US20180140557A1 - Unimolecular nanoparticles for efficient delivery of therapeutic rna - Google Patents
Unimolecular nanoparticles for efficient delivery of therapeutic rna Download PDFInfo
- Publication number
- US20180140557A1 US20180140557A1 US15/819,424 US201715819424A US2018140557A1 US 20180140557 A1 US20180140557 A1 US 20180140557A1 US 201715819424 A US201715819424 A US 201715819424A US 2018140557 A1 US2018140557 A1 US 2018140557A1
- Authority
- US
- United States
- Prior art keywords
- sirna
- unimolecular
- nanoparticle
- group
- unimolecular nanoparticle
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 239000002105 nanoparticle Substances 0.000 title claims abstract description 90
- 230000001225 therapeutic effect Effects 0.000 title claims description 30
- -1 poly(ethylene glycol) Polymers 0.000 claims abstract description 40
- 229920006317 cationic polymer Polymers 0.000 claims abstract description 36
- 239000000412 dendrimer Substances 0.000 claims abstract description 36
- 229920000736 dendritic polymer Polymers 0.000 claims abstract description 36
- 229920001223 polyethylene glycol Polymers 0.000 claims abstract description 33
- 239000003446 ligand Substances 0.000 claims abstract description 29
- 238000000034 method Methods 0.000 claims abstract description 22
- 125000002091 cationic group Chemical group 0.000 claims abstract description 21
- 230000008685 targeting Effects 0.000 claims abstract description 20
- 239000000203 mixture Substances 0.000 claims abstract description 17
- 125000000524 functional group Chemical group 0.000 claims abstract description 15
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 claims abstract description 8
- 125000002843 carboxylic acid group Chemical group 0.000 claims abstract description 8
- 125000002887 hydroxy group Chemical group [H]O* 0.000 claims abstract description 7
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims abstract description 7
- MDFFNEOEWAXZRQ-UHFFFAOYSA-N aminyl Chemical compound [NH2] MDFFNEOEWAXZRQ-UHFFFAOYSA-N 0.000 claims abstract description 4
- 229960002685 biotin Drugs 0.000 claims abstract description 4
- 235000020958 biotin Nutrition 0.000 claims abstract description 4
- 239000011616 biotin Substances 0.000 claims abstract description 4
- 108020004459 Small interfering RNA Proteins 0.000 claims description 110
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 41
- 108090000623 proteins and genes Proteins 0.000 claims description 29
- 206010028980 Neoplasm Diseases 0.000 claims description 28
- 230000014509 gene expression Effects 0.000 claims description 19
- 201000011510 cancer Diseases 0.000 claims description 18
- 229920000642 polymer Polymers 0.000 claims description 18
- 125000005647 linker group Chemical group 0.000 claims description 13
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 13
- 239000004952 Polyamide Substances 0.000 claims description 12
- 229920002647 polyamide Polymers 0.000 claims description 12
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 claims description 10
- 125000002883 imidazolyl group Chemical group 0.000 claims description 10
- 150000003839 salts Chemical class 0.000 claims description 10
- 108091023037 Aptamer Proteins 0.000 claims description 8
- 108010051109 Cell-Penetrating Peptides Proteins 0.000 claims description 6
- 102000020313 Cell-Penetrating Peptides Human genes 0.000 claims description 6
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 claims description 6
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 claims description 6
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 claims description 6
- 125000002947 alkylene group Chemical group 0.000 claims description 6
- 125000003277 amino group Chemical group 0.000 claims description 6
- 230000012010 growth Effects 0.000 claims description 6
- 229920006150 hyperbranched polyester Polymers 0.000 claims description 6
- 108010052780 polyasparagine Proteins 0.000 claims description 6
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 claims description 5
- 239000003937 drug carrier Substances 0.000 claims description 5
- 235000019152 folic acid Nutrition 0.000 claims description 5
- 239000011724 folic acid Substances 0.000 claims description 5
- 229960000304 folic acid Drugs 0.000 claims description 5
- 229920000656 polylysine Polymers 0.000 claims description 5
- 230000004083 survival effect Effects 0.000 claims description 5
- DEQANNDTNATYII-OULOTJBUSA-N (4r,7s,10s,13r,16s,19r)-10-(4-aminobutyl)-19-[[(2r)-2-amino-3-phenylpropanoyl]amino]-16-benzyl-n-[(2r,3r)-1,3-dihydroxybutan-2-yl]-7-[(1r)-1-hydroxyethyl]-13-(1h-indol-3-ylmethyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentazacycloicosane-4-carboxa Chemical compound C([C@@H](N)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](CC=2C3=CC=CC=C3NC=2)NC(=O)[C@H](CC=2C=CC=CC=2)NC1=O)C(=O)N[C@H](CO)[C@H](O)C)C1=CC=CC=C1 DEQANNDTNATYII-OULOTJBUSA-N 0.000 claims description 4
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 claims description 4
- 108010016076 Octreotide Proteins 0.000 claims description 4
- 108010039918 Polylysine Proteins 0.000 claims description 4
- 150000001720 carbohydrates Chemical class 0.000 claims description 4
- 229960002700 octreotide Drugs 0.000 claims description 4
- 229920000728 polyester Polymers 0.000 claims description 4
- 108010040003 polyglutamine Proteins 0.000 claims description 4
- 229920000155 polyglutamine Polymers 0.000 claims description 4
- 108010055896 polyornithine Proteins 0.000 claims description 4
- 229920002714 polyornithine Polymers 0.000 claims description 4
- 150000002466 imines Chemical class 0.000 claims description 3
- AFDMODCXODAXLC-UHFFFAOYSA-N phenylmethanimine Chemical group N=CC1=CC=CC=C1 AFDMODCXODAXLC-UHFFFAOYSA-N 0.000 claims description 2
- OAKJQQAXSVQMHS-UHFFFAOYSA-N Hydrazine Chemical compound NN OAKJQQAXSVQMHS-UHFFFAOYSA-N 0.000 claims 2
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 claims 1
- 239000004055 small Interfering RNA Substances 0.000 description 105
- 210000004027 cell Anatomy 0.000 description 64
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 51
- 238000005516 engineering process Methods 0.000 description 39
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 18
- 230000002132 lysosomal effect Effects 0.000 description 15
- 239000002609 medium Substances 0.000 description 15
- 230000004700 cellular uptake Effects 0.000 description 13
- 239000000243 solution Substances 0.000 description 13
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 12
- 230000015572 biosynthetic process Effects 0.000 description 12
- 239000000975 dye Substances 0.000 description 12
- 230000030279 gene silencing Effects 0.000 description 12
- 238000000338 in vitro Methods 0.000 description 12
- 238000004458 analytical method Methods 0.000 description 11
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 10
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 10
- 210000001163 endosome Anatomy 0.000 description 10
- 239000005090 green fluorescent protein Substances 0.000 description 10
- 102000001301 EGF receptor Human genes 0.000 description 9
- 108060006698 EGF receptor Proteins 0.000 description 9
- 238000012226 gene silencing method Methods 0.000 description 9
- 210000003712 lysosome Anatomy 0.000 description 9
- 230000001868 lysosomic effect Effects 0.000 description 9
- 102000005962 receptors Human genes 0.000 description 9
- 108020003175 receptors Proteins 0.000 description 9
- 238000011282 treatment Methods 0.000 description 9
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 8
- 238000006243 chemical reaction Methods 0.000 description 8
- 230000009977 dual effect Effects 0.000 description 8
- 238000005227 gel permeation chromatography Methods 0.000 description 8
- 239000002773 nucleotide Substances 0.000 description 8
- 125000003729 nucleotide group Chemical group 0.000 description 8
- 238000003786 synthesis reaction Methods 0.000 description 8
- 238000011534 incubation Methods 0.000 description 7
- VHYFNPMBLIVWCW-UHFFFAOYSA-N 4-Dimethylaminopyridine Chemical compound CN(C)C1=CC=NC=C1 VHYFNPMBLIVWCW-UHFFFAOYSA-N 0.000 description 6
- 231100000135 cytotoxicity Toxicity 0.000 description 6
- 230000003013 cytotoxicity Effects 0.000 description 6
- 238000012377 drug delivery Methods 0.000 description 6
- 238000011068 loading method Methods 0.000 description 6
- 238000000425 proton nuclear magnetic resonance spectrum Methods 0.000 description 6
- 239000000523 sample Substances 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 108010035013 GE11 peptide Proteins 0.000 description 5
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 5
- 238000003556 assay Methods 0.000 description 5
- OOTFVKOQINZBBF-UHFFFAOYSA-N cystamine Chemical compound CCSSCCN OOTFVKOQINZBBF-UHFFFAOYSA-N 0.000 description 5
- 210000000172 cytosol Anatomy 0.000 description 5
- 201000010099 disease Diseases 0.000 description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 5
- 239000003814 drug Substances 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 230000009881 electrostatic interaction Effects 0.000 description 5
- 150000002148 esters Chemical class 0.000 description 5
- 108020004999 messenger RNA Proteins 0.000 description 5
- 125000001570 methylene group Chemical group [H]C([H])([*:1])[*:2] 0.000 description 5
- 239000002539 nanocarrier Substances 0.000 description 5
- 239000013642 negative control Substances 0.000 description 5
- 102000004196 processed proteins & peptides Human genes 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 235000018102 proteins Nutrition 0.000 description 5
- 102000004169 proteins and genes Human genes 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 238000001890 transfection Methods 0.000 description 5
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 4
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 4
- 102000009016 Cholera Toxin Human genes 0.000 description 4
- 108010049048 Cholera Toxin Proteins 0.000 description 4
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 4
- 102100026219 Serine/threonine-protein kinase N3 Human genes 0.000 description 4
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 4
- 229920001400 block copolymer Polymers 0.000 description 4
- 230000000903 blocking effect Effects 0.000 description 4
- 239000002552 dosage form Substances 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 238000002296 dynamic light scattering Methods 0.000 description 4
- 238000000684 flow cytometry Methods 0.000 description 4
- 238000004108 freeze drying Methods 0.000 description 4
- 229920000587 hyperbranched polymer Polymers 0.000 description 4
- 239000000546 pharmaceutical excipient Substances 0.000 description 4
- 108010061151 protein kinase N Proteins 0.000 description 4
- 210000004881 tumor cell Anatomy 0.000 description 4
- 108010055196 EphA2 Receptor Proteins 0.000 description 3
- 102100030340 Ephrin type-A receptor 2 Human genes 0.000 description 3
- 229930040373 Paraformaldehyde Natural products 0.000 description 3
- 150000001408 amides Chemical class 0.000 description 3
- 229940009098 aspartate Drugs 0.000 description 3
- 230000006399 behavior Effects 0.000 description 3
- 235000014633 carbohydrates Nutrition 0.000 description 3
- 230000003833 cell viability Effects 0.000 description 3
- 238000003570 cell viability assay Methods 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 238000001914 filtration Methods 0.000 description 3
- 238000000799 fluorescence microscopy Methods 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 239000003999 initiator Substances 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 229920002866 paraformaldehyde Polymers 0.000 description 3
- 239000008194 pharmaceutical composition Substances 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 238000004627 transmission electron microscopy Methods 0.000 description 3
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 description 2
- NKWCGTOZTHZDHB-UHFFFAOYSA-N 1h-imidazol-1-ium-4-carboxylate Chemical compound OC(=O)C1=CNC=N1 NKWCGTOZTHZDHB-UHFFFAOYSA-N 0.000 description 2
- AZKSAVLVSZKNRD-UHFFFAOYSA-M 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide Chemical compound [Br-].S1C(C)=C(C)N=C1[N+]1=NC(C=2C=CC=CC=2)=NN1C1=CC=CC=C1 AZKSAVLVSZKNRD-UHFFFAOYSA-M 0.000 description 2
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 2
- 102000006772 Acid Ceramidase Human genes 0.000 description 2
- 108020005296 Acid Ceramidase Proteins 0.000 description 2
- 239000012099 Alexa Fluor family Substances 0.000 description 2
- 102100032187 Androgen receptor Human genes 0.000 description 2
- IYMAXBFPHPZYIK-BQBZGAKWSA-N Arg-Gly-Asp Chemical compound NC(N)=NCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O IYMAXBFPHPZYIK-BQBZGAKWSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- IAZDPXIOMUYVGZ-WFGJKAKNSA-N Dimethyl sulfoxide Chemical compound [2H]C([2H])([2H])S(=O)C([2H])([2H])[2H] IAZDPXIOMUYVGZ-WFGJKAKNSA-N 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 238000005033 Fourier transform infrared spectroscopy Methods 0.000 description 2
- 102100040225 Gamma-interferon-inducible lysosomal thiol reductase Human genes 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- HEDRZPFGACZZDS-MICDWDOJSA-N Trichloro(2H)methane Chemical compound [2H]C(Cl)(Cl)Cl HEDRZPFGACZZDS-MICDWDOJSA-N 0.000 description 2
- 208000003721 Triple Negative Breast Neoplasms Diseases 0.000 description 2
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 2
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 238000000246 agarose gel electrophoresis Methods 0.000 description 2
- 235000001014 amino acid Nutrition 0.000 description 2
- 229940024606 amino acid Drugs 0.000 description 2
- 108010080146 androgen receptors Proteins 0.000 description 2
- 230000001093 anti-cancer Effects 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 229910052786 argon Inorganic materials 0.000 description 2
- 238000000149 argon plasma sintering Methods 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 2
- WGQKYBSKWIADBV-UHFFFAOYSA-N benzylamine Chemical compound NCC1=CC=CC=C1 WGQKYBSKWIADBV-UHFFFAOYSA-N 0.000 description 2
- 239000012472 biological sample Substances 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 230000030570 cellular localization Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 238000010668 complexation reaction Methods 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 239000013068 control sample Substances 0.000 description 2
- UFULAYFCSOUIOV-UHFFFAOYSA-N cysteamine Chemical compound NCCS UFULAYFCSOUIOV-UHFFFAOYSA-N 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 238000000502 dialysis Methods 0.000 description 2
- 230000012202 endocytosis Effects 0.000 description 2
- 125000001033 ether group Chemical group 0.000 description 2
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 2
- 102000006815 folate receptor Human genes 0.000 description 2
- 108020005243 folate receptor Proteins 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 2
- 229910052737 gold Inorganic materials 0.000 description 2
- 239000010931 gold Substances 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 150000007857 hydrazones Chemical class 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 229960003151 mercaptamine Drugs 0.000 description 2
- 230000001394 metastastic effect Effects 0.000 description 2
- 206010061289 metastatic neoplasm Diseases 0.000 description 2
- 108091070501 miRNA Proteins 0.000 description 2
- 239000002679 microRNA Substances 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- MCYTYTUNNNZWOK-LCLOTLQISA-N penetratin Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCCNC(N)=N)[C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CC=CC=C1 MCYTYTUNNNZWOK-LCLOTLQISA-N 0.000 description 2
- 108010043655 penetratin Proteins 0.000 description 2
- 229920000962 poly(amidoamine) Polymers 0.000 description 2
- 229920003229 poly(methyl methacrylate) Polymers 0.000 description 2
- 239000004926 polymethyl methacrylate Substances 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 238000007151 ring opening polymerisation reaction Methods 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 241000894007 species Species 0.000 description 2
- YLQBMQCUIZJEEH-UHFFFAOYSA-N tetrahydrofuran Natural products C=1C=COC=1 YLQBMQCUIZJEEH-UHFFFAOYSA-N 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- ATGUDZODTABURZ-UHFFFAOYSA-N thiolan-2-ylideneazanium;chloride Chemical compound Cl.N=C1CCCS1 ATGUDZODTABURZ-UHFFFAOYSA-N 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- RAVVEEJGALCVIN-AGVBWZICSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-5-amino-2-[[(2s)-2-[[(2s)-2-[[(2s)-6-amino-2-[[(2s)-6-amino-2-[[(2s)-2-[[2-[[(2s)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]acetyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]hexanoyl]amino]hexanoyl]amino]-5-(diamino Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCN=C(N)N)NC(=O)CNC(=O)[C@@H](N)CC1=CC=C(O)C=C1 RAVVEEJGALCVIN-AGVBWZICSA-N 0.000 description 1
- QGKMIGUHVLGJBR-UHFFFAOYSA-M (4z)-1-(3-methylbutyl)-4-[[1-(3-methylbutyl)quinolin-1-ium-4-yl]methylidene]quinoline;iodide Chemical compound [I-].C12=CC=CC=C2N(CCC(C)C)C=CC1=CC1=CC=[N+](CCC(C)C)C2=CC=CC=C12 QGKMIGUHVLGJBR-UHFFFAOYSA-M 0.000 description 1
- ADFXKUOMJKEIND-UHFFFAOYSA-N 1,3-dicyclohexylurea Chemical compound C1CCCCC1NC(=O)NC1CCCCC1 ADFXKUOMJKEIND-UHFFFAOYSA-N 0.000 description 1
- 238000005160 1H NMR spectroscopy Methods 0.000 description 1
- PTBDIHRZYDMNKB-UHFFFAOYSA-N 2,2-Bis(hydroxymethyl)propionic acid Chemical compound OCC(C)(CO)C(O)=O PTBDIHRZYDMNKB-UHFFFAOYSA-N 0.000 description 1
- 125000000143 2-carboxyethyl group Chemical group [H]OC(=O)C([H])([H])C([H])([H])* 0.000 description 1
- 101150116411 AGTR2 gene Proteins 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-M Acrylate Chemical compound [O-]C(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-M 0.000 description 1
- 101710081722 Antitrypsin Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 102100029761 Cadherin-5 Human genes 0.000 description 1
- 101100189913 Caenorhabditis elegans pept-1 gene Proteins 0.000 description 1
- 102000055006 Calcitonin Human genes 0.000 description 1
- 108060001064 Calcitonin Proteins 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 108010014419 Chemokine CXCL1 Proteins 0.000 description 1
- 102000016950 Chemokine CXCL1 Human genes 0.000 description 1
- 108010089335 Cholecystokinin A Receptor Proteins 0.000 description 1
- 102100034927 Cholecystokinin receptor type A Human genes 0.000 description 1
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 description 1
- 102100036252 Cyclin-dependent kinase 4 Human genes 0.000 description 1
- 108091008102 DNA aptamers Proteins 0.000 description 1
- 108700022150 Designed Ankyrin Repeat Proteins Proteins 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 102100037241 Endoglin Human genes 0.000 description 1
- 102100031785 Endothelial transcription factor GATA-2 Human genes 0.000 description 1
- 102000009024 Epidermal Growth Factor Human genes 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 101150021185 FGF gene Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102000007563 Galectins Human genes 0.000 description 1
- 108010046569 Galectins Proteins 0.000 description 1
- 101710195246 Gamma-interferon-inducible lysosomal thiol reductase Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 101000881679 Homo sapiens Endoglin Proteins 0.000 description 1
- 101001066265 Homo sapiens Endothelial transcription factor GATA-2 Proteins 0.000 description 1
- 101001046870 Homo sapiens Hypoxia-inducible factor 1-alpha Proteins 0.000 description 1
- 101000987581 Homo sapiens Perforin-1 Proteins 0.000 description 1
- 101000575639 Homo sapiens Ribonucleoside-diphosphate reductase subunit M2 Proteins 0.000 description 1
- 241000714259 Human T-lymphotropic virus 2 Species 0.000 description 1
- 108700000788 Human immunodeficiency virus 1 tat peptide (47-57) Proteins 0.000 description 1
- 108700039861 Human immunodeficiency virus 1 tat peptide (48-60) Proteins 0.000 description 1
- 102100022875 Hypoxia-inducible factor 1-alpha Human genes 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 231100000002 MTT assay Toxicity 0.000 description 1
- 238000000134 MTT assay Methods 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 108010031099 Mannose Receptor Proteins 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- DGUVEDGWGJXFCX-METZQCMUSA-N N-Acetylneuraminlactose sulfate Chemical compound O1[C@@H]([C@H](O)[C@H](O)CO)[C@H](NC(=O)C)[C@@H](O)C[C@@]1(C(O)=O)O[C@@H]1[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O)C(O)O[C@@H]2CO)O)O[C@H](COS(O)(=O)=O)[C@@H]1O DGUVEDGWGJXFCX-METZQCMUSA-N 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- 206010061309 Neoplasm progression Diseases 0.000 description 1
- 102000001839 Neurturin Human genes 0.000 description 1
- 108010015406 Neurturin Proteins 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 108010016731 PPAR gamma Proteins 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 108010088535 Pep-1 peptide Proteins 0.000 description 1
- 102000003728 Peroxisome Proliferator-Activated Receptors Human genes 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 229920000805 Polyaspartic acid Polymers 0.000 description 1
- 108010020346 Polyglutamic Acid Proteins 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 101710098940 Pro-epidermal growth factor Proteins 0.000 description 1
- 101100244562 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) oprD gene Proteins 0.000 description 1
- 108091008103 RNA aptamers Proteins 0.000 description 1
- 102000003661 Ribonuclease III Human genes 0.000 description 1
- 108010057163 Ribonuclease III Proteins 0.000 description 1
- 102100026006 Ribonucleoside-diphosphate reductase subunit M2 Human genes 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 101000910357 Scorpio palmatus Maurocalcin Proteins 0.000 description 1
- 102100031463 Serine/threonine-protein kinase PLK1 Human genes 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 102000013275 Somatomedins Human genes 0.000 description 1
- 108010056088 Somatostatin Proteins 0.000 description 1
- 102000005157 Somatostatin Human genes 0.000 description 1
- 108050001286 Somatostatin Receptor Proteins 0.000 description 1
- 102000011096 Somatostatin receptor Human genes 0.000 description 1
- 238000003917 TEM image Methods 0.000 description 1
- ATJFFYVFTNAWJD-UHFFFAOYSA-N Tin Chemical compound [Sn] ATJFFYVFTNAWJD-UHFFFAOYSA-N 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 108700025716 Tumor Suppressor Genes Proteins 0.000 description 1
- 102000044209 Tumor Suppressor Genes Human genes 0.000 description 1
- 108010062481 Type 1 Angiotensin Receptor Proteins 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 231100000230 acceptable toxicity Toxicity 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 150000001252 acrylic acid derivatives Chemical class 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 229960000548 alemtuzumab Drugs 0.000 description 1
- 125000003545 alkoxy group Chemical group 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 150000001409 amidines Chemical class 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 238000007098 aminolysis reaction Methods 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O ammonium group Chemical group [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 230000001475 anti-trypsic effect Effects 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 108010072041 arginyl-glycyl-aspartic acid Proteins 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 239000003782 beta lactam antibiotic agent Substances 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 239000003833 bile salt Substances 0.000 description 1
- 229940093761 bile salts Drugs 0.000 description 1
- 239000012620 biological material Substances 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 108010018828 cadherin 5 Proteins 0.000 description 1
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 1
- 229960004015 calcitonin Drugs 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 125000005102 carbonylalkoxy group Chemical group 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 230000006369 cell cycle progression Effects 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 238000013043 cell viability test Methods 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 239000007822 coupling agent Substances 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 150000001945 cysteines Chemical class 0.000 description 1
- 108700023159 delta Opioid Receptors Proteins 0.000 description 1
- 102000048124 delta Opioid Receptors Human genes 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 150000004985 diamines Chemical class 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 150000002019 disulfides Chemical class 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 230000005684 electric field Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 239000003480 eluent Substances 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 230000002121 endocytic effect Effects 0.000 description 1
- 230000009088 enzymatic function Effects 0.000 description 1
- 238000005886 esterification reaction Methods 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 210000001723 extracellular space Anatomy 0.000 description 1
- 238000002073 fluorescence micrograph Methods 0.000 description 1
- 102000034287 fluorescent proteins Human genes 0.000 description 1
- 108091006047 fluorescent proteins Proteins 0.000 description 1
- 239000012737 fresh medium Substances 0.000 description 1
- 238000007306 functionalization reaction Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- ZXQYGBMAQZUVMI-GCMPRSNUSA-N gamma-cyhalothrin Chemical compound CC1(C)[C@@H](\C=C(/Cl)C(F)(F)F)[C@H]1C(=O)O[C@H](C#N)C1=CC=CC(OC=2C=CC=CC=2)=C1 ZXQYGBMAQZUVMI-GCMPRSNUSA-N 0.000 description 1
- 229940083124 ganglion-blocking antiadrenergic secondary and tertiary amines Drugs 0.000 description 1
- QPJBWNIQKHGLAU-IQZHVAEDSA-N ganglioside GM1 Chemical compound O[C@@H]1[C@@H](O)[C@H](OC[C@H](NC(=O)CCCCCCCCCCCCCCCCC)[C@H](O)\C=C\CCCCCCCCCCCCC)O[C@H](CO)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@]2(O[C@H]([C@H](NC(C)=O)[C@@H](O)C2)[C@H](O)[C@H](O)CO)C(O)=O)[C@@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O3)O)[C@@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](CO)O1 QPJBWNIQKHGLAU-IQZHVAEDSA-N 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 150000002357 guanidines Chemical class 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 238000007901 in situ hybridization Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 238000002743 insertional mutagenesis Methods 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- QSHDDOUJBYECFT-UHFFFAOYSA-N mercury Chemical compound [Hg] QSHDDOUJBYECFT-UHFFFAOYSA-N 0.000 description 1
- 229910052753 mercury Inorganic materials 0.000 description 1
- 208000037819 metastatic cancer Diseases 0.000 description 1
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 1
- 150000004702 methyl esters Chemical class 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- SENLDUJVTGGYIH-UHFFFAOYSA-N n-(2-aminoethyl)-3-[[3-(2-aminoethylamino)-3-oxopropyl]-[2-[bis[3-(2-aminoethylamino)-3-oxopropyl]amino]ethyl]amino]propanamide Chemical compound NCCNC(=O)CCN(CCC(=O)NCCN)CCN(CCC(=O)NCCN)CCC(=O)NCCN SENLDUJVTGGYIH-UHFFFAOYSA-N 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 238000009828 non-uniform distribution Methods 0.000 description 1
- 230000000683 nonmetastatic effect Effects 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 125000005474 octanoate group Chemical group 0.000 description 1
- 230000009437 off-target effect Effects 0.000 description 1
- 230000014207 opsonization Effects 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 125000006353 oxyethylene group Chemical group 0.000 description 1
- 229960001972 panitumumab Drugs 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 238000005192 partition Methods 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 238000012247 phenotypical assay Methods 0.000 description 1
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 108010056274 polo-like kinase 1 Proteins 0.000 description 1
- 229920000724 poly(L-arginine) polymer Polymers 0.000 description 1
- 108010064470 polyaspartate Proteins 0.000 description 1
- 229920002643 polyglutamic acid Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 150000003141 primary amines Chemical class 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 125000004076 pyridyl group Chemical group 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- NHXLMOGPVYXJNR-ATOGVRKGSA-N somatostatin Chemical compound C([C@H]1C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CSSC[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N1)[C@@H](C)O)NC(=O)CNC(=O)[C@H](C)N)C(O)=O)=O)[C@H](O)C)C1=CC=CC=C1 NHXLMOGPVYXJNR-ATOGVRKGSA-N 0.000 description 1
- 229960000553 somatostatin Drugs 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000003270 steroid hormone Substances 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 102000027257 transmembrane receptors Human genes 0.000 description 1
- 108091008578 transmembrane receptors Proteins 0.000 description 1
- PBKWZFANFUTEPS-CWUSWOHSSA-N transportan Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(N)=O)[C@@H](C)CC)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)CN)[C@@H](C)O)C1=CC=C(O)C=C1 PBKWZFANFUTEPS-CWUSWOHSSA-N 0.000 description 1
- 108010062760 transportan Proteins 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 239000002753 trypsin inhibitor Substances 0.000 description 1
- 230000005751 tumor progression Effects 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- 229920003169 water-soluble polymer Polymers 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 239000002132 β-lactam antibiotic Substances 0.000 description 1
- 229940124586 β-lactam antibiotics Drugs 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
- A61K9/51—Nanocapsules; Nanoparticles
- A61K9/5107—Excipients; Inactive ingredients
- A61K9/513—Organic macromolecular compounds; Dendrimers
- A61K9/5146—Organic macromolecular compounds; Dendrimers obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyethylene glycol, polyamines, polyanhydrides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/713—Double-stranded nucleic acids or oligonucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
- A61K9/51—Nanocapsules; Nanoparticles
- A61K9/5192—Processes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
Definitions
- the present technology relates generally to the field of siRNA drug delivery systems and methods of making and using such systems.
- the compositions of such systems include a unimolecular nanoparticle and siRNA drug(s).
- siRNA molecules are double-stranded short chain oligonucleotides that post-transcriptionally regulate protein synthesis by sequence-specific matching with mRNA molecules, thereby resulting in specific silencing of target genes.
- siRNA therapies are undergoing clinical trials.
- naked siRNA molecules show poor therapeutic efficacy.
- Various viral and non-viral delivery systems have been developed to improve the efficacy of siRNA therapy.
- Non-viral delivery systems potentially offer a safer and cheaper alternative to viral vectors.
- siRNA delivery suitable for gene silencing for treatment of diseases such as cancer.
- the present technology provides a unimolecular nanoparticle that includes 1) a dendritic polymer having a molecular weight of about 500 to about 120,000 Da and terminating in hydroxyl, amino or carboxylic acid groups; 2) cationic polymers attached to at least a majority of the terminating groups of the dendritic polymer via a pH-sensitive linker, wherein each cationic polymer comprises a polymeric backbone attached to cationic functional groups and to weakly basic groups by disulfide bonds, wherein the molar ratio of cationic functional groups to weakly basic groups ranges from 1:1 to 5:1, and has a molecular weight from about 1,000 to about 5,000 Da; and 3) poly(ethylene glycol) attached to a plurality of cationic polymers and having a terminal group selected from a targeting ligand, OH, O-alkyl, NH 2 , biotin, or a dye, wherein the terminal group of at least one poly(ethylene glycol) is having a molecular weight
- the dendritic polymer is a polyester or a poly(amido-amine).
- the dendritic polymer may be a hyper-branched polymer or a dendrimer.
- the dendritic polymer may have from 3-7 generations.
- the dendritic polymer is a poly(amido-amine) dendrimer having 3 to 4 generations.
- the dendritic polymer is a hyperbranched polyester having 3 to 4 generations.
- the pH-sensitive linker contains an imine, hydrazone or cis-aconityl group.
- each cationic polymer includes a polyamide backbone, disulfide linkers, amino and/or ammonium groups, and imidazole groups.
- the polyamide backbone may be, e.g., a polyasparagine, polyglutamine, polyornithine, or polylysine.
- the cationic polymers comprises moieties selected from the group consisting of a (C2-6 alkylene)disulfide(C2-C6 alkyl)amino group, a (C2-6 alkylene)disulfide(C2-C6 alkyl)aminocarbonylimidazole group, and salts thereof.
- the cationic polymers comprise moieties selected from the group consisting of ethylene-disulfide-ethylamino group, ethylene-disulfide-ethylaminocarbonylimidazole group and salts thereof
- the targeting ligand is a cofactor, carbohydrate, peptide, antibody, nanobody, or aptamer.
- the targeting ligand may be selected from the group consisting of folic acid, mannose, GE11, cRGD, KE108, octreotide, TAT cell penetrating peptide, PSMA aptamer, TRC105, 7D12 nanobody, CTB.
- the unimolecular nanoparticle includes a therapeutic RNA within the nanoparticle.
- the therapeutic RNA may be an siRNA.
- the loading of the siRNA may be about 1 to about 20 wt % of the unimolecular nanoparticle.
- the dendritic polymer is a hyperbranched polyester having 3-4 generations and a molecular weight of about 3,600 to about 7,400 Da;
- the pH-sensitive linker is a benzylimine;
- each cationic polymer has a polyasparagine backbone attached to an ethylene-disulfide-ethylamino or ethylene-disulfide-ethylaminocarbonylimidazole group or salt thereof, and the molar ratio of the amino to imidazole functional groups is from 1:1 to 5:1; and the molecular weight of the PEG is about 1,000 to about 15,000 Da.
- the present technology provides a method of preparing a unimolecular nanoparticle comprising dispersing therapeutic RNA within any unimolecular nanoparticle described herein
- compositions comprising a unimolecular nanoparticle as described herein and a pharmaceutically acceptable carrier.
- the present technology provides methods of treating a cancer by administering an effective amount of a unimolecular nanoparticle as described herein loaded with a therapeutic RNA, wherein the therapeutic RNA inhibits expression of a gene necessary for survival or growth of the cancer.
- therapeutic RNA is siRNA having a length of 19 base pairs (bps) to 25 bps.
- the present technology provides a kit comprising a package containing a unimolecular nanoparticle as described herein and a package containing an effective amount of therapeutic siRNA and directions for use of the kit.
- FIG. 1 shows a schematic diagram of the cellular uptake of siRNA-complexed unimolecular NPs and the subcellular release of siRNA from the siRNA-complexed NPs into the cytosol. pH/redox dual-sensitive unimolecular NPs with excellent endosomal/lysosomal escape and intracellular siRNA decomplexation capabilities for efficient targeted delivery of siRNA.
- FIGS. 2A-2C show 1 H NMR spectra of P(BLA-NCA)-PEG-OCH 3 ( FIG. 2A ), P(BLA-NCA)-PEG-Mal ( FIG. 2B ), and H40-CHO ( FIG. 2C ).
- FIGS. 3A-3D show 1 H NMR spectra of H40-P(BLA-NCA)-PEG-OCH 3 /Mal ( FIG. 3A ), H40-P(Asp-AED)-PEG-OCH 3 /Mal ( FIG. 3B ), H40-P(Asp-AED-ICA)-PEG-OCH 3 /Mal ( FIG. 3D ), and H40-P(Asp-AED-ICA)-PEG-OCH 3 /Cy5/GE11 ( FIG. 3D ).
- FIG. 4A shows gel retardation assays of siRNA/NPs with various N/P ratios.
- FIG. 5 shows an assessment of the endosomal/lysosomal escape of siRNA-complexed NPs in MDA-MB-468 cells after 2 h incubation. Endosomes/lysosomes were stained with Lysotracker (green). siRNA was labeled with Cy5.5 (red). The nuclei were stained with Hoechst (blue). Scale bar: 20 ⁇ m.
- FIG. 6 shows z-stack images for the assessment of the endosomal/lysosomal escape of siRNA-complexed NPs in MDA-MB-468 cells. Scale bar: 2 ⁇ m.
- FIG. 7 shows the in vitro cellular uptake analysis. Fluorescence images of MDA-MB-468 TNBC cells incubated with pure medium (control), Cy5-labeled non-targeted (without GE11 conjugation) NPs, Cy5-labeled targeted (GE11-conjugated) NPs with a blocking dose (2 ⁇ M) of GE11 (i.e., blocking), and Cy5-labeled targeted NPs at 37° C. for 2 h (NP concentration: 100 ⁇ g/mL). Targeted NPs significantly enhanced the cellular uptake in EGFR-overexpressing TNBC cells. Scale bar: 50 ⁇ m.
- FIGS. 8A-B show an in vitro assessment of gene silencing efficiency using (in FIG. 8A ) fluorescence microscope and (in FIG. 8B ) flow cytometry.
- GFP-expressing MDA-MA-468 cells treated with pure medium (control), siRNA-complexed non-targeted NPs (siRNA-NT), siRNA-complexed targeted NPs (siRNA-T), and siRNA-complexed RNAiMAX (siRNA-RNAiMAX) for 24 h (40 nM of GFP-siRNA).
- siRNA-NT siRNA-complexed non-targeted NPs
- siRNA-T siRNA-complexed targeted NPs
- siRNA-RNAiMAX siRNA-complexed RNAiMAX
- FIG. 9 shows a schematic of an illustrative embodiment of an siRNA-complexed unimolecular nanoparticle (NP) of the present technology including a core comprised of H40 polyester hyperbranched polymer attached to cationic polymers, which in turn are attached to hydrophilic PEG segments and terminating in various functional groups, including dye(s) and the targeting ligand GE11. siRNA molecules partition within the NPs by electrostatic interactions.
- Molecular weight refers to weight average molecular weights (Mw) and can be determined by techniques well known in the art including gel permeation chromatography (GPC). GPC analysis can be performed, for example, on a D6000M column calibrated with poly(methyl methacrylate) (PMMA) using triple detectors including a refractive index (RI) detector, a viscometer detector, and a light scattering detector, and dimethylformamide as the eluent.
- GPC gel permeation chromatography
- cancer refers to cells or tissues that exhibit an aberrant growth phenotype characterized by a significant loss of control of cell proliferation.
- the methods and compositions of this disclosure apply to malignant, pre-metastatic, metastatic, and non-metastatic cells.
- therapeutic RNA refers to single strand or duplex RNA that modulates (e.g., silences, reduces, or inhibits) expression of a target gene, e.g., by mediating the degradation of mRNAs which are complementary to the sequence of the interfering RNA, by providing an RNA that is absent or expressed at a lower level in a subject having a particular disease or condition relative to its levels in a subject that does not have the same disease or condition.
- therapeutic RNAs include siRNA and miRNA.
- small-interfering RNA refers to double-stranded RNA (i.e., duplex RNA) that modulates (e.g., silences, reduces, or inhibits) expression of a target gene, e.g., by mediating the degradation of mRNAs which are complementary to the sequence of the siRNA.
- siRNA has complete identity or complementarity to the corresponding RNA sequence of its target mRNA.
- siRNA includes RNA of having 15-60, 15-50, 15-50, or 15-40 (duplex) nucleotides in length, more typically about, 15-30, 15-25 or 19-25 (duplex) nucleotides in length, and may be 20-24, 21-22 or 21-23 (duplex) nucleotides in length.
- siRNA duplexes may include 3′ overhangs of 1, 2, 3, or 4 nucleotides and/or 5′ phosphate termini.
- the siRNA can be chemically synthesized or may be encoded by a plasmid (e.g., transcribed as sequences that automatically fold into duplexes with hairpin loops).
- siRNA can also be generated by cleavage of longer dsRNA (e.g., dsRNA greater than about 25 nucleotides in length) with the E. coli RNase III or Dicer. These enzymes process the dsRNA into biologically active siRNA (see, e.g., Yang et al., PNAS USA 99: 9942-7 (2002); Calegari et al., PNAS USA 99: 14236 (2002); Byrom et al., Ambion TechNotes 10(1): 4-6 (2003); Kawasaki et al., Nucleic Acids Res. 31: 981-7 (2003); Knight and Bass, Science 293: 2269-71 (2001); and Robertson et al., J. Biol.
- dsRNA e.g., dsRNA greater than about 25 nucleotides in length
- dsRNA are at least 50 nucleotides to about 100, 200, 300, 400 or 500 nucleotides in length.
- a dsRNA may be as long as 1000, 1500, 2000, 5000 nucleotides in length, or longer.
- the dsRNA can encode for an entire gene transcript or a partial gene transcript.
- RNA such as an siRNA
- a target gene e.g., VEGF, EphA2, protein kinase N3 (PKN3), etc.
- a test sample e.g., a biological sample from organism of interest expressing the target gene or a sample of cells in culture expressing the target gene
- an siRNA that silences, reduces, or inhibits expression of the target gene.
- Expression of the target gene in the test sample is compared to expression of the target gene in a control sample (e.g., a biological sample from organism of interest expressing the target gene or a sample of cells in culture expressing the target gene) that is not contacted with the siRNA.
- Control samples i.e., samples expressing the target gene
- Silencing, inhibition, or reduction of expression of a target gene is achieved when the value of the test sample relative to the control sample is about 95%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 10%, 0% or a range between and including any two of the foregoing values.
- Suitable assays include, e.g., examination of mRNA levels using techniques known to those of skill in the art such as dot blots, northern blots, in situ hybridization, ELISA, immunoprecipitation, enzyme function, as well as phenotypic assays known to those of skill in the art.
- a targeted receptor refers to a receptor expressed by a cell that is capable of binding a cell targeting ligand.
- the cell targeting ligand may be a “tumor cell targeting ligand.”
- the receptor may be expressed on the surface of the cell.
- the receptor may be a transmembrane receptor. Examples of such targeted receptors include EGFR, ⁇ v ⁇ 3 integrin, somatostatin receptor, folate receptor, prostate-specific membrane antigen, CD105, mannose receptor, and GM1 ganglioside.
- tumor cell targeting ligand refers to a ligand that binds to “a targeted receptor” unique to or overexpressed by a cancer cell.
- the ligands may be capable of binding due to preferential expression of a receptor for the ligand, accessible for ligand binding, on the cancer cells.
- examples of such ligands include GE11 peptide, cRGD ((cyclo (RGDfC)), KE108 peptide, octreotide, folic acid, prostate-specific membrane antigen (PSMA) aptamer, TRC105, a human/murine chimeric IgG1 monoclonal antibody, 7D12 nanobody, mannose, and cholera toxin B (CTB).
- ligands include Rituximab, Trastuzumab, Bevacizumab, Alemtuzumab, Panitumumab, RGD, DARPins, RNA aptamers, DNA aptamers, analogs of folic acid and other folate receptor-binding molecules, lectins, other vitamins, peptide ligands identified from library screens, tumor-specific peptides, tumor-specific aptamers, tumor-specific carbohydrates, tumor-specific monoclonal or polyclonal antibodies, Fab or scFv (i.e., a single chain variable region) fragments of antibodies such as, for example, an Fab fragment of an antibody directed to EphA2 or other proteins specifically expressed or uniquely accessible on metastatic cancer cells, small organic molecules derived from combinatorial libraries, growth factors, such as EGF, FGF, insulin, and insulin-like growth factors, and homologous polypeptides, somatostatin and its analogs, transferrin, lipoprotein complex
- a cell penetrating peptide may also be attached to one or more PEG terminal groups in addition to the targeting ligand.
- TAT cell penetrating peptide GRKKRRQRRRPQ
- MAP KLAL KLALKLALKALKAALKLA
- Penetratin-Arg RQIRIWFQNRRMRWRR
- antitrypsin 358-374: CSIPPEVKFNKPFVYLI
- Temporin L FVQWFSKFLGRIL-NH2
- Maurocalcine GDC(acm)LPHLKLC
- pVEC Cadherin-5): LLIILRRRIRKQAHAHSK
- Calcitonin LGTYTQDFNKFHTFPQTAIGVGAP
- Neurturin GAAEAAARVYDLGLRRLRQRRRLRRERVRA
- Penetratin RQIKIWFQNRRMKWKKGG
- RQIKIWFQNRRMKWKKGG RQIKIWFQNRRMKWKKGG
- MAP
- dyes refers to small organic molecules having a molecular weight of 2000 Da or less or a protein which is able to emit light.
- Non-limiting examples of dyes include fluorophores, chemiluminescent or phosphorescent entities.
- dyes useful in the present technology include but are not limited to cyanine dyes (e.g., Cy2, Cy3, Cy5, Cy5.5, Cy7, and sulfonated versions thereof), fluorescein isothiocyanate (FITC), ALEXA FLUOR® dyes (e.g., ALEXA FLUOR® 488, 546, or 633), DYLIGHT® dyes (e.g., DYLIGHT® 350, 405, 488, 550, 594, 633, 650, 680, 755, or 800) or fluorescent proteins such as GFP (Green Fluorescent Protein).
- cyanine dyes e.g., Cy2, Cy3, Cy5, Cy5.5, Cy7, and sulfonated versions thereof
- FITC
- the present technology provides pharmaceutical compositions and medicaments comprising any of one of the embodiments of the siRNA delivery systems disclosed herein and a pharmaceutically acceptable carrier or one or more excipients.
- the compositions may be used in the methods and treatments described herein.
- the present technology provides a drug delivery system for the prevention or treatment of cancer.
- the pharmaceutical composition may include an effective amount of any of one of the embodiments of the compositions disclosed herein. In any of the above embodiments, the effective amount may be determined in relation to a subject. “Effective amount” refers to the amount of compound or composition required to produce a desired effect.
- an effective amount includes amounts or dosages that yield acceptable toxicity and bioavailability levels for therapeutic (pharmaceutical) use including, but not limited to, the inhibition (i.e., slowing, halting or reversing) or treatment of cancer in a subject.
- a “subject” or “patient” is a mammal, such as a cat, dog, rodent or primate. Typically the subject is a human, and, preferably, a human at risk for or suffering from cancer.
- the term “subject” and “patient” can be used interchangeably.
- an effective amount of a therapeutic RNA such as an siRNA or a therapeutically effective amount of a siRNA is an amount sufficient to produce the desired effect, e.g., a decrease in the expression of a target sequence in comparison to the normal expression level detected in the absence of the siRNA.
- the present technology provides unimolecular nanoparticles designed to deliver therapeutic RNA selectively to tumor cells.
- the RNA is protected within the nanoparticles until it reaches the cytoplasm of the targeted cell.
- the technology employs a unique combination of pH sensitive and redox sensitive functionality to release the RNA intact from the nanoparticles only once the nanoparticles are within the targeted cells.
- the present unimolecular nanoparticles include three distinct polymeric domains: a dendritic polymer, which serves as the core, cationic polymers attached to the terminal groups of the dendritic polymer and PEG, attached to the terminal groups of the cationic polymers.
- a dendritic polymer which serves as the core
- cationic polymers attached to the terminal groups of the dendritic polymer
- PEG attached to the terminal groups of the cationic polymers.
- the unimolecular nanoparticle may be described as a multi-arm star-like block copolymer.
- Therapeutic RNA such as siRNA or miRNA may be loaded into the unimolecular nanoparticles described herein. While not wishing to be bound by theory, it is believed that the therapeutic RNA is bound by electrostatic interactions with the cationic polymers on the interior of the nanoparticle.
- the dendritic polymer has a molecular weight of about 500 to about 120,000 Da and terminates in hydroxyl, amino or carboxylic acid groups.
- the molecular weight of the dendritic polymer will vary based on the type of polymer and number of generations employed. Suitable molecular weights include about 500, about 1000, about 2000, about 3000, about 4000, about 5000, about 6000, about 7000, about 8000, about 9000, about 10,000, about 15,000, about 20,000, about 30,000, about 40,000, about 50,000, about 75,000, about 100,000, about 120,000 Da, or a range between and including any two of the forgoing values. In some embodiments the molecular weight of the dendritic polymer is about 1,000 to about 10,000 Da.
- the core of the unimolecular nanoparticle may be a dendrimer such as a poly(amido-amine) (PAMAM) dendrimer having from 3 to 7 generations (e.g., 3, 4, 5, 6, or 7 generations or a range between and including any two of the foregoing values) or a hyperbranched polymer such as a polyester hyperbranched polymer (e.g., Boltorn H30 and H40, which are prepared from 2,2-bis(methylol)propionic acid).
- PAMAM will be understood to refer to a polymer having a C 2 -C 4 ⁇ , ⁇ -diamine initiator and C 3 -C 4 acrylate and diamine building blocks for each subsequent generation.
- the building blocks are C 2 1,2-diamines and C 3 acrylates (not counting the methyl ester carbon, which serves as a temporary protecting group).
- the PAMAM dendrimer has from 3 to 4 generations.
- the dendritic polymer is a hyperbranched polyester having 3 to 4 generations. The number of generations will determine the number of arms available for attachment to the cationic polymers.
- the majority of arms of the dendritic polymer do, e.g., more than 50%, more than 60%, more than 70%, more than 80% or more than 90% of arms of the dendritic polymer terminate in amino, hydroxyl, or carboxylic acid groups.
- the dendritic polymer is PAMAM, all of the arms terminate in amino groups, hydroxyl groups, or carboxylic acid groups.
- the cationic polymers of the unimolecular nanoparticle link the core dendritic polymer to the outer poly(ethylene glycol) (PEG) blocks.
- the cationic polymers of the unimolecular nanoparticles are attached to at least a majority of the terminating groups of the dendritic polymer via a pH-sensitive linker.
- the pH-sensitive linker includes a functional group which is readily hydrolyzed upon a change from alkaline pH to acid pH. In some embodiments the pH-sensitive linker will be stable at the pH of blood (about 7.4) and extracellular space in tissue, but hydrolyze at the lower pH of the endosome or lysosome (about 5.5-6.5).
- Suitable pH-sensitive linkers include imine (e.g., benzylamine), hydrazone and cis-aconityl linkers. While not wishing to be bound by theory, hydrolysis of the pH-sensitive linker is intended to release the block cationic-PEG copolymer from the dendritic core upon a change in pH from alkaline to acid.
- Each cationic polymer is made up of a polymeric backbone attached to cationic functional groups and to weakly basic groups by redox-sensitive linkers that include disulfide bonds.
- the polymeric backbone may be a polyamide backbone such as a found in peptides and proteins.
- the polyamide is a polyasparagine, polyglutamine, polyornithine, or polylysine.
- the cationic functional groups may be functional groups having a pka of at least about 8 (e.g., a pka of 8, 8.5, 9, 9.5, 10, 10.5, 11 or a range between and including any two of the foregoing values).
- Suitable groups include primary, secondary and tertiary amines, amidines, and guanidines. It will be understood that the cationic functional groups may be attached to the sidechains of the polyamide backbone. For example aspartic acid and glutamic acid side chains may be derivatized with disulfides formed from aminoalkylenethiols: (polyamide backbone)-CH 2 CH 2 —C(O)NH-(C1-6 alkylene)-S—S-(C1-C6 alkylene)-NH 2 ), or (polyamide backbone)-CH 2 —C(O)NH-(C1-6 alkylene)-S—S-(C1-C6 alkylene)-NH 2 ).
- polyaspartic acid or polyglutamic acid are now a polyasparagine or a polyglutamine, respectively.
- polyornithine and polylysine may be attached to cationic functional groups through suitably functionalized species such as carboxy-alkylene-disulfide-alkylene-amino groups, e.g., (polyamide backbone)-CH 2 CH 2 -CHNH-C(O)-(C1-6 alkylene)-S-S-(C1-C6 alkylene)-NH 2 ), or (polyamide backbone)-CH 2 CH 2 CH 2 NH—C(O)-(C1-6 alkylene)-S—S-(C1-C6 alkylene)-NH 2 ).
- Weakly basic groups useful in the unimolecular nanoparticles may have a pKa between about 5.5 and about 7.0, e.g., a pKa of 5.5, 5.75, 6, 6.25, 6.5, 6.75, 7, or a range between and including any two of the foregoing values.
- the weakly basic group is imidazole or pyridinyl.
- the molar ratio of cationic functional groups to weakly basic groups ranges from 1 to 5; in others it is 2 to 4. Suitable molar ratios include about 1, about 2, about 3, about 4, and about 5 or a range between and including any two of the foregoing values.
- the cationic polymer has a molecular weight from about 1,000 to about 5,000 Da; in others it is about 1,500 to about 4,000 Da.
- Suitable molecular weights for the cationic polymers include about 1,000, about 1,500, about 2,000, about 2,500, about 3,000, about 3,500, about 4,000, about 4,500, about 5,000 or a range between and including any two of the foregoing values.
- each cationic polymer comprises a polyamide backbone, disulfide linkers, amino groups, and imidazole groups.
- the cationic polymers comprise moieties selected from the group consisting of (C2-6 alkylene)disulfide(C2-C6 alkyl)amino group, (C2-6 alkylene)disulfide(C2-C6 alkyl)aminocarbonylimidazole group, and salts thereof.
- the cationic polymers comprise moieties selected from the group consisting of ethylene-disulfide-ethylamino group, ethylene-disulfide-ethylaminocarbonylimidazole group and salts thereof.
- PEG is a hydrophilic polymer that forms the outer layer of the unimolecular nanoparticle.
- the PEG polymeric blocks are attached to a plurality of the cationic polymers.
- Each arm of the PEG terminates in one of various groups selected from a targeting ligand, OH, O-(C1-C6)alkyl, NH 2 , biotin or a dye.
- the PEG terminates in OH or O—(C1-C6)alkyl, and in still others the PEG terminates in in an OC 1-3 alkyl group.
- the PEG terminates in a targeting ligand.
- the targeting ligand may be selected from the group consisting of a cofactor, carbohydrate, peptide, antibody, nanobody, or aptamer.
- the targeting ligand is selected from the group consisting of folic acid, mannose, GE11, cRGD, KE108, octreotide, TAT cell penetrating peptide, PSMA aptamer, TRC105, 7D12 nanobody, and CTB.
- each arm of the PEG has 23 to 340 repeat units or a molecular weight of about 1,000 to about 15,000 Da.
- Suitable molecular weights for each PEG block of the unimolecular nanoparticle include about 1,000, about 1,500, about 2,000, about 2,500, about 3,000, about 4,000, about 5,0000, about 7,500, about 10,000, or about 15,000 Da, or a range between and including any two of the foregoing values.
- the unimolecular nanoparticle includes a therapeutic RNA within the nanoparticle, such as an siRNA.
- the loading of the siRNA is about 1 to about 20 wt % of the unimolecular nanoparticle.
- the loading of the siRNA may be about 1 wt %, 2 wt %, 3 wt %, 4 wt %, 5 wt %, 6 wt %, 7 wt %, 8 wt %, 9 wt %, 10 wt %, 11 wt %, 12 wt %, 13 wt %, 14 wt %, 15 wt %, 16 wt %, 17 wt %, 18 wt %, 19 wt %, 20 wt % or a range between and including any two of the foregoing values.
- any therapeutic RNA may be used in the present unimolecular nanoparticle drug delivery systems. While not wishing to be bound by theory, it is believed that the cationic polymers of the unimolecular nanoparticle bind the therapeutic RNA via electrostatic interactions between the negatively charged phosphate backbone of the therapeutic RNA and the cationic functional groups of the cationic polymers. Hence, loading of the therapeutic RNA is independent of the base sequence of the RNA. Likewise, therapeutic RNA of a variety of sequence lengths may be loaded into the unimolecular nanoparticle. In some embodiments, the length of the therapeutic RNA is 20, 21, 22, 23 or 24 bps or a range between and including any two of the foregoing values. In certain embodiments, the length of the therapeutic RNA is from about 21 to about 23 bps.
- the therapeutic RNA loaded in the unimolecular nanoparticle is an siRNA that inhibits expression of a gene necessary for survival or growth of a cancer.
- the gene necessary for survival or growth of the cancer may be selected from oncogenes, mutated tumor suppressor genes, and genes involved in tumor progression and cell cycle progression.
- the siRNAs interfere with transcription of genes for VEGF, EphA2, protein kinase N3 (PKN3), PLK1, KSP, ribonucleotide reductase regulatory subunit M2 (RRM2), gro- ⁇ , MDR-1, androgen receptor (AR), acid ceramidase (AC), HIF1, CDK4, GATA2, and the like.
- the length of the siRNA is 20, 21, 22, 23 or 24 bps or a range between and including any two of the foregoing values. In certain embodiments, the length of the siRNA is from about 21 to about 23 bps.
- the unimolecular nanoparticles may be prepared using standard techniques. For example, a dendritic polymer in which most or all of the surface arms terminate in amino, hydroxyl, or carboxylic acid groups may be conjugated to the cationic polymers via amide, ester, or ether groups. Typically, ester and amide linkages are used for ease of formation. Likewise, the PEG blocks may be attached to the cationic polymers via ester, amide or ether groups. In some embodiments, the PEG has a hydroxy group on one end and an alkoxy or carbonylalkoxy on the other. Standard coupling conditions such as the use of tin catalysis or coupling agents or active esters may be used to form the ester or amide bonds.
- the unimolecular nanoparticles described herein may be used to treat, inhibit or prevent cancer by administering an effective amount of the unimolecular nanoparticle wherein the siRNA inhibits expression of a gene necessary for survival or growth of the cancer.
- compositions described herein can be formulated for various routes of administration, for example, by parenteral, rectal, nasal, vaginal administration, or via implanted reservoir.
- Parenteral or systemic administration includes, but is not limited to, subcutaneous, intravenous, intraperitoneal, and intramuscular injections.
- the following dosage forms are given by way of example and should not be construed as limiting the instant present technology.
- Injectable dosage forms generally include solutions or aqueous suspensions which may be prepared using a suitable dispersant or wetting agent and a suspending agent so long as such agents do not interfere with formation of the nanoparticles described herein.
- Injectable forms may be prepared with acceptable solvents or vehicles including, but not limited to sterilized water, Ringer's solution, 5% dextrose, or an isotonic aqueous saline solution.
- excipients and carriers are generally known to those skilled in the art and are thus included in the instant present technology. Such excipients and carriers are described, for example, in “Remingtons Pharmaceutical Sciences” Mack Pub. Co., New Jersey (1991), which is incorporated herein by reference.
- Specific dosages may be adjusted depending on conditions of disease, the age, body weight, general health conditions, sex, and diet of the subject, dose intervals, administration routes, excretion rate, and combinations of drug conjugates. Any of the above dosage forms containing effective amounts are well within the bounds of routine experimentation and therefore, well within the scope of the instant present technology.
- dosages may be used to administer effective amounts of the siRNA drugs to the patient and may include about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.75 mg/kg, about 1 mg/kg, about 1.25 mg/kg, about 1.5 mg/kg, or a range between and including any two of the forgoing values.
- Such amounts may be administered parenterally as described herein and may take place over a period of time including but not limited to 5 minutes, 10 minutes, 20 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, 5 hours, 10 hours, 12, hours, 15 hours, 20 hours, 24 hours or a range between and including any of the foregoing values.
- the frequency of administration may vary, for example, once per day, per 2 days, per 3 days, per week, per 10 days, per 2 weeks, or a range between and including any of the foregoing frequencies.
- the compositions may be administered once per day on 2, 3, 4, 5, 6 or 7 consecutive days. A complete regimen may thus be completed in only a few days or over the course of 1, 2, 3, 4 or more weeks.
- the nanoparticles described herein may be prepared by methods comprising dispersing the siRNA within the unimolecular nanoparticle.
- the drug delivery systems include compositions comprising unimolecular nanoparticles dispersed within a pharmaceutically acceptable carrier or one or more excipients, and an effective amount of anti-cancer siRNA dispersed within the unimolecular nanoparticle.
- “dispersed” means distributed, in a generally uniform or in a non-uniform fashion.
- the siRNA is dispersed in a generally uniform fashion within the nanoparticle.
- nanoparticles with a non-uniform distribution of siRNA especially those with small variations in concentration of the siRNA are within the scope of the present technology.
- the anti-cancer siRNA may also be non-uniformly distributed within the unimolecular nanoparticles.
- kits including the components needed to prepare any of the compositions described herein.
- a kit may include a package containing a unimolecular nanoparticle and a package containing an effective amount of siRNA and directions for use of the kit.
- the unimolecular nanoparticle may include any of those described herein and any of the siRNAs described herein.
- the kits may include separate packages for the unimolecular nanoparticles and siRNAs. The present kits allow the user to prepare the drug delivery composition described herein by dispersing the siRNA in the unimolecular nanoparticles.
- compositions include ionizable components, salts such as pharmaceutically acceptable salts of such components may also be used.
- salts such as pharmaceutically acceptable salts of such components may also be used.
- the examples herein are also presented in order to more fully illustrate the preferred aspects of the present technology. The examples should in no way be construed as limiting the scope of the present technology, as defined by the appended claims.
- the examples can include or incorporate any of the variations, aspects or aspects of the present technology described above.
- the variations, aspects or aspects described above may also further each include or incorporate the variations of any or all other variations, aspects or aspects of the present technology.
- the present technology describes a pH/redox dual-sensitive cationic unimolecular NP containing imidazole residues developed for siRNA delivery ( FIG. 1 ).
- the unimolecular NP was formed by a multi-arm star block copolymer, H40-poly(aspartic acid-(2-aminoethyl disulfide)-(4-imidazolecarboxylic acid))-poly(ethylene glycol) (i.e., H40-P(Asp-AED-ICA)-PEG), in an aqueous solution. Because of its covalent nature, the unimolecular NP has excellent stability in vitro and in vivo.
- the cationic core formed by P(Asp-AED-ICA) blocks was used for siRNA complexation through electrostatic interactions while the PEG shell was used to provide good water solubility and reduced opsonization of NPs during blood circulation.
- NPs are taken up by cells through endocytosis.
- the imidazole groups in the cationic segment have a pK a of ⁇ 6.0 and can thus absorb protons in the acidic endocytic compartments (endosomes/lysosomes), leading to osmotic swelling and endosome/lysosome-membrane disruption (i.e., the proton sponge effect), thereby facilitating the endosomal/lysosomal escape of the siRNA-complexed NPs.
- siRNA molecules were complexed within the NPs by an electrostatic interaction with a cationic P(Asp-AED-ICA) block containing cleavable disulfide bonds.
- the cationic segments were conjugated onto the hyperbranched polymer (H40) via a pH-sensitive aromatic imine bond, which can be hydrolyzed in the endosome/lysosome, but stays relatively stable at physiological conditions (pH 7.4).
- H40 hyperbranched polymer
- H7 pH-sensitive aromatic imine bond
- the GSH concentration in the cytosol is 100-1000 times higher than that in bodily fluids, including blood and extracellular milieu (2-20 ⁇ M GSH) where the disulfide bonds are stable.
- the enzyme, gamma-interferon-inducible lysosomal thiol reductase (GILT in the endosomes/lysosomes), in combination with cysteines, may also trigger the cleavage of disulfide bonds.
- GILT in the endosomes/lysosomes gamma-interferon-inducible lysosomal thiol reductase
- cysteines cysteines
- the pH/redox dual-sensitive characteristic of the NPs may facilitate the release of siRNA from the NPs.
- the NPs were also functionalized with GE11 peptide, which can efficiently bind to the epidermal growth factor receptor (EGFR) to achieve active tumor targeting.
- EGFR epidermal growth factor receptor
- EGFR is one of the most common receptors overexpressed in many types of cancer cells, including triple negative breast cancers (TNBCs), ovarian cancers, pancreatic cancers, and so on.
- TNBCs triple negative breast cancers
- ovarian cancers ovarian cancers
- pancreatic cancers pancreatic cancers
- pH/redox dual-sensitive unimolecular NPs with excellent endosomal/lysosomal escape abilities, may be promising nanocarriers for the targeted delivery of siRNA.
- BOLTRON® H40 (a hyperbranched polyester with 64 hydroxyl terminal groups; M n : 2,833 Da) was kindly provided by Perstorp Polyols Inc., USA, and purified by fractional precipitation in acetone and tetrahydrofuran (THF).
- BLA-NCA ⁇ -Benzyl 1-aspartate N-carboxyanhydride
- GE11 peptide (YHWYGYTPQNVIGGGGC) was synthesized by Tufts University Core Facility (Boston, Mass., USA).
- GFP-siRNA-Cy5.5, GFP-siRNA, dimethyl sulfoxide (DMSO), 2-carboxybenzylaldehyde, 2-aminoethyl disulfide, 4-imidazolecarboxylic acid, and stannous (II) octoate (Sn(Oct) 2 ) were purchased from Sigma-Aldrich (St. Louis, Mo., USA).
- RNAiMAX 4-Dimethylamino pyridine (DMAP) and 1,3-dicyclohexylcarbodiimide (DCC) were purchased from ACROS and used without further purification.
- P(BLA-NCA)-PEG-Mal poly(ethylene glycol)-Mal
- P(BLA-NCA)-PEG-Mal was prepared by ring-opening polymerization of BLA-NCA using NH 2 -PEG-Mal as the macro-initiator. Briefly, BLA-NCA (53 mg), and NH 2 -PEG-Mal (25 mg) were dissolved in DMF (5 mL). The reaction was carried out at 55° C. under argon for 48 h. The resulting mixture was then added dropwise into a 10-fold volume of cold diethyl ether.
- the precipitate was collected by filtration using a Buchner funnel, washed with diethyl ether, and dried under vacuum.
- the P(BLA-NCA)-PEG-OCH 3 was synthesized following a similar method using NH 2 -PEG-OCH 3 instead.
- H40-carboxybenzaldehyde i.e., H40-CHO
- H40-OH 10 mg
- 2-carboxybenzylaldehyde 82 mg
- DCC 135 mg
- DMAP 8.3 mg
- the solution was stirred at room temperature under argon for 48 h. Thereafter, the dicyclohexylurea was removed by filtration using a Buchner funnel. The solution was collected and poured into a 10-fold volume of cold diethyl ether. The precipitate was collected by filtration using a Buchner funnel, washed with diethyl ether, and dried under vacuum.
- H40-poly( ⁇ -benzyl 1-aspartate N-carboxyanhydride)-poly(ethylene glycol)-OCH 3 /Mal i.e., H40-P(BLA-NCA)-PEG-OCH 3 /Mal.
- H40-CHO 5 mg
- P(BLA-NCA)-PEG-OCH 3 25 mg
- P(BLA-NCA)-PEG-Mal 8 mg
- the reaction was conducted at room temperature for 24 h. Thereafter, the resulting solution was dialyzed (molecular weight cut-off: 15 kDa) against DMSO for the first 24 h and DI water for another 24 h.
- the product was obtained after lyophilization.
- the H40-P(BLA-NCA)-PEG-OCH 3 was synthesized following a similar method.
- H40-poly(aspartic acid-(2-aminoethyl disulfide))-poly(ethylene glycol)-OCH 3 /Mal i.e., H40-P(Asp-AED)-PEG-OCH 3 /Mal.
- 2-Aminoethyl disulfide (13.1 mg) and H40-P(BLA-NCA)-PEG-OCH 3 /Mal (20 mg) were dissolved in DMSO (10 mL). The reaction was carried out at room temperature for 24 h. Thereafter, the resulting solution was dialyzed (molecular weight cut-off: 15 kDa) against DI water for 48 h. The product was obtained after lyophilization.
- the H40-P(Asp-AED)-PEG-OCH 3 was synthesized following a similar method.
- H40-poly(aspartic acid-(2-aminoethyl disulfide)-(4-imidazolecarboxylic acid))-poly(ethylene glycol)-OCH 3 /Mal i.e., H40-P(Asp-AED-ICA)-PEG-OCH 3 /Mal.
- 4-Imidazolecarboxylic acid (2.2 mg), H40-P(Asp-AED)-PEG-OCH 3 /Mal (20 mg), DCC (4.4 mg), and N-hydroxysuccinimide (2.9 mg) were dissolved in DMSO (5 mL). The reaction was carried out at room temperature for 24 h.
- H40-poly(aspartic acid-(2-aminoethyl disulfide)-(4-imidazolecarboxylic acid))-poly(ethylene glycol)-OCH 3 /GE11 i.e., H40-(PAsp-AED-ICA)-PEG-OCH 3 /Cy5/GE11.
- Cy5-SH was first prepared by a reaction between Cy5-NH 2 and Traut's reagent. Briefly, Cy5-NH 2 (0.3 mg) and Traut's reagent (0.51 mg) were dissolved in DMSO. The solution was stirred at room temperature in complete darkness for 4 h.
- H40-P(Asp-AED-ICA)-PEG-OCH 3 /Mal (20 mg) and GE11 (1.3 mg) were added into the above solution. After 24 h, the reaction solution was dialyzed (molecular weight cut-off: 15 kDa) against DI water for 48 h. The product was obtained after lyophilization.
- the H40-P(Asp-AED-ICA)-PEG-OCH 3 /Cy5 and H40-P(Asp-AED-ICA)-PEG-OCH 3 /GE11 were synthesized following a similar method.
- H40-P(Asp-AED-ICA)-PEG-OCH 3 /Cy5 and H40-P(Asp-AED-ICA)-PEG-OCH 3 /Cy5/GE11 were only used for the cellular uptake analysis.
- H40-P(Asp-AED-ICA)-PEG-OCH 3 and H40-P(Asp-AED-ICA)-PEG-OCH 3 /GE11 were used.
- siRNA-Complexed Unimolecular NPs i.e., siRNA-complexed NPs
- Gel Retardation Assay To prepare siRNA-complexed NPs, siRNA and H40-P(Asp-AED-ICA)-PEG were dissolved in PBS and the solution was mixed for 30 min under gentle shaking. The binding ability of siRNA to NPs was studied by agarose gel electrophoresis. The siRNA-complexed NPs were prepared at different N/P ratios (molar ratio of nitrogen in polymers to phosphorus in siRNA: 2, 5, 7, 10, and 15).
- Electrophoresis was carried out on 1% agarose gel in a TAE (Tris-acetate-EDTA) buffer solution with a current of 100 V for 35 min. The final siRNA concentration was 1 ⁇ g per well.
- the retardation of the complexes was visualized on a UV illuminator (Bio-Rad Baloratories, Inc., Hercules, Calif., USA) to show the position of the complexed siRNA band relative to that of naked siRNA.
- the morphologies of the siRNA-complexed NPs were studied by dynamic light scattering (DLS; ZetaSizer Nano ZS90, Malvern Instruments, USA; 0.5 mg/mL) and transmission electron microscopy (TEM, FEI Tecnai G 2 F30 TWIN 300 KV, E.A. Fischione Instruments, Inc. USA).
- pH/redox dual-sensitive multi-arm star block copolymer H40-P(Asp-AED-ICA)-PEG-OCH 3 /Cy5/GE11 was synthesized as outlined in Scheme 1.
- P(BLA-NCA)-PEG-OCH 3 and P(BLA-NCA)-PEG-Mal were first synthesized by ring-opening polymerization of BLA-NCA using NH 2 -PEG-OCH 3 and NH 2 -PEG-Mal as the macro-initiators, respectively. Their chemical structures were confirmed by 1 H NMR spectra as shown in FIG. 2(A) and (B).
- the number of BLA-NCA repeat units in the polymers was calculated to be 20 based on the relative intensity ratio of the methylene proton (a) of the PEG chain and the methylene proton (d) near the benzyl group of the PBLA chain.
- the molecular weights of the NH 2 -PEG-OCH 3 and NH 2 -PEG-Mal polymers as measured by GPC were 9,040 and 9,105 g/mol, respectively, which was consistent with that determined by the 1 H NMR analyses.
- the benzylaldehyde-functionalized H40 (H40-CHO) was prepared by an esterification reaction.
- the chemical structure was also confirmed by 1 H NMR spectrum ( FIG. 2C ).
- the peaks at 0.97-1.2 ppm and 3.8-4.1 ppm were assigned to the protons in H40.
- the peaks at (a) 7.6-7.8 ppm corresponded to the protons in the phenyl group of H40-CHO as labeled.
- the GPC analyses further demonstrated the formation of H40-P(BLA-NCA)-PEG-OCH 3 /Mal and its molecular weight was measured to be 200,833 Da, which was significantly larger than that of the linear NH 2 -PEG-OCH 3 or NH 2 -PEG-Mal polymers.
- the average number of arms in the H40-P(BLA-NCA)-PEG-OCH 3 /Mal was calculated to be 22 based on the molecular weights of H40-P(BLA-NCA)-PEG-OCH 3 /Mal, NH 2 -PEG-OCH 3 , and NH 2 -PEG-Mal.
- H40-P(BLA-NCA)-PEG-OCH 3 /Mal polymer underwent aminolysis by using 2-aminoethyl disulfide (AED) to form water-soluble polymer H40-P(Asp-AED)-PEG-OCH 3 /Mal.
- AED 2-aminoethyl disulfide
- FIG. 3(B) the absence of proton peaks at 7.28-7.40 ppm and 5.15 ppm, and the presence of proton peaks at 2.71 and 3.17 ppm ascribed to the protons in AED, demonstrated the formation of H40-P(Asp-AED)-PEG-OCH 3 /Mal.
- Imidazole groups were selectively conjugated to H40-P(Asp-AED)-PEG-OCH 3 /Mal (molar ratio: 5/1) through an amidization reaction for enhanced endosomal/lysosomal escape.
- the characteristic proton peaks at (j) 7.23 and (k) 7.91 ppm for imidazole groups were observed in FIG. 3 (C).
- GE11 peptide and Cy5 dye were conjugated to H40-P(Asp-AED-ICA)-PEG-OCH 3 /Mal (molar ratio: 3/2/1) though a Mal-SH reaction.
- Proton peaks assigned to the GE11 and Cy5 molecules, as labeled in FIG. 3(D) were also observed.
- the cationic polymer H40-P(Asp-AED-ICA)-PEG which had good solubility in aqueous solutions, was able to form the unimolecular NPs. Because of its covalent nature, the unimolecular NPs had excellent stability in vitro and in vivo.
- siRNA GFP-siRNA was used as a model siRNA
- siRNA-complexed NPs with various N/P ratios were tested and siRNA lost mobility in the electric field when the N/P ratio reached 10, which was selected for the following tests.
- the siRNA loading level defined by the weight percentage of the siRNA in the siRNA-complexed NP was 16.3% at N/P ratio of 10, and the loading efficiency is 100%.
- siRNA-complexed NP solutions (5 mL; 100 ⁇ g/mL) were enclosed in a dialysis bag. The dialysis bag was immersed in 50 ml of the release medium and kept at 37° C. under a horizontal laboratory shaker (Thermo Scientific MaxQ Shaker, USA) at 100 rpm. At specific time points, 3 ml of release media were collected and replaced by the same volume of fresh media. GFP-siRNA-Cy5.5 was used in this experiment. The amount of released siRNA was analyzed based on the UV-vis intensity of Cy5.5 at 649 nm.
- the cellular uptake behaviors of the NPs in MDA-MB-468 TNBC cell lines were analyzed using a fluorescence microscope based on the Cy5 dye conjugated on the NPs.
- Cells were seeded (1 ⁇ 10 5 cells/ml) onto 8-well high-optical-quality plates and grown overnight.
- Cells were treated with either non-targeted NPs, targeted NPs, or targeted NPs with free GE11 peptide (2 ⁇ M; blocking assay) at an NP concentration of 100 ⁇ g/ml. After 2 h incubation, cells were washed with PBS twice, fixed with 4% PFA, and stained with DAPI for 4 h.
- MDA-MB-468 cells were incubated with siRNA-complexed NPs for 2 h at 37° C. Cells treated with pure medium or free siRNA were used as negative controls. The siRNA labeled with Cy5.5 was used for intracellular tracking. The cells were washed three times with PBS, followed by staining with LysoTracker Green DND-26 (100 nM) for endosomes/lysosomes and Hoechst (5 ng/mL) for the nuclei, for 20 min at 37° C. Cells were then washed three times with PBS. The cellular localization of siRNA was visualized with a fluorescence microscope (Nikon, Melville, N.Y.).
- siRNA-expressing MDA-MB-468 TNBC cells were provided by Professor Wei Xu.
- flow cytometry assay cells were seeded at a density of 50,000 cells/well on a 24-well plate and incubated overnight. Cells were treated with pure medium (control), siRNA-complexed non-targeted NPs (siRNA-NT), siRNA-complexed targeted NPs (siRNA-T), and siRNA complexed with RNAiMAX (i.e., siRNA-RNAiMAX; positive control). The concentration of siRNA was 40 nM.
- Cell Viability Assays were conducted using the 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium bromide (MTT) assay.
- MTT 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium bromide
- a standard MTT assay was performed by aspirating the treatment media, adding 25 ⁇ L of the medium containing 0.5 mg/ml MTT agent, and incubating at 37° C. for 4 h. Thereafter, the medium was aspirated and 75 ⁇ L of DMSO was added to each well. The plates were then measured at 570 nm using a spectrophotometer (Quant, Bio-Tek Instruments, Winooski, Vt.), and the average absorbance and percent of cell viability relative to the control (pure medium) were calculated. The cytotoxicity of siRNA-complexed NP systems was also studied.
- NPs with pH/redox dual-sensitive structures were designed to achieve decomplexation of siRNA from cationic nanocarriers and controlled release of siRNA to enhance gene silencing efficiency.
- in vitro release analyses were conducted by monitoring Cy5.5-labeled siRNA. As shown in FIG. 4(C) , the release rate was very slow at neutral pH (7.4) without adding GSH, with 7.1% of siRNA released after 48 h. In comparison, the addition of GSH (10 mM) to the solution resulted in an increased siRNA release rate (50.1% of siRNA released after 48 h).
- siRNA can be decomplexed from siRNA-complexed NPs inside of cells.
- siRNA needs to be released into the cytoplasm for efficient gene silencing. Therefore, the siRNA nanocarriers were functionalized with endosomal/lysosomal escape capabilities.
- the imidazole groups in the cationic segment promote endosomal/lysosomal escape through the proton-sponge effect, thereby facilitating the release of siRNA to the cytosol.
- fluorescence microscopy was used to assess the intracellular localizations of siRNA.
- the cells (MDA-MB-468 TNBC cell line) were treated with pure medium (control) or media containing free siRNA or siRNA-complexed nanoparticles.
- siRNA was labeled with Cy5.5 (red) for detection. After 2 h incubation, the nucleus and endosomes/lysosomes of cells were stained with Hoechst (blue) and Lysotracker (green), respectively. As shown in FIG. 5 , siRNA complexed with NPs were taken up efficiently as signified by the strong red signal.
- EGFR is overexpressed in many common types of cancer.
- an EGFR targeting peptide, GE11 was used as an active-tumor-targeting ligand to enhance cellular uptake.
- MDA-MB-468 a TNBC cell line that overexpresses EGFR, was used as the model cell line.
- Cells were incubated with either non-targeted (i.e., NPs without GE11 conjugation) or targeted (i.e., GE11 conjugated) NPs for 2 h. Cells without any treatment were used as a negative control. Cy5 was conjugated onto the NPs. Fluorescence imaging analysis was performed to compare cellular uptake. As shown in FIG.
- the targeted NPs showed a markedly higher Cy5 fluorescence intensity than non-targeted ones.
- the blocking experiment co-incubated cells with free GE11 and targeted NPs
- the cellular uptake of the targeted NPs returned to the level of the non-targeted ones, thereby demonstrating the targeting ability of GE11.
- the targeted NPs increased the cellular uptake of NPs through EGFR-mediated endocytosis.
- siRNA-complexed non-targeted NPs produced a 47% GFP down-regulation.
- the targeted NPs induced a 79% GFR reduction, which is comparable to that of RNAiMAX treatment (81%).
- the assessment of cell viability on these treatments revealed that siRNA-complexed RNAiMAX exhibited significant cytotoxicity, inducing more than 25% cell death ( FIG. 8(C) ), which is consistent with the previous report. See N. Segovia, M. Pont, N. Oliva, V. Ramos, S. Borrós, N. Artzi, Hydrogel doped with nanoparticles for local sustained release of siRNA in breast cancer, Advanced Healthcare Materials, 4 (2015) 271-280.
- GE11-conjugated NPs are suitable nanocarriers for siRNA delivery targeted at TNBC cells and, potentially, other EGFR-overexpressing cells.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Nanotechnology (AREA)
- Optics & Photonics (AREA)
- Physics & Mathematics (AREA)
- Biomedical Technology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Medicinal Preparation (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
Description
- This application claims the benefit of and priority to U.S. Provisional Application No. 62/426,004 filed Nov. 23, 2016, the contents of which is incorporated herein by reference its entirety.
- This technology was made with government support under CA166178 awarded by the National Institutes of Health. The government has certain rights in the technology.
- The present technology relates generally to the field of siRNA drug delivery systems and methods of making and using such systems. The compositions of such systems include a unimolecular nanoparticle and siRNA drug(s).
- Specific silencing of target genes using short interfering RNA (siRNA) is of significant interest for the treatment of cancers and other disease. siRNA molecules are double-stranded short chain oligonucleotides that post-transcriptionally regulate protein synthesis by sequence-specific matching with mRNA molecules, thereby resulting in specific silencing of target genes. Currently, several dozen potential siRNA therapies are undergoing clinical trials. However, due to their negatively charged nature, limited chemical stability, short plasma elimination half-life, and off target effect, naked siRNA molecules show poor therapeutic efficacy. Various viral and non-viral delivery systems have been developed to improve the efficacy of siRNA therapy. Although viral vectors provide high transfection efficiency, concerns associated with insertional mutagenesis, immunogenicity, and cytotoxicity limit their use. Non-viral delivery systems potentially offer a safer and cheaper alternative to viral vectors. Currently there is no clinically available method of siRNA delivery suitable for gene silencing for treatment of diseases such as cancer.
- In one aspect, the present technology provides a unimolecular nanoparticle that includes 1) a dendritic polymer having a molecular weight of about 500 to about 120,000 Da and terminating in hydroxyl, amino or carboxylic acid groups; 2) cationic polymers attached to at least a majority of the terminating groups of the dendritic polymer via a pH-sensitive linker, wherein each cationic polymer comprises a polymeric backbone attached to cationic functional groups and to weakly basic groups by disulfide bonds, wherein the molar ratio of cationic functional groups to weakly basic groups ranges from 1:1 to 5:1, and has a molecular weight from about 1,000 to about 5,000 Da; and 3) poly(ethylene glycol) attached to a plurality of cationic polymers and having a terminal group selected from a targeting ligand, OH, O-alkyl, NH2, biotin, or a dye, wherein the terminal group of at least one poly(ethylene glycol) is having a molecular weight of about 1,000 to about 15,000 Da.
- In some embodiments of the unimolecular nanoparticle, the dendritic polymer is a polyester or a poly(amido-amine). The dendritic polymer may be a hyper-branched polymer or a dendrimer. The dendritic polymer may have from 3-7 generations. In some embodiments, the dendritic polymer is a poly(amido-amine) dendrimer having 3 to 4 generations. In other embodiments, the dendritic polymer is a hyperbranched polyester having 3 to 4 generations.
- In some embodiments of the unimolecular nanoparticle, the pH-sensitive linker contains an imine, hydrazone or cis-aconityl group.
- In some embodiments of the unimolecular nanoparticle, each cationic polymer includes a polyamide backbone, disulfide linkers, amino and/or ammonium groups, and imidazole groups. The polyamide backbone may be, e.g., a polyasparagine, polyglutamine, polyornithine, or polylysine. In some embodiments, the cationic polymers comprises moieties selected from the group consisting of a (C2-6 alkylene)disulfide(C2-C6 alkyl)amino group, a (C2-6 alkylene)disulfide(C2-C6 alkyl)aminocarbonylimidazole group, and salts thereof. In certain embodiments, the cationic polymers comprise moieties selected from the group consisting of ethylene-disulfide-ethylamino group, ethylene-disulfide-ethylaminocarbonylimidazole group and salts thereof
- In some embodiments of the unimolecular nanoparticle, the targeting ligand is a cofactor, carbohydrate, peptide, antibody, nanobody, or aptamer. For example, the targeting ligand may be selected from the group consisting of folic acid, mannose, GE11, cRGD, KE108, octreotide, TAT cell penetrating peptide, PSMA aptamer, TRC105, 7D12 nanobody, CTB.
- In some embodiments, the unimolecular nanoparticle includes a therapeutic RNA within the nanoparticle. The therapeutic RNA may be an siRNA. The loading of the siRNA may be about 1 to about 20 wt % of the unimolecular nanoparticle.
- In some embodiments of the unimolecular nanoparticle, the dendritic polymer is a hyperbranched polyester having 3-4 generations and a molecular weight of about 3,600 to about 7,400 Da; the pH-sensitive linker is a benzylimine; each cationic polymer has a polyasparagine backbone attached to an ethylene-disulfide-ethylamino or ethylene-disulfide-ethylaminocarbonylimidazole group or salt thereof, and the molar ratio of the amino to imidazole functional groups is from 1:1 to 5:1; and the molecular weight of the PEG is about 1,000 to about 15,000 Da.
- In another aspect, the present technology provides a method of preparing a unimolecular nanoparticle comprising dispersing therapeutic RNA within any unimolecular nanoparticle described herein
- In another aspect, the present technology provides compositions comprising a unimolecular nanoparticle as described herein and a pharmaceutically acceptable carrier.
- In one aspect, the present technology provides methods of treating a cancer by administering an effective amount of a unimolecular nanoparticle as described herein loaded with a therapeutic RNA, wherein the therapeutic RNA inhibits expression of a gene necessary for survival or growth of the cancer. In some embodiments of the method, therapeutic RNA is siRNA having a length of 19 base pairs (bps) to 25 bps.
- In another aspect, the present technology provides a kit comprising a package containing a unimolecular nanoparticle as described herein and a package containing an effective amount of therapeutic siRNA and directions for use of the kit.
-
FIG. 1 shows a schematic diagram of the cellular uptake of siRNA-complexed unimolecular NPs and the subcellular release of siRNA from the siRNA-complexed NPs into the cytosol. pH/redox dual-sensitive unimolecular NPs with excellent endosomal/lysosomal escape and intracellular siRNA decomplexation capabilities for efficient targeted delivery of siRNA. -
FIGS. 2A-2C show 1H NMR spectra of P(BLA-NCA)-PEG-OCH3 (FIG. 2A ), P(BLA-NCA)-PEG-Mal (FIG. 2B ), and H40-CHO (FIG. 2C ). -
FIGS. 3A-3D show 1H NMR spectra of H40-P(BLA-NCA)-PEG-OCH3/Mal (FIG. 3A ), H40-P(Asp-AED)-PEG-OCH3/Mal (FIG. 3B ), H40-P(Asp-AED-ICA)-PEG-OCH3/Mal (FIG. 3D ), and H40-P(Asp-AED-ICA)-PEG-OCH3/Cy5/GE11 (FIG. 3D ). -
FIG. 4A shows gel retardation assays of siRNA/NPs with various N/P ratios.FIG. 4B shows transmission electron microscopy (TEM) images of the siRNA-complexed NPs (N/P=10).FIG. 4C shows in vitro siRNA release from siRNA-complexed NPs in different buffers at 37° C. Data represent mean±SD (n=3). -
FIG. 5 shows an assessment of the endosomal/lysosomal escape of siRNA-complexed NPs in MDA-MB-468 cells after 2 h incubation. Endosomes/lysosomes were stained with Lysotracker (green). siRNA was labeled with Cy5.5 (red). The nuclei were stained with Hoechst (blue). Scale bar: 20 μm. -
FIG. 6 shows z-stack images for the assessment of the endosomal/lysosomal escape of siRNA-complexed NPs in MDA-MB-468 cells. Scale bar: 2 μm. -
FIG. 7 shows the in vitro cellular uptake analysis. Fluorescence images of MDA-MB-468 TNBC cells incubated with pure medium (control), Cy5-labeled non-targeted (without GE11 conjugation) NPs, Cy5-labeled targeted (GE11-conjugated) NPs with a blocking dose (2 μM) of GE11 (i.e., blocking), and Cy5-labeled targeted NPs at 37° C. for 2 h (NP concentration: 100 μg/mL). Targeted NPs significantly enhanced the cellular uptake in EGFR-overexpressing TNBC cells. Scale bar: 50 μm. -
FIGS. 8A-B show an in vitro assessment of gene silencing efficiency using (inFIG. 8A ) fluorescence microscope and (inFIG. 8B ) flow cytometry. GFP-expressing MDA-MA-468 cells treated with pure medium (control), siRNA-complexed non-targeted NPs (siRNA-NT), siRNA-complexed targeted NPs (siRNA-T), and siRNA-complexed RNAiMAX (siRNA-RNAiMAX) for 24 h (40 nM of GFP-siRNA).FIG. 8C shows cell viability analysis for MDA-MA-468 cells treated with pure medium (control), siRNA-NT, siRNA-T, siRNA-RNAiMAX, and pure RNAiMAX for 24 h (40 nM of GFP-siRNA). All values are presented as a mean±SD (n=5); **: p<0.01; NS: not significant. Scale bar: 100 μm. -
FIG. 9 shows a schematic of an illustrative embodiment of an siRNA-complexed unimolecular nanoparticle (NP) of the present technology including a core comprised of H40 polyester hyperbranched polymer attached to cationic polymers, which in turn are attached to hydrophilic PEG segments and terminating in various functional groups, including dye(s) and the targeting ligand GE11. siRNA molecules partition within the NPs by electrostatic interactions. - The following terms are used throughout as defined below. All other terms and phrases used herein have their ordinary meanings as one of skill in the art would understand.
- As used herein and in the appended claims, singular articles such as “a” and “an” and “the” and similar referents in the context of describing the elements (especially in the context of the following claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context.
- As used herein, “about” will be understood by persons of ordinary skill in the art and will vary to some extent depending upon the context in which it is used. If there are uses of the term which are not clear to persons of ordinary skill in the art, given the context in which it is used, “about” will mean up to plus or minus 10% of the particular term.
- “Molecular weight” as used herein with respect to polymers refers to weight average molecular weights (Mw) and can be determined by techniques well known in the art including gel permeation chromatography (GPC). GPC analysis can be performed, for example, on a D6000M column calibrated with poly(methyl methacrylate) (PMMA) using triple detectors including a refractive index (RI) detector, a viscometer detector, and a light scattering detector, and dimethylformamide as the eluent.
- The terms “cancer,” “neoplasm,” “tumor,” “malignancy” and “carcinoma,” used interchangeably herein, refer to cells or tissues that exhibit an aberrant growth phenotype characterized by a significant loss of control of cell proliferation. The methods and compositions of this disclosure apply to malignant, pre-metastatic, metastatic, and non-metastatic cells.
- The term “therapeutic RNA” refers to single strand or duplex RNA that modulates (e.g., silences, reduces, or inhibits) expression of a target gene, e.g., by mediating the degradation of mRNAs which are complementary to the sequence of the interfering RNA, by providing an RNA that is absent or expressed at a lower level in a subject having a particular disease or condition relative to its levels in a subject that does not have the same disease or condition. Examples of therapeutic RNAs include siRNA and miRNA.
- The term “small-interfering RNA” or “siRNA” refers to double-stranded RNA (i.e., duplex RNA) that modulates (e.g., silences, reduces, or inhibits) expression of a target gene, e.g., by mediating the degradation of mRNAs which are complementary to the sequence of the siRNA. Typically, siRNA has complete identity or complementarity to the corresponding RNA sequence of its target mRNA. siRNA includes RNA of having 15-60, 15-50, 15-50, or 15-40 (duplex) nucleotides in length, more typically about, 15-30, 15-25 or 19-25 (duplex) nucleotides in length, and may be 20-24, 21-22 or 21-23 (duplex) nucleotides in length. siRNA duplexes may include 3′ overhangs of 1, 2, 3, or 4 nucleotides and/or 5′ phosphate termini. The siRNA can be chemically synthesized or may be encoded by a plasmid (e.g., transcribed as sequences that automatically fold into duplexes with hairpin loops). siRNA can also be generated by cleavage of longer dsRNA (e.g., dsRNA greater than about 25 nucleotides in length) with the E. coli RNase III or Dicer. These enzymes process the dsRNA into biologically active siRNA (see, e.g., Yang et al., PNAS USA 99: 9942-7 (2002); Calegari et al., PNAS USA 99: 14236 (2002); Byrom et al., Ambion TechNotes 10(1): 4-6 (2003); Kawasaki et al., Nucleic Acids Res. 31: 981-7 (2003); Knight and Bass, Science 293: 2269-71 (2001); and Robertson et al., J. Biol. Chem. 243: 82 (1968)). Preferably, dsRNA are at least 50 nucleotides to about 100, 200, 300, 400 or 500 nucleotides in length. A dsRNA may be as long as 1000, 1500, 2000, 5000 nucleotides in length, or longer. The dsRNA can encode for an entire gene transcript or a partial gene transcript.
- The phrase “inhibits expression of a gene” refers to the ability of a therapeutic RNA, such as an siRNA, of the technology to silence, reduce, or inhibit expression of a target gene (e.g., VEGF, EphA2, protein kinase N3 (PKN3), etc.). To examine the extent of gene silencing, a test sample (e.g., a biological sample from organism of interest expressing the target gene or a sample of cells in culture expressing the target gene) is contacted with an siRNA that silences, reduces, or inhibits expression of the target gene. Expression of the target gene in the test sample is compared to expression of the target gene in a control sample (e.g., a biological sample from organism of interest expressing the target gene or a sample of cells in culture expressing the target gene) that is not contacted with the siRNA. Control samples (i.e., samples expressing the target gene) are assigned a value of 100%. Silencing, inhibition, or reduction of expression of a target gene is achieved when the value of the test sample relative to the control sample is about 95%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 10%, 0% or a range between and including any two of the foregoing values. Suitable assays include, e.g., examination of mRNA levels using techniques known to those of skill in the art such as dot blots, northern blots, in situ hybridization, ELISA, immunoprecipitation, enzyme function, as well as phenotypic assays known to those of skill in the art.
- The phrase “a targeted receptor” refers to a receptor expressed by a cell that is capable of binding a cell targeting ligand. The cell targeting ligand may be a “tumor cell targeting ligand.” The receptor may be expressed on the surface of the cell. The receptor may be a transmembrane receptor. Examples of such targeted receptors include EGFR, αvβ3 integrin, somatostatin receptor, folate receptor, prostate-specific membrane antigen, CD105, mannose receptor, and GM1 ganglioside.
- The phrase “tumor cell targeting ligand” refers to a ligand that binds to “a targeted receptor” unique to or overexpressed by a cancer cell. The ligands may be capable of binding due to preferential expression of a receptor for the ligand, accessible for ligand binding, on the cancer cells. Examples of such ligands include GE11 peptide, cRGD ((cyclo (RGDfC)), KE108 peptide, octreotide, folic acid, prostate-specific membrane antigen (PSMA) aptamer, TRC105, a human/murine chimeric IgG1 monoclonal antibody, 7D12 nanobody, mannose, and cholera toxin B (CTB). Additional examples of such ligands include Rituximab, Trastuzumab, Bevacizumab, Alemtuzumab, Panitumumab, RGD, DARPins, RNA aptamers, DNA aptamers, analogs of folic acid and other folate receptor-binding molecules, lectins, other vitamins, peptide ligands identified from library screens, tumor-specific peptides, tumor-specific aptamers, tumor-specific carbohydrates, tumor-specific monoclonal or polyclonal antibodies, Fab or scFv (i.e., a single chain variable region) fragments of antibodies such as, for example, an Fab fragment of an antibody directed to EphA2 or other proteins specifically expressed or uniquely accessible on metastatic cancer cells, small organic molecules derived from combinatorial libraries, growth factors, such as EGF, FGF, insulin, and insulin-like growth factors, and homologous polypeptides, somatostatin and its analogs, transferrin, lipoprotein complexes, bile salts, selecting, steroid hormones, Arg-Gly-Asp containing peptides, retinoids, various galectins, δ-opioid receptor ligands, cholecystokinin A receptor ligands, ligands specific for angiotensin AT1 or AT2 receptors, peroxisome proliferator-activated receptor γ ligands, β-lactam antibiotics, small organic molecules including antimicrobial drugs, and other molecules that bind specifically to a receptor preferentially expressed on the surface of tumor cells or on an infectious organism, or fragments of any of these molecules.
- In some embodiments, a cell penetrating peptide may also be attached to one or more PEG terminal groups in addition to the targeting ligand. A “cell penetrating peptide,” also referred to as a “protein transduction domain (PTD),” a “membrane translocating sequence,” and a “Trojan peptide”, refers to a short peptide (e.g., from 4 to about 40 amino acids) that has the ability to translocate across a cellular membrane to gain access to the interior of a cell and to carry into the cells a variety of covalently and noncovalently conjugated cargoes, including proteins, oligonucleotides, and liposomes. They are typically highly cationic and rich in arginine and lysine amino acids. Examples of such peptides include TAT cell penetrating peptide (GRKKRRQRRRPQ); MAP (KLAL) KLALKLALKALKAALKLA; Penetratin or Antenapedia PTD RQIKWFQNRRMKWKK; Penetratin-Arg: RQIRIWFQNRRMRWRR; antitrypsin (358-374): CSIPPEVKFNKPFVYLI; Temporin L: FVQWFSKFLGRIL-NH2; Maurocalcine: GDC(acm)LPHLKLC; pVEC (Cadherin-5): LLIILRRRIRKQAHAHSK; Calcitonin: LGTYTQDFNKFHTFPQTAIGVGAP; Neurturin: GAAEAAARVYDLGLRRLRQRRRLRRERVRA; Penetratin: RQIKIWFQNRRMKWKKGG; TAT-HA2 Fusion Peptide: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG; TAT (47-57) YGRKKRRQRRR; SynB1 RGGRLSYSRRRFSTSTGR; SynB3 RRLSYSRRRF; PTD-4 PIRRRKKLRRL; PTD-5 RRQRRTSKLMKR; FHV Coat-(35-49) RRRRNRTRRNRRRVR; BMV Gag-(7-25) KMTRAQRRAAARRNRWTAR; HTLV-II Rex-(4-16) TRRQRTRRARRNR; HIV-1 Tat (48-60) or D-Tat GRKKRRQRRRPPQ; R9-Tat GRRRRRRRRRPPQ; Transportan GWTLNSAGYLLGKINLKALAALAKKIL chimera; MAP KLALKLALKLALALKLA; SBP or Human P1 MGLGLHLLVLAAALQGAWSQPKKKRKV; FBP GALFLGWLGAAGSTMGAWSQPKKKRKV; MPG ac-GALFLGFLGAAGSTMGAWSQPKKKRKV-cya (wherein cya is cysteamine); MPG(ANLS) ac-GALFLGFLGAAGSTMGAWSQPKSKRKV-cya; Pep-1 or Pep-1-Cysteamine ac-KETWWETWWTEWSQPKKKRKV-cya; Pep-2 ac-KETWFETWFTEWSQPKKKRKV-cya; Periodic sequences, Polyarginines RxN (4<N<17) chimera; Polylysines K×N (4<N<17) chimera; (RAca)6R; (RAbu)6R; (RG)6R; (RM)6R; (RT)6R; (RS)6R; R10; (RA)6R; and R7.
- A “dye” refers to small organic molecules having a molecular weight of 2000 Da or less or a protein which is able to emit light. Non-limiting examples of dyes include fluorophores, chemiluminescent or phosphorescent entities. For example, dyes useful in the present technology include but are not limited to cyanine dyes (e.g., Cy2, Cy3, Cy5, Cy5.5, Cy7, and sulfonated versions thereof), fluorescein isothiocyanate (FITC), ALEXA FLUOR® dyes (e.g., ALEXA FLUOR® 488, 546, or 633), DYLIGHT® dyes (e.g., DYLIGHT® 350, 405, 488, 550, 594, 633, 650, 680, 755, or 800) or fluorescent proteins such as GFP (Green Fluorescent Protein).
- The present technology provides pharmaceutical compositions and medicaments comprising any of one of the embodiments of the siRNA delivery systems disclosed herein and a pharmaceutically acceptable carrier or one or more excipients. The compositions may be used in the methods and treatments described herein. In one aspect the present technology provides a drug delivery system for the prevention or treatment of cancer. The pharmaceutical composition may include an effective amount of any of one of the embodiments of the compositions disclosed herein. In any of the above embodiments, the effective amount may be determined in relation to a subject. “Effective amount” refers to the amount of compound or composition required to produce a desired effect. One example of an effective amount includes amounts or dosages that yield acceptable toxicity and bioavailability levels for therapeutic (pharmaceutical) use including, but not limited to, the inhibition (i.e., slowing, halting or reversing) or treatment of cancer in a subject. As used herein, a “subject” or “patient” is a mammal, such as a cat, dog, rodent or primate. Typically the subject is a human, and, preferably, a human at risk for or suffering from cancer. The term “subject” and “patient” can be used interchangeably. An effective amount of a therapeutic RNA, such as an siRNA or a therapeutically effective amount of a siRNA is an amount sufficient to produce the desired effect, e.g., a decrease in the expression of a target sequence in comparison to the normal expression level detected in the absence of the siRNA.
- In one aspect, the present technology provides unimolecular nanoparticles designed to deliver therapeutic RNA selectively to tumor cells. The RNA is protected within the nanoparticles until it reaches the cytoplasm of the targeted cell. The technology employs a unique combination of pH sensitive and redox sensitive functionality to release the RNA intact from the nanoparticles only once the nanoparticles are within the targeted cells.
- The present unimolecular nanoparticles include three distinct polymeric domains: a dendritic polymer, which serves as the core, cationic polymers attached to the terminal groups of the dendritic polymer and PEG, attached to the terminal groups of the cationic polymers. Thus, the unimolecular nanoparticle may be described as a multi-arm star-like block copolymer. Therapeutic RNA, such as siRNA or miRNA may be loaded into the unimolecular nanoparticles described herein. While not wishing to be bound by theory, it is believed that the therapeutic RNA is bound by electrostatic interactions with the cationic polymers on the interior of the nanoparticle.
- The dendritic polymer has a molecular weight of about 500 to about 120,000 Da and terminates in hydroxyl, amino or carboxylic acid groups. The molecular weight of the dendritic polymer will vary based on the type of polymer and number of generations employed. Suitable molecular weights include about 500, about 1000, about 2000, about 3000, about 4000, about 5000, about 6000, about 7000, about 8000, about 9000, about 10,000, about 15,000, about 20,000, about 30,000, about 40,000, about 50,000, about 75,000, about 100,000, about 120,000 Da, or a range between and including any two of the forgoing values. In some embodiments the molecular weight of the dendritic polymer is about 1,000 to about 10,000 Da. The core of the unimolecular nanoparticle may be a dendrimer such as a poly(amido-amine) (PAMAM) dendrimer having from 3 to 7 generations (e.g., 3, 4, 5, 6, or 7 generations or a range between and including any two of the foregoing values) or a hyperbranched polymer such as a polyester hyperbranched polymer (e.g., Boltorn H30 and H40, which are prepared from 2,2-bis(methylol)propionic acid). PAMAM will be understood to refer to a polymer having a C2-C4 α, ω-diamine initiator and C3-C4 acrylate and diamine building blocks for each subsequent generation. Typically the building blocks are
C 2 1,2-diamines and C3 acrylates (not counting the methyl ester carbon, which serves as a temporary protecting group). In some embodiments, the PAMAM dendrimer has from 3 to 4 generations. In some embodiments, the dendritic polymer is a hyperbranched polyester having 3 to 4 generations. The number of generations will determine the number of arms available for attachment to the cationic polymers. Although not every arm of the dendritic polymer must terminate in amino, hydroxyl, carboxylic acid groups, the majority of arms of the dendritic polymer do, e.g., more than 50%, more than 60%, more than 70%, more than 80% or more than 90% of arms of the dendritic polymer terminate in amino, hydroxyl, or carboxylic acid groups. In some embodiments, e.g., where the dendritic polymer is PAMAM, all of the arms terminate in amino groups, hydroxyl groups, or carboxylic acid groups. - The cationic polymers of the unimolecular nanoparticle link the core dendritic polymer to the outer poly(ethylene glycol) (PEG) blocks. The cationic polymers of the unimolecular nanoparticles are attached to at least a majority of the terminating groups of the dendritic polymer via a pH-sensitive linker. The pH-sensitive linker includes a functional group which is readily hydrolyzed upon a change from alkaline pH to acid pH. In some embodiments the pH-sensitive linker will be stable at the pH of blood (about 7.4) and extracellular space in tissue, but hydrolyze at the lower pH of the endosome or lysosome (about 5.5-6.5). Suitable pH-sensitive linkers include imine (e.g., benzylamine), hydrazone and cis-aconityl linkers. While not wishing to be bound by theory, hydrolysis of the pH-sensitive linker is intended to release the block cationic-PEG copolymer from the dendritic core upon a change in pH from alkaline to acid.
- Each cationic polymer is made up of a polymeric backbone attached to cationic functional groups and to weakly basic groups by redox-sensitive linkers that include disulfide bonds. The polymeric backbone may be a polyamide backbone such as a found in peptides and proteins. In some embodiments the polyamide is a polyasparagine, polyglutamine, polyornithine, or polylysine. The cationic functional groups may be functional groups having a pka of at least about 8 (e.g., a pka of 8, 8.5, 9, 9.5, 10, 10.5, 11 or a range between and including any two of the foregoing values). Suitable groups include primary, secondary and tertiary amines, amidines, and guanidines. It will be understood that the cationic functional groups may be attached to the sidechains of the polyamide backbone. For example aspartic acid and glutamic acid side chains may be derivatized with disulfides formed from aminoalkylenethiols: (polyamide backbone)-CH2CH2—C(O)NH-(C1-6 alkylene)-S—S-(C1-C6 alkylene)-NH2), or (polyamide backbone)-CH2—C(O)NH-(C1-6 alkylene)-S—S-(C1-C6 alkylene)-NH2). When derivatized in this fashion, it will be understood that the polyaspartic acid or polyglutamic acid are now a polyasparagine or a polyglutamine, respectively. Similarly, polyornithine and polylysine may be attached to cationic functional groups through suitably functionalized species such as carboxy-alkylene-disulfide-alkylene-amino groups, e.g., (polyamide backbone)-CH2CH2-CHNH-C(O)-(C1-6 alkylene)-S-S-(C1-C6 alkylene)-NH2), or (polyamide backbone)-CH2CH2CH2NH—C(O)-(C1-6 alkylene)-S—S-(C1-C6 alkylene)-NH2).
- Weakly basic groups useful in the unimolecular nanoparticles may have a pKa between about 5.5 and about 7.0, e.g., a pKa of 5.5, 5.75, 6, 6.25, 6.5, 6.75, 7, or a range between and including any two of the foregoing values. In some embodiments, the weakly basic group is imidazole or pyridinyl. In certain embodiments, the molar ratio of cationic functional groups to weakly basic groups ranges from 1 to 5; in others it is 2 to 4. Suitable molar ratios include about 1, about 2, about 3, about 4, and about 5 or a range between and including any two of the foregoing values.
- In certain embodiments, the cationic polymer has a molecular weight from about 1,000 to about 5,000 Da; in others it is about 1,500 to about 4,000 Da. Suitable molecular weights for the cationic polymers include about 1,000, about 1,500, about 2,000, about 2,500, about 3,000, about 3,500, about 4,000, about 4,500, about 5,000 or a range between and including any two of the foregoing values.
- In some embodiments, each cationic polymer comprises a polyamide backbone, disulfide linkers, amino groups, and imidazole groups. In some embodiments, the cationic polymers comprise moieties selected from the group consisting of (C2-6 alkylene)disulfide(C2-C6 alkyl)amino group, (C2-6 alkylene)disulfide(C2-C6 alkyl)aminocarbonylimidazole group, and salts thereof. the cationic polymers comprise moieties selected from the group consisting of ethylene-disulfide-ethylamino group, ethylene-disulfide-ethylaminocarbonylimidazole group and salts thereof.
- PEG is a hydrophilic polymer that forms the outer layer of the unimolecular nanoparticle. The PEG polymeric blocks are attached to a plurality of the cationic polymers. Each arm of the PEG terminates in one of various groups selected from a targeting ligand, OH, O-(C1-C6)alkyl, NH2, biotin or a dye. In some embodiments the PEG terminates in OH or O—(C1-C6)alkyl, and in still others the PEG terminates in in an OC1-3 alkyl group. In still other embodiments, the PEG terminates in a targeting ligand. The targeting ligand may be selected from the group consisting of a cofactor, carbohydrate, peptide, antibody, nanobody, or aptamer. In other embodiments, the targeting ligand is selected from the group consisting of folic acid, mannose, GE11, cRGD, KE108, octreotide, TAT cell penetrating peptide, PSMA aptamer, TRC105, 7D12 nanobody, and CTB.
- Typically each arm of the PEG has 23 to 340 repeat units or a molecular weight of about 1,000 to about 15,000 Da. Suitable molecular weights for each PEG block of the unimolecular nanoparticle include about 1,000, about 1,500, about 2,000, about 2,500, about 3,000, about 4,000, about 5,0000, about 7,500, about 10,000, or about 15,000 Da, or a range between and including any two of the foregoing values.
- In another aspect, the unimolecular nanoparticle includes a therapeutic RNA within the nanoparticle, such as an siRNA. In some embodiments, the loading of the siRNA is about 1 to about 20 wt % of the unimolecular nanoparticle. For example, the loading of the siRNA may be about 1 wt %, 2 wt %, 3 wt %, 4 wt %, 5 wt %, 6 wt %, 7 wt %, 8 wt %, 9 wt %, 10 wt %, 11 wt %, 12 wt %, 13 wt %, 14 wt %, 15 wt %, 16 wt %, 17 wt %, 18 wt %, 19 wt %, 20 wt % or a range between and including any two of the foregoing values.
- Any therapeutic RNA may be used in the present unimolecular nanoparticle drug delivery systems. While not wishing to be bound by theory, it is believed that the cationic polymers of the unimolecular nanoparticle bind the therapeutic RNA via electrostatic interactions between the negatively charged phosphate backbone of the therapeutic RNA and the cationic functional groups of the cationic polymers. Hence, loading of the therapeutic RNA is independent of the base sequence of the RNA. Likewise, therapeutic RNA of a variety of sequence lengths may be loaded into the unimolecular nanoparticle. In some embodiments, the length of the therapeutic RNA is 20, 21, 22, 23 or 24 bps or a range between and including any two of the foregoing values. In certain embodiments, the length of the therapeutic RNA is from about 21 to about 23 bps.
- In some embodiments, the therapeutic RNA loaded in the unimolecular nanoparticle is an siRNA that inhibits expression of a gene necessary for survival or growth of a cancer. The gene necessary for survival or growth of the cancer may be selected from oncogenes, mutated tumor suppressor genes, and genes involved in tumor progression and cell cycle progression. In certain embodiments, the siRNAs interfere with transcription of genes for VEGF, EphA2, protein kinase N3 (PKN3), PLK1, KSP, ribonucleotide reductase regulatory subunit M2 (RRM2), gro-α, MDR-1, androgen receptor (AR), acid ceramidase (AC), HIF1, CDK4, GATA2, and the like. In some embodiments, the length of the siRNA is 20, 21, 22, 23 or 24 bps or a range between and including any two of the foregoing values. In certain embodiments, the length of the siRNA is from about 21 to about 23 bps.
- The unimolecular nanoparticles may be prepared using standard techniques. For example, a dendritic polymer in which most or all of the surface arms terminate in amino, hydroxyl, or carboxylic acid groups may be conjugated to the cationic polymers via amide, ester, or ether groups. Typically, ester and amide linkages are used for ease of formation. Likewise, the PEG blocks may be attached to the cationic polymers via ester, amide or ether groups. In some embodiments, the PEG has a hydroxy group on one end and an alkoxy or carbonylalkoxy on the other. Standard coupling conditions such as the use of tin catalysis or coupling agents or active esters may be used to form the ester or amide bonds.
- The unimolecular nanoparticles described herein may be used to treat, inhibit or prevent cancer by administering an effective amount of the unimolecular nanoparticle wherein the siRNA inhibits expression of a gene necessary for survival or growth of the cancer.
- The compositions described herein can be formulated for various routes of administration, for example, by parenteral, rectal, nasal, vaginal administration, or via implanted reservoir. Parenteral or systemic administration includes, but is not limited to, subcutaneous, intravenous, intraperitoneal, and intramuscular injections. The following dosage forms are given by way of example and should not be construed as limiting the instant present technology.
- Injectable dosage forms generally include solutions or aqueous suspensions which may be prepared using a suitable dispersant or wetting agent and a suspending agent so long as such agents do not interfere with formation of the nanoparticles described herein. Injectable forms may be prepared with acceptable solvents or vehicles including, but not limited to sterilized water, Ringer's solution, 5% dextrose, or an isotonic aqueous saline solution.
- Besides those representative dosage forms described above, pharmaceutically acceptable excipients and carriers are generally known to those skilled in the art and are thus included in the instant present technology. Such excipients and carriers are described, for example, in “Remingtons Pharmaceutical Sciences” Mack Pub. Co., New Jersey (1991), which is incorporated herein by reference.
- Specific dosages may be adjusted depending on conditions of disease, the age, body weight, general health conditions, sex, and diet of the subject, dose intervals, administration routes, excretion rate, and combinations of drug conjugates. Any of the above dosage forms containing effective amounts are well within the bounds of routine experimentation and therefore, well within the scope of the instant present technology. By way of example only, such dosages may be used to administer effective amounts of the siRNA drugs to the patient and may include about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.75 mg/kg, about 1 mg/kg, about 1.25 mg/kg, about 1.5 mg/kg, or a range between and including any two of the forgoing values. Such amounts may be administered parenterally as described herein and may take place over a period of time including but not limited to 5 minutes, 10 minutes, 20 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, 5 hours, 10 hours, 12, hours, 15 hours, 20 hours, 24 hours or a range between and including any of the foregoing values. The frequency of administration may vary, for example, once per day, per 2 days, per 3 days, per week, per 10 days, per 2 weeks, or a range between and including any of the foregoing frequencies. Alternatively, the compositions may be administered once per day on 2, 3, 4, 5, 6 or 7 consecutive days. A complete regimen may thus be completed in only a few days or over the course of 1, 2, 3, 4 or more weeks.
- The nanoparticles described herein may be prepared by methods comprising dispersing the siRNA within the unimolecular nanoparticle. The drug delivery systems include compositions comprising unimolecular nanoparticles dispersed within a pharmaceutically acceptable carrier or one or more excipients, and an effective amount of anti-cancer siRNA dispersed within the unimolecular nanoparticle. As used herein, “dispersed” means distributed, in a generally uniform or in a non-uniform fashion. In some embodiments, the siRNA is dispersed in a generally uniform fashion within the nanoparticle. However, it will be understood that nanoparticles with a non-uniform distribution of siRNA, especially those with small variations in concentration of the siRNA are within the scope of the present technology. The anti-cancer siRNA may also be non-uniformly distributed within the unimolecular nanoparticles.
- In another aspect, the present technology provides kits including the components needed to prepare any of the compositions described herein. For example, a kit may include a package containing a unimolecular nanoparticle and a package containing an effective amount of siRNA and directions for use of the kit. In such kits, the unimolecular nanoparticle may include any of those described herein and any of the siRNAs described herein. In some embodiments, the kits may include separate packages for the unimolecular nanoparticles and siRNAs. The present kits allow the user to prepare the drug delivery composition described herein by dispersing the siRNA in the unimolecular nanoparticles.
- The examples herein are provided to illustrate advantages of the present technology and to further assist a person of ordinary skill in the art with preparing or using the nanoparticle compositions of the present technology. To the extent that the compositions include ionizable components, salts such as pharmaceutically acceptable salts of such components may also be used. The examples herein are also presented in order to more fully illustrate the preferred aspects of the present technology. The examples should in no way be construed as limiting the scope of the present technology, as defined by the appended claims. The examples can include or incorporate any of the variations, aspects or aspects of the present technology described above. The variations, aspects or aspects described above may also further each include or incorporate the variations of any or all other variations, aspects or aspects of the present technology.
- The present technology describes a pH/redox dual-sensitive cationic unimolecular NP containing imidazole residues developed for siRNA delivery (
FIG. 1 ). The unimolecular NP was formed by a multi-arm star block copolymer, H40-poly(aspartic acid-(2-aminoethyl disulfide)-(4-imidazolecarboxylic acid))-poly(ethylene glycol) (i.e., H40-P(Asp-AED-ICA)-PEG), in an aqueous solution. Because of its covalent nature, the unimolecular NP has excellent stability in vitro and in vivo. The cationic core formed by P(Asp-AED-ICA) blocks was used for siRNA complexation through electrostatic interactions while the PEG shell was used to provide good water solubility and reduced opsonization of NPs during blood circulation. NPs are taken up by cells through endocytosis. The imidazole groups in the cationic segment have a pKa of ˜6.0 and can thus absorb protons in the acidic endocytic compartments (endosomes/lysosomes), leading to osmotic swelling and endosome/lysosome-membrane disruption (i.e., the proton sponge effect), thereby facilitating the endosomal/lysosomal escape of the siRNA-complexed NPs. Moreover, siRNA molecules were complexed within the NPs by an electrostatic interaction with a cationic P(Asp-AED-ICA) block containing cleavable disulfide bonds. The cationic segments were conjugated onto the hyperbranched polymer (H40) via a pH-sensitive aromatic imine bond, which can be hydrolyzed in the endosome/lysosome, but stays relatively stable at physiological conditions (pH 7.4). Furthermore, once inside the cells, it was expected that the pendant mercaptoethylamine group (SH—CH2—CH2—NH2) would be cleaved from the P(Asp-AED-ICA) block by highly concentrated GSH (2-10 mM) in the cytosol. The GSH concentration in the cytosol is 100-1000 times higher than that in bodily fluids, including blood and extracellular milieu (2-20 μM GSH) where the disulfide bonds are stable. The enzyme, gamma-interferon-inducible lysosomal thiol reductase (GILT in the endosomes/lysosomes), in combination with cysteines, may also trigger the cleavage of disulfide bonds. Hence, the pH/redox dual-sensitive characteristic of the NPs may facilitate the release of siRNA from the NPs. The NPs were also functionalized with GE11 peptide, which can efficiently bind to the epidermal growth factor receptor (EGFR) to achieve active tumor targeting. EGFR is one of the most common receptors overexpressed in many types of cancer cells, including triple negative breast cancers (TNBCs), ovarian cancers, pancreatic cancers, and so on. These pH/redox dual-sensitive unimolecular NPs, with excellent endosomal/lysosomal escape abilities, may be promising nanocarriers for the targeted delivery of siRNA. - Preparation of siRNA-loaded Unimolecular Nanoparticle
- Materials. BOLTRON® H40 (a hyperbranched polyester with 64 hydroxyl terminal groups; Mn: 2,833 Da) was kindly provided by Perstorp Polyols Inc., USA, and purified by fractional precipitation in acetone and tetrahydrofuran (THF). β-Benzyl 1-aspartate N-carboxyanhydride (BLA-NCA) was prepared as previously reported. See M. Prabaharan, J. J. Grailer, S. Pilla, D. A. Steeber, S. Gong, Amphiphilic multi-arm-block copolymer conjugated with doxorubicin via pH-sensitive hydrazone bond for tumor-targeted drug delivery, Biomaterials, 30 (2009) 5757-5766. The heterobifunctional poly(ethylene glycol) (PEG) derivatives, methoxy—PEG—NH2 (OCH3—PEG—OH, Mn=5 kDa) and maleimide—PEG—NH2 (Mal—PEG—NH2, Mn=5 kDa), were purchased from JenKem Technology (Allen, Tex., USA). Cy5 dye was obtained from Lumiprobe Corporation (Hallandale Beach, Fla., USA). GE11 peptide (YHWYGYTPQNVIGGGGC) was synthesized by Tufts University Core Facility (Boston, Mass., USA). GFP-siRNA-Cy5.5, GFP-siRNA, dimethyl sulfoxide (DMSO), 2-carboxybenzylaldehyde, 2-aminoethyl disulfide, 4-imidazolecarboxylic acid, and stannous (II) octoate (Sn(Oct)2) were purchased from Sigma-Aldrich (St. Louis, Mo., USA). 4-Dimethylamino pyridine (DMAP) and 1,3-dicyclohexylcarbodiimide (DCC) were purchased from ACROS and used without further purification. Other reagents, including RNAiMAX, were purchased from Thermo Fisher Scientific (Fitchburg, Wisc., USA) and used as received unless otherwise stated.
- Synthesis of H40-poly(aspartic acid-(2-aminoethyl disulfide)-(4-imidazolecarboxylic acid))-poly(ethylene glycol)-OCH3/Cy5/GE11 (i.e., H40- P(Asp-AED-ICA)-PEG-OCH3/Cy5/GE11)
- Synthesis of poly(β-benzyl 1-aspartate N-carboxyanhydride)-poly(ethylene glycol)-Mal (i.e., P(BLA-NCA)-PEG-Mal). P(BLA-NCA)-PEG-Mal was prepared by ring-opening polymerization of BLA-NCA using NH2-PEG-Mal as the macro-initiator. Briefly, BLA-NCA (53 mg), and NH2-PEG-Mal (25 mg) were dissolved in DMF (5 mL). The reaction was carried out at 55° C. under argon for 48 h. The resulting mixture was then added dropwise into a 10-fold volume of cold diethyl ether. The precipitate was collected by filtration using a Buchner funnel, washed with diethyl ether, and dried under vacuum. The P(BLA-NCA)-PEG-OCH3 was synthesized following a similar method using NH2-PEG-OCH3 instead.
- Synthesis of H40-carboxybenzaldehyde (i.e., H40-CHO). H40-OH (10 mg), 2-carboxybenzylaldehyde (82 mg), DCC (135 mg), and DMAP (8.3 mg) were dissolved in anhydrous DMSO (3 mL). The solution was stirred at room temperature under argon for 48 h. Thereafter, the dicyclohexylurea was removed by filtration using a Buchner funnel. The solution was collected and poured into a 10-fold volume of cold diethyl ether. The precipitate was collected by filtration using a Buchner funnel, washed with diethyl ether, and dried under vacuum.
- Synthesis of H40-poly(β-benzyl 1-aspartate N-carboxyanhydride)-poly(ethylene glycol)-OCH3/Mal (i.e., H40-P(BLA-NCA)-PEG-OCH3/Mal). H40-CHO (5 mg), P(BLA-NCA)-PEG-OCH3 (25 mg), and P(BLA-NCA)-PEG-Mal (8 mg) were dissolved in DMSO. The reaction was conducted at room temperature for 24 h. Thereafter, the resulting solution was dialyzed (molecular weight cut-off: 15 kDa) against DMSO for the first 24 h and DI water for another 24 h. The product was obtained after lyophilization. The H40-P(BLA-NCA)-PEG-OCH3 was synthesized following a similar method.
- Synthesis of H40-poly(aspartic acid-(2-aminoethyl disulfide))-poly(ethylene glycol)-OCH3/Mal (i.e., H40-P(Asp-AED)-PEG-OCH3/Mal). 2-Aminoethyl disulfide (13.1 mg) and H40-P(BLA-NCA)-PEG-OCH3/Mal (20 mg) were dissolved in DMSO (10 mL). The reaction was carried out at room temperature for 24 h. Thereafter, the resulting solution was dialyzed (molecular weight cut-off: 15 kDa) against DI water for 48 h. The product was obtained after lyophilization. The H40-P(Asp-AED)-PEG-OCH3 was synthesized following a similar method.
- Synthesis of H40-poly(aspartic acid-(2-aminoethyl disulfide)-(4-imidazolecarboxylic acid))-poly(ethylene glycol)-OCH3/Mal (i.e., H40-P(Asp-AED-ICA)-PEG-OCH3/Mal). 4-Imidazolecarboxylic acid (2.2 mg), H40-P(Asp-AED)-PEG-OCH3/Mal (20 mg), DCC (4.4 mg), and N-hydroxysuccinimide (2.9 mg) were dissolved in DMSO (5 mL). The reaction was carried out at room temperature for 24 h. Thereafter, the resulting solution was dialyzed (molecular weight cut-off: 15 kDa) against DI water for 48 h. The product was obtained after lyophilization. The H40-(Asp-AED-ICA)-PEG-OCH3 was synthesized following a similar method.
- Synthesis of H40-poly(aspartic acid-(2-aminoethyl disulfide)-(4-imidazolecarboxylic acid))-poly(ethylene glycol)-OCH3/GE11 (i.e., H40-(PAsp-AED-ICA)-PEG-OCH3/Cy5/GE11). Cy5-SH was first prepared by a reaction between Cy5-NH2 and Traut's reagent. Briefly, Cy5-NH2 (0.3 mg) and Traut's reagent (0.51 mg) were dissolved in DMSO. The solution was stirred at room temperature in complete darkness for 4 h. H40-P(Asp-AED-ICA)-PEG-OCH3/Mal (20 mg) and GE11 (1.3 mg) were added into the above solution. After 24 h, the reaction solution was dialyzed (molecular weight cut-off: 15 kDa) against DI water for 48 h. The product was obtained after lyophilization. The H40-P(Asp-AED-ICA)-PEG-OCH3/Cy5 and H40-P(Asp-AED-ICA)-PEG-OCH3/GE11 were synthesized following a similar method. Polymers H40-P(Asp-AED-ICA)-PEG-OCH3/Cy5 and H40-P(Asp-AED-ICA)-PEG-OCH3/Cy5/GE11 were only used for the cellular uptake analysis. For all other experiments, H40-P(Asp-AED-ICA)-PEG-OCH3 and H40-P(Asp-AED-ICA)-PEG-OCH3/GE11 were used.
- Preparation of siRNA-Complexed Unimolecular NPs (i.e., siRNA-complexed NPs) and Gel Retardation Assay. To prepare siRNA-complexed NPs, siRNA and H40-P(Asp-AED-ICA)-PEG were dissolved in PBS and the solution was mixed for 30 min under gentle shaking. The binding ability of siRNA to NPs was studied by agarose gel electrophoresis. The siRNA-complexed NPs were prepared at different N/P ratios (molar ratio of nitrogen in polymers to phosphorus in siRNA: 2, 5, 7, 10, and 15). Electrophoresis was carried out on 1% agarose gel in a TAE (Tris-acetate-EDTA) buffer solution with a current of 100 V for 35 min. The final siRNA concentration was 1 μg per well. The retardation of the complexes was visualized on a UV illuminator (Bio-Rad Baloratories, Inc., Hercules, Calif., USA) to show the position of the complexed siRNA band relative to that of naked siRNA.
- Characterization. 1H NMR spectra of all intermediate and final polymer products were recorded on a Varian Mercury Plus 300 spectrometer in DMSO-d6 or CDCl3 at 25° C. Molecular weights (Mn and Mw) and polydispersity indices (PDI) of the polymers were determined by a gel permeation chromatography (GPC) system equipped with a refractive index detector, a viscometer detector, and a light scattering detector (Viscotek, USA). Fourier transform infrared (FT-IR) spectra were recorded on a Bruker Tensor 27 FT-IR spectrometer. The morphologies of the siRNA-complexed NPs were studied by dynamic light scattering (DLS; ZetaSizer Nano ZS90, Malvern Instruments, USA; 0.5 mg/mL) and transmission electron microscopy (TEM, FEI Tecnai G2 F30 TWIN 300 KV, E.A. Fischione Instruments, Inc. USA).
- Polymer Synthesis and siRNA Encapsulation. pH/redox dual-sensitive multi-arm star block copolymer H40-P(Asp-AED-ICA)-PEG-OCH3/Cy5/GE11 was synthesized as outlined in
Scheme 1. P(BLA-NCA)-PEG-OCH3 and P(BLA-NCA)-PEG-Mal were first synthesized by ring-opening polymerization of BLA-NCA using NH2-PEG-OCH3 and NH2-PEG-Mal as the macro-initiators, respectively. Their chemical structures were confirmed by 1H NMR spectra as shown inFIG. 2(A) and (B). The peaks at (e) 7.28-7.40 ppm and (d) 5.15 ppm were assigned to the protons in the benzyl and methylene groups in the P(BLA-NCA) side chains, respectively. The signals labeled as (c) at 2.6-2.8 ppm were ascribed to the methylene group of the side chain that connects the main chain in the P(BLA-NCA) segment. The peak located at (a) 3.57 ppm corresponded to the methylene protons of the oxyethylene repeat units in the PEG segment. The Mal group in the P(BLA-NCA)-PEG-Mal at 6.7 ppm was also observed. The number of BLA-NCA repeat units in the polymers was calculated to be 20 based on the relative intensity ratio of the methylene proton (a) of the PEG chain and the methylene proton (d) near the benzyl group of the PBLA chain. The molecular weights of the NH2-PEG-OCH3 and NH2-PEG-Mal polymers as measured by GPC (Table 1) were 9,040 and 9,105 g/mol, respectively, which was consistent with that determined by the 1H NMR analyses. - The benzylaldehyde-functionalized H40 (H40-CHO) was prepared by an esterification reaction. The chemical structure was also confirmed by 1H NMR spectrum (
FIG. 2C ). The peaks at 0.97-1.2 ppm and 3.8-4.1 ppm were assigned to the protons in H40. The peaks at (a) 7.6-7.8 ppm corresponded to the protons in the phenyl group of H40-CHO as labeled. Thereafter, P(BLA-NCA)-PEG-OCH3 and P(BLA-NCA)-PEG-Mal (molar ratio: 3.1/1) polymers were then conjugated to H40-CHO through imine bonds to form H40-P(BLA-NCA)-PEG-OCH3/Mal. In the 1H NMR spectrum shown inFIG. 3(A) , other than the proton peaks assigned to P(BLA-NCA)-PEG-OCH3 and P(BLA-NCA)-PEG-Mal, proton peaks ascribed to H40 were also observed. The GPC analyses further demonstrated the formation of H40-P(BLA-NCA)-PEG-OCH3/Mal and its molecular weight was measured to be 200,833 Da, which was significantly larger than that of the linear NH2-PEG-OCH3 or NH2-PEG-Mal polymers. The average number of arms in the H40-P(BLA-NCA)-PEG-OCH3/Mal was calculated to be 22 based on the molecular weights of H40-P(BLA-NCA)-PEG-OCH3/Mal, NH2-PEG-OCH3, and NH2-PEG-Mal. Thereafter, the H40-P(BLA-NCA)-PEG-OCH3/Mal polymer underwent aminolysis by using 2-aminoethyl disulfide (AED) to form water-soluble polymer H40-P(Asp-AED)-PEG-OCH3/Mal. As shown inFIG. 3(B) , the absence of proton peaks at 7.28-7.40 ppm and 5.15 ppm, and the presence of proton peaks at 2.71 and 3.17 ppm ascribed to the protons in AED, demonstrated the formation of H40-P(Asp-AED)-PEG-OCH3/Mal. - Imidazole groups were selectively conjugated to H40-P(Asp-AED)-PEG-OCH3/Mal (molar ratio: 5/1) through an amidization reaction for enhanced endosomal/lysosomal escape. The characteristic proton peaks at (j) 7.23 and (k) 7.91 ppm for imidazole groups were observed in
FIG. 3 (C). In the last step, GE11 peptide and Cy5 dye were conjugated to H40-P(Asp-AED-ICA)-PEG-OCH3/Mal (molar ratio: 3/2/1) though a Mal-SH reaction. Proton peaks assigned to the GE11 and Cy5 molecules, as labeled inFIG. 3(D) , were also observed. -
TABLE 1 GPC analyses of polymers. Polymers Mn (g/mol) PDI P(BLA—NCA)—PEG—OCH3 9,040 1.4 P(BLA—NCA)—PEG—Mal 9,105 1.3 H40—P(BLA—NCA)—PEG—OCH3/Mal 200,833 1.6 H40—P(Asp-AED)—PEG—OCH3/Mal 186,406 1.7 H40—P(Asp-AED—ICA)—PEG—OCH3/Mal 187,130 1.6 - The cationic polymer H40-P(Asp-AED-ICA)-PEG, which had good solubility in aqueous solutions, was able to form the unimolecular NPs. Because of its covalent nature, the unimolecular NPs had excellent stability in vitro and in vivo. siRNA (GFP-siRNA was used as a model siRNA) was electrostatically complexed with the cationic P(Asp-AED-ICA) polymer to form siRNA-complexed NPs. The complexation was evaluated using agarose gel electrophoresis. As shown in
FIG. 4 (A), siRNA-complexed NPs with various N/P ratios were tested and siRNA lost mobility in the electric field when the N/P ratio reached 10, which was selected for the following tests. The siRNA loading level, defined by the weight percentage of the siRNA in the siRNA-complexed NP was 16.3% at N/P ratio of 10, and the loading efficiency is 100%. The average hydrodynamic diameter of the siRNA-complexed NPs was 68.3 nm (PDI=0.14) as measured by dynamic light scattering (DLS). Transmission electron microscopy (TEM) observation showed that the siRNA-complexed NPs were uniform, with an average size of around 39 nm (FIG. 4 (B)). - In Vitro siRNA Release. The release profiles of siRNA from siRNA-complexed NPs were studied in a glass apparatus at 37° C. in a release medium at four conditions: (1) pH 7.4, (2) pH 5.3, (3) pH 7.4+10 mM GSH, and (4) pH 5.3+10 mM GSH. siRNA-complexed NP solutions (5 mL; 100 μg/mL) were enclosed in a dialysis bag. The dialysis bag was immersed in 50 ml of the release medium and kept at 37° C. under a horizontal laboratory shaker (Thermo Scientific MaxQ Shaker, USA) at 100 rpm. At specific time points, 3 ml of release media were collected and replaced by the same volume of fresh media. GFP-siRNA-Cy5.5 was used in this experiment. The amount of released siRNA was analyzed based on the UV-vis intensity of Cy5.5 at 649 nm.
- Cellular Uptake. The cellular uptake behaviors of the NPs in MDA-MB-468 TNBC cell lines were analyzed using a fluorescence microscope based on the Cy5 dye conjugated on the NPs. Cells were seeded (1×105 cells/ml) onto 8-well high-optical-quality plates and grown overnight. Cells were treated with either non-targeted NPs, targeted NPs, or targeted NPs with free GE11 peptide (2 μM; blocking assay) at an NP concentration of 100 μg/ml. After 2 h incubation, cells were washed with PBS twice, fixed with 4% PFA, and stained with DAPI for 4 h. Then the cells were mounted with Prolong Gold anti-fade reagent. The cellular uptake was observed using a fluorescence microscope (Nikon, Melville, N.Y.). Digital monochromatic images were acquired using NIS-Elements BR Software.
- Endosomal/Lysosomal Escape. To assess the endosomal/lysosomal escape behaviors of the NPs, MDA-MB-468 cells were incubated with siRNA-complexed NPs for 2 h at 37° C. Cells treated with pure medium or free siRNA were used as negative controls. The siRNA labeled with Cy5.5 was used for intracellular tracking. The cells were washed three times with PBS, followed by staining with LysoTracker Green DND-26 (100 nM) for endosomes/lysosomes and Hoechst (5 ng/mL) for the nuclei, for 20 min at 37° C. Cells were then washed three times with PBS. The cellular localization of siRNA was visualized with a fluorescence microscope (Nikon, Melville, N.Y.).
- In Vitro siRNA Transfection. Cellular transfection was performed on GFP-expressing MDA-MB-468 TNBC cells using flow cytometry and a fluorescence microscopy. GFP-expressing MDA-MB-468 cells were provided by Professor Wei Xu. For the flow cytometry assay, cells were seeded at a density of 50,000 cells/well on a 24-well plate and incubated overnight. Cells were treated with pure medium (control), siRNA-complexed non-targeted NPs (siRNA-NT), siRNA-complexed targeted NPs (siRNA-T), and siRNA complexed with RNAiMAX (i.e., siRNA-RNAiMAX; positive control). The concentration of siRNA was 40 nM. After 24 h incubation, cells were washed twice with PBS and harvested with 0.25% trypsin. Cells were collected by centrifugation at 200 g for 5 min, washed twice with PBS, fixed with paraformaldehyde (PFA) for 15 min, and resuspended in 500 μL PBS for analysis. The transfection efficiency was examined by quantifying GFP expression levels in the cells using an AccuriTM C6 flow cytometry system (BD Biosciences, USA). A minimum of 10,000 cells was analyzed from each sample.
- For fluorescence microscope imaging, cells were seeded (50,000 cells/well) in an 8-well chamber slide system. Cells were treated with the same five groups as described above. After 24 h incubation, cells were washed twice with PBS, fixed with PEA for 15 min, stained with DAPI for 4 h, and mounted with ProLong Gold Antifade Mountant. Images were acquired with a fluorescence microscope (Nikon, Melville, N.Y.) to observe the GFP expression levels in the cells. Digital monochromatic images were acquired using NIS-Elements BR Software.
- Cell Viability Assays. Cell viability tests were conducted using the 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium bromide (MTT) assay. To test the cytotoxicity of the pure (empty) NPs, MDA-MB-468 cells were seeded in quadruplicate on 96-well plates and incubated overnight. Cells were treated with NPs at different concentrations (i.e., 10, 20, 50, 100, and 500 μg/mL). Cells treated with pure medium were used as the control group. After 24 h of incubation, a standard MTT assay was performed by aspirating the treatment media, adding 25 μL of the medium containing 0.5 mg/ml MTT agent, and incubating at 37° C. for 4 h. Thereafter, the medium was aspirated and 75 μL of DMSO was added to each well. The plates were then measured at 570 nm using a spectrophotometer (Quant, Bio-Tek Instruments, Winooski, Vt.), and the average absorbance and percent of cell viability relative to the control (pure medium) were calculated. The cytotoxicity of siRNA-complexed NP systems was also studied. Similarly, cells were treated with pure medium (control), siRNA-NT, siRNA-T, siRNA-RNAiMAX, and RNAiMAX at the equivalent amount of siRNA (40 nM), After 24 h of incubation, the aforementioned MTT protocol was performed and the cell viabilities relative to the control (pure medium) were calculated.
- pH/redox Dual-Sensitive siRNA Release. NPs with pH/redox dual-sensitive structures were designed to achieve decomplexation of siRNA from cationic nanocarriers and controlled release of siRNA to enhance gene silencing efficiency. To verify the pH/redox dual-sensitive release behavior, in vitro release analyses were conducted by monitoring Cy5.5-labeled siRNA. As shown in
FIG. 4(C) , the release rate was very slow at neutral pH (7.4) without adding GSH, with 7.1% of siRNA released after 48 h. In comparison, the addition of GSH (10 mM) to the solution resulted in an increased siRNA release rate (50.1% of siRNA released after 48 h). Meanwhile, 27.2% of siRNA was released at a pH of 5.3 after 48 h, which is much faster compared to that at a neutral pH. Moreover, dual stimuli (pH 5.3 and 10 mM GSH) led to the quickest siRNA release (81.4% of siRNA released after 48 h). Taken together, these observations suggest that siRNA can be decomplexed from siRNA-complexed NPs inside of cells. - Enhanced Endosomal/Lysosomal Escape Capability of NPs. Another major obstacle in designing nanocarriers for siRNA delivery is their poor endosomal/lysosomal escape capabilities. siRNA needs to be released into the cytoplasm for efficient gene silencing. Therefore, the siRNA nanocarriers were functionalized with endosomal/lysosomal escape capabilities. As mentioned above, the imidazole groups in the cationic segment promote endosomal/lysosomal escape through the proton-sponge effect, thereby facilitating the release of siRNA to the cytosol. To verify endosomal/lysosomal escape, fluorescence microscopy was used to assess the intracellular localizations of siRNA. The cells (MDA-MB-468 TNBC cell line) were treated with pure medium (control) or media containing free siRNA or siRNA-complexed nanoparticles. siRNA was labeled with Cy5.5 (red) for detection. After 2 h incubation, the nucleus and endosomes/lysosomes of cells were stained with Hoechst (blue) and Lysotracker (green), respectively. As shown in
FIG. 5 , siRNA complexed with NPs were taken up efficiently as signified by the strong red signal. The red signals barely overlapped with the green ones (endosomes/lysosomes), and they were distributed relatively uniformly in the cytosol, demonstrating that the majority of the siRNA escaped from the endosomes/lysosomes. The z-stack images shown inFIG. 6 also confirmed the excellent endososomal/lysosomal escape capabilities of the siRNA-complexed NPs. NPs capable of effective endosomal/lysosomal escape should lead to efficient gene silencing. - In Vitro Cellular Uptake. EGFR is overexpressed in many common types of cancer. Here, an EGFR targeting peptide, GE11, was used as an active-tumor-targeting ligand to enhance cellular uptake. MDA-MB-468, a TNBC cell line that overexpresses EGFR, was used as the model cell line. Cells were incubated with either non-targeted (i.e., NPs without GE11 conjugation) or targeted (i.e., GE11 conjugated) NPs for 2 h. Cells without any treatment were used as a negative control. Cy5 was conjugated onto the NPs. Fluorescence imaging analysis was performed to compare cellular uptake. As shown in
FIG. 7 , the targeted NPs showed a markedly higher Cy5 fluorescence intensity than non-targeted ones. In the blocking experiment (co-incubated cells with free GE11 and targeted NPs), after the EGFR was saturated with free GE11, the cellular uptake of the targeted NPs returned to the level of the non-targeted ones, thereby demonstrating the targeting ability of GE11. Taken together, the targeted NPs increased the cellular uptake of NPs through EGFR-mediated endocytosis. - In Vitro Gene Silencing Efficiency and Cell Viability Analysis. To determine the potential of NPs to deliver siRNA, gene silencing was assessed in vitro. The gene silencing capacity of GFP-siRNA toward MDA-MB-468 cells stably expressing green fluorescent protein was evaluated for siRNA-complexed non-targeted and targeted NPs. Pure medium was used as the negative control. RNAiMAX, a commercially available transfection agent, was used as the positive control. As shown in
FIG. 8(A) and (B), both targeted and non-targeted groups induced GFP reduction compared to the negative control. As expected based on the cellular uptake analysis, the extent of knockdown was dependent on GE11 functionalization. Relative to the negative control group, the siRNA-complexed non-targeted NPs produced a 47% GFP down-regulation. In contrast, the targeted NPs induced a 79% GFR reduction, which is comparable to that of RNAiMAX treatment (81%). However, the assessment of cell viability on these treatments revealed that siRNA-complexed RNAiMAX exhibited significant cytotoxicity, inducing more than 25% cell death (FIG. 8(C) ), which is consistent with the previous report. See N. Segovia, M. Pont, N. Oliva, V. Ramos, S. Borrós, N. Artzi, Hydrogel doped with nanoparticles for local sustained release of siRNA in breast cancer, Advanced Healthcare Materials, 4 (2015) 271-280. However, no apparent cytotoxicity associated with NPs was observed. In fact, no significant cytotoxicity was observed for NPs alone up to 500 μg/mL. Taken together, these findings reveal that GE11-conjugated NPs are suitable nanocarriers for siRNA delivery targeted at TNBC cells and, potentially, other EGFR-overexpressing cells. - While certain embodiments have been illustrated and described, a person with ordinary skill in the art, after reading the foregoing specification, can effect changes, substitutions of equivalents and other types of alterations to the conjugates and nanoparticles of the present technology or derivatives, prodrugs, or pharmaceutical compositions thereof as set forth herein. Each aspect and embodiment described above can also have included or incorporated therewith such variations or aspects as disclosed in regard to any or all of the other aspects and embodiments.
- The present technology is also not to be limited in terms of the particular aspects described herein, which are intended as single illustrations of individual aspects of the present technology. Many modifications and variations of this present technology can be made without departing from its spirit and scope, as will be apparent to those skilled in the art. Functionally equivalent methods within the scope of the present technology, in addition to those enumerated herein, will be apparent to those skilled in the art from the foregoing descriptions. Such modifications and variations are intended to fall within the scope of the appended claims. It is to be understood that this present technology is not limited to particular methods, conjugates, reagents, compounds, compositions, labeled compounds or biological systems, which can, of course, vary. All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. It is also to be understood that the terminology used herein is for the purpose of describing particular aspects only, and is not intended to be limiting. Thus, it is intended that the specification be considered as exemplary only with the breadth, scope and spirit of the present technology indicated only by the appended claims, definitions therein and any equivalents thereof. No language in the specification should be construed as indicating any non-claimed element as essential.
- The embodiments, illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms “comprising,” “including,” “containing,” etc. shall be read expansively and without limitation. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the claimed technology. Additionally, the phrase “consisting essentially of” will be understood to include those elements specifically recited and those additional elements that do not materially affect the basic and novel characteristics of the claimed technology. The phrase “consisting of” excludes any element not specified.
- In addition, where features or aspects of the disclosure are described in terms of Markush groups, those skilled in the art will recognize that the disclosure is also thereby described in terms of any individual member or subgroup of members of the Markush group. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part of the technology. This includes the generic description of the technology with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.
- As will be understood by one skilled in the art, for any and all purposes, particularly in terms of providing a written description, all ranges disclosed herein also encompass any and all possible subranges and combinations of subranges thereof. Any listed range can be easily recognized as sufficiently describing and enabling the same range being broken down into at least equal halves, thirds, quarters, fifths, tenths, etc. As a non-limiting example, each range discussed herein can be readily broken down into a lower third, middle third and upper third, etc. As will also be understood by one skilled in the art all language such as “up to,” “at least,” “greater than,” “less than,” and the like, include the number recited and refer to ranges which can be subsequently broken down into subranges as discussed above. Finally, as will be understood by one skilled in the art, a range includes each individual member, and each separate value is incorporated into the specification as if it were individually recited herein.
- All publications, patent applications, issued patents, and other documents (for example, journals, articles and/or textbooks) referred to in this specification are herein incorporated by reference as if each individual publication, patent application, issued patent, or other document was specifically and individually indicated to be incorporated by reference in its entirety. Definitions that are contained in text incorporated by reference are excluded to the extent that they contradict definitions in this disclosure.
- Other embodiments are set forth in the following claims, along with the full scope of equivalents to which such claims are entitled.
Claims (19)
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/819,424 US11058644B2 (en) | 2016-11-23 | 2017-11-21 | Unimolecular nanoparticles for efficient delivery of therapeutic RNA |
| US17/331,012 US20210346309A1 (en) | 2016-11-23 | 2021-05-26 | Unimolecular nanoparticles for efficient delivery of therapeutic rna |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662426004P | 2016-11-23 | 2016-11-23 | |
| US15/819,424 US11058644B2 (en) | 2016-11-23 | 2017-11-21 | Unimolecular nanoparticles for efficient delivery of therapeutic RNA |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/331,012 Continuation US20210346309A1 (en) | 2016-11-23 | 2021-05-26 | Unimolecular nanoparticles for efficient delivery of therapeutic rna |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20180140557A1 true US20180140557A1 (en) | 2018-05-24 |
| US11058644B2 US11058644B2 (en) | 2021-07-13 |
Family
ID=62144035
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/819,424 Active US11058644B2 (en) | 2016-11-23 | 2017-11-21 | Unimolecular nanoparticles for efficient delivery of therapeutic RNA |
| US17/331,012 Abandoned US20210346309A1 (en) | 2016-11-23 | 2021-05-26 | Unimolecular nanoparticles for efficient delivery of therapeutic rna |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/331,012 Abandoned US20210346309A1 (en) | 2016-11-23 | 2021-05-26 | Unimolecular nanoparticles for efficient delivery of therapeutic rna |
Country Status (1)
| Country | Link |
|---|---|
| US (2) | US11058644B2 (en) |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5661025A (en) * | 1992-04-03 | 1997-08-26 | Univ California | Self-assembling polynucleotide delivery system comprising dendrimer polycations |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2007132461A2 (en) | 2006-05-11 | 2007-11-22 | Ramot At Tel Aviv University Ltd. | Classification of protein sequences and uses of classified proteins |
| BR112016013213A2 (en) | 2013-12-12 | 2017-12-05 | Massachusetts Inst Technology | administration, use and therapeutic applications of crisper systems and compositions for targeting disorders and diseases using particle delivery components |
-
2017
- 2017-11-21 US US15/819,424 patent/US11058644B2/en active Active
-
2021
- 2021-05-26 US US17/331,012 patent/US20210346309A1/en not_active Abandoned
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5661025A (en) * | 1992-04-03 | 1997-08-26 | Univ California | Self-assembling polynucleotide delivery system comprising dendrimer polycations |
Also Published As
| Publication number | Publication date |
|---|---|
| US20210346309A1 (en) | 2021-11-11 |
| US11058644B2 (en) | 2021-07-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Jang et al. | Nanovesicle-mediated systemic delivery of microRNA-34a for CD44 overexpressing gastric cancer stem cell therapy | |
| Brinkman et al. | Aminoflavone-loaded EGFR-targeted unimolecular micelle nanoparticles exhibit anti-cancer effects in triple negative breast cancer | |
| Xu et al. | Multifunctional envelope-type siRNA delivery nanoparticle platform for prostate cancer therapy | |
| Patil et al. | Surface-modified and internally cationic polyamidoamine dendrimers for efficient siRNA delivery | |
| Xu et al. | Folic acid-decorated polyamidoamine dendrimer exhibits high tumor uptake and sustained highly localized retention in solid tumors: Its utility for local siRNA delivery | |
| Shen et al. | Restoration of chemosensitivity by multifunctional micelles mediated by P-gp siRNA to reverse MDR | |
| Wang et al. | Aptamer-dendrimer bioconjugates for targeted delivery of miR-34a expressing plasmid and antitumor effects in non-small cell lung cancer cells | |
| Dirisala et al. | Optimized rod length of polyplex micelles for maximizing transfection efficiency and their performance in systemic gene therapy against stroma-rich pancreatic tumors | |
| Gu et al. | Reversal of P-glycoprotein-mediated multidrug resistance by CD44 antibody-targeted nanocomplexes for short hairpin RNA-encoding plasmid DNA delivery | |
| Kim et al. | Hyaluronic acid complexed to biodegradable poly l‐arginine for targeted delivery of siRNAs | |
| JP2012505243A (en) | Multifunctional self-assembled polymer nanosystem | |
| Kim et al. | Hyaluronic acid receptor-targetable imidazolized nanovectors for induction of gastric cancer cell death by RNA interference | |
| Gaspar et al. | Biofunctionalized nanoparticles with pH-responsive and cell penetrating blocks for gene delivery | |
| Pandey et al. | The efficiency of membrane transport of vitamin B6 coupled to poly (ester amine) gene transporter and transfection in cancer cells | |
| Li et al. | Captopril-polyethyleneimine conjugate modified gold nanoparticles for co-delivery of drug and gene in anti-angiogenesis breast cancer therapy | |
| WO2012024396A2 (en) | Compositions and methods for delivering nucleic acid molecules and treating cancer | |
| JP2013501781A (en) | Particulate hyaluronic acid formulation for cellular delivery of bioactive substances | |
| Ganbold et al. | Receptor-mediated delivery of therapeutic RNA by peptide functionalized curdlan nanoparticles | |
| US9789194B2 (en) | Graft copolymer polyelectrolyte complexes for drug delivery | |
| US12527834B2 (en) | Polyaminated polyglutamic acid-containing compounds and uses thereof for delivering oligonucleotides | |
| Golan et al. | Conjugates of HA2 with octaarginine-grafted HPMA copolymer offer effective siRNA delivery and gene silencing in cancer cells | |
| Guo et al. | Tumor-penetrating peptide-functionalized redox-responsive hyperbranched poly (amido amine) delivering siRNA for lung cancer therapy | |
| Lee et al. | RPM peptide conjugated bioreducible polyethylenimine targeting invasive colon cancer | |
| Park et al. | Polyethylenimine grafted-chitosan based Gambogic acid copolymers for targeting cancer cells overexpressing transferrin receptors | |
| Ren et al. | Peptide GE11–polyethylene glycol–polyethylenimine for targeted gene delivery in laryngeal cancer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY |
|
| FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY |
|
| AS | Assignment |
Owner name: WISCONSIN ALUMNI RESEARCH FOUNDATION, WISCONSIN Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GONG, SHAOQIN;CHEN, GUOJUN;REEL/FRAME:044719/0657 Effective date: 20161202 |
|
| AS | Assignment |
Owner name: NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF HEALTH AND HUMAN SERVICES (DHHS), U.S. GOVERNMENT, MARYLAND Free format text: CONFIRMATORY LICENSE;ASSIGNOR:UNIVERSITY OF WISCONSIN-MADISON;REEL/FRAME:045398/0493 Effective date: 20100113 Owner name: NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF Free format text: CONFIRMATORY LICENSE;ASSIGNOR:UNIVERSITY OF WISCONSIN-MADISON;REEL/FRAME:045398/0493 Effective date: 20100113 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: AWAITING TC RESP., ISSUE FEE NOT PAID |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT RECEIVED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED |
|
| STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
| MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YR, SMALL ENTITY (ORIGINAL EVENT CODE: M2551); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY Year of fee payment: 4 |