (SEQ ID NO:5).
- the formulations of the present disclosure comprise one or more buffering agents useful for maintaining the pH of the formulation within a desired range.
- the pH of the liquid formulations of the present disclosure is within the range of from about 5.0 to about 9.0, or from about 5.5 to about 8.5, or from about 6.0 to about 8.0, or from about 6.5 to about 7.5, or from about 6.8 to about 7.2. More preferably, the pH of the liquid formulations of the present disclosure is about 7.0.
- buffering agents and their use in protein-containing formulations are well known in the art and non-limiting examples of buffering agents that find use in the liquid formulations of the present disclosure include, for example, sodium acetate, citric acid monohydrate, sodium citrate dihydrate, sodium phosphate monobasic monohydrate and sodium phosphate dibasic heptahydrate, and the like.
- the concentration of sodium phosphate monobasic monohydrate preferably ranges from about 0.005 mg/ml to about 0.1 mg/ml, or from about 0.01 mg/ml to about 0.1 mg/ml, or from about 0.02 mg/ml to about 0.08 mg/ml, or from about 0.03 mg/ml to about 0.05 mg/ml. In a particularly preferred embodiment, the concentration of sodium phosphate monobasic monohydrate is about 0.04 mg/ml.
- the concentration of sodium phosphate dibasic heptahydrate preferably ranges from about 0.005 mg/ml to about 0.5 mg/ml, or from about 0.01 mg/ml to about 0.5 mg/ml, or from about 0.05 mg/ml to about 0.4 mg/ml, or from about 0.1 mg/ml to about 0.4 mg/ml, or from about 0.15 mg/ml to about 0.25 mg/ml. In a particularly preferred embodiment, the concentration of sodium phosphate dibasic heptahydrate is about 0.19 mg/ml.
- the formulations of the present disclosure comprise one or more isotonicity agents useful for maintaining a desired tonicity and rendering the formulation more compatible for administration, particularly intrathecal administration, to a subject.
- isotonicity agents and their use in protein-containing formulations are well known in the art and non-limiting examples of isotonicity agents that find use in the liquid formulations of the present disclosure include, for example, sodium chloride, trehalose, mannitol, dextrose, glucose, glycerin, sorbitol, xylitol, ethanol, and the like.
- trehalose is used in ranges from about 3% (w/v) to about 10% (w/v), or from about 3% (w/v) to about 5% (w/v) or from about 7% (w/v) to about 9% (w/v). In a preferred embodiment, trehalose is used at about 8% (w/v). In yet another preferred embodiment, trehalose is used at about 4% (w/v).
- the formulations contain an anti-adsorbent agent (e.g., to mitigate adsorption of a protein component to glass or plastic and to reduce the formation of aggregates and multimers).
- Anti-adsorbent agents include without limitation benzyl alcohol, Polysorbate 20, and Polysorbate 80.
- the anti-adsorbent is in a concentration from about 0.001% to about 0.5%, or from about 0.01% to about 0.5%, or from about 0.1% to about 1%, or from about 0.5% to about 1%, or from about 0.5% to about 1.5%, or from about 0.5% to about 2%, or from about 1% to about 2%.
- the anti-adsorbent agent is Polysorbate 20 in a range from about 0.004% to about 0.006%. In a preferred embodiment, Polysorbate 20 is used at 0.005%.
- the concentration of sodium chloride preferably ranges from about 0.5 mg/ml to about 20 mg/ml, or from about 2 mg/ml to about 15 mg/ml, or from about 5 mg/ml to about 10 mg/ml, or from about 7 mg/ml to about 10 mg/ml, or from about 8 mg/ml to about 9 mg/ml.
- the concentration of sodium chloride is about 0.88 mg/ml. In another preferred embodiment, the concentration of sodium chloride is about 5 mg/ml.
- the formulations of the present disclosure comprise one or more electrolyte agents useful for maintaining the level of key electrolyte(s) in the cerebrospinal fluid (CSF) of the subject or for mimicking the natural composition of human CSF.
- electrolyte agents and their use in protein-containing formulations are well known in the art and non-limiting examples of electrolyte agents that find use in the liquid formulations of the present disclosure include, for example, potassium chloride, magnesium chloride, magnesium chloride hexahydrate, calcium chloride, calcium chloride dihydrate, and the like.
- the concentration of potassium chloride preferably ranges from about 0.01 mg/ml to about 1 mg/ml, or from about 0.1 mg/ml to about 0.5 mg/ml, or from about 0.2 mg/ml to about 0.8 mg/ml, or from about 0.15 mg/ml to about 0.4 mg/ml, or from about 0.15 mg/ml to about 0.3 mg/ml. In a preferred embodiment, the concentration of potassium chloride is about 0.22 mg/ml.
- the concentration of magnesium chloride hexahydrate preferably ranges from about 0.01 mg/ml to about 1 mg/ml, or from about 0.1 mg/ml to about 0.8 mg/ml, or from about 0.1 mg/ml to about 0.5 mg/ml, or from about 0.1 mg/ml to about 0.3 mg/ml, or from about 0.1 mg/ml to about 0.2 mg/ml. In a preferred embodiment, the concentration of magnesium chloride hexahydrate is about 0.16 mg/ml.
- the concentration of calcium chloride dihydrate preferably ranges from about 0.01 mg/ml to about 1 mg/ml, or from about 0.1 mg/ml to about 0.8 mg/ml, or from about 0.1 mg/ml to about 0.5 mg/ml, or from about 0.15 mg/ml to about 0.4 mg/ml, or from about 0.15 mg/ml to about 0.3 mg/ml. In a preferred embodiment, the concentration of calcium chloride dihydrate is about 0.21 mg/ml.
- the formulation of the present disclosure is a liquid formulation that comprises the BMN001 targeted therapeutic fusion protein, one or more buffering agents, one or more isotonicity agents and one or more electrolyte agents. More preferably, the liquid formulation comprises BMN001, sodium phosphate dibasic heptahydrate, sodium phosphate monobasic monohydrate, sodium chloride, and trehalose.
- the liquid formulation comprises BMN001 at a concentration of from about 25 mg/ml to about 35 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of from about 0.15 to about 0.25 mg/ml, sodium phosphate monobasic monohydrate at a concentration of from about 0.02 mg/ml to about 0.06 mg/ml, sodium chloride at a concentration of from about 0.8 mg/ml to about 1 mg/ml, and trehalose at about 7% (w/v) to about 9% (w/v).
- the liquid formulation comprises BMN001 at a concentration of about 30 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of about 0.19 mg/ml, sodium phosphate monobasic monohydrate at a concentration of about 0.04 mg/ml, sodium chloride at a concentration of about 0.88 mg/ml, and trehalose at about 8% (w/v).
- the liquid formulation is at about pH 7.0.
- the formulation of the present disclosure is a liquid formulation that comprises the BMN001 targeted therapeutic fusion protein, one or more buffering agents, one or more isotonicity agents and one or more electrolyte agents. More preferably, the liquid formulation comprises BMN001, sodium phosphate dibasic heptahydrate, sodium phosphate monobasic monohydrate, sodium chloride, trehalose, and polysorbate 20.
- the liquid formulation comprises BMN001 at a concentration of from about 25 mg/ml to about 35 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of from about 0.15 to about 0.25 mg/ml, sodium phosphate monobasic monohydrate at a concentration of from about 0.02 mg/ml to about 0.06 mg/ml, sodium chloride at a concentration of from about 4.5 mg/ml to about 5.5 mg/ml, trehalose at about 3% (w/v) to about 5% (w/v), and polysorbate 20 at about 0.004% to about 0.006%.
- the liquid formulation comprises BMN001 at a concentration of about 30 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of about 0.19 mg/ml, sodium phosphate monobasic monohydrate at a concentration of about 0.04 mg/ml, sodium chloride at a concentration of about 5 mg/ml, trehalose at about 4% (w/v), and polysorbate 20 at about 0.005%.
- the liquid formulation is at about pH 7.0.
- the formulations may comprise a preservative.
- Preservatives include, but are not limited to, m-cresol and benzyl alcohol.
- the preservative is in a concentration of about 0.4% ⁇ 0.2%, or about 1% ⁇ 0.5%, or about 1.5% ⁇ 0.5%, or about 2.0% ⁇ 0.5%.
- the formulation does not contain a preservative.
- the formulations comprise a stabilizer.
- stabilizers include glycerin, glycerol, thioglycerol, methionine, and ascorbic acid and salts thereof.
- the stabilizer when the stabilizer is thioglycerol or ascorbic acid or a salt thereof, the stabilizer is in a concentration from about 0.1% to about 1%.
- the stabilizer when the stabilizer is methionine, the stabilizer is in a concentration from about 0.01% to about 0.5%, or from about 0.01% to about 0.2%.
- the stabilizer when the stabilizer is glycerin, the stabilizer is in a concentration from about 5% to about 100% (neat).
- the compositions contain an antioxidant.
- exemplary anti-oxidants include without limitation methionine and ascorbic acid.
- the molar ratio of antioxidant to protein is from about 0.1:1 to about 15:1, or from about 1:1 to about 15:1, or from about 0.5:1 to about 10:1, or from about 1:1 to about 10:1 or from about 3:1 to about 10:1.
- Pharmaceutically acceptable salts can be used in the formulations, including without limitation mineral acid salts (e.g., hydrochloride, hydrobromide, phosphate, sulfate), salts of organic acids (e.g., acetate, propionate, malonate, benzoate, mesylate, tosylate), and salts of amines (e.g., isopropylamine, trimethylamine, dicyclohexylamine, diethanolamine).
- mineral acid salts e.g., hydrochloride, hydrobromide, phosphate, sulfate
- salts of organic acids e.g., acetate, propionate, malonate, benzoate, mesylate, tosylate
- salts of amines e.g., isopropylamine, trimethylamine, dicyclohexylamine, diethanolamine.
- the formulations of the present disclosure are stable and can be stored for extended periods of time without an unacceptable change in quality, potency, or purity.
- the formulation is stable at a temperature of about 5° C. (e.g., 2° C. to 8° C.) for at least 1 month, for example, at least 1 month, at least 3 months, at least 6 months, at least 12 months, at least 18 months, at least 24 months, or more.
- the formulation is stable at a temperature of less than or equal to about ⁇ 20° C. for at least 6 months, for example, at least 6 months, at least 12 months, at least 18 months, at least 24 months, at least 36 months, or more.
- the formulation is stable at a temperature of less than or equal to about ⁇ 40° C. for at least 6 months, for example, at least 6 months, at least 12 months, at least 18 months, at least 24 months, at least 36 months, or more. In another aspect, the formulation is stable at a temperature of less than or equal to about ⁇ 60° C. for at least 6 months, for example, at least 6 months, at least 12 months, at least 18 months, at least 24 months, at least 36 months, or more.
- Suitable formulations of the present disclosure include, liquid, lyophilized or reconstituted lyophilized formulations.
- the formulations of the present disclosure are contained within a container, which in one aspect, may comprise a single dosage form of the formulation.
- Exemplary containers include, for example, ampules, vials, bottles, cartridges, reservoirs and pre-filled syringes.
- the enzyme, enzyme fusion protein or formulation comprising the same is administered by direct introduction into the central nervous system of the subject, e.g., into the cerebrospinal fluid of the subject.
- the enzyme is introduced intrathecally, e.g., into the lumbar area, or the cisterna magna or intraventricularly (or intracerebroventricularly (ICV)) into a cerebral ventricle space.
- Methods of administering a lysosomal enzyme or fusion protein comprising a functional lysosomal enzyme intrathecally or intracerebroventricularly are described in U.S. Pat. Nos. 7,442,372, 9,044,473 and 9,089,566, incorporated herein by reference in their entirety.
- the therapy may be given using an Ommaya reservoir which is in common use for intrathecally administering drugs for meningeal carcinomatosis (Ommaya et al., Lancet 2: 983-84 (1963)). More specifically, in this method, a ventricular tube is inserted through a hole formed in the anterior horn and is connected to an Ommaya reservoir installed under the scalp, and the reservoir is subcutaneously punctured to intrathecally deliver the particular enzyme being replaced, which is injected into the reservoir.
- Other devices for intrathecal administration of therapeutic compositions to an individual are described in U.S. Pat. No.
- composition may be intrathecally given, for example, by a single injection, or continuous infusion. It should be understood that the dosage treatment may be in the form of a single dose administration or multiple doses.
- the term “intrathecal administration” is intended to include delivering a pharmaceutical composition directly into the cerebrospinal fluid of a subject, by techniques including lateral cerebroventricular injection (i.e., intracerebroventricularly) through a burr hole or cisternal or lumbar puncture, or the like (described in Lazorthes et al. Advances in Drug Delivery Systems and Applications in Neurosurgery, 143-192 (1991) and Ommaya et al., Cancer Drug Delivery 1:169-179 (1984), the contents of which are incorporated herein by reference).
- the term “lumbar region” is intended to include the area between the third and fourth lumbar (lower hack) vertebrae and, more inclusively, the L2-S1 region of the spine.
- compositions in accordance with the present disclosure can be achieved by direct injection of the composition or by the use of infusion pumps.
- the composition of the disclosure can be formulated in liquid solutions, preferably in physiologically compatible buffers such as Hank's solution, Ringer's solution or phosphate buffer.
- the enzyme may be formulated in solid form and re-dissolved or suspended immediately prior to use. Lyophilized forms are also included.
- the injection can be, for example, in the form of a bolus injection or continuous infusion (e.g., using infusion pumps) of the enzyme.
- the enzyme is administered by lateral cerebroventricular injection into the brain of a subject.
- the injection can be made, for example, through a burr hole made in the subject's skull.
- the enzyme fusion protein and/or other pharmaceutical formulation is administered through a surgically inserted shunt into the cerebral ventricle of a subject.
- the injection can be made into the lateral ventricles, which are larger, even though injection into the third and fourth smaller ventricles can also be made.
- the pharmaceutical compositions used in the present disclosure are administered by injection into the ci sterna magna , or lumbar area of a subject.
- the pharmaceutically acceptable formulation provides sustained delivery, e.g., “slow release” of the enzyme or other pharmaceutical composition used in the present disclosure, to a subject for at least one, two, three, four weeks or longer periods of time after the pharmaceutically acceptable formulation is administered to the subject.
- a therapeutic fusion protein is delivered to one or more surface or shallow tissues of the brain or spinal cord.
- a therapeutic fusion protein is delivered to one or more surface or shallow tissues of the cerebrum or spinal cord.
- the targeted surface or shallow tissues of the cerebrum or spinal cord are located within 4 mm from the surface of the cerebrum.
- the targeted surface or shallow tissues of the cerebrum are selected from pia mater tissues, cerebral cortical ribbon tissues, hippocampus, Virchow Robin space, blood vessels within the VR space, the hippocampus, portions of the hypothalamus on the inferior surface of the brain, the optic nerves and tracts, the olfactory bulb and projections, and combinations thereof.
- a therapeutic fusion protein is delivered to one or more deep tissues of the cerebrum or spinal cord.
- the targeted surface or shallow tissues of the cerebrum or spinal cord are located 4 mm (e.g., 5 mm, 6 mm, 7 mm, 8 mm, 9 mm, or 10 mm) below (or internal to) the surface of the cerebrum.
- targeted deep tissues of the cerebrum include the cerebral cortical ribbon.
- targeted deep tissues of the cerebrum include one or more of the diencephalon (e.g., the hypothalamus, thalamus, prethalamus, subthalamus, etc.), metencephalon, lentifoim nuclei, the basal ganglia, caudate, putamen, amygdala, globus pallidus, and combinations thereof.
- diencephalon e.g., the hypothalamus, thalamus, prethalamus, subthalamus, etc.
- metencephalon e.g., the hypothalamus, thalamus, prethalamus, subthalamus, etc.
- metencephalon e.g., the basal ganglia, caudate, putamen, amygdala, globus pallidus, and combinations thereof.
- a targeted surface or shallow tissue of the spinal cord contains pia matter and/or the tracts of white matter.
- a targeted deep tissue of the spinal cord contains spinal cord grey matter and/or ependymal cells.
- a therapeutic fusion protein is delivered to neurons of the spinal cord.
- a therapeutic fusion protein is delivered to one or more tissues of the cerebellum.
- the targeted one or more tissues of the cerebellum are selected from the group consisting of tissues of the molecular layer, tissues of the Purkinje cell layer, tissues of the Granular cell layer, cerebellar peduncles, and combination thereof.
- therapeutic agents e.g., enzymes
- a therapeutic fusion protein is delivered to one or more tissues of the brainstem.
- the targeted one or more tissues of the brainstem include brain stem white matter tissue and/or brain stem nuclei tissue.
- a therapeutic fusion protein is delivered to various brain tissues including, but not limited to, gray matter, white matter, periventricular areas, pia-arachnoid, meninges, neocortex, cerebellum, deep tissues in cerebral cortex, molecular layer, caudate/putamen region, midbrain, deep regions of the pons or medulla, and combinations thereof.
- a therapeutic fusion protein is delivered to various cells in the brain including, but not limited to, neurons, glial cells, perivascular cells and/or meningeal cells. In some embodiments, a therapeutic protein is delivered to oligodendrocytes of deep white matter.
- in order to treat MPS IIIB disease in a human subject reduce the rate of decline of at least one symptom (including cognitive decline) of MPS IIIB in a human subject, or to reduce or prevent GAG storage in one or more tissues of the CNS of a subject suffering from MPS IIIB disease, about 30 mg, 100 mg or 300 mg of therapeutic fusion protein, or from about 30 mg-300 mg, 30 mg-200 mg or 30 mg-100 mg of therapeutic fusion protein, is administered once weekly ICV (isovolumetric) for a time period of at least about 24, preferably 48 weeks.
- ICV isovolumetric
- kits which kit may further include instructions for use.
- a kit will comprise a lysosomal enzyme or fusion protein as described herein comprising an enzyme for use in the treatment of a lysosomal storage disease and a lysosomal targeting moiety, usually in a dose and formulation suitable for administration to the host.
- the kit may comprise one or more device(s) for delivering the enzyme intrathecally.
- kits of the present disclosure may comprise instructions for the intrathecal administration of the therapeutic compositions of the present disclosure, in addition to the therapeutic compositions.
- the kits of the disclosure may comprise catheter(s), pump(s), or other devices for the intrathecal administration of the enzyme replacement therapy that are preloaded with the therapeutic compositions of the present disclosure.
- catheters preloaded with 0.001-0.01 mg, 0.01-0.1 mg, 0.1-1.0 mg, 1.0-10 mg, 10-100 mg, or more of a therapeutic fusion protein comprising a lysosomal enzyme and lysosomal targeting moiety, such as Naglu and an IGF-II peptide tag, in a pharmaceutically acceptable formulation are specifically contemplated.
- Exemplary catheters may include single use catheters that can be discarded after use.
- kits of the present disclosure may comprise one or more of the following components, an extension line (e.g., Smiths Medical PN:536040), an in-line filter (e.g., Smiths Medical PN:FS116), a port needle (e.g., Smiths Medical PN:21-2737-24), a syringe (e.g., Becton Dickinson PN:309604) or a syringe needle (e.g., Becton Dickinson PN:305196).
- an extension line e.g., Smiths Medical PN:536040
- an in-line filter e.g., Smiths Medical PN:FS116
- a port needle e.g., Smiths Medical PN:21-2737-24
- a syringe e.g., Becton Dickinson PN:309604
- a syringe needle e.g., Becton Dickinson PN:305196
- Intrathecal e.g., ICV or lumbar
- administration of a Naglu enzyme or fusion protein thereof (including BMN001) into the CSF of the patient can be used for the prevention or treatment of one or more symptom or adverse consequence of MPS IIIB disease in humans.
- intrathecal administration of a therapeutically effective amount of a Naglu enzyme or fusion protein thereof (including BMN001) will result in improvement of at least one symptom or adverse consequence of MPS IIIB disease, a slowing or reduction of the progression of at least one symptom or adverse consequence of MPS IIIB or a stabilization of decline of at least one symptom or adverse consequence of MPS IIIB.
- MPS IIIB disease known symptoms or adverse consequences of MPS IIIB disease in humans include, for example, detectable decline in one or more of the following: cognitive function, language function, motor function, social-emotional function, adaptive function, conceptual thinking, facial recognition, story completion, pattern reasoning and hand function/dexterity.
- DQ developmental quotient
- the DQ score is a cognitive function DQ score.
- a DQ score for a human subject may be obtained through use of the Bayley Scales of Infant Development, 3rd Edition (BSID-III) (Bayley, Bayley Scales of Infant and Toddler Development ( Bayley - III ). Technical Manual. Third ed. San Antonio: Psychological Corp., 2006, incorporated herein by reference).
- the BSID-III is a tool comprised of 5 domains (cognitive, language, motor, social-emotional and adaptive functioning) intended to assess developmental function in children ages 1 to 42 months. In certain embodiments, neither the social-emotional nor adaptive functioning domains of the BSID-III test are used. In one embodiment, only the cognitive domain is used to determine a DQ score.
- the BSID-III's cognitive domain may be the primary focus of the study.
- the cognitive scale is administered individually by a qualified examiner and captures the development of critical skills such as processing speed, problem solving and play.
- the cognitive assessments do not require the subject to respond verbally; as a result, this test is particularly useful for assessing cognitive function in conditions such as MPS IIIB where there are problems with expressive language.
- Raw scores within one domain may be converted to a scaled score, which may then be converted to composite scores encompassing several domains. Mean raw scores associated with different ages also allow for the generation of age-equivalent scores and a DQ.
- the language and motor domains of the BSID-III may also be administered.
- the language domain consists of 2 subtests (receptive communication and expressive communication) and the motor domain consists of 2 subtests (fine motor and gross motor).
- a DQ score for a human subject may be obtained through use of the Kaufman Assessment Battery for Children, 2nd Edition (KABC-II) (Kaufman et al., Kaufman Assessment Battery for Children. Second Edition ed. Pearson Assessment, Inc. 2004, incorporated herein by reference).
- the KABC-II is a clinical instrument (psychological diagnostic test) for assessing cognitive development.
- the KABC can be used to generate age-equivalent scores and hence a DQ. Since many parts of the test are non-verbal it is particularly suited for assessing function in children who may have difficulties in both hearing and in verbal communication, both of which are conditions relevant to the MPS IIIB patient population.
- the test has been translated into a number of different languages across the world.
- the subtests that comprise the Kaufman nonverbal index include the following: conceptual thinking, face recognition, story completion, triangles, pattern reasoning, and hand movements.
- the knowledge cluster subtests may be administered to subjects who have language.
- the algorithm employed for determining whether to employ the BSID-III or KABC-II test for determining a DQ quotient is described by Delaney et al., JIMD Rep. 13:129-137 (2014).
- Results from either the tool (or cognitive subtest thereof) or the KABC-II nonverbal index are used to determine the DQ score for subjects either prior to treatment, or during or after treatment, with a therapeutic enzyme or fusion protein thereof. More specifically, using the BSID-III or KABC-II tools described above, the subject is assigned an “age-equivalent rating” (in months) based upon their performance in the tool employed. The DQ score is then calculated by dividing that “age-equivalent rating” by the actual age of the subject (in months), and then multiplying by 100.
- cognitive function language function, motor function, social-emotional function, adaptive function, conceptual thinking, facial recognition, story completion, pattern reasoning and/or hand function/dexterity tend to decline over time in human MPS IIIB patients, it is expected that DQ scores for untreated MPS IIIB subjects will decline over time.
- the beneficial effect of administration of a therapeutic fusion protein of the present disclosure, or formulation comprising the same, can be detected by determining a DQ score for a subject prior to treatment and comparing to a DQ score for a subject after treatment.
- Lysosomal enzyme fusions proteins comprising GILT tags and spacers have been disclosed in U.S. Patent Publication Nos. 2003-0082176, 2004-0006008, 2003-0072761, 2004-0005309, 2005-0281805, 2005-0244400, U.S. Pat. Nos. 8,492,337 and 8,563,691, and International Publications WO 03/032913, WO 03/032727, WO 02/087510, WO 03/102583, WO 2005/078077, WO 2009/137721 and WO 2014/085621, the disclosures of which are all incorporated herein by reference.
- BMN001 a Naglu/IGF-II fusion protein comprising a functional mature human Naglu enzyme fused through a rigid linker to a furin-resistant IFG-II peptide consisting of amino acids 8-67 of the mature human IGF-II and having an alanine for arginine substitution at amino acid position 37 thereof was prepared and formulated for use in in vivo safety and efficacy studies.
- the peptide linker employed in BMN001 has the amino acid sequence shown herein as SEQ ID NO:4.
- the complete amino acid sequence of the BMN001 therapeutic fusion protein is shown in FIG. 2 (SEQ ID NO:5).
- BMN001 liquid formulation appropriate for human clinical use via intrathecal administration
- various experiments were conducted.
- the propensity of BMN001 to aggregate in liquid formulation at various pH's was tested as follows. Initially, BMN001 was introduced into a liquid formulation comprising a citrate buffer at pH 5.0 or 6.5, or an artificial human CSF liquid formulation at pH 6.0, 6.5, 7.0 and 8.0, and static light scattering analyses were conducted to measure the propensity of BMN001 to aggregate at different pH and increasing temperature.
- BMN001 tends to aggregate more readily with increasing temperature at lower pH (pH 5.0 to 6.0), than it does at higher, more neutral pH (about pH 7.0).
- SEC analyses performed on BMN001 liquid formulations at 25° C. and varying pH demonstrated a significantly higher percentage of aggregated, multimeric BMN001 at pH's below 6.5, as compared to less acidic, more neutral pH's in the range of from about 6.5 to about pH 7.5.
- liquid formulations comprising varying concentrations of BMN001 were tested to determine the effect of fusion protein concentration on aggregate/multimer formation during 5 cycles of freeze/thaw.
- liquid formulations containing 1, 5, 15 or 24 mg/ml of BMN001 were prepared at pH 5.0, 6.0, 7.0 and 8.0.
- the relative percentage of aggregate/multimer to monomer tended to be larger in the lower protein concentration formulations than in the formulations comprising a larger concentration of fusion protein.
- aggregate/multimer formation tended to occur more frequently at more acidic pH than at a neutral pH. Addition of 2% trehalose prevented fusion protein aggregation when compared to the same formulation in the absence of trehalose.
- liquid formulations comprising at least about 24 mg/ml of BMN001 fusion protein are preferable to formulations comprising a lower fusion protein concentration.
- higher protein concentration i.e., approximately 30 mg/ml
- the formulations of the present disclosure including BMN001-containing formulations, having a protein concentration of at least 24 mg/ml, including those formulations having a protein concentration of about 30 mg/ml, are quite useful for intrathecal administration to human subjects.
- Liquid formulations comprising identical amounts of BMN001 were prepared that comprised either (i) 180 mM N-acetylglucosamine, (ii) 222 mM glucose, (iii) 234 mM sucrose, (iv) 212 mM trehalose, (v) 220 mM sorbitol, (vi) 200 mM glutamic acid, (vii) 200 mM glutamine, (viii) 200 mM arginine, (ix) 200 mM histidine, (x) 200 mM glycine, (xi) 0.1% w/v polysorbate 20, or (xii) 0.1% w/v poloaxamer 188.
- BMN001 liquid formulation was developed for use in further human clinical development as described below.
- the BMN001 clinical formulation employed in the human clinical studies described in Example 3 below consisted of the following components: (i) 30 mg/ml BMN001 fusion protein, (ii) 0.19 mg/ml sodium phosphate dibasic, heptahydrate, (iii) 0.04 mg/ml sodium phosphate monobasic monohydrate, (iv) 8.66 mg/ml sodium chloride, (v) 0.22 mg/ml potassium chloride, (vi) 0.16 mg/ml magnesium chloride, hexahydrate, and (vi) 0.21 mg/ml calcium chloride dihydrate.
- This BMN001 clinical formulation was formulated at a final pH of 7.0.
- the BMN001 clinical formulation may be packaged in a clear borosilicate glass vial closed with a fluoropolymer-coated bromobutyl rubber stopper, capped with an aluminum seal and stored frozen at about ⁇ 40° C. until thawed for use.
- Nonclinical studies were conducted as described herein and indicate likely therapeutic benefit without significant risk of BMN001-related toxicity for human patients with MPS IIIB disease.
- the nonclinical studies described herein were designed to support chronic ICV infusion of BMN001 for the treatment of MPS IIIB in human patients.
- the primary pharmacodynamics (PD), cardiovascular (CV) and CNS safety pharmacology, PK, CNS distribution and toxicity of BMN001 administered by the ICV route have been characterized in one single dose study in normal animals (cynomolgus monkey) and four repeat dose studies in normal and disease models of MPS IIIB (Naglu-knockout [KO] mouse, WT and NAGLU-null dog (Ellinwood et al., J. Inherit. Metab. Dis. 26(5):489-504 (2003) and cynomolgus monkey).
- the animal models of disease also display some of the key features of the human MPS IIIB disease, including accumulation of lysosomal storage material, neuron death, decline in function and reduced lifespan with similar relative timing of disease progression. They also display certain neurologic signs, including tremors and ataxia, which can be used to functionally track the underlying CNS pathology and potentially be used to monitor response to treatment. Therefore, these models provide valuable insight as to pharmacological attenuation of disease progression using clinically translatable endpoints.
- BMN001 Primary PD assessments for BMN001 were conducted in IGF2 receptor binding assays, MPS IIIB human fibroblasts and the two available animal models of MPS IIIB, the NAGLU knockout (KO) mouse and juvenile NAGLU-null dog and demonstrate the robust pharmacological activity of BMN001. Analysis of IGF2 receptor binding of BMN001 lots used in these studies resulted in a calculated average IC 50 of 0.28 nM. The in vitro cellular uptake of BMN001 and cellular half-life was determined in MPS IIIB human fibroblasts.
- the lysosomal K uptake of BMN001 was defined as the concentration at which uptake into the lysosome is at half the maximal rate and was 3.7-6.4 nM (5.3 nM average) with a lysosomal half-life of approximately 9.5 days.
- ICV administration of BMN001 reversed the pathology of the disease.
- Repeat-dose studies in these mice show consistent tissue distribution of BMN001 across the CNS.
- the primary PD assessment demonstrated the effects of BMN001 on both biochemical and histological endpoints.
- ICV administration of BMN001 to Naglu-KO mice resulted in reduction of lysosomal storage material accumulation (i.e., GAG/heparan sulfate accumulation) with accompanying improvement in histological and immune-histological indices of lysosomal function.
- BMN001 when evaluated 24 hours after the final dose of BMN001, treatment resulted in a marked increase of Naglu enzyme activity and a concomitant decrease in beta-hexosaminidase activity and levels of total heparan sulfate and LAMP-2.
- Naglu activity was detectable in brain tissues, not only in cortex, hippocampus, dentate gyrus and thalamus, but also in remote distal geographic locations including amygdyla, perirhinal cortex and hypothalamus.
- Levels of heparan sulfate, Naglu-specific NREs and beta-hexosaminidase activity continued to decrease over the 7, 14 and 28 day post-last-dose time points.
- CSF cerebrospinal fluid
- Group 1 normal NAGLU+ dogs—ICV vehicle only (10 ml/kg); Group 2 (normal NAGLU+ dogs)—BMN001 (12 mg/kg); Group 3 (normal NAGLU+ dogs)—BMN001 (12 mg/kg, escalated to 48 mg/kg at dose 3); Group 4 (NAGLU-null dogs)—ICV vehicle only (10 ml/kg); Group 5 (NAGLU-null dogs)—BMN001 (12 mg/kg); Group 6 (NAGLU-null dogs)—BMN001 (12 mg/kg, escalated to 48 mg/kg at dose 3).
- Heparan Sulfate (HS) levels were measured in the CNS tissue, CSF, and cerebellum tissue in the dogs from groups 1, 4, 5, and 6.
- BMN001 reduced HS levels in both CNS tissue and in the CSF in MPS IIIB dogs in a dose dependent fashion, with the 48 mg/kg dose reducing HS to wild-type levels.
- the levels of HS in the CNS and CSF in each group of dogs was evaluated and compared.
- FIG. 4 there is a strong correlation in the HS levels in these two brain compartments, demonstrating BMN001's ability to reduce HS uniformly throughout the brain.
- BMN001 treatment on LAMP2 levels was also investigated. Cerebellum tissue homogenate samples (18 ⁇ g protein/lane) from wild-type, untreated MPSIIIB-affected dogs, and MPSIIIB-affected dogs treated with BMN001 were electrophoresed and blotted under non-reducing conditions, then probed with unlabeled AC17 and detected with an HRP-conjugated anti-mouse IgG secondary antibody. LAMP2-expressing or control CHO-K1 cell lysates were included in the blots as controls (5 ⁇ g protein/lane). To assess the total amount of protein loaded into each lane, cerebellum homogenate blots were stripped and re-probed for ⁇ -actin. As shown in FIG. 5 , untreated MPSIIIB-affected dogs had high levels of LAMP2 relative to wild-type dogs. However, treatment with BMN001 reduced the LAMP2 levels in MPSIIIB-affected dogs to levels seen in wild-type dogs.
- BMN001 caused a significant reduction in cerebellar HS at both doses. Further, both doses of BMN001 attenuated cerebellar white matter decline as measured by diffusion tensor imaging (DTI) ( FIG. 7 ). The attenuation of cerebellar atrophy by BMN001 was also clearly seen in MRI images of wild-type and BMN001 treated MPS IIIB dogs ( FIG. 8 ).
- Group 1 ICV vehicle only (5 minutes, 2.5 ml isovolumetric ICV, 0.5 ml/min); Group 2—30 mg BMN001 (5 minutes, 2.5 ml isovolumetric ICV, 0.5 ml/min); Group 3—73 mg BMN001 (5 minutes, 2.5 ml isovolumetric ICV, 0.5 ml/min); Group 4—73 mg BMN001 (240 minutes, 2.5 ml non-isovolumetric ICV, 0.88 ml/hr); and Group 5—200 mg/kg BMN001 (5 minutes, non-isovolumetric IV, 3 ml/min).
- Cardiovascular, respiratory and CNS safety pharmacology parameters were assessed in the single and weekly repeat dose monkey toxicity studies.
- CNS and cardiovascular safety pharmacology parameters were assessed in the biweekly repeat dose studies in WT and NAGLU-null dogs.
- systemic toxicity including hypoglycemia, observed after repeat IV administration of BMN001.
- human-equivalent doses were calculated based on scaling of brain mass.
- the human brain achieves about 75% of adult mass by age 2 and 100% of adult mass by age 5.
- an average mass of 1000 g was assumed for the intended patient population. This yields a scaling factor of 10-fold based on an average cynomolgus brain mass of 100 g.
- the safety and efficacy profile of BMN001 supports the chronic ICV administration of BMN001 at doses up to 730 mg (as scaled by brain weight) when administered as either a 4-hour infusion or an isovolumetric bolus every week in the intended pediatric patient population.
- BMN001 formulated as described in Example 1 above, is administered weekly by ICV infusion and subjects are evaluated in terms of neurocognitive function, behavior, sleep, quality of life (both of the subject and of the family/caregiver), imaging characteristics and biochemical markers of disease burden.
- the study's primary objectives are to evaluate the safety and tolerability of BMN001 administered to subjects with MPS IIIB via an ICV reservoir and catheter and to evaluate the impact of BMN001 on cognitive function in human patients with MPS MB as assessed by an applicable development quotient (DQ).
- DQ applicable development quotient
- the current phase 1/2 human clinical study consists of 2 parts.
- the dose escalation period 3 human subjects (not previously enrolled in natural history study) each receive at least 4 weekly doses of BMN001 at up to 3 escalating dose levels (30 mg, 100 mg and 300 mg) until the maximum tolerated tested dose (MTTD) is established.
- the stable dose period up to 30 human subjects previously enrolled in the natural history study begin a treatment course of weekly BMN001 at the MTTD that continues for 48 weeks.
- the 3 subjects from Part 1 also move into Part 2, perform the Part 2 Baseline assessments and continue weekly dosing for an additional 48 weeks at the MTTD established in Part 1.
- the infusion regimen involves isovolumetric removal of 10 ml of CSF followed by ICV delivery of 10 ml total volume of BMN001 over a time period of from about 5 minutes to about 10 minutes.
- a rapid infusion rate was chosen for this study to address the specific needs of the MPS IIIB patient population; in particular, these patients often have pronounced behavior problems which would make longer infusion periods logistically challenging.
- Rapid intraventricular delivery of large volumes (e.g., 10-12 ml) of therapeutics following the removal of isovolumetric amounts of CSF is part of routine practice in the pediatric oncology setting. ICV delivery of a longer period of time, however, may also be employed.
- a single ICV administration of BMN001 may occur over a time period of at least 5, 10, 15, 20, 25, 30, 45, 60, 90, 120, 150, 180, 210 or 240 minutes, or more.
- VABS-II Vineland Adaptive Behavior Scales, 2nd Edition
- BSID-III Bayley Scales of Infant Development, 3rd Edition
- KBC-II Kaufman Assessment Battery for Children
- SBRS Sanfilippo Behavior Rating Scale
- Additional study procedures to be performed during both Part 1 and Part 2 Baseline visits and at Weeks 24 and 48 in Part 2 include the Infant Toddler Quality of Life questionnaire (ITQOL) or Child Health Questionnaire Parent Form (CHQ-PF50), the Children's Sleep Habits Questionnaire (CSHQ), the Parenting Stress Index, the PEDIATRIC QUALITY OF LIFE INVENTORYTM (PEDSQLTM) Family Impact Module, MRI (under anesthesia) of the brain and abdomen and a brainstem auditory evoked response (BAER) assessment.
- IQOL Infant Toddler Quality of Life questionnaire
- CHQ-PF50 Child Health Questionnaire Parent Form
- CSHQ Children's Sleep Habits Questionnaire
- PEDSQLTM PEDIATRIC QUALITY OF LIFE INVENTORYTM
- BAER brainstem auditory evoked response
- the subjects were monitored over the course of at least 24 weeks prior treatment initiation to understand the natural history of disease progression.
- the baseline levels of Heparan Sulfate (HS) and MPS IIIB-specific HS non-reducing end (NRE) were measured in the cerebrospinal fluid (CSF) for each patient before and after treatment.
- CSF cerebrospinal fluid
- treatment with BMN001 induced marked and sustained decreases in both HS and NRE in both subject A and B ( FIG. 10 ) (subject C enrolled later in the study and data was not yet available).
- BMN001 was well tolerated with no serious adverse events related to treatment.
- N-acetylglucosamine, glucose, sucrose, trehalose, sorbitol, polysorbate 20, and poloaxamer 188 were found to reduce aggregate/multimer formation. Of these, trehalose and polysorbate 20, were selected as lead candidate excipients for further work.
- Formulations containing various concentrations of trehalose and/or polysorbate 20 were generated in a base containing sodium phosphate dibasic heptahydrate, sodium phosphate monobasic monohydrate, and sodium chloride. These were then tested for their ability to reduce aggregates/multimers created by recirculation pumping, four passes of pumping, and freeze/thaw cycling ( ⁇ 40° C./25° C. for 20 cycles). In addition, each formulation was tested for stability at accelerated temperatures of 40° C. and 25° C. For each condition, aggregation was measured by visible and sub-visible particle count, solution turbidity (OD550), particle size homogeneity, and percent multimers. As shown in FIGS.
- trehalose reduced particle formation in a dose dependent manner.
- the combination of trehalose and polysorbate 20 had the strongest effect on particle formation reduction. Similar results were observed measuring particle formation after each of four passes through a pump, with the combination of both trehalose and polysorbate 20 showing the greatest reduction in particle count (Tables 3 and 4).
- Trehalose or Polysorbate 20 TABLE 3 Particles per ml after each stage of pump stress, Trehalose or Polysorbate 20.
- Formulation Before Pass 1 Pass 2 Pass 3 Pass 4 No Trehalose 50,520 49,853 138,709 239,257 385,098 No PS20* 0.005% PS20 55,128 51,523 74,063 88,344 118,344 8% Trehalose 43,643 25,034 76,281 172,005 269,737 4% Trehalose 28,511 15,703 87,551 190,998 387,826 *PS20 is polysorbate 20.
- Trehalose and Polysorbate 20 TABLE 4 Particles per ml after each stage of pump stress, Trehalose and Polysorbate 20.
- Formulation Before Pass 1 Pass 2 Pass 3 Pass 4 No Trehalose 2188 9207 151,514 353,469 528,347 No PS20* 0.005% PS20 3549 3558 125,017 212,017 276,984 8% Trehalose 2961 2669 40,200 88,129 122,931 0.005% PS20 *PS20 is polysorbate 20.
- trehalose/polysorbate 20 combinations were tested. As shown in Table 5, increasing the amount of either trehalose or polysorbate 20 in the combination decreased the amount of particles formed, with the greatest reduction seen in the combination with the highest trehalose and polysorbate 20 (8% trehalose and 0.005% polysorbate 20). The combination of trehalose and polysorbate 20 was also more effective in the reduction of aggregates formed by twenty freeze/thaw cycles than trehalose or polysorbate 20 alone ( FIG. 12 ). As summarized in Table 6, the excipients trehalose and trehalose in combination with polysorbate 20 effectively reduced BMN001 aggregate and multimer formation relative to the original formulation.
- BMN001 at a concentration of about 30 mg/ml
- sodium phosphate dibasic heptahydrate at a concentration of about 0.19 mg/ml
- sodium phosphate monobasic monohydrate at a concentration of about 0.04 mg/ml
- sodium chloride at a concentration of about 5 mg/ml
- trehalose at a concentration of about 4% (w/v)
- polysorbate 20 at a concentration of about 0.005%, at a pH of about 7.0.
- the disclosure includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process.
- the disclosure also includes embodiments in which more than one, or all, of the group members are present in, employed in, or otherwise relevant to a given product or process.
- the disclosure encompasses variations, combinations, and permutations in which one or more limitations, elements, clauses, descriptive terms, etc., from one or more of the claims is introduced into another claim dependent on the same base claim (or, as relevant, any other claim) unless otherwise indicated or unless it would be evident to one of ordinary skill in the art that a contradiction or inconsistency would arise.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Organic Chemistry (AREA)
- Epidemiology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Wood Science & Technology (AREA)
- Immunology (AREA)
- Diabetes (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- Hospice & Palliative Care (AREA)
- Psychiatry (AREA)
- Endocrinology (AREA)
- Toxicology (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Dermatology (AREA)
- Inorganic Chemistry (AREA)
- Orthopedic Medicine & Surgery (AREA)
Abstract
Description
- The present disclosure relates, in general, to therapeutic lysosomal enzyme fusion proteins useful for treating lysosomal storage diseases, formulations comprising such therapeutic lysosomal enzyme fusion proteins and associated methods for treating lysosomal storage diseases in mammals.
- Normally, mammalian lysosomal enzymes are synthesized in the cytosol and traverse the ER where they are glycosylated with N-linked, high mannose type carbohydrate. In the golgi, the high mannose carbohydrate is modified on lysosomal enzymes by the addition of mannose-6-phosphate (M6P) which targets these proteins to the lysosome. The M6P-modified enzymes are then delivered to the lysosome via interaction with either/both of two M6P receptors.
- More than forty lysosomal storage diseases (LSDs) are caused, directly or indirectly, by the absence of one or more lysosomal enzymes in the lysosome. Enzyme replacement therapy for LSDs is being actively pursued. Therapy generally requires that LSD proteins be taken up and delivered to the lysosomes of a variety of cell types in an M6P-dependent fashion. One possible approach involves purifying an LSD protein and modifying it to incorporate a carbohydrate moiety with M6P. This modified material may be taken up by the cells more efficiently than unmodified LSD proteins due to interaction with M6P receptors on the cell surface.
- A peptide-based targeting technology that allows more efficient delivery of therapeutic enzymes to the lysosomes has been previously developed. This proprietary technology is termed Glycosylation Independent Lysosomal Targeting (GILT) because a peptide tag that is linked to the therapeutic enzyme replaces M6P as the moiety that targets the protein to the lysosomes. Details of the GILT technology are described in U.S. Application Publication Nos. 2003-0082176, 2004-0006008, 2003-0072761, 2005-0281805, 2005-0244400, U.S. Pat. Nos. 8,492,337 and 8,563,691, and International Publications WO 03/032913, WO 03/032727, WO 02/087510, WO 03/102583, WO 2005/078077, WO 2009/137721 and WO 2014/085621, the disclosures of all of which are hereby incorporated by reference.
- The present disclosure provides further improved compositions, formulations and methods for efficient lysosomal targeting of therapeutic fusion proteins based on the GILT technology. Among other things, the present disclosure provides methods and compositions for targeting therapeutic lysosomal enzymes to lysosomes using lysosomal targeting peptides for the treatment of lysosomal storage disorders. The present disclosure also provides methods and compositions for targeting lysosomal enzymes to lysosomes using a lysosomal targeting peptide that has reduced or diminished binding affinity for the IGF-I receptor and/or reduced or diminished binding affinity for the insulin receptor, and/or is resistant to furin cleavage. The present disclosure also provides targeted lysosomal enzyme fusion proteins comprising a lysosomal enzyme and IGF-II and spacer peptides that provide for improved production and uptake into lysosomes of the lysosomal enzyme fusion protein. Exemplary lysosomal enzymes useful for incorporation into the therapeutic fusion proteins of the present disclosure and the associated diseases to be treated with those fusion proteins are set out in Table 1 below. In certain preferred embodiments, the lysosomal enzyme is a mature human alpha-N-acetylglucosaminidase (Naglu) enzyme and the lysosomal storage disorder is Mucopolysaccharidosis Type IIIB (MPS IIIB; Sanfilippo B Syndrome).
- In one aspect, the therapeutic fusion protein of the present disclosure comprises a functional α-N-acetylglucosaminidase enzyme that exhibits detectable enzyme activity and has an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of the mature human Naglu protein shown in
FIG. 1 (SEQ ID NO:1). In another aspect, the disclosure is directed to a fragment of the mature human Naglu protein shown inFIG. 1 (SEQ ID NO:1) that retains detectable Naglu enzyme activity. - In another aspect, the therapeutic fusion protein of the present disclosure comprises a peptide tag having an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of amino acids 8-67 of mature human IGF-II. In this regard, amino acids 8-67 of mature human IGF-II has the following amino acid sequence: LCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE (SEQ ID NO:2).
- In various embodiments, the targeted therapeutic fusion protein of the present disclosure comprises a peptide tag having an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of amino acids 8-67 of mature human IGF-II having an alanine for arginine substitution at
amino acid position 37. In this particularly preferred embodiment, the peptide tag has the following amino acid sequence: LCGGELVDTLQFVCGDRGFYFSRPASRVSARSRGIVEECCFRSCDLALLETYCATPAKSE (SEQ ID NO:3). The substitution of alanine for arginine atamino acid position 37 has previously been reported to abolish at least one furin protease cleavage site (see, e.g., U.S. Pat. No. 8,563,691). - In another aspect, the therapeutic fusion protein of the present disclosure comprises a spacer peptide located between and linking the lysosomal enzyme and the peptide tag. In various embodiments, the spacer/linker peptide has an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of a 31 amino acid rigid linker peptide having the following amino acid sequence: GAPGGGSPAPAPTPAPAPTPAPAGGGPSGAP (SEQ ID NO:4). In various embodiments, the spacer peptide is from about 25-37, 26-36, 27-35, 28-34, 29-33 or 30-32 amino acids in length and represents a variant of SEQ ID NO:4 wherein 1, 2, 3, 4, 5 or 6 specific amino acids of SEQ ID NO:4 are substituted, added or deleted.
- In yet another aspect, the therapeutic fusion protein of the present disclosure comprises (i) a functional α-N-acetylglucosaminidase enzyme having an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of the mature human Naglu protein shown in
FIG. 1 (SEQ ID NO:1), (ii) a peptide tag having an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:3, and (iii) a spacer/linker peptide located between the enzyme and the peptide tag having an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of the 31 amino acid rigid linker peptide shown herein as SEQ ID NO:4. In one embodiment (herein referred to as BMN001), the therapeutic fusion protein of the present disclosure comprises (i) a functional mature human α-N-acetylglucosaminidase (Naglu) enzyme having the amino acid sequence shown inFIG. 1 (SEQ ID NO:1), (ii) a spacer/linker peptide having the amino acid sequence shown herein as SEQ ID NO:4, and (iii) an IGF-II peptide tag having the amino acid sequence of SEQ ID NO:3. The complete amino acid sequence of the BMN001 therapeutic fusion protein is shown inFIG. 2 (SEQ ID NO:5). - In yet another aspect, the disclosure provides pharmaceutical compositions useful for treating a lysosomal storage disorder in a mammal, wherein said compositions comprise a therapeutic fusion protein of the present disclosure. In various embodiments, the pharmaceutical composition is a formulation that comprises (a) a fusion protein comprising a lysosomal enzyme or functional fragment thereof, a peptide tag having at least 90% sequence identity to SEQ ID NO:2, and a spacer peptide located between said lysosomal enzyme or functional fragment thereof and said peptide tag, said spacer peptide having at least 90% sequence identity to SEQ ID NO:4; and (b) one or more components selected from the group consisting of a buffering agent, an isotonicity agent and an electrolyte agent. The formulations of the present disclosure may be liquid formulations, lyophilized formulations or liquid formulations that were reconstituted from previously lyophilized formulations. In various embodiments, the formulations of the present disclosure are stable.
- In various embodiments, the formulations or compositions of matter of the present disclosure may comprise a lysosomal enzyme or functional fragment thereof that comprises the amino acid sequence of SEQ ID NO:1. The formulations of the present disclosure may comprise a fusion protein that comprises or consists of the amino acid sequence of SEQ ID NO:5.
- The formulations of the present disclosure may comprise a fusion protein comprising the amino acid sequence of SEQ ID NO:5, a buffering agent, an isotonicity agent, an electrolyte agent, and an anti-adsorption agent. In various embodiments, the formulations of the present disclosure comprise a fusion protein comprising the amino acid sequence of SEQ ID NO:5, sodium phosphate dibasic heptahydrate, sodium phosphate monobasic monohydrate, sodium chloride, and trehalose. In one embodiment, the formulations of the present disclosure comprise a fusion protein comprising the amino acid sequence of SEQ ID NO:5 at a concentration of from about 25 mg/ml to about 35 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of from about 0.15 mg/ml to about 0.25 mg/ml, sodium phosphate monobasic monohydrate at a concentration of from about 0.03 mg/ml to about 0.05 mg/ml, sodium chloride at a concentration of from about 0.8 mg/ml to about 1 mg/ml, and trehalose is at a concentration of from about 7% to about 9%, said formulation having a pH in the range of about 6.5 to about 7.5. In various embodiments, a formulation of the present disclosure comprises a fusion protein comprising the amino acid sequence of SEQ ID NO:5 at a concentration of about 30 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of about 0.19 mg/ml, sodium phosphate monobasic monohydrate at a concentration of about 0.04 mg/ml, sodium chloride at a concentration of about 0.88 mg/ml, and the trehalose concentration at about 8%, said formulation having a pH of about 7.0. These formulations may be in either aqueous or dry/lyophilized form.
- In other embodiments, the formulations of the present disclosure comprise a fusion protein comprising the amino acid sequence of SEQ ID NO:5, sodium phosphate dibasic heptahydrate, sodium phosphate monobasic monohydrate, sodium chloride, trehalose, and
polysorbate 20. In one embodiment, the formulations of the present disclosure comprise a fusion protein comprising the amino acid sequence of SEQ ID NO:5 at a concentration of from about 25 mg/ml to about 35 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of from about 0.15 mg/ml to about 0.25 mg/ml, sodium phosphate monobasic monohydrate at a concentration of from about 0.03 mg/ml to about 0.05 mg/ml, sodium chloride at a concentration of from about 4.5 mg/ml to about 5.5 mg/ml, trehalose is at a concentration of from about 3% to about 5%, and thepolysorbate 20 is at a concentration from about 0.0025% to about 0.0075%, said formulation having a pH in the range of about 6.5 to about 7.5. In various embodiments, a formulation of the present disclosure comprises a fusion protein comprising the amino acid sequence of SEQ ID NO:5 at a concentration of about 30 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of about 0.19 mg/ml, sodium phosphate monobasic monohydrate at a concentration of about 0.04 mg/ml, sodium chloride at a concentration of about 5 mg/ml, the trehalose concentration at about 4%, and thepolysorbate 20 concentration at about 0.005% said formulation having a pH of about 7.0. These formulations may be in either aqueous or dry/lyophilized form. - In various embodiments, the formulations of the disclosure comprise sodium phosphate dibasic heptahydrate, sodium phosphate monobasic monohydrate, sodium chloride, potassium chloride, magnesium chloride hexahydrate and calcium chloride dehydrate, and wherein the fusion protein comprises the amino acid sequence of SEQ ID NO:5. In yet other embodiments, the formulations of the present disclosure comprise a fusion protein comprising the amino acid sequence of SEQ ID NO:5 at a concentration of from about 25 mg/ml to about 35 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of from about 0.15 mg/ml to about 0.25 mg/ml, sodium phosphate monobasic monohydrate at a concentration of from about 0.03 mg/ml to about 0.05 mg/ml, sodium chloride at a concentration of from about 8 mg/ml to about 9 mg/ml, potassium chloride at a concentration of from about 0.15 mg/ml to about 0.3 mg/ml, magnesium chloride hexahydrate at a concentration of from about 0.1 mg/ml to about 0.2 mg/ml and calcium chloride dihydrate at a concentration of from about 0.15 mg/ml to about 0.3 mg/ml, said formulation having a pH in the range of about 6.5 to about 7.5. In various embodiments, a formulation of the present disclosure comprises a fusion protein comprising the amino acid sequence of SEQ ID NO:5 at a concentration of about 30 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of about 0.19 mg/ml, sodium phosphate monobasic monohydrate at a concentration of about 0.04 mg/ml, sodium chloride at a concentration of about 8.66 mg/ml, potassium chloride at a concentration of about 0.22 mg/ml, magnesium chloride hexahydrate at a concentration of about 0.16 mg/ml and calcium chloride dihydrate at a concentration of about 0.21 mg/ml, said formulation having a pH of about 7.0. These formulations may be in either aqueous or dry/lyophilized form.
- In yet other aspects, the present disclosure is directed to methods for treating lysosomal storage diseases in subjects suffering therefrom, wherein those methods comprise the step of administering a composition of matter or formulation described herein. In various embodiments, the present disclosure is directed to a method of treating MPS IIIB disease in a subject suffering therefrom, wherein the method comprises the step of administering a therapeutic fusion protein having Naglu enzyme activity, or a formulation comprising the same, as described herein. In certain embodiments, the formulation is administered intrathecally, intracerebroventricularly or directly to the CSF via lumbar puncture, which may be either non-volumetric or isovolumetric. Administration of a therapeutic formulation of the present disclosure may occur over a period of from about 5 minutes to about 240 minutes or more, or from about 5 minutes to about 10 minutes. In certain embodiments, administration of a formulation for the treatment of MPS IIIB may occur weekly for a period of at least 24 weeks, preferably at least 48 weeks. In one embodiment, administration of a therapeutically effective amount of a therapeutic fusion protein or formulation of the present disclosure results in reduced severity, intensity or frequency, or delayed onset of at least one symptom or feature of MPS IIIB disease.
- In yet other aspects, the present disclosure is directed to a method for slowing the rate of decline, or preventing decline, of at least one symptom of MPS IIIB disease in a subject suffering therefrom, wherein the method comprises the step of administering to the subject a therapeutic fusion protein having Naglu activity or a formulation comprising the same. In various embodiments, the formulation is administered intracerebroventricularly, wherein the intracerebroventricular administration is isovolumetric. Administration of a therapeutic formulation of the present disclosure may occur over a period of from about 5 minutes to about 240 minutes or more, or from about 5 minutes to about 10 minutes. In certain embodiments, administration of a formulation for the treatment of MPS IIIB may occur weekly for a period of at least 24 weeks, preferably at least 48 weeks. These methods may result in improvement of at least one symptom of MPS IIIB disease. In various embodiments, the at least one symptom of MPS IIIB disease can be selected from the group consisting of cognitive decline, decline in language function, decline in motor function, decline in social-emotional function, decline in adaptive function, decline in conceptual thinking, decline in facial recognition, decline in story completion capability, decline in hand function/dexterity, hearing loss, hyperactivity, aggressiveness, or sleep disturbances.
- In various aspects, the reduction in the rate of decline, or prevention of decline, of said at least one symptom may be determined by: (a) determining the rate of decline of said symptom prior to said administration, and (b) determining the rate of decline of said symptom subsequent to said administration; wherein a lower rate of decline of said symptom subsequent to said administration as compared to prior to said administration is indicative of a reduction in said rate of decline. These methods may further comprise the steps of determining a development quotient (DQ) for said subject prior to said administration and determining a DQ for said subject subsequent to said administration, wherein a higher DQ for said subject subsequent to said administration as compared to prior to said administration is indicative of a reduction in said rate of decline. In various embodiments, therefore, the present disclosure is directed to methods for stabilizing or reducing the decline of a DQ quotient in a subject suffering from MPS IIIB disease, wherein the methods comprise administering to the subject a therapeutic fusion protein or formulation comprising the same. Development quotients may be determined using the BSID-III or KABC-II tool as described herein and known in the art.
- In yet other aspects, the present disclosure is directed to slowing the rate of decline of a cognitive function in a subject suffering from MPS IIIB disease, wherein the method comprises the step of administering to said subject a therapeutically effective amount of a therapeutic fusion protein of the present disclosure, or a formulation thereof, as described herein. In certain embodiments, the fusion protein or formulation thereof may be administered IT, ICV or via lumbar puncture, wherein the administration may be isovolumetric. Administration of a therapeutic formulation of the present disclosure may occur over a period of from about 5 minutes to about 240 minutes or more, or from about 5 minutes to about 10 minutes. In various embodiments, administration of a formulation for the treatment of MPS IIIB may occur weekly for a period of at least 24 weeks, or for at least 48 weeks.
- In yet other aspects, the present disclosure is directed to methods for reducing or preventing GAG storage in one or more tissues of the CNS of a subject suffering from a lysosomal storage disorder, wherein the methods comprise administering a therapeutically effective amount of a therapeutic fusion protein or formulation described herein. In one embodiment, the GAG is heparan sulfate and the lysosomal storage disorder is MPS IIIB. As described herein, the administration may be intracerebroventricular, which may be isovolumetric. In various embodiments, GAG storage is reduced in the lysosomes of cells of one or more tissues of the CNS including, for example, gray matter, white matter, periventricular areas, meninges, pia-arachnoid, deep tissues in the cerebral cortex, neocortex, cerebellum, caudate/putamen region, molecular layer, deep regions of the pons or medulla, midbrain, or combinations of two or more of the above.
- In various embodiments, the therapeutic fusion protein is delivered to neurons, glial cells, perivascular cells, meningeal cells, and/or neurons of the spinal cord. In certain embodiments, administration of the therapeutic fusion protein or formulation comprising the same results in reduction of GAG storage in one or more of the brain target tissues or spinal cord neurons by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 1-fold, 1.5-fold or 2-fold or more as compared to an appropriate control (e.g., the pre-treatment GAG storage in the subject).
- Other features, objects, and advantages of the present disclosure are apparent in the detailed description that follows. It should be understood, however, that the detailed description, while indicating embodiments of the present disclosure, is given by way of illustration only, not limitation. Various changes and modifications within the scope of the disclosure will become apparent to those skilled in the art from the detailed description.
-
FIG. 1 depicts the amino acid sequence (SEQ ID NO:1) of the mature human Naglu protein. -
FIG. 2 depicts the amino acid sequence (SEQ ID NO:5) of the BMN001 therapeutic fusion protein. -
FIG. 3 is a set of graphs showing Heparan Sulfate (HS) levels in central nervous system tissue (CNS) (upper graph) and cerebrospinal fluid (CSF) (lower graph) in control heterozygous Naglu dogs and homozygous Naglu null affected MPS IIIB dogs treated with vehicle, 12 mg BMN001, or 48 mg BMN001. The data demonstrates that BMN001 reduced HS levels in MPS IIIB dogs to those seen in unaffected heterozygous carrier dogs. -
FIG. 4 is a plot of CNS HS levels compared to CSF HS levels showing a strong correlation (r2=0.824) between HS levels in these two compartments. -
FIG. 5 is a western blot of canine cerebellum from wild-type dogs, untreated MPS IIIB dogs, and BMN001 treated MPS IIIB dogs probed with an antibody specific for canine LAMP2 protein, showing that LAMP2 levels are elevated in untreated MPS IIIB dogs relative to wild-type and that treatment with BMN001 reduces LAMP2 to wild-type levels in treated MPS IIIB dogs. -
FIG. 6 is a graph showing Heparan Sulfate (HS) levels in cerebellum in control heterozygous Naglu dogs and homozygous Naglu null affected MPS IIIB dogs treated with vehicle, 12 mg BMN001, or 48 mg BMN001. The data demonstrates that BMN001 reduced HS levels in MPS IIIB dog cerebellum to those seen in unaffected heterozygous carrier dogs. -
FIG. 7 is a graph showing cerebellar mean diffusivity in control heterozygous Naglu dogs and homozygous Naglu null affected MPS MB dogs treated with vehicle, 12 mg BMN001, or 48 mg BMN001. -
FIG. 8 is a set of MRI images of the cerebellum of wild type vehicle treated dogs and MPS IIIB dogs treated with vehicle or BMN001. -
FIG. 9 is a bar graph showing that untreated MPS IIIB patients have elevated Heparan Sulfate (HS) and MPS IIIB-specific HS non-reducing end (NRE) in the cerebrospinal fluid (CSF). The dashed vertical lines show the average normal CSF levels of HS and NRE (0.05 mg/L and 0.0025 mg/L respectively). This data was collected over a period of at least 24 weeks to understand the natural history of the disease. Where available data from early and late time-points in the natural history are shown. -
FIG. 10 is a set of graphs showing the reduction of HS and NRE in the CSF of two subjects treated with BMN001. -
FIGS. 11A and 11B are graphs showing the effects of trehalose and trehalose—polysorbate 20 combination on aggregate particle formation following pumping stress of BMN001 containing formulations. -
FIG. 12 is a graph showing the effects of trehalose and trehalose—polysorbate 20 combination on aggregate particle formation following freeze thaw stress of BMN001 containing formulations. Artificial cerebrospinal fluid (aCSF) is BMN001 formulated without trehalose orpolysorbate 20. - As used herein, “lysosomal storage diseases” refer to a group of genetic disorders that result from deficiency in at least one of the enzymes (e.g., acid hydrolases) that are required to break macromolecules down to peptides, amino acids, monosaccharides, nucleic acids and fatty acids in lysosomes. As a result, individuals suffering from a lysosomal storage disease have accumulated materials in lysosomes. Exemplary lysosomal storage diseases are listed in Table 1.
- As used herein, the term “lysosomal enzyme” refers to any enzyme that is capable of reducing accumulated materials in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms. Lysosomal enzymes suitable for the disclosure include both wild-type or modified lysosomal enzymes and can be produced using recombinant and synthetic methods or purified from nature sources. Exemplary lysosomal enzymes are listed in Table 1, wherein such lysosomal enzymes may be incorporated into the therapeutic fusion proteins described herein.
- As used herein, the term “human alpha-N-acetylglucosaminidase” refers to precursor (i.e., containing the native signal peptide sequence) or processed (i.e., lacking the native signal peptide sequence) wild-type form of human alpha-N-acetylglucosaminidase, or a functional fragment or variant thereof, that is capable of reducing glycosaminoglycan (GAG) levels in mammalian lysosomes or that can rescue or ameliorate one or more MPS IIIB (Sanfilippo B Syndrome) symptoms. In one embodiment, a human Naglu enzyme that finds use herein comprises or consists of the amino acid sequence shown in
FIG. 1 (SEQ ID NO:1). - As used herein, the term “functional” as it relates to a lysosomal enzyme, a fusion protein comprising a lysosomal enzyme or fragment of either refers to a polypeptide having the capability of being taken up by mammalian lysosomes and having sufficient enzymatic activity to reduce storage material, i.e., glycosaminoglycan (GAG), in the mammalian lysosome.
- As used herein, the term “spacer” (also referred to as “linker”) refers to a peptide sequence located between two protein moieties in a fusion protein. A spacer is generally designed to be flexible or to interpose a structure, such as an alpha-helix, between the two protein moieties. A spacer can be of variable length, such as, for example, 10-50, 20-40, or 25-35 amino acids in length. Exemplary spacer sequences are disclosed in greater detail in this specification.
- As used herein, the terms “improve,” “increase” or “reduce,” or grammatical equivalents, indicate values that are relative to a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control individual (or multiple control individuals) in the absence of the treatment described herein. A “control individual” is an individual afflicted with the same form of lysosomal storage disease (e.g., MPS IIIB (Sanfilippo B Syndrome)) as the individual being treated, who is about the same age as the individual being treated (to ensure that the stages of the disease in the treated individual and the control individual(s) are comparable).
- As used herein, the terms “ameliorate”, “amelioration”, and grammatical equivalents thereof are meant the prevention, reduction or palliation of a state or disease symptom, the stabilization from decline of a state or disease symptom, or the improvement of a state or disease symptom of/in a subject. Amelioration includes, but does not require complete recovery or complete prevention of a disease condition. In some embodiments, amelioration includes reduction of accumulated materials inside lysosomes of relevant lysosomal storage disease tissues.
- As used herein, the terms “subject,” “individual” or “patient” refer to a human or a non-human mammalian subject. The individual (also referred to as “patient” or “subject”) being treated is an individual (fetus, infant, child, adolescent, or adult human) suffering from a lysosomal storage disease, e.g., MPS IIIB (Sanfilippo B Syndrome) (i.e., either infantile-, juvenile-, or adult-onset or severe/classical type or attenuated type MPS IIIB (Sanfilippo B Syndrome)) or having the potential to develop a lysosomal storage disease (e.g., MPS IIIB (Sanfilippo B Syndrome)).
- As used herein, the term “therapeutically effective amount” or “effective amount” refers to an amount of a targeted therapeutic fusion protein (or formulation comprising it) which confers a therapeutic effect on the treated subject, at a reasonable benefit/risk ratio applicable to any medical treatment. The therapeutic effect may be objective (i.e., measurable by some test or marker) or subjective (i.e., subject gives an indication of or feels an effect). In particular, the “therapeutically effective amount” refers to an amount of a therapeutic fusion protein or associated pharmaceutical composition effective to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease. A therapeutically effective amount is commonly administered in a dosing regimen that may comprise multiple unit doses. For any particular therapeutic fusion protein, a therapeutically effective amount (and/or an appropriate unit dose within an effective dosing regimen) may vary, for example, depending on route of administration, on combination with other pharmaceutical agents. Also, the specific therapeutically effective amount (and/or unit dose) for any particular patient may depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific pharmaceutical agent employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and/or rate of excretion or metabolism of the specific fusion protein employed; the duration of the treatment; and like factors as is well known in the medical arts.
- As used herein, the term “treatment” (also “treat” or “treating”) refers to any administration of a therapeutic fusion protein or pharmaceutical composition comprising said therapeutic fusion protein that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of a particular disease, disorder, and/or condition. Such treatment may be of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition.
- Alternatively or additionally, such treatment may be of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition. For example, treatment can refer to improvement of cardiac status (e.g., increase of end-diastolic and/or end-systolic volumes, or reduction, amelioration or prevention of the progressive cardiomyopathy that is typically found in, e.g., Pompe disease) or of pulmonary function (e.g., increase in crying vital capacity over baseline capacity, and/or normalization of oxygen desaturation during crying); improvement in neurodevelopment and/or motor skills (e.g., increase in AIMS score); reduction of storage (e.g., glycosaminoglycan (GAG)) levels in tissue of the individual affected by the disease; or any combination of these effects. In some embodiments, treatment includes improvement of GAG clearance, particularly in reduction or prevention of MPS IIIB (Sanfilippo B Syndrome)-associated neuronal symptoms.
- A “stable” or “stabilized” protein-containing formulation is one in which the protein component therein essentially retains its physical, functional and/or chemical stability upon storage over time. Stability can be measured at a selected temperature for a selected time period. Preferably, the formulation is stable at room temperature (about 30° C.) or at 40° C. for at least 1, 3, 6 or 12 months or more, stable at about 2-8° C. for at least 1, 3, 6, 12, 18, 24, 30, 36, 42 or 48 months or more, or stable at either −30° C., −40° C. or −60° C. for at least 1, 3, 6, 12, 18, 24, 30, 36, 42 or 48 months or more. In one aspect, the extent of protein degradation or aggregation during storage can be used as an indicator of protein stability. Thus, a “stable” formulation may be one wherein less than about 20%, more preferably less than about 10%, and most preferably less than about 5%, 4%, 3%, 2% or 1% of the protein component is present in a non-degraded or non-aggregated form in the formulation. “Stable” formulations retain essentially the same functional or therapeutic characteristics, or same physical and/or chemical integrity of the newly prepared formulation. Various analytical techniques for measuring protein stability are available in the art and are reviewed, for example, in Peptide and Protein Drug Delivery, 247-301, Vincent Lee Ed., Marcel Dekker, Inc., New York, N.Y., Pubs. (1991) and Jones, A. Adv. Drug Delivery Rev. 10: 29-90 (1993).
- By “isovolumetric” in relation to intrathecal administration of a pharmaceutical composition to the CSF of a subject is meant that prior to administration of a specified volume of the pharmaceutical composition, approximately the same volume of CSF is removed from the subject, thereby maintaining approximately the same volume of fluid in the CSF compartment of the subject being treated.
- As used in this application, the terms “about” and “approximately” are used as equivalents. Any numerals used in this application with or without about/approximately are meant to cover any normal fluctuations appreciated by one of ordinary skill in the relevant art.
- The present disclosure provides compositions, formulations and methods for efficient lysosomal targeting of therapeutic fusion proteins based on the GILT technology. Among other things, the present disclosure provides methods and compositions for targeting therapeutic lysosomal enzymes to lysosomes using lysosomal targeting peptides for the treatment of lysosomal storage disorders. The present disclosure also provides methods and compositions for targeting lysosomal enzymes to lysosomes using a lysosomal targeting peptide that has reduced or diminished binding affinity for the IGF-I receptor and/or reduced or diminished binding affinity for the insulin receptor, and/or is resistant to furin cleavage. The present disclosure also provides targeted lysosomal enzyme fusion proteins comprising a lysosomal enzyme and IGF-II and spacer peptides that provide for improved production and uptake into lysosomes of the lysosomal enzyme fusion protein. The present disclosure also provides formulations that comprise a targeted lysosomal enzyme fusion protein and use thereof for the treatment or prevention of a lysosomal storage disease.
- Various aspects of the disclosure are described in detail in the following sections. The use of sections is not meant to limit the disclosure. Each section can apply to any aspect of the disclosure. In this application, the use of “or” means “and/or” unless stated otherwise.
- A lysosomal enzyme suitable for incorporation into the therapeutic fusion proteins or formulations of the disclosure includes any enzyme that is capable of reducing accumulated materials in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms. Suitable lysosomal enzymes include both wild-type or modified lysosomal enzymes (and functional fragments thereof) and can be produced using recombinant or synthetic methods or purified from natural sources. Exemplary lysosomal enzymes are listed in Table 1.
-
TABLE 1 Lysosomal Storage Diseases and Associated Lysosomal Storage Diseases Disease Name Enzyme Defect Substance Stored A. Glycogenosis Disorders Pompe Disease Acid-αl, 4-Glucosidase Glycogen αl-4 linked oligosaccharides B. Glycolipidosis Disorders GM1 Gangliodsidosis β-Galactosidase GM1 gangliosides Tay-Sachs Disease β-Hexosaminidase A GM2 ganglioside GM2 Gangliosidosis: AB GM2 Activator Protein GM2 ganglioside Variant Sandhoff Disease β-Hexosaminidase A&B GM2 ganglioside Fabry Disease α-Galactosidase A Globosides Gaucher Disease Glucocerebrosidase Glucosylceramide Metachromatic Arylsulfatase A Sulphatides Leukodystrophy Krabbe Disease Galactosylceramidase Galactocerebroside Niemann-Pick, Types A & B Acid Sphingomyelinase Sphingomyelin (SM) Niemann-Pick, Type C Cholesterol Esterification SM Defect Niemann-Pick, Type D Unknown SM Farber Disease Acid Ceramidase Ceramide Wolman Disease Acid Lipase Cholesteryl esters C. Mucopolysaccharide Disorders Hurler Syndrome (MPS IH) α-L-Iduronidase Heparan sulfate (HS) & Dermatan sulfate (DS) Scheie Syndrome (MPS IS) α-L-Iduronidase HS & DS Hurler-Scheie (MPS IH/S) α-L-Iduronidase HS & DS Hunter Syndrome (MPS II) Iduronate Sulfatase HS & DS Sanfilippo A (MPS IIIA) Heparan N-Sulfatase HS Sanfilippo B (MPS IIIB) α-N-Acetylglucosaminidase HS Sanfilippo C (MPS IIIC) Acetyl-CoA-Glucosaminide HS Acetyltransferase Sanfilippo D (MPS IIID) N-Acetylglucosamine-6- HS Sulfatase Morquio A (MPS IVA) Galactosamine-6-Sulfatase Keratan sulfate (KS) Morquio B (MPS IVB) β-Galactosidase KS Maroteaux-Lamy (MPS VI) Arylsulfatase B DS Sly Syndrome (MPS VII) β-Glucuronidase DS, HS & chondroitin sulfate D. Oligosaccharide/Glycoprotein Disorders α-Mannosidosis α-Mannosidase Mannose/Oligosaccharides β-Mannosidosis β-Mannosidase Mannose/Oligosaccharides Fucosidosis α-L-Fucosidase Fucosyl Oligosaccharides Aspartylglucosaminuria N-Aspartyl-β- Aspartylglucosamine Glucosaminidase Asparagines Sialidosis (Mucolipidosis I) α-Neuraminidase Sialyloligosaccharides Galactosialidosis (Goldberg Lysosomal Protective Protein Sialyloligosaccharides Syndrome) Deficiency Schindler Disease α-N-Acetyl- Various Galactosaminidase E. Lysosomal Enzyme Transport Disorders Mucolipidosis II (I-Cell N-Acetylglucosamine-1- HS Disease) Phosphotransferase Mucolipidosis III (Pseudo- Same as ML II HS Hurler Polydystrophv) F. Lysosomal Membrane Transport Disorders Cystinosis Cystine Transport Protein Free cystine Salla Disease Sialic Acid Transport Protein Free sialic acid and glucuronic acid Infantile Sialic Acid Storage Sialic Acid Transport Protein Free sialic acid and glucuronic Disease acid G. Other Batten Disease Unknown Lipofuscins Infantile Neuronal Ceroid Palmitoyl-Protein Thioesterase Lipofuscins Lipofuscinosis Late Infantile Neuronal Tripeptidyl Peptidase I Lipofuscins Ceroid Lipofuscinosis Mucolipidosis IV Unknown Gangliosides & Hyaluronic Acid Prosaposin Saposins A, B, C or D - In some embodiments, a lysosomal enzyme contemplated herein has an amino acid sequence having from about 90% to about 100%, including 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and 100%, sequence identity to the naturally-occurring amino acid sequence of a human enzyme shown in Table 1, or the mature form thereof, while still encoding a protein that is functional, i.e., capable of reducing accumulated materials, e.g., GAG, in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms. Sequences of the above enzymes are known to those of skill in the art and are available through public databases, such as the National Center for Biotechnology Information maintained by the U.S. National Library of Medicine.
- “Percent (%) amino acid sequence identity” with respect to subject and reference amino acid sequences is defined as the percentage of amino acid residues in a subject sequence that are identical with the amino acid residues in the associated reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. Preferably, the WU-BLAST-2 software is used to determine amino acid sequence identity (Altschul et al., Methods in Enzymology 266, 460-480 (1996). WU-BLAST-2 uses several search parameters, most of which are set to the default values. The adjustable parameters are set with the following values: overlap span=1, overlap fraction=0.125, world threshold (T)=11. HSP score (S) and HSP S2 parameters are dynamic values and are established by the program itself, depending upon the composition of the particular sequence, however, the minimum values may be adjusted and are set as indicated above. In other embodiments, % sequence identity between two nucleic acid or amino acid sequences can be determined using the Needle (EMBOSS) or Stretcher (EMBOSS) global sequence alignment tools available at http://www.ebi.ac.uk/Tools/psa/ using the default parameters incorporated therein (incorporated in their entirety by reference herein).
- Alpha-N-acetylglucosaminidase, Naglu, is produced as a precursor molecule that is processed to a mature form. This process generally occurs by removing the 23 amino acid signal peptide as the protein enters the endoplasmic reticulum. Typically, the precursor form is also referred to as full-length precursor or full-length Naglu protein, which contains 743 amino acids. The N-terminal 23 amino acids are cleaved as the precursor protein enters the endoplasmic reticulum, resulting in a processed or mature form. Thus, it is contemplated that the N-terminal 23 amino acids of the native full-length human Naglu protein are generally not required for the Naglu protein activity. The amino acid sequence of the mature form of the human Naglu protein is shown in
FIG. 1 and set out in SEQ ID NO:1. The mRNA sequence of human Naglu is described in Genbank Accession number NM_000263. In various embodiments of the present disclosure, the Naglu is human Naglu, with (amino acids 1-743) or without (amino acids 24-743) the associated signal sequence. In a preferred embodiment, the Naglu lysosomal enzyme incorporated in a therapeutic fusion protein has the amino acid sequence shown inFIG. 1 (SEQ ID NO:1). In a particularly preferred embodiment, the Naglu-containing fusion protein has the amino acid sequence shown inFIG. 2 (SEQ ID NO:5). In other embodiments, the fusion protein contains a functional fragment of the mature human Naglu protein, wherein the fragment is generally at least 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650 or 700 or more amino acids in length. - One exemplary lysosomal storage disease is Mucopolysaccharidosis III B (MPS IIIB) disease, also known as Sanfilippo Type B Syndrome. MPS IIIB, Sanfilippo B Syndrome, is a rare autosomal recessive genetic disorder that is characterized by a deficiency of the enzyme alpha-N-acetyl-glucosaminidase (Naglu). In the absence of this enzyme, glycosaminoglycans (GAG), for example the GAG heparan sulfate, and partially degraded GAG molecules cannot be cleared from the body and accumulate in lysosomes of various tissues, resulting in progressive widespread somatic dysfunction (Kakkis et al., N Engl J Med. 344(3):182-8 (2001)). It has been shown that GAGs accumulate in lysosomes of neurons and glial cells, with lesser accumulation outside the brain.
- Four distinct forms of MPS III, designated MPS IIIA, B, C, and D, have been identified. Each represents a deficiency in one of four enzymes involved in the degradation of the GAG heparan sulfate. All forms include varying degrees of the same clinical symptoms, including coarse facial features, hepatosplenomegaly, corneal clouding and skeletal deformities. Most notably, however, is the severe and progressive loss of cognitive ability, which is tied not only to the accumulation of heparan sulfate in neurons, but also the subsequent elevation of the gangliosides GM2, GM3 and GD2 caused by primary GAG accumulation (Walkley et al., Ann N Y Acad Sci. 845:188-99 (1998)).
- A characteristic clinical feature of Sanfilippo B Syndrome is central nervous system (CNS) degeneration, which results in loss of, or failure to attain, major developmental milestones. The progressive cognitive decline culminates in dementia and premature mortality. The disease typically manifests itself in young children, and the lifespan of an affected individual generally does not extend beyond late teens to early twenties.
- MPS III diseases all have similar symptoms that typically manifest in young children. Affected infants are apparently normal, although some mild facial dysmorphism may be noticeable. The stiff joints, hirsuteness and coarse hair typical of other mucopolysaccharidoses are usually not present until late in the disease. After an initial symptom-free interval, patients usually present with a slowing of development and/or behavioral problems, followed by progressive intellectual decline resulting in severe dementia and progressive motor disease. Acquisition of speech is often slow and incomplete. The disease progresses to increasing behavioral disturbance including temper tantrums, hyperactivity, destructiveness, aggressive behavior, pica and sleep disturbance. As affected children have normal muscle strength and mobility, the behavioral disturbances are very difficult to manage. In the final phase of the illness, children become increasingly immobile and unresponsive, often require wheelchairs, and develop swallowing difficulties and seizures. The life-span of an affected child does not usually extend beyond late teens to early twenties.
- An alpha-N-acetylglucosaminidase enzyme suitable for treating MPS IIIB (Sanfilippo B Syndrome) includes a wild-type human alpha-N-acetylglucosaminidase, a functional fragment or sequence variant thereof which retains the ability to be taken up into mammalian lysosomes and to hydrolyze alpha, 1,4 linkages at the terminal N-acetyl-D-glucosamine residue in linear oligosaccharides or a targeted therapeutic fusion protein that comprises the wild-type human Naglu enzyme or functional fragment thereof. In particular embodiments, proteins comprising or consisting of the amino acid sequences of SEQ ID NO:1 or SEQ ID NO:5 will find use for the treatment of MPS IIIB.
- Efficacy of treatment of MPS IIIB using targeted therapeutic fusion proteins as described herein can be measured using techniques known in the art, as well as by analysis of lysosomal and neuronal biomarkers. Initial experiments are conducted on Naglu knock-out animals (see Li et al., Proc Nall Acad Sci USA 96:14505-510 (1999)). Naglu knockouts present with large amounts of heparan sulfate in the liver and kidney and elevation of gangliosides in the brain.
- Assays include analysis of the activity of and biodistribution of the exogenous enzyme, reduction of GAG storage in the lysosomes, particularly in brain cells, and activation of astrocytes and microglia. Levels of various lysosomal or neuronal biomarkers include, but are not limited to, Lysosomal-associated membrane protein 1 (LAMP1), glypican, gangliosides, cholesterol, Subunit c of Mitochondrial ATP Synthase (SCMAS), ubiquitin, P-GSK3b, beta amyloid and P-tau. Survival and behavioral analysis is also performed using techniques known in the field.
- In various embodiments, treatment of a lysosomal storage disease refers to decreased lysosomal storage (e.g., of GAG) in various tissues. In various embodiments, treatment refers to decreased lysosomal storage in brain target tissues, spinal cord neurons, and/or peripheral target tissues. In certain embodiments, lysosomal storage is decreased by about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100% or more as compared to an untreated control subject. In various embodiments, lysosomal storage is decreased by at least 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold or more as compared to a control subject.
- In various embodiments, treatment refers to increased enzyme activity in various tissues. In various embodiments, treatment refers to increased enzyme activity in brain target tissues, spinal cord neurons and/or peripheral target tissues. In various embodiments, enzyme activity is increased by about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 200%, 300%, 400%, 500%, 600%, 700%, 800%, 900%, 1000% or more as compared to a control. In various embodiments, enzyme activity is increased by at least 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold or more as compared to a control. In various embodiments, increased enzymatic activity is at least approximately 10 nmol/hr/mg, 20 nmol/hr/mg, 40 nmol/hr/mg, 50 nmol/hr/mg, 60 nmol/hr/mg, 70 nmol/hr/mg, 80 nmol/hr/mg, 90 nmol/hr/mg, 100 nmol/hr/mg, 150 nmol/hr/mg, 200 nmol/hr/mg, 250 nmol/hr/mg, 300 nmol/hr/mg, 350 nmol/hr/mg, 400 nmol/hr/mg, 450 nmol/hr/mg, 500 nmol/hr/mg, 550 nmol/hr/mg, 600 nmol/hr/mg or more. In various embodiments, the lysosomal enzyme is Naglu.
- Enzyme Replacement Therapy
- Enzyme replacement therapy (ERT) is a therapeutic strategy to correct an enzyme deficiency by infusing the missing enzyme into the bloodstream or other body tissue of the patient. As the blood perfuses patient tissues, enzyme is taken up by cells and transported to the lysosome, where the enzyme acts to eliminate material that has accumulated in the lysosomes due to the enzyme deficiency. For lysosomal enzyme replacement therapy to be effective, the therapeutic enzyme must be delivered to lysosomes in the appropriate cells in tissues where the storage defect is manifest. Conventional lysosomal enzyme replacement therapeutics are delivered using carbohydrates naturally attached to the protein to engage specific receptors on the surface of the target cells. One receptor, the cation-independent M6P receptor (CI-MPR), is particularly useful for targeting replacement lysosomal enzymes because the CI-MPR is present on the surface of most cell types.
- The terms “cation-independent mannose-6-phosphate receptor (CI-MPR),” “M6P/IGF-II receptor,” “CI-MPR/IGF-II receptor,” “IGF-II receptor” or “IGF2 Receptor,” or abbreviations thereof, are used interchangeably herein, referring to the cellular receptor which binds both M6P and IGF-II.
- Glycosylation Independent Lysosomal Targeting (GILT) technology was developed to target therapeutic enzymes to lysosomes. Specifically, the GILT technology uses a peptide tag instead of M6P to engage the CI-MPR for lysosomal targeting. Typically, a GILT tag is a protein, peptide, or other moiety that binds the CI-MPR in a mannose-6-phosphate-independent manner. Advantageously, this technology mimics the normal biological mechanism for uptake of lysosomal enzymes, yet does so in a manner independent of mannose-6-phosphate.
- A preferred GILT tag is derived from human insulin-like growth factor II (IGF-II). Human IGF-II is a high affinity ligand for the CI-MPR, which is also referred to as IGF-II receptor. Binding of GILT-tagged therapeutic enzymes to the M6P/IGF-II receptor targets the protein to the lysosome via the endocytic pathway. This method has numerous advantages over methods involving glycosylation including simplicity and cost effectiveness, because once the protein is isolated, no further modifications need be made.
- Detailed description of the GILT technology and GILT tags can be found in U.S. Application Publication Nos. 2003-0082176, 2004-0006008, 2003-0072761, 2005-0281805, 2005-0244400, U.S. Pat. Nos. 8,492,337 and 8,563,691, and International Publications WO 03/032913, WO 03/032727, WO 02/087510, WO 03/102583, WO 2005/078077, WO 2009/137721 and WO 2014/085621, the disclosures of all of which are hereby incorporated by reference.
- In various embodiments, the GILT tag is a furin-resistant GILT tag having the amino acid sequence shown herein as SEQ ID NO:3 (see, e.g., U.S. Pat. No. 8,563,691).
- Many IGF-II muteins, including furin-resistant IGF-II muteins, have reduced or diminished binding affinity for the insulin receptor. Thus, in some embodiments, a peptide tag suitable for the disclosure has reduced or diminished binding affinity for the insulin receptor relative to the affinity of naturally-occurring human IGF-II for the insulin receptor. In some embodiments, peptide tags with reduced or diminished binding affinity for the insulin receptor suitable for the disclosure include peptide tags having a binding affinity for the insulin receptor that is more than 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 12-fold, 14-fold, 16-fold, 18-fold, 20-fold, 30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, or 100-fold less than that of the wild-type mature human IGF-II. The binding affinity for the insulin receptor can be measured using various in vitro and in vivo assays known in the art.
- In accordance of the disclosure, a therapeutic fusion protein of the disclosure is typically administered to the individual alone, or in compositions or medicaments comprising the therapeutic protein (e.g., in the manufacture of a medicament for the treatment of the disease), as described herein. The compositions can be formulated with one or more physiologically acceptable carriers or excipients to prepare a pharmaceutical composition. The carriers and compositions can be sterile. The formulation should suit the mode of administration.
- Suitable pharmaceutically acceptable carriers include but are not limited to water, salt solutions (e.g., NaCl), saline, buffered saline, alcohols, glycerol, ethanol, gum arabic, vegetable oils, benzyl alcohols, polyethylene glycols, gelatin, carbohydrates such as lactose, amylose or starch, sugars such as mannitol, sucrose, or others, dextrose, magnesium stearate, talc, silicic acid, viscous paraffin, perfume oil, fatty acid esters, hydroxymethylcellulose, polyvinyl pyrolidone, etc., as well as combinations thereof. The pharmaceutical preparations can, if desired, be mixed with auxiliary agents (e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, flavoring and/or aromatic substances and the like) which do not deleteriously react with the active compounds or interference with their activity.
- The composition or medicament, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. The composition can be a liquid solution, suspension, emulsion, tablet, pill, capsule, sustained release formulation, or powder. The composition can also be formulated as a suppository, with traditional binders and carriers such as triglycerides. Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, polyvinyl pyrollidone, sodium saccharine, cellulose, magnesium carbonate, etc.
- Generally, the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampule or sachette indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water, saline or dextrose/water. Where the composition is administered by injection, an ampule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
- The therapeutic protein can be formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
- A therapeutic protein (or a composition or medicament containing a therapeutic protein) is administered by any appropriate route. In various embodiments, a therapeutic protein is administered intravenously. In other embodiments, a therapeutic protein is administered by direct administration to a target tissue, such as heart or muscle (e.g., intramuscular), or nervous system (e.g., direct injection into the brain, CNS, CSF; intracerebroventricularly; intrathecally). In various embodiments, a therapeutic protein is administered intrathecally. Methods for the intrathecal administration of therapeutic fusion proteins are known in the art (see, e.g., U.S. Pat. Nos. 7,442,372 and 9,044,473). Alternatively, a therapeutic protein (or a composition or medicament containing a therapeutic protein) can be administered parenterally, transdermally, or transmucosally (e.g., orally or nasally). More than one route can be used concurrently, if desired, e.g., a therapeutic protein is administered intravenously and intrathecally. Concurrent intravenous and intrathecal administration need not be simultaneous, but can be sequential.
- A therapeutic protein (or a composition or medicament containing a therapeutic protein) can be administered alone, or in conjunction with other agents, such as antihistamines (e.g., diphenhydramine) or immunosuppressants or other immunotherapeutic agents which counteract anti-GILT-tagged lysosomal enzyme antibodies. The term, “in conjunction with,” indicates that the agent is administered prior to, at about the same time as, or following the therapeutic protein (or a composition or medicament containing the therapeutic protein). For example, the agent can be mixed into a composition containing the therapeutic protein, and thereby administered contemporaneously with the therapeutic protein; alternatively, the agent can be administered contemporaneously, without mixing (e.g., by “piggybacking” delivery of the agent on the intravenous line by which the therapeutic protein is also administered, or vice versa). In another example, the agent can be administered separately (e.g., not admixed), but within a short time frame (e.g., within 24 hours) of administration of the therapeutic protein.
- The therapeutic protein (or composition or medicament containing the therapeutic protein) is administered in a therapeutically effective amount (i.e., a dosage amount that, when administered at regular intervals, is sufficient to treat the disease, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease, as described above). The dose which will be therapeutically effective for the treatment of the disease will depend on the nature and extent of the disease's effects, and can be determined by standard clinical techniques. In addition, in vitro or in vivo assays may optionally be employed to help identify optimal dosage ranges using methods known in the art. The precise dose to be employed will also depend on the route of administration, and the seriousness of the disease, and should be decided according to the judgment of a practitioner and each patient's circumstances. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems. In various embodiments, the therapeutically effective dosage amount can be, for example, about 0.1-1 mg/kg, about 1-5 mg/kg, about 2.5-20 mg/kg, about 5-20 mg/kg, about 20-50 mg/kg, or about 20-100 mg/kg or about 50-200 mg/kg, or about 2.5 to 20 mg/kg of body weight. The effective dose for a particular individual can be varied (e.g., increased or decreased) over time, depending on the needs of the individual. For example, in times of physical illness or stress, or if disease symptoms worsen, the dosage amount can be increased.
- The therapeutically effective amount of the therapeutic protein (or composition or medicament containing the therapeutic protein) is administered at regular intervals, depending on the nature and extent of the disease's effects, and on an ongoing basis.
- Administration at an “interval,” as used herein, indicates that the therapeutically effective amount is administered periodically (as distinguished from a one-time dose). The interval can be determined by standard clinical techniques. In some embodiments, the therapeutic protein is administered bimonthly, monthly, twice monthly, triweekly, biweekly, weekly, twice weekly, thrice weekly, or daily. The administration interval for a single individual need not be a fixed interval, but can be varied over time, depending on the needs of the individual. For example, in times of physical illness or stress, or if disease symptoms worsen, the interval between doses can be decreased.
- As used herein, the term “bimonthly” means administration once per two months (i.e., once every two months); the term “monthly” means administration once per month; the term “triweekly” means administration once per three weeks (i.e., once every three weeks); the term “biweekly” means administration once per two weeks (i.e., once every two weeks); the term “weekly” means administration once per week; and the term “daily” means administration once per day.
- The disclosure additionally pertains to a pharmaceutical composition comprising a therapeutic protein, as described herein, in a container (e.g., a vial, bottle, bag for intravenous administration, syringe, etc.) with a label containing instructions for administration of the composition for treatment of Mucopolysaccharidosis Type TIM (Sanfilippo B Syndrome), such as by the methods described herein.
- In certain embodiments, the present disclosure is directed to formulations comprising a lysosomal enzyme, a targeted therapeutic lysosomal enzyme fusion protein or a functional fragment thereof. In some embodiments, such formulations are liquid formulations, preferably liquid formulations appropriate for intrathecal administration. In other embodiments, the formulation may be a lyophilized formulation or may be a liquid formulation that was reconstituted from a previously lyophilized formulation.
- In various embodiments, the formulations of the present disclosure comprise a lysosomal enzyme, a targeted therapeutic lysosomal enzyme fusion protein or a functional fragment thereof in a concentration range of from about 0.1 mg/ml to about 300 mg/ml, or from about 1 mg/ml to about 75 mg/ml, or from about 5 mg/ml to about 50 mg/ml, or from about 10 mg/ml to about 40 mg/ml, or from about 20 mg/ml to about 40 mg/ml, or from about 25 mg/ml to about 35 mg/ml. In certain embodiments, the lysosomal enzyme, fusion protein or fragment thereof may be present at or up to a concentration of about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200, 250 or 300 mg/ml or greater. In various embodiments, the formulations of the present disclosure comprise a lysosomal enzyme, a targeted therapeutic lysosomal enzyme fusion protein or a functional fragment thereof at a concentration of about 30 mg/ml. In various embodiments, the lysosomal enzyme, targeted therapeutic lysosomal enzyme fusion protein or functional fragment thereof has at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater sequence identity to the amino acid sequence shown in
FIG. 2 (SEQ ID NO:5). More preferably, the lysosomal enzyme, targeted therapeutic lysosomal enzyme fusion protein or functional fragment thereof is BMN001 having the amino acid sequence shown inFIG. 2 (SEQ ID NO:5). - In further embodiments, the formulations of the present disclosure comprise one or more buffering agents useful for maintaining the pH of the formulation within a desired range. In preferred embodiments, the pH of the liquid formulations of the present disclosure is within the range of from about 5.0 to about 9.0, or from about 5.5 to about 8.5, or from about 6.0 to about 8.0, or from about 6.5 to about 7.5, or from about 6.8 to about 7.2. More preferably, the pH of the liquid formulations of the present disclosure is about 7.0. Various buffering agents and their use in protein-containing formulations are well known in the art and non-limiting examples of buffering agents that find use in the liquid formulations of the present disclosure include, for example, sodium acetate, citric acid monohydrate, sodium citrate dihydrate, sodium phosphate monobasic monohydrate and sodium phosphate dibasic heptahydrate, and the like.
- When employed in the formulations of the present disclosure, the concentration of sodium phosphate monobasic monohydrate preferably ranges from about 0.005 mg/ml to about 0.1 mg/ml, or from about 0.01 mg/ml to about 0.1 mg/ml, or from about 0.02 mg/ml to about 0.08 mg/ml, or from about 0.03 mg/ml to about 0.05 mg/ml. In a particularly preferred embodiment, the concentration of sodium phosphate monobasic monohydrate is about 0.04 mg/ml.
- When employed in the formulations of the present disclosure, the concentration of sodium phosphate dibasic heptahydrate preferably ranges from about 0.005 mg/ml to about 0.5 mg/ml, or from about 0.01 mg/ml to about 0.5 mg/ml, or from about 0.05 mg/ml to about 0.4 mg/ml, or from about 0.1 mg/ml to about 0.4 mg/ml, or from about 0.15 mg/ml to about 0.25 mg/ml. In a particularly preferred embodiment, the concentration of sodium phosphate dibasic heptahydrate is about 0.19 mg/ml.
- In further embodiments, the formulations of the present disclosure comprise one or more isotonicity agents useful for maintaining a desired tonicity and rendering the formulation more compatible for administration, particularly intrathecal administration, to a subject. Various isotonicity agents and their use in protein-containing formulations are well known in the art and non-limiting examples of isotonicity agents that find use in the liquid formulations of the present disclosure include, for example, sodium chloride, trehalose, mannitol, dextrose, glucose, glycerin, sorbitol, xylitol, ethanol, and the like. In particular embodiments, trehalose is used in ranges from about 3% (w/v) to about 10% (w/v), or from about 3% (w/v) to about 5% (w/v) or from about 7% (w/v) to about 9% (w/v). In a preferred embodiment, trehalose is used at about 8% (w/v). In yet another preferred embodiment, trehalose is used at about 4% (w/v).
- In various embodiments, the formulations contain an anti-adsorbent agent (e.g., to mitigate adsorption of a protein component to glass or plastic and to reduce the formation of aggregates and multimers). Anti-adsorbent agents include without limitation benzyl alcohol,
Polysorbate 20, andPolysorbate 80. In certain embodiments, the anti-adsorbent is in a concentration from about 0.001% to about 0.5%, or from about 0.01% to about 0.5%, or from about 0.1% to about 1%, or from about 0.5% to about 1%, or from about 0.5% to about 1.5%, or from about 0.5% to about 2%, or from about 1% to about 2%. In some embodiments the anti-adsorbent agent isPolysorbate 20 in a range from about 0.004% to about 0.006%. In a preferred embodiment,Polysorbate 20 is used at 0.005%. - When employed in the formulations of the present disclosure, the concentration of sodium chloride preferably ranges from about 0.5 mg/ml to about 20 mg/ml, or from about 2 mg/ml to about 15 mg/ml, or from about 5 mg/ml to about 10 mg/ml, or from about 7 mg/ml to about 10 mg/ml, or from about 8 mg/ml to about 9 mg/ml. In a preferred embodiment, the concentration of sodium chloride is about 0.88 mg/ml. In another preferred embodiment, the concentration of sodium chloride is about 5 mg/ml.
- In further embodiments, the formulations of the present disclosure comprise one or more electrolyte agents useful for maintaining the level of key electrolyte(s) in the cerebrospinal fluid (CSF) of the subject or for mimicking the natural composition of human CSF. Various electrolyte agents and their use in protein-containing formulations are well known in the art and non-limiting examples of electrolyte agents that find use in the liquid formulations of the present disclosure include, for example, potassium chloride, magnesium chloride, magnesium chloride hexahydrate, calcium chloride, calcium chloride dihydrate, and the like.
- When employed in the formulations of the present disclosure, the concentration of potassium chloride preferably ranges from about 0.01 mg/ml to about 1 mg/ml, or from about 0.1 mg/ml to about 0.5 mg/ml, or from about 0.2 mg/ml to about 0.8 mg/ml, or from about 0.15 mg/ml to about 0.4 mg/ml, or from about 0.15 mg/ml to about 0.3 mg/ml. In a preferred embodiment, the concentration of potassium chloride is about 0.22 mg/ml.
- When employed in the formulations of the present disclosure, the concentration of magnesium chloride hexahydrate preferably ranges from about 0.01 mg/ml to about 1 mg/ml, or from about 0.1 mg/ml to about 0.8 mg/ml, or from about 0.1 mg/ml to about 0.5 mg/ml, or from about 0.1 mg/ml to about 0.3 mg/ml, or from about 0.1 mg/ml to about 0.2 mg/ml. In a preferred embodiment, the concentration of magnesium chloride hexahydrate is about 0.16 mg/ml.
- When employed in the formulations of the present disclosure, the concentration of calcium chloride dihydrate preferably ranges from about 0.01 mg/ml to about 1 mg/ml, or from about 0.1 mg/ml to about 0.8 mg/ml, or from about 0.1 mg/ml to about 0.5 mg/ml, or from about 0.15 mg/ml to about 0.4 mg/ml, or from about 0.15 mg/ml to about 0.3 mg/ml. In a preferred embodiment, the concentration of calcium chloride dihydrate is about 0.21 mg/ml.
- In a preferred embodiment, the formulation of the present disclosure is a liquid formulation that comprises the BMN001 targeted therapeutic fusion protein, one or more buffering agents, one or more isotonicity agents and one or more electrolyte agents. More preferably, the liquid formulation comprises BMN001, sodium phosphate dibasic heptahydrate, sodium phosphate monobasic monohydrate, sodium chloride, and trehalose. In one embodiment, the liquid formulation comprises BMN001 at a concentration of from about 25 mg/ml to about 35 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of from about 0.15 to about 0.25 mg/ml, sodium phosphate monobasic monohydrate at a concentration of from about 0.02 mg/ml to about 0.06 mg/ml, sodium chloride at a concentration of from about 0.8 mg/ml to about 1 mg/ml, and trehalose at about 7% (w/v) to about 9% (w/v). In one preferred embodiment, the liquid formulation comprises BMN001 at a concentration of about 30 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of about 0.19 mg/ml, sodium phosphate monobasic monohydrate at a concentration of about 0.04 mg/ml, sodium chloride at a concentration of about 0.88 mg/ml, and trehalose at about 8% (w/v). Preferably, the liquid formulation is at about pH 7.0.
- In another preferred embodiment, the formulation of the present disclosure is a liquid formulation that comprises the BMN001 targeted therapeutic fusion protein, one or more buffering agents, one or more isotonicity agents and one or more electrolyte agents. More preferably, the liquid formulation comprises BMN001, sodium phosphate dibasic heptahydrate, sodium phosphate monobasic monohydrate, sodium chloride, trehalose, and
polysorbate 20. In one embodiment, the liquid formulation comprises BMN001 at a concentration of from about 25 mg/ml to about 35 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of from about 0.15 to about 0.25 mg/ml, sodium phosphate monobasic monohydrate at a concentration of from about 0.02 mg/ml to about 0.06 mg/ml, sodium chloride at a concentration of from about 4.5 mg/ml to about 5.5 mg/ml, trehalose at about 3% (w/v) to about 5% (w/v), andpolysorbate 20 at about 0.004% to about 0.006%. In one preferred embodiment, the liquid formulation comprises BMN001 at a concentration of about 30 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of about 0.19 mg/ml, sodium phosphate monobasic monohydrate at a concentration of about 0.04 mg/ml, sodium chloride at a concentration of about 5 mg/ml, trehalose at about 4% (w/v), andpolysorbate 20 at about 0.005%. Preferably, the liquid formulation is at about pH 7.0. - In various embodiments, the formulations may comprise a preservative. Preservatives include, but are not limited to, m-cresol and benzyl alcohol. In certain embodiments, the preservative is in a concentration of about 0.4%±0.2%, or about 1%±0.5%, or about 1.5%±0.5%, or about 2.0%±0.5%. In certain embodiments of the disclosure, the formulation does not contain a preservative.
- In various embodiments, the formulations comprise a stabilizer. Non-limiting examples of stabilizers include glycerin, glycerol, thioglycerol, methionine, and ascorbic acid and salts thereof. In some embodiments, when the stabilizer is thioglycerol or ascorbic acid or a salt thereof, the stabilizer is in a concentration from about 0.1% to about 1%. In other embodiments, when the stabilizer is methionine, the stabilizer is in a concentration from about 0.01% to about 0.5%, or from about 0.01% to about 0.2%. In still other embodiments, when the stabilizer is glycerin, the stabilizer is in a concentration from about 5% to about 100% (neat).
- In various embodiments, the compositions contain an antioxidant. Exemplary anti-oxidants include without limitation methionine and ascorbic acid. In certain embodiments, the molar ratio of antioxidant to protein is from about 0.1:1 to about 15:1, or from about 1:1 to about 15:1, or from about 0.5:1 to about 10:1, or from about 1:1 to about 10:1 or from about 3:1 to about 10:1.
- Pharmaceutically acceptable salts can be used in the formulations, including without limitation mineral acid salts (e.g., hydrochloride, hydrobromide, phosphate, sulfate), salts of organic acids (e.g., acetate, propionate, malonate, benzoate, mesylate, tosylate), and salts of amines (e.g., isopropylamine, trimethylamine, dicyclohexylamine, diethanolamine). A thorough discussion of pharmaceutically acceptable salts is found in Remington's Pharmaceutical Sciences, 18th Edition, Mack Publishing Company, (Easton, Pa. (1990)).
- Examples of other formulary additives and compositions useful for intrathecal or ICV delivery are described in WO2013/096899, which is herein incorporated by reference.
- The formulations of the present disclosure are stable and can be stored for extended periods of time without an unacceptable change in quality, potency, or purity. In one aspect, the formulation is stable at a temperature of about 5° C. (e.g., 2° C. to 8° C.) for at least 1 month, for example, at least 1 month, at least 3 months, at least 6 months, at least 12 months, at least 18 months, at least 24 months, or more. In another aspect, the formulation is stable at a temperature of less than or equal to about −20° C. for at least 6 months, for example, at least 6 months, at least 12 months, at least 18 months, at least 24 months, at least 36 months, or more. In another aspect, the formulation is stable at a temperature of less than or equal to about −40° C. for at least 6 months, for example, at least 6 months, at least 12 months, at least 18 months, at least 24 months, at least 36 months, or more. In another aspect, the formulation is stable at a temperature of less than or equal to about −60° C. for at least 6 months, for example, at least 6 months, at least 12 months, at least 18 months, at least 24 months, at least 36 months, or more.
- Suitable formulations of the present disclosure include, liquid, lyophilized or reconstituted lyophilized formulations. In various aspects, the formulations of the present disclosure are contained within a container, which in one aspect, may comprise a single dosage form of the formulation. Exemplary containers include, for example, ampules, vials, bottles, cartridges, reservoirs and pre-filled syringes.
- In various embodiments, the enzyme, enzyme fusion protein or formulation comprising the same is administered by direct introduction into the central nervous system of the subject, e.g., into the cerebrospinal fluid of the subject. In certain aspects of the disclosure, the enzyme is introduced intrathecally, e.g., into the lumbar area, or the cisterna magna or intraventricularly (or intracerebroventricularly (ICV)) into a cerebral ventricle space. Methods of administering a lysosomal enzyme or fusion protein comprising a functional lysosomal enzyme intrathecally or intracerebroventricularly are described in U.S. Pat. Nos. 7,442,372, 9,044,473 and 9,089,566, incorporated herein by reference in their entirety.
- Those of skill in the art are aware of devices that may be used to effect intrathecal administration of a therapeutic composition. For example, the therapy may be given using an Ommaya reservoir which is in common use for intrathecally administering drugs for meningeal carcinomatosis (Ommaya et al., Lancet 2: 983-84 (1963)). More specifically, in this method, a ventricular tube is inserted through a hole formed in the anterior horn and is connected to an Ommaya reservoir installed under the scalp, and the reservoir is subcutaneously punctured to intrathecally deliver the particular enzyme being replaced, which is injected into the reservoir. Other devices for intrathecal administration of therapeutic compositions to an individual are described in U.S. Pat. No. 6,217,552, incorporated herein by reference. Alternatively, the composition may be intrathecally given, for example, by a single injection, or continuous infusion. It should be understood that the dosage treatment may be in the form of a single dose administration or multiple doses.
- As used herein, the term “intrathecal administration” is intended to include delivering a pharmaceutical composition directly into the cerebrospinal fluid of a subject, by techniques including lateral cerebroventricular injection (i.e., intracerebroventricularly) through a burr hole or cisternal or lumbar puncture, or the like (described in Lazorthes et al. Advances in Drug Delivery Systems and Applications in Neurosurgery, 143-192 (1991) and Ommaya et al., Cancer Drug Delivery 1:169-179 (1984), the contents of which are incorporated herein by reference). The term “lumbar region” is intended to include the area between the third and fourth lumbar (lower hack) vertebrae and, more inclusively, the L2-S1 region of the spine.
- The term “cisterna magna” is intended to include access to the space around and below the cerebellum via the opening between the skull and the top of the spine. The term “cerebral ventricle” is intended to include the cavities in the brain that are continuous with the central canal of the spinal cord. Administration of a pharmaceutical composition in accordance with the present disclosure to any of the above mentioned sites can be achieved by direct injection of the composition or by the use of infusion pumps. For injection, the composition of the disclosure can be formulated in liquid solutions, preferably in physiologically compatible buffers such as Hank's solution, Ringer's solution or phosphate buffer. In addition, the enzyme may be formulated in solid form and re-dissolved or suspended immediately prior to use. Lyophilized forms are also included. The injection can be, for example, in the form of a bolus injection or continuous infusion (e.g., using infusion pumps) of the enzyme.
- In various embodiments of the disclosure, the enzyme is administered by lateral cerebroventricular injection into the brain of a subject. The injection can be made, for example, through a burr hole made in the subject's skull. In another embodiment, the enzyme fusion protein and/or other pharmaceutical formulation is administered through a surgically inserted shunt into the cerebral ventricle of a subject. For example, the injection can be made into the lateral ventricles, which are larger, even though injection into the third and fourth smaller ventricles can also be made.
- In various embodiments, the pharmaceutical compositions used in the present disclosure are administered by injection into the ci sterna magna, or lumbar area of a subject. In another embodiment of the method of the disclosure, the pharmaceutically acceptable formulation provides sustained delivery, e.g., “slow release” of the enzyme or other pharmaceutical composition used in the present disclosure, to a subject for at least one, two, three, four weeks or longer periods of time after the pharmaceutically acceptable formulation is administered to the subject.
- In various embodiments, a therapeutic fusion protein is delivered to one or more surface or shallow tissues of the brain or spinal cord. For example, in various embodiments, a therapeutic fusion protein is delivered to one or more surface or shallow tissues of the cerebrum or spinal cord. In some embodiments, the targeted surface or shallow tissues of the cerebrum or spinal cord are located within 4 mm from the surface of the cerebrum. In some embodiments, the targeted surface or shallow tissues of the cerebrum are selected from pia mater tissues, cerebral cortical ribbon tissues, hippocampus, Virchow Robin space, blood vessels within the VR space, the hippocampus, portions of the hypothalamus on the inferior surface of the brain, the optic nerves and tracts, the olfactory bulb and projections, and combinations thereof.
- In some embodiments, a therapeutic fusion protein is delivered to one or more deep tissues of the cerebrum or spinal cord. In some embodiments, the targeted surface or shallow tissues of the cerebrum or spinal cord are located 4 mm (e.g., 5 mm, 6 mm, 7 mm, 8 mm, 9 mm, or 10 mm) below (or internal to) the surface of the cerebrum. In some embodiments, targeted deep tissues of the cerebrum include the cerebral cortical ribbon. In some embodiments, targeted deep tissues of the cerebrum include one or more of the diencephalon (e.g., the hypothalamus, thalamus, prethalamus, subthalamus, etc.), metencephalon, lentifoim nuclei, the basal ganglia, caudate, putamen, amygdala, globus pallidus, and combinations thereof.
- In various embodiments, a targeted surface or shallow tissue of the spinal cord contains pia matter and/or the tracts of white matter. In various embodiments, a targeted deep tissue of the spinal cord contains spinal cord grey matter and/or ependymal cells. In some embodiments, a therapeutic fusion protein is delivered to neurons of the spinal cord.
- In various embodiments, a therapeutic fusion protein is delivered to one or more tissues of the cerebellum. In certain embodiments, the targeted one or more tissues of the cerebellum are selected from the group consisting of tissues of the molecular layer, tissues of the Purkinje cell layer, tissues of the Granular cell layer, cerebellar peduncles, and combination thereof. In some embodiments, therapeutic agents (e.g., enzymes) are delivered to one or more deep tissues of the cerebellum including, but not limited to, tissues of the Purkinje cell layer, tissues of the Granular cell layer, deep cerebellar white matter tissue (e.g., deep relative to the Granular cell layer), and deep cerebellar nuclei tissue.
- In various embodiments, a therapeutic fusion protein is delivered to one or more tissues of the brainstem. In some embodiments, the targeted one or more tissues of the brainstem include brain stem white matter tissue and/or brain stem nuclei tissue.
- In various embodiments, a therapeutic fusion protein is delivered to various brain tissues including, but not limited to, gray matter, white matter, periventricular areas, pia-arachnoid, meninges, neocortex, cerebellum, deep tissues in cerebral cortex, molecular layer, caudate/putamen region, midbrain, deep regions of the pons or medulla, and combinations thereof.
- In various embodiments, a therapeutic fusion protein is delivered to various cells in the brain including, but not limited to, neurons, glial cells, perivascular cells and/or meningeal cells. In some embodiments, a therapeutic protein is delivered to oligodendrocytes of deep white matter.
- In certain preferred embodiments, in order to treat MPS IIIB disease in a human subject, reduce the rate of decline of at least one symptom (including cognitive decline) of MPS IIIB in a human subject, or to reduce or prevent GAG storage in one or more tissues of the CNS of a subject suffering from MPS IIIB disease, about 30 mg, 100 mg or 300 mg of therapeutic fusion protein, or from about 30 mg-300 mg, 30 mg-200 mg or 30 mg-100 mg of therapeutic fusion protein, is administered once weekly ICV (isovolumetric) for a time period of at least about 24, preferably 48 weeks.
- The agents utilized in the methods of the disclosure may be provided in a kit, which kit may further include instructions for use. Such a kit will comprise a lysosomal enzyme or fusion protein as described herein comprising an enzyme for use in the treatment of a lysosomal storage disease and a lysosomal targeting moiety, usually in a dose and formulation suitable for administration to the host. In various embodiments, the kit may comprise one or more device(s) for delivering the enzyme intrathecally.
- A kit of the present disclosure may comprise instructions for the intrathecal administration of the therapeutic compositions of the present disclosure, in addition to the therapeutic compositions. In certain embodiments, the kits of the disclosure may comprise catheter(s), pump(s), or other devices for the intrathecal administration of the enzyme replacement therapy that are preloaded with the therapeutic compositions of the present disclosure. For example, catheters preloaded with 0.001-0.01 mg, 0.01-0.1 mg, 0.1-1.0 mg, 1.0-10 mg, 10-100 mg, or more of a therapeutic fusion protein comprising a lysosomal enzyme and lysosomal targeting moiety, such as Naglu and an IGF-II peptide tag, in a pharmaceutically acceptable formulation are specifically contemplated. Exemplary catheters may include single use catheters that can be discarded after use.
- In certain embodiments, the kits of the present disclosure may comprise one or more of the following components, an extension line (e.g., Smiths Medical PN:536040), an in-line filter (e.g., Smiths Medical PN:FS116), a port needle (e.g., Smiths Medical PN:21-2737-24), a syringe (e.g., Becton Dickinson PN:309604) or a syringe needle (e.g., Becton Dickinson PN:305196).
- Intrathecal (e.g., ICV or lumbar) administration of a Naglu enzyme or fusion protein thereof (including BMN001) into the CSF of the patient can be used for the prevention or treatment of one or more symptom or adverse consequence of MPS IIIB disease in humans. In this regard, it is expected that intrathecal administration of a therapeutically effective amount of a Naglu enzyme or fusion protein thereof (including BMN001) will result in improvement of at least one symptom or adverse consequence of MPS IIIB disease, a slowing or reduction of the progression of at least one symptom or adverse consequence of MPS IIIB or a stabilization of decline of at least one symptom or adverse consequence of MPS IIIB. In this regard, known symptoms or adverse consequences of MPS IIIB disease in humans include, for example, detectable decline in one or more of the following: cognitive function, language function, motor function, social-emotional function, adaptive function, conceptual thinking, facial recognition, story completion, pattern reasoning and hand function/dexterity.
- In order to quantify the therapeutic effect of an administered enzyme or fusion protein thereof, any of a variety of well-known and routinely employed neurocognitive tests can be employed to derive a developmental quotient (DQ) score. In one embodiment, the DQ score is a cognitive function DQ score.
- In one embodiment of the present disclosure, a DQ score for a human subject may be obtained through use of the Bayley Scales of Infant Development, 3rd Edition (BSID-III) (Bayley, Bayley Scales of Infant and Toddler Development (Bayley-III). Technical Manual. Third ed. San Antonio: Psychological Corp., 2006, incorporated herein by reference). The BSID-III is a tool comprised of 5 domains (cognitive, language, motor, social-emotional and adaptive functioning) intended to assess developmental function in
children ages 1 to 42 months. In certain embodiments, neither the social-emotional nor adaptive functioning domains of the BSID-III test are used. In one embodiment, only the cognitive domain is used to determine a DQ score. - In certain embodiments, the BSID-III's cognitive domain may be the primary focus of the study. The cognitive scale is administered individually by a qualified examiner and captures the development of critical skills such as processing speed, problem solving and play. Importantly, the cognitive assessments do not require the subject to respond verbally; as a result, this test is particularly useful for assessing cognitive function in conditions such as MPS IIIB where there are problems with expressive language. Raw scores within one domain may be converted to a scaled score, which may then be converted to composite scores encompassing several domains. Mean raw scores associated with different ages also allow for the generation of age-equivalent scores and a DQ.
- In certain embodiments, the language and motor domains of the BSID-III may also be administered. The language domain consists of 2 subtests (receptive communication and expressive communication) and the motor domain consists of 2 subtests (fine motor and gross motor).
- In another embodiment of the present disclosure, a DQ score for a human subject may be obtained through use of the Kaufman Assessment Battery for Children, 2nd Edition (KABC-II) (Kaufman et al., Kaufman Assessment Battery for Children. Second Edition ed. Pearson Assessment, Inc. 2004, incorporated herein by reference). The KABC-II is a clinical instrument (psychological diagnostic test) for assessing cognitive development. Like the BSID, the KABC can be used to generate age-equivalent scores and hence a DQ. Since many parts of the test are non-verbal it is particularly suited for assessing function in children who may have difficulties in both hearing and in verbal communication, both of which are conditions relevant to the MPS IIIB patient population. In addition, the test has been translated into a number of different languages across the world. The subtests that comprise the Kaufman nonverbal index include the following: conceptual thinking, face recognition, story completion, triangles, pattern reasoning, and hand movements. In addition to the nonverbal index subtests, the knowledge cluster subtests (riddles, expressive vocabulary and verbal knowledge) may be administered to subjects who have language.
- In certain embodiments, the algorithm employed for determining whether to employ the BSID-III or KABC-II test for determining a DQ quotient is described by Delaney et al., JIMD Rep. 13:129-137 (2014).
- Results from either the tool (or cognitive subtest thereof) or the KABC-II nonverbal index are used to determine the DQ score for subjects either prior to treatment, or during or after treatment, with a therapeutic enzyme or fusion protein thereof. More specifically, using the BSID-III or KABC-II tools described above, the subject is assigned an “age-equivalent rating” (in months) based upon their performance in the tool employed. The DQ score is then calculated by dividing that “age-equivalent rating” by the actual age of the subject (in months), and then multiplying by 100. To illustrate, an MPS IIIB subject having an actual age of 60 months that is assigned an “age-equivalent rating” of 48 months based upon his/her performance in the tool employed, would have a DQ calculated as follows: (48 divided by 60)×100=80. On the other hand, a fully-functioning 60 month old who is assigned an “age-equivalent rating” of 60 months would have a DQ of (60 divided by 60)×100=100. As cognitive function, language function, motor function, social-emotional function, adaptive function, conceptual thinking, facial recognition, story completion, pattern reasoning and/or hand function/dexterity tend to decline over time in human MPS IIIB patients, it is expected that DQ scores for untreated MPS IIIB subjects will decline over time. It is the intention of the present disclosure to reduce the observed decline in DQ, stabilize DQ over time or improve DQ over time through administration of a therapeutic protein described herein. The beneficial effect of administration of a therapeutic fusion protein of the present disclosure, or formulation comprising the same, can be detected by determining a DQ score for a subject prior to treatment and comparing to a DQ score for a subject after treatment.
- The disclosure will be further and more specifically described by the following examples. Examples, however, are included for illustration purposes, not for limitation.
- Lysosomal enzyme fusions proteins (including mature human alpha-N-acetylglucosaminidase[Naglu] fusion proteins) comprising GILT tags and spacers have been disclosed in U.S. Patent Publication Nos. 2003-0082176, 2004-0006008, 2003-0072761, 2004-0005309, 2005-0281805, 2005-0244400, U.S. Pat. Nos. 8,492,337 and 8,563,691, and International Publications WO 03/032913, WO 03/032727, WO 02/087510, WO 03/102583, WO 2005/078077, WO 2009/137721 and WO 2014/085621, the disclosures of which are all incorporated herein by reference.
- In one particularly preferred embodiment (referred to herein as BMN001), a Naglu/IGF-II fusion protein comprising a functional mature human Naglu enzyme fused through a rigid linker to a furin-resistant IFG-II peptide consisting of amino acids 8-67 of the mature human IGF-II and having an alanine for arginine substitution at
amino acid position 37 thereof was prepared and formulated for use in in vivo safety and efficacy studies. The peptide linker employed in BMN001 has the amino acid sequence shown herein as SEQ ID NO:4. The complete amino acid sequence of the BMN001 therapeutic fusion protein is shown inFIG. 2 (SEQ ID NO:5). - In order to identify excipients and associated formulary conditions that would be amenable for a BMN001 liquid formulation appropriate for human clinical use via intrathecal administration, various experiments were conducted. First, the propensity of BMN001 to aggregate in liquid formulation at various pH's was tested as follows. Initially, BMN001 was introduced into a liquid formulation comprising a citrate buffer at pH 5.0 or 6.5, or an artificial human CSF liquid formulation at pH 6.0, 6.5, 7.0 and 8.0, and static light scattering analyses were conducted to measure the propensity of BMN001 to aggregate at different pH and increasing temperature. The results of these analyses demonstrated that BMN001 tends to aggregate more readily with increasing temperature at lower pH (pH 5.0 to 6.0), than it does at higher, more neutral pH (about pH 7.0). Moreover, SEC analyses performed on BMN001 liquid formulations at 25° C. and varying pH demonstrated a significantly higher percentage of aggregated, multimeric BMN001 at pH's below 6.5, as compared to less acidic, more neutral pH's in the range of from about 6.5 to about pH 7.5. Finally, SEC analyses performed on BMN001 liquid formulations at varying pH subjected to 10 cycles of freeze/thaw demonstrated a significantly higher percentage of aggregated, multimeric BMN001 at pH's below 6.5, as compared to less acidic, more neutral pH's in the range of about 7.0. These combined data suggest the use of a pH in the range of from about 6.5 to about 7.5, preferably about 7.0, would be beneficial for a clinical BMN001 liquid formulation.
- Next, liquid formulations comprising varying concentrations of BMN001 were tested to determine the effect of fusion protein concentration on aggregate/multimer formation during 5 cycles of freeze/thaw. In these experiments, liquid formulations containing 1, 5, 15 or 24 mg/ml of BMN001 were prepared at pH 5.0, 6.0, 7.0 and 8.0. After five cycles of freeze/thaw, the relative percentage of aggregate/multimer to monomer tended to be larger in the lower protein concentration formulations than in the formulations comprising a larger concentration of fusion protein. Moreover, aggregate/multimer formation tended to occur more frequently at more acidic pH than at a neutral pH. Addition of 2% trehalose prevented fusion protein aggregation when compared to the same formulation in the absence of trehalose. These results suggest that liquid formulations comprising at least about 24 mg/ml of BMN001 fusion protein are preferable to formulations comprising a lower fusion protein concentration. These surprising results demonstrating that liquid formulations having higher protein concentration (i.e., approximately 30 mg/ml) tend to have lower relative percentage of aggregate/multimer formation provides significant benefit for intrathecal administration to humans, where such administration is quite sensitive to the total volume of fluid being administered. As such, the formulations of the present disclosure, including BMN001-containing formulations, having a protein concentration of at least 24 mg/ml, including those formulations having a protein concentration of about 30 mg/ml, are quite useful for intrathecal administration to human subjects.
- Next, a variety of formulary excipients were screened for their ability to prevent agitation- or freeze/thaw-induced aggregate formation of BMN001 as measured by static light scattering analysis. Liquid formulations comprising identical amounts of BMN001 were prepared that comprised either (i) 180 mM N-acetylglucosamine, (ii) 222 mM glucose, (iii) 234 mM sucrose, (iv) 212 mM trehalose, (v) 220 mM sorbitol, (vi) 200 mM glutamic acid, (vii) 200 mM glutamine, (viii) 200 mM arginine, (ix) 200 mM histidine, (x) 200 mM glycine, (xi) 0.1% w/
v polysorbate 20, or (xii) 0.1% w/v poloaxamer 188. The results of these analyses demonstrated that addition of one or more amino acids tended to destabilize the liquid formulation as evidenced by increased aggregate/multimer formation as induced by either agitation or freeze/thaw. On the other hand, addition of one or more sugar/polyol tended to reduce the relative amount of aggregate/multimer formed as induced by either agitation or freeze/thaw. - Based upon the formulation development work described above and additional experimentation not described herein, a final BMN001 liquid formulation was developed for use in further human clinical development as described below. The BMN001 clinical formulation employed in the human clinical studies described in Example 3 below consisted of the following components: (i) 30 mg/ml BMN001 fusion protein, (ii) 0.19 mg/ml sodium phosphate dibasic, heptahydrate, (iii) 0.04 mg/ml sodium phosphate monobasic monohydrate, (iv) 8.66 mg/ml sodium chloride, (v) 0.22 mg/ml potassium chloride, (vi) 0.16 mg/ml magnesium chloride, hexahydrate, and (vi) 0.21 mg/ml calcium chloride dihydrate. This BMN001 clinical formulation was formulated at a final pH of 7.0. The BMN001 clinical formulation may be packaged in a clear borosilicate glass vial closed with a fluoropolymer-coated bromobutyl rubber stopper, capped with an aluminum seal and stored frozen at about −40° C. until thawed for use.
- Nonclinical studies were conducted as described herein and indicate likely therapeutic benefit without significant risk of BMN001-related toxicity for human patients with MPS IIIB disease.
- The nonclinical studies described herein were designed to support chronic ICV infusion of BMN001 for the treatment of MPS IIIB in human patients. The primary pharmacodynamics (PD), cardiovascular (CV) and CNS safety pharmacology, PK, CNS distribution and toxicity of BMN001 administered by the ICV route have been characterized in one single dose study in normal animals (cynomolgus monkey) and four repeat dose studies in normal and disease models of MPS IIIB (Naglu-knockout [KO] mouse, WT and NAGLU-null dog (Ellinwood et al., J. Inherit. Metab. Dis. 26(5):489-504 (2003) and cynomolgus monkey). These species were selected due to the high degree of NAGLU amino acid sequence homology, CI-MPR expression and amino acid sequence identity. The animal models of disease also display some of the key features of the human MPS IIIB disease, including accumulation of lysosomal storage material, neuron death, decline in function and reduced lifespan with similar relative timing of disease progression. They also display certain neurologic signs, including tremors and ataxia, which can be used to functionally track the underlying CNS pathology and potentially be used to monitor response to treatment. Therefore, these models provide valuable insight as to pharmacological attenuation of disease progression using clinically translatable endpoints.
- Primary PD assessments for BMN001 were conducted in IGF2 receptor binding assays, MPS IIIB human fibroblasts and the two available animal models of MPS IIIB, the NAGLU knockout (KO) mouse and juvenile NAGLU-null dog and demonstrate the robust pharmacological activity of BMN001. Analysis of IGF2 receptor binding of BMN001 lots used in these studies resulted in a calculated average IC50 of 0.28 nM. The in vitro cellular uptake of BMN001 and cellular half-life was determined in MPS IIIB human fibroblasts. The lysosomal Kuptake of BMN001 was defined as the concentration at which uptake into the lysosome is at half the maximal rate and was 3.7-6.4 nM (5.3 nM average) with a lysosomal half-life of approximately 9.5 days.
- In the MPS IIIB mouse disease model, ICV administration of BMN001 reversed the pathology of the disease. Repeat-dose studies in these mice show consistent tissue distribution of BMN001 across the CNS. The primary PD assessment demonstrated the effects of BMN001 on both biochemical and histological endpoints. ICV administration of BMN001 to Naglu-KO mice resulted in reduction of lysosomal storage material accumulation (i.e., GAG/heparan sulfate accumulation) with accompanying improvement in histological and immune-histological indices of lysosomal function. More specifically, when evaluated 24 hours after the final dose of BMN001, treatment resulted in a marked increase of Naglu enzyme activity and a concomitant decrease in beta-hexosaminidase activity and levels of total heparan sulfate and LAMP-2. Naglu activity was detectable in brain tissues, not only in cortex, hippocampus, dentate gyrus and thalamus, but also in remote distal geographic locations including amygdyla, perirhinal cortex and hypothalamus. Significant decreases in the levels of CD68, SCMAS, beta-amyloid, p-Tau, P-GSK3beta and
glypican 5 were also observed. Levels of heparan sulfate, Naglu-specific NREs and beta-hexosaminidase activity continued to decrease over the 7, 14 and 28 day post-last-dose time points. - In NAGLU-null dogs, the PD effects of BMN001 observed after 6 months of ICV administration included reduction of cerebrospinal fluid (CSF) lysosomal storage material and maintenance of motor function. Additional pharmacodynamics endpoints, including cognition and delay in disease progression, are currently being assessed as follows. Six independent groups having 4 previously immunotolerized dogs per group were treated biweekly by ICV infusion between
ages 4 and 18 months as follows: - Group 1 (normal NAGLU+ dogs)—ICV vehicle only (10 ml/kg);
Group 2 (normal NAGLU+ dogs)—BMN001 (12 mg/kg);
Group 3 (normal NAGLU+ dogs)—BMN001 (12 mg/kg, escalated to 48 mg/kg at dose 3);
Group 4 (NAGLU-null dogs)—ICV vehicle only (10 ml/kg);
Group 5 (NAGLU-null dogs)—BMN001 (12 mg/kg);
Group 6 (NAGLU-null dogs)—BMN001 (12 mg/kg, escalated to 48 mg/kg at dose 3). - Heparan Sulfate (HS) levels were measured in the CNS tissue, CSF, and cerebellum tissue in the dogs from
groups FIG. 3 , BMN001 reduced HS levels in both CNS tissue and in the CSF in MPS IIIB dogs in a dose dependent fashion, with the 48 mg/kg dose reducing HS to wild-type levels. The levels of HS in the CNS and CSF in each group of dogs was evaluated and compared. As shown inFIG. 4 , there is a strong correlation in the HS levels in these two brain compartments, demonstrating BMN001's ability to reduce HS uniformly throughout the brain. - The effect of BMN001 treatment on LAMP2 levels was also investigated. Cerebellum tissue homogenate samples (18 μg protein/lane) from wild-type, untreated MPSIIIB-affected dogs, and MPSIIIB-affected dogs treated with BMN001 were electrophoresed and blotted under non-reducing conditions, then probed with unlabeled AC17 and detected with an HRP-conjugated anti-mouse IgG secondary antibody. LAMP2-expressing or control CHO-K1 cell lysates were included in the blots as controls (5 μg protein/lane). To assess the total amount of protein loaded into each lane, cerebellum homogenate blots were stripped and re-probed for β-actin. As shown in
FIG. 5 , untreated MPSIIIB-affected dogs had high levels of LAMP2 relative to wild-type dogs. However, treatment with BMN001 reduced the LAMP2 levels in MPSIIIB-affected dogs to levels seen in wild-type dogs. - The effect of BMN001 on cerebellar atrophy was also investigated. As seen in
FIG. 6 , BMN001 caused a significant reduction in cerebellar HS at both doses. Further, both doses of BMN001 attenuated cerebellar white matter decline as measured by diffusion tensor imaging (DTI) (FIG. 7 ). The attenuation of cerebellar atrophy by BMN001 was also clearly seen in MRI images of wild-type and BMN001 treated MPS IIIB dogs (FIG. 8 ). - In a separate study, healthy juvenile cynomolgus monkeys weighing approximately 1-2 kg were randomly assigned to one of five dosage groups as follows:
-
Group 1—ICV vehicle only (5 minutes, 2.5 ml isovolumetric ICV, 0.5 ml/min);
Group 2—30 mg BMN001 (5 minutes, 2.5 ml isovolumetric ICV, 0.5 ml/min);
Group 3—73 mg BMN001 (5 minutes, 2.5 ml isovolumetric ICV, 0.5 ml/min);
Group 4—73 mg BMN001 (240 minutes, 2.5 ml non-isovolumetric ICV, 0.88 ml/hr); and
Group 5—200 mg/kg BMN001 (5 minutes, non-isovolumetric IV, 3 ml/min). - At 48 hours post-dosing, animals were euthanized and specific tissues of the CNS were harvested. Specimens of superficial and deep tissue, relative to the ventricle, for seven brain and three spinal cord regions were collected for biodistribution analyses. These analyses demonstrated that the ICV delivery route enabled direct CNS enzyme replacement with superior biodistribution in the CNS than is achieved via IV administration and that rapid administration of BMN001 following isovolumetric CSF removal is safe and well tolerated in vivo. Finally, comparable and widespread distribution of BMN001 to both superficial and deep CNS tissues was observed from both rapid (i.e., about 5 minutes) isovolumetric administration or slow (i.e., about 240 minutes) non-isovolumetric administration.
- Cardiovascular, respiratory and CNS safety pharmacology parameters were assessed in the single and weekly repeat dose monkey toxicity studies. CNS and cardiovascular safety pharmacology parameters were assessed in the biweekly repeat dose studies in WT and NAGLU-null dogs. There were no findings in these studies to indicate there were BMN001-related adverse effects on the CNS, cardiovascular or respiratory systems. No BMN001-related CNS or systemic organ toxicity or toxicity due to exaggerated pharmacology, such as rapid clearance of accumulated lysosomal storage material, has been observed following ICV administration. Furthermore, there was no systemic toxicity, including hypoglycemia, observed after repeat IV administration of BMN001.
- For clinical studies conducted in humans, human-equivalent doses were calculated based on scaling of brain mass. The human brain achieves about 75% of adult mass by
age age 5. Given an adult human brain mass of 1400 g and progressive brain atrophy in MPS IIIB patients, an average mass of 1000 g was assumed for the intended patient population. This yields a scaling factor of 10-fold based on an average cynomolgus brain mass of 100 g. Therefore, the safety and efficacy profile of BMN001, as assessed in the current nonclinical program, supports the chronic ICV administration of BMN001 at doses up to 730 mg (as scaled by brain weight) when administered as either a 4-hour infusion or an isovolumetric bolus every week in the intended pediatric patient population. - This is a
phase 1/2, first-in-human, multicenter, multinational, open-label, dose-escalation study in human patients diagnosed with MPS IIIB. BMN001, formulated as described in Example 1 above, is administered weekly by ICV infusion and subjects are evaluated in terms of neurocognitive function, behavior, sleep, quality of life (both of the subject and of the family/caregiver), imaging characteristics and biochemical markers of disease burden. The study's primary objectives are to evaluate the safety and tolerability of BMN001 administered to subjects with MPS IIIB via an ICV reservoir and catheter and to evaluate the impact of BMN001 on cognitive function in human patients with MPS MB as assessed by an applicable development quotient (DQ). To assess the impact of treatment on cognitive function, data from human subjects under treatment in this study is compared with data from a related observational study of progressive MPS IIIB symptomology conducted earlier in the same set of human subjects (i.e., the “natural history study”). - The
current phase 1/2 human clinical study consists of 2 parts. InPart 1, the dose escalation period, 3 human subjects (not previously enrolled in natural history study) each receive at least 4 weekly doses of BMN001 at up to 3 escalating dose levels (30 mg, 100 mg and 300 mg) until the maximum tolerated tested dose (MTTD) is established. InPart 2, the stable dose period, up to 30 human subjects previously enrolled in the natural history study begin a treatment course of weekly BMN001 at the MTTD that continues for 48 weeks. The 3 subjects fromPart 1 also move intoPart 2, perform thePart 2 Baseline assessments and continue weekly dosing for an additional 48 weeks at the MTTD established inPart 1. - The infusion regimen involves isovolumetric removal of 10 ml of CSF followed by ICV delivery of 10 ml total volume of BMN001 over a time period of from about 5 minutes to about 10 minutes. A rapid infusion rate was chosen for this study to address the specific needs of the MPS IIIB patient population; in particular, these patients often have pronounced behavior problems which would make longer infusion periods logistically challenging. Rapid intraventricular delivery of large volumes (e.g., 10-12 ml) of therapeutics following the removal of isovolumetric amounts of CSF is part of routine practice in the pediatric oncology setting. ICV delivery of a longer period of time, however, may also be employed. In this regard a single ICV administration of BMN001 (which may or may not be isovolumetric) may occur over a time period of at least 5, 10, 15, 20, 25, 30, 45, 60, 90, 120, 150, 180, 210 or 240 minutes, or more.
- Study procedures performed at Baseline in
Part 1 and at Baseline andWeeks Part 2 include the Vineland Adaptive Behavior Scales, 2nd Edition (VABS-II), either the Bayley Scales of Infant Development, 3rd Edition (BSID-III) or the Kaufman Assessment Battery for Children, 2nd Edition (KABC-II) and the Sanfilippo Behavior Rating Scale (SBRS). Additional study procedures to be performed during bothPart 1 andPart 2 Baseline visits and atWeeks Part 2 include the Infant Toddler Quality of Life questionnaire (ITQOL) or Child Health Questionnaire Parent Form (CHQ-PF50), the Children's Sleep Habits Questionnaire (CSHQ), the Parenting Stress Index, the PEDIATRIC QUALITY OF LIFE INVENTORY™ (PEDSQL™) Family Impact Module, MRI (under anesthesia) of the brain and abdomen and a brainstem auditory evoked response (BAER) assessment. - A total of three subjects received at least 8 doses of 30 mg QW BMN001 and at least 3 doses of 100 mg QW. As part of this study, the subjects were monitored over the course of at least 24 weeks prior treatment initiation to understand the natural history of disease progression. The baseline levels of Heparan Sulfate (HS) and MPS IIIB-specific HS non-reducing end (NRE) were measured in the cerebrospinal fluid (CSF) for each patient before and after treatment. As shown in
FIG. 9 , prior to treatment three subjects (A, B, and C) had extremely elevated HS and NRE compared to non-disease (normal) controls. However, treatment with BMN001 induced marked and sustained decreases in both HS and NRE in both subject A and B (FIG. 10 ) (subject C enrolled later in the study and data was not yet available). BMN001 was well tolerated with no serious adverse events related to treatment. - These findings demonstrate that BMN001 can be administered safely into the ventricular space via isovolumetric bolus infusion and that this treatment approach leads to a marked pharmacodynamic response in the CNS of MPS IIIB patients.
- Physical stress of formulations containing BMN001 were found to cause the formation of aggregates and/or multimers of the active fusion protein. Aggregates and/or multimers are undesirable in drug products because they likely lower the effective concentration of drug, may cause clogging of in-line filters during administration, and may elicit unwanted immune response to the drug product. Accordingly, additional work was done to identify formulations that were resistant to aggregation and/or multimer formation in response to physical stress. To this end, various excipients were screened for their effect on aggregate/multimer formation (see Table 2). Formulations containing each of these excipients was subjected to physical stress—recirculation pumping—and aggregation was measured by differential scanning calorimetry (DSC) and static light scattering (SLS).
-
TABLE 2 Excipients Tested for Aggregate Reduction REDUCED EXCIPIENT CONCENTRATION CATEGORY ENDOGENOUS AGGREGATION N- acetylglucosamine 4% w/v (180 mM) NAGLU product Yes Yes (GlcNAc) Glucose 4% w/v (222 mM) Sugar Yes Yes Sucrose 8% w/v (234 mM) Sugar No Yes Trehalose 8% w/v (212 mM) Sugar No Yes Sorbitol 4% w/v (220 mM) Sugar Alcohol No Yes Arginine 150 mM Amino Acid Yes No Histidine 150 mM Amino Acid Yes No Glycine 150 mM Amino Acid Yes No Glutamic Acid 25 mM Amino Acid Yes No Glutamine 150 mM Amino Acid Yes No Polysorbate 20 0.1% w/v Detergent No Yes Poloaxamer 188 0.1% w/v Detergent No Yes Lecithin 0.0001% w/v Phospholipid Yes No - As shown in Table 2, N-acetylglucosamine, glucose, sucrose, trehalose, sorbitol,
polysorbate 20, and poloaxamer 188 were found to reduce aggregate/multimer formation. Of these, trehalose andpolysorbate 20, were selected as lead candidate excipients for further work. - Formulations containing various concentrations of trehalose and/or
polysorbate 20 were generated in a base containing sodium phosphate dibasic heptahydrate, sodium phosphate monobasic monohydrate, and sodium chloride. These were then tested for their ability to reduce aggregates/multimers created by recirculation pumping, four passes of pumping, and freeze/thaw cycling (−40° C./25° C. for 20 cycles). In addition, each formulation was tested for stability at accelerated temperatures of 40° C. and 25° C. For each condition, aggregation was measured by visible and sub-visible particle count, solution turbidity (OD550), particle size homogeneity, and percent multimers. As shown inFIGS. 11A and 11B , trehalose reduced particle formation in a dose dependent manner. In addition, the combination of trehalose andpolysorbate 20 had the strongest effect on particle formation reduction. Similar results were observed measuring particle formation after each of four passes through a pump, with the combination of both trehalose andpolysorbate 20 showing the greatest reduction in particle count (Tables 3 and 4). -
TABLE 3 Particles per ml after each stage of pump stress, Trehalose or Polysorbate 20.Formulation Before Pass 1Pass 2Pass 3Pass 4No Trehalose 50,520 49,853 138,709 239,257 385,098 No PS20* 0.005% PS20 55,128 51,523 74,063 88,344 118,344 8% Trehalose 43,643 25,034 76,281 172,005 269,737 4% Trehalose 28,511 15,703 87,551 190,998 387,826 *PS20 is polysorbate 20. -
TABLE 4 Particles per ml after each stage of pump stress, Trehalose and Polysorbate 20.Formulation Before Pass 1Pass 2Pass 3Pass 4No Trehalose 2188 9207 151,514 353,469 528,347 No PS20* 0.005% PS20 3549 3558 125,017 212,017 276,984 8% Trehalose 2961 2669 40,200 88,129 122,931 0.005% PS20 *PS20 is polysorbate 20. - After finding an additive or synergistic effect of the combination of trehalose and
polysorbate 20 on inhibiting particle formation in response to pumping stress, a number of trehalose/polysorbate 20 combinations were tested. As shown in Table 5, increasing the amount of either trehalose orpolysorbate 20 in the combination decreased the amount of particles formed, with the greatest reduction seen in the combination with the highest trehalose and polysorbate 20 (8% trehalose and 0.005% polysorbate 20). The combination of trehalose andpolysorbate 20 was also more effective in the reduction of aggregates formed by twenty freeze/thaw cycles than trehalose orpolysorbate 20 alone (FIG. 12 ). As summarized in Table 6, the excipients trehalose and trehalose in combination withpolysorbate 20 effectively reduced BMN001 aggregate and multimer formation relative to the original formulation. -
TABLE 5 Effect of varying trehalose/ polysorbate 20 combinationson particle formation (particles per ml). Formulation Before Pass 1Pass 2Pass 3Pass 4No Trehalose 5,214 2,871 30,688 94,475 185,233 No PS20* 4% Trehalose 3,701 2,369 17,674 40,193 80,759 0.0025 % PS20 4% Trehalose 7,610 1,238 7,032 16,271 28,738 0.005 % PS20 8% Trehalose 8,105 4,357 46,255 81,841 116,240 0.00125 % PS20 8% Trehalose 7,420 9,788 14,931 33,415 51,841 0.0025 % PS20 8% Trehalose 3,281 1,426 11,109 11,109 20,386 0.005% PS20 *PS20 is polysorbate 20. -
TABLE 6 Summary of Excipient Effects on Aggregate and Multimer Reduction (percent reduction) Pumping Model Freeze/Thaw Freeze/Thaw Aggregate Aggregate Multimer Formulation Reduction Reduction Reduction 8% Trehalose 32% 30% 100% 8% Trehalose and 90% 100% 100% 0.005 % PS20 8% Trehalose and 75% 100% 100% 0.0025 % PS20 8% Trehalose and 40% 100% 100% 0.001 % PS20 4% Trehalose and 88% 100% 100% 0.005 % PS20 4% Trehalose and 57% 100% 100% 0.0025% PS20 - From these excipient studies, two additional formulations were identified for use in clinical trials. A formulation containing BMN001 at a concentration of about 30 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of about 0.19 mg/ml, sodium phosphate monobasic monohydrate at a concentration of about 0.04 mg/ml, sodium chloride at a concentration of about 0.88 mg/ml, and trehalose at a concentration of about 8% (w/v), at a pH of about 7.0. And a formulation containing BMN001 at a concentration of about 30 mg/ml, sodium phosphate dibasic heptahydrate at a concentration of about 0.19 mg/ml, sodium phosphate monobasic monohydrate at a concentration of about 0.04 mg/ml, sodium chloride at a concentration of about 5 mg/ml, trehalose at a concentration of about 4% (w/v), and
polysorbate 20 at a concentration of about 0.005%, at a pH of about 7.0. - Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the disclosure described herein. The scope of the present disclosure is not intended to be limited to the above Description, but rather is as set forth in the appended claims. The articles “a”, “an”, and “the” as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to include the plural referents. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The disclosure includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The disclosure also includes embodiments in which more than one, or all, of the group members are present in, employed in, or otherwise relevant to a given product or process. Furthermore, it is to be understood that the disclosure encompasses variations, combinations, and permutations in which one or more limitations, elements, clauses, descriptive terms, etc., from one or more of the claims is introduced into another claim dependent on the same base claim (or, as relevant, any other claim) unless otherwise indicated or unless it would be evident to one of ordinary skill in the art that a contradiction or inconsistency would arise. Where elements are presented as lists, e.g., in Markush group or similar format, it is to be understood that each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the disclosure, or aspects of the disclosure, is/are referred to as comprising particular elements, features, etc., certain embodiments of the disclosure or aspects of the disclosure consist, or consist essentially of, such elements, features, etc. For purposes of simplicity those embodiments have not in every case been specifically set forth herein. It should also be understood that any embodiment of the disclosure, e.g., any embodiment found within the prior art, can be explicitly excluded from the claims, regardless of whether the specific exclusion is recited in the specification.
- It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one act, the order of the acts of the method is not necessarily limited to the order in which the acts of the method are recited, but the disclosure includes embodiments in which the order is so limited. Furthermore, where the claims recite a composition, the disclosure encompasses methods of using the composition and methods of making the composition. Where the claims recite a composition, it should be understood that the disclosure encompasses methods of using the composition and methods of making the composition.
- All publications and patent documents cited in this application are incorporated by reference in their entirety to the same extent as if the contents of each individual publication or patent document were incorporated herein.
Claims (82)
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/728,359 US20220251526A1 (en) | 2016-02-24 | 2022-04-25 | Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof |
US18/609,855 US20240263160A1 (en) | 2016-02-24 | 2024-03-19 | Targeted Therapeutic Lysosomal Enzyme Fusion Proteins, Associated Formulations and Uses Thereof |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201662299188P | 2016-02-24 | 2016-02-24 | |
US201662428221P | 2016-11-30 | 2016-11-30 | |
PCT/US2017/019343 WO2017147414A1 (en) | 2016-02-24 | 2017-02-24 | Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof |
US201816078546A | 2018-08-21 | 2018-08-21 | |
US17/728,359 US20220251526A1 (en) | 2016-02-24 | 2022-04-25 | Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/078,546 Continuation US11345904B2 (en) | 2016-02-24 | 2017-02-24 | Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof |
PCT/US2017/019343 Continuation WO2017147414A1 (en) | 2016-02-24 | 2017-02-24 | Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US18/609,855 Continuation US20240263160A1 (en) | 2016-02-24 | 2024-03-19 | Targeted Therapeutic Lysosomal Enzyme Fusion Proteins, Associated Formulations and Uses Thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
US20220251526A1 true US20220251526A1 (en) | 2022-08-11 |
Family
ID=58314512
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/078,546 Active 2038-02-06 US11345904B2 (en) | 2016-02-24 | 2017-02-24 | Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof |
US17/728,359 Abandoned US20220251526A1 (en) | 2016-02-24 | 2022-04-25 | Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof |
US18/609,855 Pending US20240263160A1 (en) | 2016-02-24 | 2024-03-19 | Targeted Therapeutic Lysosomal Enzyme Fusion Proteins, Associated Formulations and Uses Thereof |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/078,546 Active 2038-02-06 US11345904B2 (en) | 2016-02-24 | 2017-02-24 | Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US18/609,855 Pending US20240263160A1 (en) | 2016-02-24 | 2024-03-19 | Targeted Therapeutic Lysosomal Enzyme Fusion Proteins, Associated Formulations and Uses Thereof |
Country Status (14)
Country | Link |
---|---|
US (3) | US11345904B2 (en) |
EP (2) | EP3419651B1 (en) |
JP (1) | JP7109369B2 (en) |
KR (1) | KR20180114199A (en) |
CN (1) | CN109069595A (en) |
AU (1) | AU2017222620B2 (en) |
BR (1) | BR112018017322A2 (en) |
CA (1) | CA3015358A1 (en) |
CL (1) | CL2018002430A1 (en) |
IL (1) | IL261246B2 (en) |
MX (1) | MX2018010196A (en) |
RU (1) | RU2751235C2 (en) |
WO (1) | WO2017147414A1 (en) |
ZA (1) | ZA201805648B (en) |
Families Citing this family (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP7109369B2 (en) | 2016-02-24 | 2022-07-29 | バイオマリン ファーマシューティカル インコーポレイテッド | Targeted Therapeutic Lysosomal Enzyme Fusion Proteins, Related Formulations, and Uses Thereof |
EP3563863B1 (en) * | 2016-12-28 | 2023-07-12 | JCR Pharmaceuticals Co., Ltd. | Lyophilized preparation |
TW201925236A (en) | 2017-10-02 | 2019-07-01 | 美商戴納立製藥公司 | Fusion proteins comprising enzyme replacement therapy enzymes |
EP3811962A4 (en) * | 2018-06-25 | 2022-03-16 | JCR Pharmaceuticals Co., Ltd. | Protein-containing aqueous liquid formulation |
EP4229192A1 (en) | 2020-10-14 | 2023-08-23 | Denali Therapeutics Inc. | Fusion proteins comprising sulfoglucosamine sulfohydrolase enzymes and methods thereof |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20220127326A1 (en) * | 2012-11-27 | 2022-04-28 | Biomarin Pharmaceutical Inc. | Targeted Therapeutic Lysosomal Enzyme Fusion Proteins and Uses Thereof |
Family Cites Families (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6217552B1 (en) | 1999-03-01 | 2001-04-17 | Coaxia, Inc. | Medical device for selective intrathecal spinal cooling in aortic surgery and spinal trauma |
US6642038B1 (en) | 1999-09-14 | 2003-11-04 | Genzyme Glycobiology Research Institute, Inc. | GlcNAc phosphotransferase of the lysosomal targeting pathway |
US7560424B2 (en) | 2001-04-30 | 2009-07-14 | Zystor Therapeutics, Inc. | Targeted therapeutic proteins |
US20040005309A1 (en) | 2002-05-29 | 2004-01-08 | Symbiontics, Inc. | Targeted therapeutic proteins |
ATE384736T1 (en) | 2001-04-30 | 2008-02-15 | Zystor Therapeutics Inc | SUB-CELLULAR TARGETING OF THERAPEUTIC PROTEINS |
US7629309B2 (en) | 2002-05-29 | 2009-12-08 | Zystor Therapeutics, Inc. | Targeted therapeutic proteins |
IL161352A0 (en) | 2001-10-16 | 2004-09-27 | Symbiontics Inc | Methods and compositions for targeting underglycosylated proteins across the blood brain barrier |
US20030072761A1 (en) | 2001-10-16 | 2003-04-17 | Lebowitz Jonathan | Methods and compositions for targeting proteins across the blood brain barrier |
AU2003237314B2 (en) | 2002-05-29 | 2010-03-04 | Biomarin Pharmaceutical Inc. | Targeted therapeutic proteins |
US7442372B2 (en) | 2003-08-29 | 2008-10-28 | Biomarin Pharmaceutical Inc. | Delivery of therapeutic compounds to the brain and other tissues |
JP4914224B2 (en) | 2004-02-10 | 2012-04-11 | バイオマリン ファーマシューティカル インコーポレイテッド | Acid α-glucosidase and its fragments |
JO3000B1 (en) | 2004-10-20 | 2016-09-05 | Genentech Inc | Antibody Formulations. |
CA2707032C (en) | 2007-12-21 | 2019-09-24 | Inspiration Biopharmaceuticals, Inc. | Stabilized factor ix formulations containing trehalose |
EP3272773B8 (en) | 2008-05-07 | 2020-11-18 | BioMarin Pharmaceutical Inc. | Lysosomal targeting peptides and uses thereof |
EP3679942A1 (en) * | 2009-06-17 | 2020-07-15 | BioMarin Pharmaceutical Inc. | Formulations for lysosomal enzymes |
JP2012530721A (en) | 2009-06-18 | 2012-12-06 | ワイス・エルエルシー | Lyophilized formulations for small module immunity drugs |
US20110318327A1 (en) | 2010-06-25 | 2011-12-29 | Shire Human Genetic Therapies, Inc. | Treatment of sanfilippo syndrome type b |
RS59469B1 (en) | 2010-06-25 | 2019-11-29 | Shire Human Genetic Therapies | Methods and compositions for cns delivery of iduronate-2-sulfatase |
LT3103469T (en) * | 2010-06-25 | 2021-03-25 | Shire Human Genetic Therapies, Inc. | Cns delivery of therapeutic agents |
BR112013028271B1 (en) * | 2011-05-05 | 2020-11-24 | Wellstat Immuno Therapeutics, Llc | POLIPEPTIDEO, NUCLEIC ACID, VIRAL VECTOR, PHARMACEUTICAL PREPARATION, AS WELL AS USE OF THE SAME IN THE TREATMENT OF COMPLEMENTED MEDIATED DISEASE |
US20140377244A1 (en) | 2011-12-23 | 2014-12-25 | Shire Human Genetic Therapies, Inc. | Stable formulations for cns delivery of arylsulfatase a |
JP7109369B2 (en) | 2016-02-24 | 2022-07-29 | バイオマリン ファーマシューティカル インコーポレイテッド | Targeted Therapeutic Lysosomal Enzyme Fusion Proteins, Related Formulations, and Uses Thereof |
-
2017
- 2017-02-24 JP JP2018544940A patent/JP7109369B2/en active Active
- 2017-02-24 MX MX2018010196A patent/MX2018010196A/en unknown
- 2017-02-24 CA CA3015358A patent/CA3015358A1/en active Pending
- 2017-02-24 EP EP17711041.8A patent/EP3419651B1/en active Active
- 2017-02-24 RU RU2018132639A patent/RU2751235C2/en active
- 2017-02-24 AU AU2017222620A patent/AU2017222620B2/en active Active
- 2017-02-24 KR KR1020187027691A patent/KR20180114199A/en active Search and Examination
- 2017-02-24 CN CN201780025534.1A patent/CN109069595A/en active Pending
- 2017-02-24 US US16/078,546 patent/US11345904B2/en active Active
- 2017-02-24 IL IL261246A patent/IL261246B2/en unknown
- 2017-02-24 WO PCT/US2017/019343 patent/WO2017147414A1/en active Application Filing
- 2017-02-24 EP EP23188800.9A patent/EP4275751A3/en active Pending
- 2017-02-24 BR BR112018017322A patent/BR112018017322A2/en unknown
-
2018
- 2018-08-23 ZA ZA2018/05648A patent/ZA201805648B/en unknown
- 2018-08-24 CL CL2018002430A patent/CL2018002430A1/en unknown
-
2022
- 2022-04-25 US US17/728,359 patent/US20220251526A1/en not_active Abandoned
-
2024
- 2024-03-19 US US18/609,855 patent/US20240263160A1/en active Pending
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20220127326A1 (en) * | 2012-11-27 | 2022-04-28 | Biomarin Pharmaceutical Inc. | Targeted Therapeutic Lysosomal Enzyme Fusion Proteins and Uses Thereof |
Also Published As
Publication number | Publication date |
---|---|
WO2017147414A1 (en) | 2017-08-31 |
RU2018132639A (en) | 2020-03-25 |
EP4275751A2 (en) | 2023-11-15 |
CL2018002430A1 (en) | 2018-12-28 |
AU2017222620B2 (en) | 2022-06-16 |
US20200297821A1 (en) | 2020-09-24 |
ZA201805648B (en) | 2023-01-25 |
IL261246B2 (en) | 2023-03-01 |
RU2018132639A3 (en) | 2020-07-15 |
IL261246A (en) | 2018-10-31 |
EP4275751A3 (en) | 2023-12-27 |
JP2019506439A (en) | 2019-03-07 |
EP3419651B1 (en) | 2023-10-25 |
AU2017222620A1 (en) | 2018-09-06 |
JP7109369B2 (en) | 2022-07-29 |
CA3015358A1 (en) | 2017-08-31 |
EP3419651C0 (en) | 2023-10-25 |
IL261246B (en) | 2022-11-01 |
US11345904B2 (en) | 2022-05-31 |
RU2751235C2 (en) | 2021-07-12 |
BR112018017322A2 (en) | 2019-01-02 |
US20240263160A1 (en) | 2024-08-08 |
KR20180114199A (en) | 2018-10-17 |
EP3419651A1 (en) | 2019-01-02 |
CN109069595A (en) | 2018-12-21 |
MX2018010196A (en) | 2018-11-19 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20220251526A1 (en) | Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof | |
US11065307B2 (en) | Therapeutic fusion protein comprising an alpha-n-acetylglucosaminidase and a lysosomal targeting moiety | |
US20220127326A1 (en) | Targeted Therapeutic Lysosomal Enzyme Fusion Proteins and Uses Thereof | |
EP2585105B1 (en) | Treatment of sanfilippo syndrome type b | |
AU2017202289B2 (en) | Methods and compositions for cns delivery of arylsulfatase a | |
KR20190103320A (en) | Therapeutic Therapy for the Treatment of Fabry with Stabilized Alpha-galactosidase | |
US20220133863A1 (en) | Treatment of sanfilippo syndrome type b |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: BIOMARIN PHARMACEUTICAL INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:CIACCIO, NATALIE;REEL/FRAME:060006/0515 Effective date: 20220210 Owner name: BIOMARIN PHARMACEUTICAL INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:MOSHASHAEE, SAEED;PINKSTAFF, JASON;SHAYWITZ, ADAM;SIGNING DATES FROM 20190323 TO 20190529;REEL/FRAME:060006/0473 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |