US20150224186A1 - Hpv e6 protein t cell epitopes and uses thereof - Google Patents
Hpv e6 protein t cell epitopes and uses thereof Download PDFInfo
- Publication number
- US20150224186A1 US20150224186A1 US14/566,604 US201414566604A US2015224186A1 US 20150224186 A1 US20150224186 A1 US 20150224186A1 US 201414566604 A US201414566604 A US 201414566604A US 2015224186 A1 US2015224186 A1 US 2015224186A1
- Authority
- US
- United States
- Prior art keywords
- seq
- cells
- hpv
- cell
- adjuvant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 74
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 71
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 200
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 108
- 239000000427 antigen Substances 0.000 claims abstract description 99
- 108091007433 antigens Proteins 0.000 claims abstract description 98
- 102000036639 antigens Human genes 0.000 claims abstract description 98
- 230000005867 T cell response Effects 0.000 claims abstract description 39
- 210000004027 cell Anatomy 0.000 claims description 173
- 239000000203 mixture Substances 0.000 claims description 57
- 239000002671 adjuvant Substances 0.000 claims description 51
- 230000002163 immunogen Effects 0.000 claims description 38
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims description 15
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims description 15
- 241000222122 Candida albicans Species 0.000 claims description 13
- 229940095731 candida albicans Drugs 0.000 claims description 13
- 239000013612 plasmid Substances 0.000 claims description 7
- 208000005647 Mumps Diseases 0.000 claims description 6
- 241000223238 Trichophyton Species 0.000 claims description 6
- 208000010805 mumps infectious disease Diseases 0.000 claims description 6
- 230000003612 virological effect Effects 0.000 claims description 4
- 239000013598 vector Substances 0.000 claims description 2
- 210000001744 T-lymphocyte Anatomy 0.000 abstract description 194
- 241000701806 Human papillomavirus Species 0.000 abstract description 167
- 238000000034 method Methods 0.000 abstract description 46
- 210000000265 leukocyte Anatomy 0.000 abstract description 36
- 206010028980 Neoplasm Diseases 0.000 abstract description 26
- 125000003275 alpha amino acid group Chemical group 0.000 abstract description 20
- 238000009169 immunotherapy Methods 0.000 abstract description 13
- 230000009826 neoplastic cell growth Effects 0.000 abstract description 8
- 238000003745 diagnosis Methods 0.000 abstract description 5
- 230000002085 persistent effect Effects 0.000 abstract description 5
- 229940021747 therapeutic vaccine Drugs 0.000 abstract description 5
- 238000012512 characterization method Methods 0.000 abstract description 4
- 238000003556 assay Methods 0.000 description 42
- 241000341655 Human papillomavirus type 16 Species 0.000 description 33
- 102000004190 Enzymes Human genes 0.000 description 32
- 108090000790 Enzymes Proteins 0.000 description 32
- 101000954493 Human papillomavirus type 16 Protein E6 Proteins 0.000 description 29
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 29
- 210000004443 dendritic cell Anatomy 0.000 description 26
- 230000004044 response Effects 0.000 description 25
- 206010008342 Cervix carcinoma Diseases 0.000 description 22
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 22
- 210000004369 blood Anatomy 0.000 description 22
- 239000008280 blood Substances 0.000 description 22
- 201000010881 cervical cancer Diseases 0.000 description 22
- 208000015181 infectious disease Diseases 0.000 description 19
- 241000700618 Vaccinia virus Species 0.000 description 18
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 16
- 238000002347 injection Methods 0.000 description 16
- 239000007924 injection Substances 0.000 description 16
- 102100037850 Interferon gamma Human genes 0.000 description 15
- 108010074328 Interferon-gamma Proteins 0.000 description 15
- 101100540311 Human papillomavirus type 16 E6 gene Proteins 0.000 description 14
- 241000699670 Mus sp. Species 0.000 description 14
- 229960005486 vaccine Drugs 0.000 description 14
- 208000032124 Squamous Intraepithelial Lesions Diseases 0.000 description 13
- 230000000735 allogeneic effect Effects 0.000 description 13
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 13
- 230000028993 immune response Effects 0.000 description 13
- 229960003130 interferon gamma Drugs 0.000 description 13
- 238000010186 staining Methods 0.000 description 13
- 238000012360 testing method Methods 0.000 description 13
- 101000767631 Human papillomavirus type 16 Protein E7 Proteins 0.000 description 12
- 201000010099 disease Diseases 0.000 description 12
- 238000000338 in vitro Methods 0.000 description 12
- 210000003071 memory t lymphocyte Anatomy 0.000 description 12
- 239000013641 positive control Substances 0.000 description 12
- 102000007079 Peptide Fragments Human genes 0.000 description 11
- 108010033276 Peptide Fragments Proteins 0.000 description 11
- 150000001413 amino acids Chemical class 0.000 description 11
- 210000000612 antigen-presenting cell Anatomy 0.000 description 11
- 208000009608 Papillomavirus Infections Diseases 0.000 description 10
- 230000008901 benefit Effects 0.000 description 10
- 229940079593 drug Drugs 0.000 description 10
- 239000003814 drug Substances 0.000 description 10
- 210000002865 immune cell Anatomy 0.000 description 10
- 230000003902 lesion Effects 0.000 description 10
- 239000013642 negative control Substances 0.000 description 10
- 238000002255 vaccination Methods 0.000 description 10
- 238000004458 analytical method Methods 0.000 description 9
- 150000001875 compounds Chemical class 0.000 description 9
- 239000012636 effector Substances 0.000 description 9
- 208000021145 human papilloma virus infection Diseases 0.000 description 9
- 244000052769 pathogen Species 0.000 description 9
- 230000004963 pathophysiological condition Effects 0.000 description 9
- 239000000523 sample Substances 0.000 description 9
- 230000000638 stimulation Effects 0.000 description 9
- 102000004127 Cytokines Human genes 0.000 description 8
- 108090000695 Cytokines Proteins 0.000 description 8
- 230000000890 antigenic effect Effects 0.000 description 8
- 201000011510 cancer Diseases 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 7
- 102000014158 Interleukin-12 Subunit p40 Human genes 0.000 description 7
- 108010011429 Interleukin-12 Subunit p40 Proteins 0.000 description 7
- 230000002159 abnormal effect Effects 0.000 description 7
- 239000002609 medium Substances 0.000 description 7
- 239000002953 phosphate buffered saline Substances 0.000 description 7
- 239000006228 supernatant Substances 0.000 description 7
- 241000722343 Human papillomavirus types Species 0.000 description 6
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 6
- 230000036541 health Effects 0.000 description 6
- 239000002243 precursor Substances 0.000 description 6
- 230000003248 secreting effect Effects 0.000 description 6
- 208000020077 squamous cell intraepithelial neoplasia Diseases 0.000 description 6
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 6
- 206010008263 Cervical dysplasia Diseases 0.000 description 5
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 5
- 238000011510 Elispot assay Methods 0.000 description 5
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 5
- 241000700605 Viruses Species 0.000 description 5
- 229910052804 chromium Inorganic materials 0.000 description 5
- 239000011651 chromium Substances 0.000 description 5
- 238000002573 colposcopy Methods 0.000 description 5
- 238000002955 isolation Methods 0.000 description 5
- 210000001616 monocyte Anatomy 0.000 description 5
- 238000009595 pap smear Methods 0.000 description 5
- 230000001717 pathogenic effect Effects 0.000 description 5
- 210000003289 regulatory T cell Anatomy 0.000 description 5
- 230000028327 secretion Effects 0.000 description 5
- 210000004989 spleen cell Anatomy 0.000 description 5
- 230000004936 stimulating effect Effects 0.000 description 5
- 102000008203 CTLA-4 Antigen Human genes 0.000 description 4
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 4
- 108010013476 HLA-A24 Antigen Proteins 0.000 description 4
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 4
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 4
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 4
- 239000012980 RPMI-1640 medium Substances 0.000 description 4
- 208000035415 Reinfection Diseases 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 238000001574 biopsy Methods 0.000 description 4
- 208000035475 disorder Diseases 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 230000002349 favourable effect Effects 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 230000003834 intracellular effect Effects 0.000 description 4
- 230000007774 longterm Effects 0.000 description 4
- 210000004985 myeloid-derived suppressor cell Anatomy 0.000 description 4
- 230000001613 neoplastic effect Effects 0.000 description 4
- 208000003154 papilloma Diseases 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 210000003491 skin Anatomy 0.000 description 4
- 238000011282 treatment Methods 0.000 description 4
- 239000013603 viral vector Substances 0.000 description 4
- 208000023275 Autoimmune disease Diseases 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 3
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 3
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 3
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 108010047620 Phytohemagglutinins Proteins 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 210000001728 clone cell Anatomy 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000002708 enhancing effect Effects 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 230000036039 immunity Effects 0.000 description 3
- 231100000682 maximum tolerated dose Toxicity 0.000 description 3
- 239000007908 nanoemulsion Substances 0.000 description 3
- 239000002105 nanoparticle Substances 0.000 description 3
- 229940023041 peptide vaccine Drugs 0.000 description 3
- 230000001885 phytohemagglutinin Effects 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 238000011084 recovery Methods 0.000 description 3
- 238000013207 serial dilution Methods 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 229960005322 streptomycin Drugs 0.000 description 3
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 238000011740 C57BL/6 mouse Methods 0.000 description 2
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 108090000852 Forkhead Transcription Factors Proteins 0.000 description 2
- 102000004315 Forkhead Transcription Factors Human genes 0.000 description 2
- 102100027581 Forkhead box protein P3 Human genes 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- 108010075646 HLA-B18 Antigen Proteins 0.000 description 2
- 101000861452 Homo sapiens Forkhead box protein P3 Proteins 0.000 description 2
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 2
- 102000003777 Interleukin-1 beta Human genes 0.000 description 2
- 108090000193 Interleukin-1 beta Proteins 0.000 description 2
- 102000003814 Interleukin-10 Human genes 0.000 description 2
- 108090000174 Interleukin-10 Proteins 0.000 description 2
- 108010002350 Interleukin-2 Proteins 0.000 description 2
- 102000000588 Interleukin-2 Human genes 0.000 description 2
- 108090001005 Interleukin-6 Proteins 0.000 description 2
- 102000004889 Interleukin-6 Human genes 0.000 description 2
- 206010033128 Ovarian cancer Diseases 0.000 description 2
- 206010061535 Ovarian neoplasm Diseases 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 2
- 238000011529 RT qPCR Methods 0.000 description 2
- 238000010240 RT-PCR analysis Methods 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 2
- 230000005856 abnormality Effects 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 229910052782 aluminium Inorganic materials 0.000 description 2
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 2
- 230000030741 antigen processing and presentation Effects 0.000 description 2
- 208000007951 cervical intraepithelial neoplasia Diseases 0.000 description 2
- 210000003679 cervix uteri Anatomy 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 231100000371 dose-limiting toxicity Toxicity 0.000 description 2
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 description 2
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000036512 infertility Effects 0.000 description 2
- 230000003211 malignant effect Effects 0.000 description 2
- 229960002566 papillomavirus vaccine Drugs 0.000 description 2
- 229940056360 penicillin g Drugs 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 238000009520 phase I clinical trial Methods 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 230000037452 priming Effects 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 239000002510 pyrogen Substances 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 206010041823 squamous cell carcinoma Diseases 0.000 description 2
- 208000017572 squamous cell neoplasm Diseases 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 231100000041 toxicology testing Toxicity 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 210000002845 virion Anatomy 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- GEYOCULIXLDCMW-UHFFFAOYSA-N 1,2-phenylenediamine Chemical compound NC1=CC=CC=C1N GEYOCULIXLDCMW-UHFFFAOYSA-N 0.000 description 1
- KZDCMKVLEYCGQX-UDPGNSCCSA-N 2-(diethylamino)ethyl 4-aminobenzoate;(2s,5r,6r)-3,3-dimethyl-7-oxo-6-[(2-phenylacetyl)amino]-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid;hydrate Chemical compound O.CCN(CC)CCOC(=O)C1=CC=C(N)C=C1.N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 KZDCMKVLEYCGQX-UDPGNSCCSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 208000007860 Anus Neoplasms Diseases 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 210000004366 CD4-positive T-lymphocyte Anatomy 0.000 description 1
- 102000000905 Cadherin Human genes 0.000 description 1
- 108050007957 Cadherin Proteins 0.000 description 1
- 229930105110 Cyclosporin A Natural products 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 102000006354 HLA-DR Antigens Human genes 0.000 description 1
- 108010058597 HLA-DR Antigens Proteins 0.000 description 1
- 101001066129 Homo sapiens Glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 241000725303 Human immunodeficiency virus Species 0.000 description 1
- 101000954519 Human papillomavirus type 18 Protein E6 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 102000004890 Interleukin-8 Human genes 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 102000000585 Interleukin-9 Human genes 0.000 description 1
- BAVYZALUXZFZLV-UHFFFAOYSA-N Methylamine Chemical compound NC BAVYZALUXZFZLV-UHFFFAOYSA-N 0.000 description 1
- 102100023123 Mucin-16 Human genes 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 102000007066 Prostate-Specific Antigen Human genes 0.000 description 1
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 102000044209 Tumor Suppressor Genes Human genes 0.000 description 1
- 108700025716 Tumor Suppressor Genes Proteins 0.000 description 1
- 241000036581 Vaccinia virus Western Reserve Species 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 1
- 108010004469 allophycocyanin Proteins 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 230000005809 anti-tumor immunity Effects 0.000 description 1
- 230000006023 anti-tumor response Effects 0.000 description 1
- 201000011165 anus cancer Diseases 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- -1 but not limited to Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000007969 cellular immunity Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 201000006612 cervical squamous cell carcinoma Diseases 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 230000001085 cytostatic effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 229940029030 dendritic cell vaccine Drugs 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 239000000890 drug combination Substances 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 239000012091 fetal bovine serum Substances 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 238000003205 genotyping method Methods 0.000 description 1
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 238000011194 good manufacturing practice Methods 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 102000047486 human GAPDH Human genes 0.000 description 1
- 102000055277 human IL2 Human genes 0.000 description 1
- 238000002991 immunohistochemical analysis Methods 0.000 description 1
- 238000011532 immunohistochemical staining Methods 0.000 description 1
- 238000011293 immunotherapeutic strategy Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- PGHMRUGBZOYCAA-UHFFFAOYSA-N ionomycin Natural products O1C(CC(O)C(C)C(O)C(C)C=CCC(C)CC(C)C(O)=CC(=O)C(C)CC(C)CC(CCC(O)=O)C)CCC1(C)C1OC(C)(C(C)O)CC1 PGHMRUGBZOYCAA-UHFFFAOYSA-N 0.000 description 1
- PGHMRUGBZOYCAA-ADZNBVRBSA-N ionomycin Chemical compound O1[C@H](C[C@H](O)[C@H](C)[C@H](O)[C@H](C)/C=C/C[C@@H](C)C[C@@H](C)C(/O)=C/C(=O)[C@@H](C)C[C@@H](C)C[C@@H](CCC(O)=O)C)CC[C@@]1(C)[C@@H]1O[C@](C)([C@@H](C)O)CC1 PGHMRUGBZOYCAA-ADZNBVRBSA-N 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 210000001821 langerhans cell Anatomy 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 238000007798 limiting dilution analysis Methods 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 210000005210 lymphoid organ Anatomy 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 208000026037 malignant tumor of neck Diseases 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 238000012758 nuclear staining Methods 0.000 description 1
- 238000010899 nucleation Methods 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 102000045222 parkin Human genes 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000001991 pathophysiological effect Effects 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- PHEDXBVPIONUQT-RGYGYFBISA-N phorbol 13-acetate 12-myristate Chemical compound C([C@]1(O)C(=O)C(C)=C[C@H]1[C@@]1(O)[C@H](C)[C@H]2OC(=O)CCCCCCCCCCCCC)C(CO)=C[C@H]1[C@H]1[C@]2(OC(C)=O)C1(C)C PHEDXBVPIONUQT-RGYGYFBISA-N 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 238000013102 re-test Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 238000005067 remediation Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000007423 screening assay Methods 0.000 description 1
- 230000000405 serological effect Effects 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- PXLIDIMHPNPGMH-UHFFFAOYSA-N sodium chromate Chemical compound [Na+].[Na+].[O-][Cr]([O-])(=O)=O PXLIDIMHPNPGMH-UHFFFAOYSA-N 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000013517 stratification Methods 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000012353 t test Methods 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 230000029069 type 2 immune response Effects 0.000 description 1
- 210000001364 upper extremity Anatomy 0.000 description 1
- 239000012646 vaccine adjuvant Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 208000012498 virus associated tumor Diseases 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 229910001868 water Inorganic materials 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
- A61K9/0021—Intradermal administration, e.g. through microneedle arrays, needleless injectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/01—DNA viruses
- G01N2333/025—Papovaviridae, e.g. papillomavirus, polyomavirus, SV40, BK virus, JC virus
Definitions
- the present invention relates generally to the field of immunology. More specifically, the present invention involves identification of dominant CD8 T cell epitopes in the Human Papilloma virus (HPV) proteins and its use in treating cancer such as cervical cancer.
- HPV Human Papilloma virus
- Cervical cancer is the second most common malignancy among women worldwide (1) with 400,000 new cases annually (2). Annually 12,000 to 14,000 new cases of squamous cell cancer of the cervix are reported in the United States (3), resulting in about 3,500 deaths per year.
- High-risk Human Papilloma virus, the most commonly HPV16 is the major cause of cervical cancer (4-5). Among the over one hundred different types of Human Papilloma virus, at least 15 are strongly associated with invasive squamous cell cancer of the cervix (6). HPV16 is the one most commonly found associated with this cancer (7-8).
- Human Papilloma virus infection is also associated with the precursor lesion of cervical cancer, squamous intraepithelial lesion (7-12). While most low-grade squamous intraepithelial lesions prospectively regress spontaneously (13-14), some progress to high-grade squamous intraepithelial lesions. These high-grade lesions, in particular, cervical intraepithelial neoplasia-3 is associated with a high rate progression to invasive cervical cancer (15-16).
- E6 and E7 mediate transformation to a malignant phenotype by Human Papilloma virus. Both of these viral proteins have been shown to interact with the products of cellular human tumor suppressor genes.
- the E6 protein can bind and promote degradation of cell-encoded p53, while the E7 protein interacts with the retinoblastoma susceptibility gene product.
- Constitutive expression of HPV E6/E7 proteins is required for the maintenance of a malignant phenotype of cervical cancer (5, 17).
- HPV16 E6 and E7 proteins contain many antigenic epitopes and are foreign viral antigens. These proteins may, therefore, represent targets of antigen-specific immunotherapeutic strategies for the prevention and treatment of cervical cancer.
- CD4 T cells are important in the development of anti-tumor responses (18-21). It is believed that the effectiveness of these CD4 T cells lies in their ability to deliver help for priming and maintaining CD8 cytotoxic T lymphocytes, which are thought to serve as the dominant effector cells in tumor elimination. Immunohistochemical analyses of squamous intraepithelial lesions and cervical cancer specimens have demonstrated the presence of activated cytotoxic T lymphocytes in lesions (22).
- the CD4 T cells activate cytotoxic T lymphocytes by producing T helper 1 cytokines (23) and by providing activation signals for priming of tumor-specific cytotoxic T lymphocytes to professional antigen presenting cells (24-27).
- CD8-positive cytotoxic T lymphocytes recognize foreign peptides that are 8 to 11 amino acids in length and bound to and presented by Human Leukocyte Antigen class I molecules. These peptides are called T cell epitopes.
- HPV16 E6- and/or E7-specific cytotoxic T lymphocytes have demonstrated HPV16 E6- and/or E7-specific cytotoxic T lymphocytes in women with and without squamous intraepithelial lesion and in women with cervical cancer. Efforts have been made to define the viral epitopes inducing the Human Papilloma virus-specific cytotoxic T lymphocyte that are responsible for the clearance of virus-infected and virus-transformed cells. Using the same approach as was taken for HPV16, Human Leukocyte Antigen-A2.1 binding synthetic peptides of HPV18 E6 protein were identified (32). Some of these binding peptides were also shown to be antigenic by demonstrating in vitro cytotoxicity.
- High-risk human Papilloma virus peptide antigens for CD8 T lymphocytes have been shown to be antigenic in human experimental systems by demonstrating peptide-specific cytotoxicity or interferon- ⁇ secretion. Except for the Human Leukocyte Antigen-B18-restricted epitopes identified by Bourgault Villada et al., all were pre-selected for the given Human Leukocyte Antigen types. None of the antigenic epitopes were identified based on the magnitude of T cell response regardless of the restricting Human Leukocyte Antigen molecules.
- Memory T cells play an important role in maintaining long-term immunity to previously encountered pathogens or tumor antigens. They may proliferate, and rapidly acquire effector functions to kill virus-infected cells or tumor cells, and secrete cytokines that inhibit replication of the pathogen after re-stimulation with re-exposure to antigen (33).
- Antigen presenting cells which may transfer peripheral antigenic signals to the lymphoid organs, play a crucial role in the induction of antigen-specific T cell immunity responses to Human Papilloma virus infection and Human Papilloma virus-associated tumors. Dendritic cells as professional antigen presenting cells express high level of major histocompatibility complex and co-stimulatory molecules.
- the prior art is deficient in peptide antigens, derived from the Human Papilloma virus E6 protein useful as vaccine antigens or for dendritic cell immunotherapy to treat cervical cancers.
- the present invention fulfills this long-standing need and desire in the art.
- a method of determining immunodominant T cell epitopes within a protein in an individual comprises pulsing dendritic cells obtained from the individual with a recombinant protein and establishing T cell lines by stimulating peripheral blood mononuclear cells (PBMCs) with the dendritic cells.
- PBMCs peripheral blood mononuclear cells
- the T cell lines thus established are then incubated with peptides representative of the protein and the specific T cell response in the incubated cells is then measured. Subsequently, peptides that induce T cell response are identified, where the sequence of the peptide corresponds to a region within the protein, thereby determining the immunodominant T cell epitopes within the protein in the individual.
- the peptides that induce a T cell response are identified, wherein the sequence of the peptides corresponds to a region within the Human Papilloma virus protein.
- the pattern of the immunodominant T cell epitopes within the Human Papilloma virus protein is determined.
- a method of immunotherapy targeted towards a protein in an individual comprises isolating immune cells from the individual and incubating the isolated immune cells with peptides comprising one or more of the immunodominant T cell epitopes identified using the method described supra. These immune cells are then transferred back to the individual such that the transferred immune cells produce a specific immune response in the individual, thereby generating immunotherapy targeted towards the protein in the individual.
- synthetic peptides selected from the group consisting of SEQ ID NO.1, SEQ ID NO.2, SEQ ID NO. 3, SEQ ID NO. 4; SEQ ID NO. 5; SEQ ID NO. 6; SEQ ID NO. 7, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, or SEQ ID NO: 37.
- an immunogenic composition comprising one or more of the synthetic peptides identified supra.
- a method of preventing or treating a pathophysiological condition involving expression of protein in an individual comprises administering an immunologically effective amount of the immunogenic composition identified herein, where the composition activates a specific immune response in the individual, thereby preventing or treating the pathophysiological condition in the individual.
- a method for increasing regression of human papilloma virus (HPV)-associated cervical lesions in an HPV positive individual comprises administering an immunogenic composition comprising two or more peptides derived from two or more immunodominant epitopes of HPV E6 or E7 protein effective to generate CD8 T-cell responses specific against the HPV.
- HPV human papilloma virus
- a method to predict the probability of developing persistent cervical neoplasia in an individual consisting the steps of: 1) obtaining whole blood from the individual; 2) establishing mature dendritic cells by pulsing the dendritic cells from the whole blood with a peptide fragment of an E6 protein of a Human Papilloma Virus; 3) establishing a T cell line by combining T cells from the whole blood with the mature dendritic cells; 4) determining the percentage of T cells in the T cell line that respond to the peptide fragment of an E6 protein of a Human Papilloma Virus.
- a higher T cell response to the peptide fragment from the individual being diagnosed than a T cell response to the same peptide fragment from an individual without cervical neoplasia indicates that the individual with higher T cell response is more likely to develop persistent cervical neoplasia.
- FIGS. 1A-1B show the natural history of HPV16 infection.
- FIG. 1A shows for subject 2, the Human Papilloma virus infection was detected at one visit, the T cell clones isolated to define the dominant CD8 T cell epitope are derived from a blood sample drawn 53 months after Human Papilloma virus clearance.
- FIG. 1B shows subject 18, whose HPV16 infection persisted for about 4 years.
- Peripheral blood mononuclear cells for the cultured enzyme-linked immunospot assay were isolated from blood sample collected 4, 22, 27, 48 and 74 months after the clearance of this infection.
- the T cell clones isolated to define the dominant CD8 T cell epitope derived from a blood sample drawn 78 months after Human Papilloma virus clearance.
- FIGS. 2A-2F show the characterization of subject 2's dominant CD8 T cell epitope in terms of its minimal and optimal amino acid sequence and the Human Leukocyte Antigen restricting molecule. The bars represent standard errors of the means.
- FIG. 2A shows an enzyme-linked immunospot assay performed to retest the screen-positive T cell clones. Three 15-mer peptides contained in the positive pool were tested individually in duplicate or triplicate. Seven of eight positive T cell clones demonstrated positive responses with the E6 71-85 peptide, but not with E6 61-75 and E6 66-80 peptides.
- FIG. 1A shows an enzyme-linked immunospot assay performed to retest the screen-positive T cell clones. Three 15-mer peptides contained in the positive pool were tested individually in duplicate or triplicate. Seven of eight positive T cell clones demonstrated positive responses with the E6 71-85 peptide, but not with E6 61-75 and E6 66-80 peptides.
- FIG. 2B shows an enzyme-linked immunospot assay was performed using the screen-positive T cell clones, with vaccinia virus expressing E6 protein (E6-vac) or wild type vaccinia virus, Western Reserve (WR-vac), at a multiplicity of infection of 5.
- E6-vac vaccinia virus expressing E6 protein
- WR-vac Western Reserve
- Seven of eight screen-positive T cell clones demonstrated a strong positive response with vaccinia virus expressing E6 protein infected autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells, but not with wild type vaccinia virus infected autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells.
- FIG. 2C shows an enzyme-linked immunospot assay performed using the T cell clones, with 9-mer peptides overlapping by 8 amino acids, contained within the screen-positive 15-mer peptide. Seven T cell clones demonstrated a strong positive response with the SEQ ID NO. 1 E6 75-83 peptide, followed by the E6 74-82 peptide.
- FIG. 2D shows an enzyme-linked immunospot assay performed using the T cell clones, with two 10-mer peptides surrounding SEQ ID NO. 1 E6 75-83 and two 8-mer peptides within it. The results were equally strong with the SEQ ID NO. 1 E6 75-83 9-mer and the E6 74-83 10-mer.
- FIG. 2E shows a comparison of the SEQ ID NO. 1 E6 75-83 9-mer peptide and the E6 74-83 10-mer peptide, ranging from 10 ⁇ 5 M to 10 ⁇ 10 M, demonstrating that the optimal peptide of minimum length is the SEQ ID NO. 1 E6 75-83 9-mer.
- FIG. 2F shows a chromium release assay was performed using peptides-pulsed autologous or a panel of partially Human Leukocyte Antigen-matched autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells as antigen presenting cells. Human Leukocyte Antigen-B62 was demonstrated to be the restricting molecule for the CD8 epitope of SEQ ID NO.
- E6 75-83 A representative (#78-2) of the two clones was shown.
- E:T ratio effector-to-target T cell ratio.
- ⁇ autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells.
- * Human Leukocyte Antigen type determined using one of the molecular methods.
- FIGS. 3A-3F show the characterization of the dominant CD8 T cell epitope of subject 18 in terms of its minimal and optimal amino acid sequence and the Human Leukocyte Antigen restricting molecule.
- FIG. 3A shows an enzyme-linked immunospot assay performed using eight screen-positive T cell clones, with the three 15-mer peptides contained in the HPV16 E6 121-145 region. All T cell clones demonstrated positive responses with the E6 131-145 peptide, but not with the E6 121-135 and E6 126-140 peptides.
- FIG. 3A shows an enzyme-linked immunospot assay performed using eight screen-positive T cell clones, with the three 15-mer peptides contained in the HPV16 E6 121-145 region. All T cell clones demonstrated positive responses with the E6 131-145 peptide, but not with the E6 121-135 and E6 126-140 peptides.
- FIG. 3B shows an enzyme-linked immunospot assay was performed using eight screen-positive T cell clones, with vaccinia virus expressing E6 protein, vaccinia virus expressing E7 protein or Western Reserve wild type vaccinia virus at multiplicity of infection of 5. All eight tested T cell clones demonstrated a strong positive response with vaccinia virus expressing E6 protein, yet not with vaccinia virus expressing E7 protein and wild type vaccinia virus.
- FIG. 3C shows an enzyme-linked immunospot assay was performed using two T cell clones, with 10-mer peptides overlapping by 9 amino acids contained within the screen-positive 15-mer peptide. Both T cell clones demonstrated a strong positive response with the SEQ ID NO.
- FIG. 3D shows an enzyme-linked immunospot assay was performed using four T cell clones, with different length of peptides surrounding the SEQ ID NO. 2 E6 133-142 10-mer peptide. The two 11-mer peptides surrounding this SEQ ID NO. 2 E6 133-142 10-mer peptides and the 10-mer were positive but not the 9-mer peptides within the 10-mer.
- FIG. 3E shows a comparison of the SEQ ID NO.
- FIG. 3F shows a chromium release assay was performed using peptide-pulsed autologous or a panel of partially Human Leukocyte Antigen-matched autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells as the antigen presenting cells.
- * Human Leukocyte Antigen type determined using one of the molecular methods. The bars represent standard errors of the means.
- FIG. 4 shows T cell epitope “hot spots” identified in the HPV16 E6 protein. Regions of the Human Papilloma virus HPV16 E6 protein, which contain multiple T cell epitopes termed “hot spots”, have been identified and shown to be restricted by several Human Leukocyte Antigen major histocompatibility complex I molecules. The CD8 T cell epitopes contained in these epitopes “hot spots” are relevant to 99% of the US population.
- FIGS. 5A-5C show intracellular cytokine staining of spleen cells from vaccinated C57BL/6 mice.
- a higher numbers of T-cells specific for HPV E6 were detected in mice vaccinated with HPV E6 peptides with CAN DIN (Allermed, San Diego, Calif.) as adjuvant, compared to the number of specific T cells from mice vaccinated with either the antigen or the adjutant alone.
- FIG. 5A shows the results obtained using HPV 16 E6 48-57 (SEQ ID No: 36, 10-mer, EVYDFAFRDL) as antigen.
- FIG. 5B shows the results obtained using HPV 16 E6 46-60 (SEQ ID No: 37, 15-mer, RREVYDFAFRDLCIV) as antigen.
- FIG. 5C shows the results obtained using HPV 16 E6 46-80 (SIQ ID No: 33, 35-mer, CH 3 —NH 2 ) as antigen.
- SEQ ID No: 33 is acetylated (CH 3 —) at the amino terminus and amidated at the carboxyl ternius (—NH 2 ) to enhance stability. The results from one of the two experiments in which mice were injected thrice every two weeks are shown.
- FIGS. 6A-6B show quantitative RT-PCR analysis of monocyte-derived Langerhan cells treated with CANDIN (Allermed, San Diego, Calif.). Langerhan cells treated with E. coli LPS were used as positive control ( FIG. 6A ) and Langerhan cells treated with CANDIN revealed the expression of IL-12p40 consistently ( FIG. 6B ). The experiment was performed three times.
- FIG. 7 shows ELISA results of supernatants of Langerhan cells treated with CANDIN (Allermed, San Diego, Calif.). Supernatants from the above experiment were analyzed for the IL-12p40 protein expression. The results from the 24 hour time point are shown.
- FIG. 8 shows diagram of a vaccination scheme. Each subject receives all the injections at the same dose.
- CRC clinical Research Center
- Colpo colposcopy
- Bx biopsy.
- FIG. 9 shows dose-escalation plan of vaccination. A total of 24 subjects are enrolled in the dose-escalation phase, and an additional 30 subjects are recruited at the final dose.
- the term, “a” or “an” may mean one or more.
- the words “a” or “an” when used in conjunction with the word “comprising”, the words “a” or “an” may mean one or more than one.
- another or “other” may mean at least a second or more of the same or different claim element or components thereof.
- Some embodiments of the invention may consist of or consist essentially of one or more elements, method steps, and/or methods of the invention. It is contemplated that any method or composition described herein can be implemented with respect to any other method or composition described herein.
- the term “immunologically effective amount” refers to an amount that results in an improvement or remediation of the symptoms of the disease or condition due to induction of an immune response. Those of skill in the art understand that the effective amount may improve the patient's or subject's condition, but may not be a complete cure of the disease and/or condition.
- the present invention examined the pattern of Human Papilloma virus-specific CD8 T cell epitopes in the HPV16 E6 protein recognized by T lymphocytes from women demonstrating evidence of HPV-16 clearance (i.e., at least two consecutive HPV-16-negative tests after an initial HPV-16-positive test).
- the female subjects were participants of a longitudinal study of Human Papilloma virus infection, and were monitored using cervical Human Papilloma virus DNA testing by PCR (36), cytology, and colposcopy every 4 months.
- Subject 2's HPV16 infection was detected at a single visit and the blood to establish the CD8 T cell line was drawn 53 months later.
- Subject 18 had an HPV16 infection lasting more than 4 years, and the blood sample was taken 53 months after clearance ( FIGS.
- CD8 T cell lines obtained from blood samples drawn after Human Papilloma virus infection clearance, were established by in vitro stimulation of CD8 T cells with autologous dendritic cells infected with vaccinia virus expressing the Human Papilloma virus E6 recombinant protein.
- An object of the present invention is to further define for Human Papilloma virus HPV16 E6 protein the minimal and optimal amino acid sequences and the corresponding Human Leukocyte Antigen restricting molecules of the dominant CD8 T cell epitopes within those regions.
- Memory T cells play an important role in maintaining long-term immunity to previously encountered pathogens or tumor antigens. They may proliferate, rapidly acquire effector functions to kill virus-infected cells or tumor cells and secrete cytokines that inhibit replication of the pathogen after re-stimulation with re-exposure to antigen (33).
- the identification of HPV16 E6 132-142 specific memory T cells was examined using tetramer staining on cells obtained from drawn blood samples obtained after HPV16 clearance, and before isolation of the T cell clones. The frequencies of tetramer + CD8 + T cells were above the negative control in three of the five samples.
- the data indicates the Human Papilloma virus-specific T cells can be detected at 22 months, or almost 2 years, after the Human Papilloma virus-DNA has become undetectable. It may be that the SEQ ID NO. 2 (E6 133-142) specific T cells were isolated 78 months after HPV16 clearance because mature dendritic cells, which are the most potent antigen presenting cells, were used for in vitro stimulation. The challenge in the future is to determine whether these memory cells confer long-term protection to Human Papilloma virus re-infection and whether these memory T cells are capable of quickly differentiating into a potent effector response during Human Papilloma virus re-infection.
- SEQ ID NO. 2 E6 133-142
- the present invention differs from others in that the approach has an advantage of being able to select T cell epitopes based on the magnitude of the T cell response. Hence, these epitopes may play a significant role in viral clearance. Additionally, the present invention studied women who demonstrated Human Papilloma virus clearance and identified several dominant CD8 T cell epitopes and regions of multiple T cell epitopes, which are relevant to approximately 99% of the U.S. population. Table 5 shows the CD8 T-cell epitopes contained in the HPV 16 E6 and E7 epitope hot spots. Taken together, SEQ ID NO. 1 through SEQ ID NO.
- E6 peptides are immunodominant regions in which several T cell epitopes are contained. It is contemplated that one may determine whether these memory cells confer long-term protection to Human Papilloma virus re-infection and whether these memory T-cells are capable of differentiating into a effector response during Human Papilloma virus re-infection.
- the present invention is directed to a method of determining a pattern of immunodominant T cell epitopes within a protein expressed in an individual, comprising: establishing T cell lines from an individual by stimulating in vitro the individual's immune cells with autologous dendritic cells which had been previously incubated with Human Papilloma virus protein or Human Papilloma virus peptides; further incubating the stimulated T cell line with peptides representing the Human Papilloma virus protein; determining the T cell response in the incubated cells; and identifying peptides that induce a specific T cell response, wherein a sequence of the peptide corresponds to a region within the protein, thereby determining the pattern of the immunodominant T cell epitopes within the protein in the individual.
- a set of peptides is 15-amino acid residues long and overlaps by the 10 central amino acids and is representative of the entire protein. These peptides allow identification of what comprises the immunodominant T cell epitope. These peptides are used to select T cell lines based on the secretion of interferon- ⁇ . Specifically, these peptides are fragments of Human Papilloma virus protein having amino acid sequence of SEQ ID NO. 1 (E6 75-83), SEQ ID NO. 2 (E6 133-142), SEQ ID NO.3 (E6 49-61), SEQ ID NO. 4 (E6 75-88), SEQ ID NO. 5 (E6 127-142), SEQ ID NO.
- SEQ ID NO. 6 E6 11-38
- SEQ ID NO. 7 E6 49-88
- amino acid sequences of these peptides comprising at least 80% and up to and including 90% similarity of the composition of the immunodominant T cell epitopes in Human Papilloma virus protein of amino acid sequences SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7 (Table 1).
- the present invention contemplates investigating human papilloma virus epitopes as tumor antigens and using them as sources of antigens for dendritic cell immunotherapies or as a therapeutic vaccine to treat cervical cancer patients who express the particular Human Leukocyte Antigen types.
- the small size of these epitopes makes it easier to produce a large quantity of the antigen at Good Manufacturing Practice grade compared to a whole protein. Additionally, it is safer to use these epitopes in the treatment since the small size of the peptide makes it unlikely to have oncogenic potential.
- Such a vaccine might comprise use of recombinant viral vector, a plasmid or a peptide.
- such methods can be performed on an individual who is diagnosed with a pathophysiological condition, is in remission, or is diagnosed with a precursor of the pathophysiological condition.
- pathophysiological conditions include but are not limited to a neoplastic disease or disorder, an autoimmune disease or disorder, or a pathogen-related infection or disease.
- examples of the neoplastic disease include but are not limited to prostate cancer, ovarian cancer, or cervical cancer.
- cervical cancer the individual might have been infected with Human Papilloma virus, had atypical cells of undetermined significance (ACUS), had abnormal pap smear results, or had been diagnosed with precursor of cervical cancer for example, squamous intraepithelial lesion.
- ACUS atypical cells of undetermined significance
- this method may be used to identify dominant epitopes of any protein such as prostate specific antigen or cancer antigen-125 or Human Immunodeficiency virus or malaria or melanoma as long as the protein or peptides can be cloned into a recombinant virus that can infect dendritic cells. Therefore, this method can be used to identify epitopes from many other pathogens or self-antigens.
- an immunogenic composition comprising a sequence or a combination of sequences identified herein and an immunogenic composition comprising an adjuvant to enhance the immune response in said individuals.
- a peptide sequence may be acetylated at the amino terminus, amidated at the carboxyl terminus or acetylated at the amino terminus and amidated at the carboxyl terminus.
- Such a sequence or sequences may be expressed in a recombinant viral vector, a plasmid or a peptide.
- Representative adjuvants comprises antigens from Candida albicans , mumps, or Trichophyton .
- Such an adjuvant can also be nanoemulsions or nanoparticles.
- Such an adjuvant includes, but is not limited, to concentrated whole cell extract made from lyophilized cells of Candida albicans .
- Such an adjuvant is contained in a composition in an antigen/adjuvant ratio of about 20 micrograms antigen per 200 microliter of adjuvant to about 20 micrograms antigen per 500 microliter of adjuvant.
- Such an immunogenic composition may be administered intradermally.
- the present invention is directed to a method of determining immunodominant T cell epitopes within a protein expressed in an individual, comprising: pulsing dendritic cells obtained from the individual with a recombinant protein, establishing T cell lines by stimulating peripheral blood mononuclear cells (PBMCs) with the dendritic cells, incubating the T cells with peptides representative of the protein, measuring the specific T cell response in the incubated cells and identifying peptides that induce T cell response, where sequence of the peptide corresponds to a region within the protein, thereby determining the immunodominant T cell epitopes within the protein in the individual.
- This method may further comprise determining the amino acid sequence of the immunodominant T cell epitope identified therein.
- the individual may include but is not limited to one who is diagnosed with a pathophysiological disorder, is in remission, or is diagnosed with a precursor of the pathophysiological condition.
- the pathophysiological condition may include but is not limited to a neoplastic disease or disorder, an autoimmune disease or disorder or a pathogen-related disease.
- a neoplastic disease or disorder may include but is not limited to Human Papilloma virus infection, atypical cells of undetermined significance (ACUS), squamous intraepithelial lesion, cervical intraepithelial lesion, cervical cancer, prostate cancer, ovarian cancer, vulvar cancer, anal cancer, head cancer, neck cancer or other types of cancer.
- the T cell epitopes determined by this method may be CD4 T cell epitopes or CD8 T cell epitopes.
- the peptides that comprise the immunodominant T cell epitopes may have amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 and SEQ ID NO: 7; or have amino acid sequences of these peptides comprising at least 80% and up to and including 90% similarity of the composition of the immunodominant T cell epitopes in Human Papilloma virus protein of amino acid sequences SEQ ID NO.1, SEQ ID NO.2, SEQ ID NO. 3, SEQ ID NO. 4; SEQ ID NO. 5; SEQ ID NO. 6; SEQ ID NO.
- the present invention is further directed to a method of immunotherapy targeted towards a protein in an individual, comprising: isolating immune cells from the individual; incubating the isolated immune cells with peptide comprising one or more of the immunodominant T cell epitope identified using the method described supra; and transferring the incubated immune cells back into the individual such that the immune cells induce a specific immune response in the individual, thus generating immunotherapy targeted towards the protein in the individual.
- a peptide may be acetylated at the amino terminus, amidated at the carboxyl terminus or acetylated at the amino terminus and amidated at the carboxyl terminus.
- the protein towards which the immunotherapy is targeted may include but is not limited to a Human Papilloma virus E6 or E7 protein.
- the immune cells used in this method may be T cells or dendritic cells.
- the individual likely to benefit from this immunotherapy may include but is not limited to one who has abnormal pap smear results has been diagnosed with precursor of cervical cancer, has been diagnosed with cervical cancer or is suspected or at risk of suffering from cervical cancer. Since antigenic epitopes for many other pathogens and self antigens can be identified using the method described in the present invention, the immunotherapy described above will benefit individuals suffering from other cancers, pathogen-related diseases and autoimmune diseases.
- the present invention is also directed to synthetic peptides having a sequence selected from the group consisting of SEQ ID NO.1, SEQ ID NO.2, SEQ ID NO. 3, SEQ ID NO. 4; SEQ ID NO. 5; SEQ ID NO. 6; SEQ ID NO. 7, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, or SEQ ID NO: 37; or have amino acid sequences of these peptides comprising at least 80% and up to and including 90% similarity of the amino acid sequences SEQ ID NO.1, SEQ ID NO.2, SEQ ID NO. 3, SEQ ID NO. 4; SEQ ID NO.
- SEQ ID NO. 6 SEQ ID NO. 7, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, or SEQ ID NO: 37 (Tables 1 and 6-7, and FIG. 5 ).
- an immunogenic composition comprising one or more of the synthetic peptides identified herein.
- Such synthetic peptides may be acetylated at the amino terminus, amidated at the carboxyl terminus or acetylated at the amino terminus and amidated at the carboxyl terminus.
- Such an immunogenic composition may also comprise an adjuvant to enhance the immune response in the individuals.
- Such a sequence or sequences may be expressed in a recombinant viral vector, a plasmid or a peptide.
- Such an adjuvant comprises antigens from Candida albicans , mumps, or Trichophyton .
- Such an adjuvant can also be nanoemulsions or nanoparticles.
- Such an adjuvant includes, but is not limited, to concentrated whole cell extract made from lyophilized cells of Candida albicans .
- Such an adjuvant is contained in a composition in an antigen/adjuvant ratio of about 20 micrograms antigen per 200 microliter of adjuvant to about 20 micrograms antigen per 500 microliter of adjuvant.
- Such an immunogenic composition may be administered intradermally.
- the present invention is also directed to a method of preventing or treating a pathophysiological condition involving expression of a protein in an individual, comprising administering an immunologically effective amount of the immunogenic composition described herein to the individual, where the composition activates a specific immune response in the individual, thereby preventing or treating the pathophysiological condition in the individual.
- the individual who might benefit from this method may include but is not limited to one who has Human Papilloma virus infection, one who has atypical cells of undetermined significance, one who has abnormal pap smear results, one who has been diagnosed with a precursor of cervical cancer such as squamous intraepithelial lesion or is suspected or at risk of suffering from cervical cancer.
- the cancer may include but is not limited to one that is Human Papilloma virus positive.
- the present invention is directed to a method for increasing regression of Human Papilloma Virus (HPV)-associated cervical lesions in an HPV positive individual, comprising administering an immunogenic composition comprising two or more peptides derived from two or more immunodominant epitopes of HPV E6 or E7 protein effective to generate CD8 T-cell responses specific against the HPV thereby increasing regression of the cervical lesions.
- immunogenic peptides are acetylated at the amino terminus, amidated at the carboxyl terminus or acetylated at the amino terminus and amidated at the carboxyl terminus.
- the immunogenic composition may further comprise an adjuvant, such as, but not limited to, antigens from Candida albicans , antigens from mumps, antigens from Trichophyton , a nanoemulsion or nanoparticles.
- an adjuvant includes, but is not limited, to concentrated whole cell extract made from lyophilized cells of Candida albicans .
- the immunogenic composition may be expressed in a recombinant viral vector, a plasmid or as a peptide.
- the immunodominant epitopes may include, but are not limited to, a sequence shown in SEQ ID NOs: 29-37.
- the HPV type may be HPV 16 or HPV 16 related types or HPV 18.
- Such adjuvant is contained in the composition in an antigen/adjuvant ratio of about 20 micrograms antigen per 200 microliter of adjuvant to about 20 micrograms antigen per 500 microliter of adjuvant.
- Such immunogenic composition may be administered intradermally.
- the present invention is also directed to a method to predict the probability of developing persistent cervical neoplasia in an individual, consisting the steps of: 1) obtaining whole blood from the individual; 2) establishing mature dendritic cells by pulsing the dendritic cells from the whole blood with a peptide fragment of an E6 protein of a Human Papilloma Virus; 3) establishing a T cell line by combining T cells from the whole blood with the mature dendritic cells; 4) determining the percentage of T cells in the T cell line that respond to a peptide fragment of an E6 protein of a Human Papilloma Virus.
- a higher T cell response to the peptide fragment mentioned supra from the individual being diagnosed than a T cell response to the same peptide fragment from an individual without cervical neoplasia indicates that the individual with higher T cell response is more likely to develop persistent cervical neoplasia.
- the individual undertaking the diagnosis includes, but is not limited to, an individual who has an abnormal Papanicolaou smear or is suspected to have cervical neoplasia.
- the peptide fragment of an E6 protein of a Human Papilloma Virus used in the diagnosis method includes, but is not limited to, a peptide fragment of an E6 protein of a Human Papilloma Virus type 16.
- the peptide fragment of an E6 protein of a Human Papilloma Virus used in the diagnosis method includes, but is not limited to, a peptide sequence having at least 80% identical to a sequence that is SEQ ID NO.1, SEQ ID NO.2, SEQ ID NO. 3, SEQ ID NO. 4; SEQ ID NO. 5; SEQ ID NO. 6; SEQ ID NO. 7, SEQ ID NO: 29, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, or SEQ ID NO: 37.
- the T cells used in the diagnosis method includes, but is not limited to, CD4 positive T cells.
- the immunogenic compositions disclosed herein may be administered either alone or in combination with another drug or a compound. Such a drug or a compound may be administered concurrently or sequentially with the immunogenic composition.
- the effect of co-administration with the immunogenic composition is to lower the dosage of the drug or the compound normally required that is known to have at least a minimal pharmacological or therapeutic effect against the disease that is being treated.
- toxicity of the drug or the compound to normal cells, tissues and organs is reduced without reducing, ameliorating, eliminating or otherwise interfering with any cytotoxic, cytostatic, apoptotic or other killing or inhibitory therapeutic effect of the drug or the compound.
- composition described herein and the drug or compound may be administered independently, either systemically or locally, by any method standard in the art, for example, subcutaneously, parenterally, intraperitoneally, intradermally, intramuscularly, topically, nasally, or by inhalation spray, by drug pump or contained within transdermal patch or an implant.
- Dosage formulations of the composition described herein may comprise conventional non-toxic, physiologically or pharmaceutically acceptable carriers, or vehicles suitable for the method of administration.
- the immunogenic composition described herein and the drug or compound may be administered independently one or more times to achieve, maintain or improve upon a therapeutic effect. It is well within the skill of an artisan to determine dosage or whether a suitable dosage of either or both of the immunogenic composition and the drug or compound comprises a single administered dose or multiple administered doses.
- a specific dose level of such an immunogenic composition for any particular patient depends upon a variety of factors including the activity of the specific compound employed, the age, body weight, general health, sex, diet, time of administration, route of administration, rate of excretion, drug combination, and the severity of the particular disease undergoing therapy. The person responsible for administration will determine the appropriate dose for the individual subject. Moreover, for human administration, preparations should meet sterility, pyrogenicity, and general safety and purity standards as required by Food and Drug Administration Office of Biologics standards.
- CD8 T-cell lines from women who were able to clear their Human Papilloma virus infections has been described (Nakagawa et al., 2005). Briefly, the CD8 T-cell lines were established by stimulation peripheral blood mononuclear cells using autologous dendritic cells infected with recombinant vaccinia viruses expressing the HPV 16 E6 protein. Using enzyme-linked immunospot assay, the presence of potential CD8 T-cell epitopes in the E6 31-55 and E6 61-85 regions was demonstrated for subject 2, and that in the E6 31-55, E6 76-100, E6 121-145 regions for subject 18.
- the blood samples used to establish these CD8 T-cell lines were drawn 53 or 78 months after HPV 16 clearance in subjects 2 or 18 respectively. These findings were extended by defining the minimal/optimal amino acid sequences and the Human Leukocyte Antigen restriction molecules of the CD8 T-cell epitopes.
- the CD8 T cell lines from subjects 2 and 18 were stimulated for two additional 7-day cycles to increase the frequency of targeted antigen specific T-cells as described (37).
- the HPV 16 E6 antigen-specific CD8 T-cell lines (2 ⁇ 10 7 cells from each line) were then stimulated with 10 ⁇ M of each peptide contained in positive peptide pools (three 15-mer peptides contained in each peptide pool) for 3-6 h.
- the interferon- ⁇ secreting cells were selected using a commercially available kit according to the manufacturer's instructions (Interferon- ⁇ Secretion Assay, Miltenyi Biotec).
- interferon- ⁇ positive T-cells were plated at a 0.5 cell/well concentration in a 0.5 ⁇ feeder cell mixture [Yssel's medium containing 1% human serum, penicillin G 100 U/ml, streptomycin 100 ⁇ g/ml, 5 ⁇ 10 5 /ml irradiated allogeneic peripheral blood mononuclear cells 5 ⁇ 10 4 /ml irradiated JY cells, phytohemagglutinin at a concentration of 0.1 ⁇ g/ml] and incubated at 37° C. 5% CO 2 .
- a 0.5 ⁇ feeder cell mixture Yssel's medium containing 1% human serum, penicillin G 100 U/ml, streptomycin 100 ⁇ g/ml, 5 ⁇ 10 5 /ml irradiated allogeneic peripheral blood mononuclear cells 5 ⁇ 10 4 /ml irradiated JY cells, phytohemagglutinin at a concentration of 0.1 ⁇ g/ml
- Yssel's medium with 20 u/ml of recombinant human interleukin-2 was added to each well.
- the cells were transferred to a well of a 24-wells plate containing 1 ml of 1 ⁇ feeder cell mixture (Yessel's medium, 1 ⁇ 10 6 /ml irradiated allogeneic peripheral blood mononuclear cells, 1 ⁇ 10 5 /ml irradiated JY cells, 0.1 ⁇ g/ml phytohemagglutinin).
- 1 ⁇ feeder cell mixture Yessel's medium, 1 ⁇ 10 6 /ml irradiated allogeneic peripheral blood mononuclear cells, 1 ⁇ 10 5 /ml irradiated JY cells, 0.1 ⁇ g/ml phytohemagglutinin.
- Growing cultures were split using Yssel's medium containing 20 u/ml of recombinant IL-2 for enzyme-linked immunospot assay screening assay.
- biotin-conjugated anti-interferon- ⁇ monoclonal antibody (1 ⁇ g/ml, Mabtech) was added to each well and incubated for 2 hr at 37° C. After washing the plate with phosphate buffered saline containing 0.1% Tween-20 four times, 50 ⁇ l of Avidin-bound biotinylated horseradish peroxidase H (Vectastain Elite Kit; Vector laboratories, Inc., Burlingame, Calif.) was added to each well and the plate was incubated for 1 hr at 37° C.
- Avidin-bound biotinylated horseradish peroxidase H Vectastain Elite Kit; Vector laboratories, Inc., Burlingame, Calif.
- Wells were washed with phosphate buffered saline containing 0.1% Tween-20 for 4 times and spots were developed using stable diaminobenzene (Research Genetics, Huntsville, Ala.) at room temperature. Wells were washed 3 times with deionized water and air-dried. Spot-forming units were counted using an automated enzyme-linked immunospot assay analyzer (Cell Technology, Inc., Jessup, Md.). The wells that showed spots in an enzyme-linked immunospot assay plate with one peptide pool, yet not in other plates, were considered to potentially contain T-cell clones with specificity of interest.
- Epstein-Barr virus-transformed B-lymphoblastoid cell line is established for each subject that CD8 T cell epitopes are characterized (38).
- CD3- and CD14-depleted peripheral blood mononuclear cells are incubated, with occasional mixing, for 90 minutes with a supernatant fluid of B958 containing free Epstein-Barr virus virions.
- Ninety percent of Epstein-Barr virus virions are removed by centrifugation, and the peripheral blood mononuclear cells are grown in RPMI 1640 containing 10% fetal calf serum, penicillin G (1,000 U/mL), streptomycin (1,000 pg/mL), and cyclosporin A.
- Epstein-Barr virus-transformed B-lymphoblastoid cell line cells are utilized to reduce the number of T cell clones necessary to define the minimal/optimal amino acid sequences and the restriction element of the T cell epitope.
- enzyme-linked immunospot assays were repeated using 15-mer peptides contained in the positive peptide pools individually in duplicate or triplicate.
- 15-mer peptides contained in the positive peptide pools individually in duplicate or triplicate.
- One thousand T-clone cells were co-incubated with 1 ⁇ 10 5 autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells along with 20 U/ml of recombinant human IL-2 in the presence of 15-mer peptide at a concentration of 10 ⁇ M.
- the enzyme-linked immunospot assays were otherwise performed as described above.
- enzyme-linked immunospot assays were performed, as described above, using autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells sharing one or a few class I molecules with the subjects. The results were confirmed using chromium release assays in which at least two autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells expressing the putative Human Leukocyte Antigen class I molecule were tested.
- Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells were labeled with 100 ⁇ Ci of sodium chromate (Na 2 51 CrO 4 ), and were incubated with 10 ⁇ M of positive peptide. After plating the cells in 96-wells plate at 3 ⁇ 10 3 /well, effector cells were added at multiple effector to target cell (E:T) ratios. After 5 hr of incubation, the supernatants were harvested and radioactivity was counted with a gamma counter (Packard Instruments, Meriden, Conn.). Percentage specific lysis was calculated as described (39).
- T-clone cells were stained with CD4-PE/CD8-FITC cocktail, CD3-FITC/CD16-PE cocktail and corresponding antibody isotype controls (Caltag, Burlingame, Calif.) for 30 min at 4° C.
- the cells were washed with RPMI 1640 medium plus 5% fetal bovine serum, and resuspended in phosphate buffered saline containing 1% formalin. Events were analyzed using the Coulter EPICS XL-MLC flow cytometer (Beckman Coulter, Fullerton, Calif.).
- HPV16 E6 CD8 T-cell epitopes as the source of antigens for vaccine or immunotherapy would be broader if the specific T-cells also recognized homologous epitopes in other high-risk Human Papilloma virus types. Therefore, homologous epitopes, defined as peptides containing the same anchor residues (amino acid no.
- SEQ ID NO. 2 (E6 133-142) specific T-cell clones (1,000 cells of insert clones #s tested) were tested using Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells (1 ⁇ 10 5 cells per well) from subject 18 and Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells (1 ⁇ 10 5 cells per well) from five more individuals expressing the HLA-A68 molecule.
- Peptides were added at a concentration of 10 ⁇ M along with 20 U/ml of recombinant IL-2, and the wells were set up in duplicate or triplicate.
- the enzyme-linked immunospot assay was performed as described above.
- the CD8 T-cells from women who had cleared their HPV 16 infection were incubated with autologous mature dendritic cells infected with vaccinia virus expressing E6 protein since dendritic cells are the most potent antigen presenting cells.
- One drawback of this approach is that one cannot be certain whether the antigen-specific T-cells are primed during the course of their natural HPV 16 infection in vivo or during the course of the in vitro stimulation. If the former scenario is true, then the epitope-specific memory T-cells may be detectable in peripheral blood mononuclear cells from the same subjects.
- a tetramer designed to bind T-cells specific for the SEQ ID NO. 2 (E6 133-142) epitope restricted by the HLA-A6801 molecule was obtained from the National Institutes of Health tetramer facility. A tetramer could not be made for the other epitope restricted by the HLA-B62 molecule since this Human Leukocyte Antigen type was not available for production.
- medium RPMI 1640 plus 10% human serum, penicillin 100 U/ml and streptomycin 100 pg/ml; referred to as RP-10H
- recombinant human IL-2 was added to each well to a concentration of 1,800 U/ml.
- One more ml of RP-10H with recombinant human IL-2 (1,800 U/ml) was added to each well on day 7.
- day 10 Three days later (day 10), the cells were pooled and washed three times and cultured in RP-10H at 10 6 /ml (without peptide and recombinant human IL-2) in a 24-wells plate overnight, and the tetramer staining was performed on the following day.
- the optimal amount of SEQ ID NO. 2 (E6 133-142) PE-labeled tetramer to be used was determined by serial dilution as recommended by the National Institutes of Health tetramer facility (1:50, 1:100, 1:200, 1:400, 1:800, 1:1600). The lowest concentration, 1:1600, was chosen because minimal amount of background staining was observed without decrease in the detection of the T-cell clones (#83-18, designates clone #83 from subject 18) used as positive control. Three different incubating conditions were tested (4° C. for 30 min, room temperature for 30 min, or 37° C. for 15 min), but no difference in staining was observed. Therefore, the standard condition for tetramer staining (i.e., room temperature for 30 min) was used.
- peripheral blood mononuclear cell samples were stained with CD4-FITC, CD14-FITC, CD19-FITC, CD8-PerCP, and CD45RO-APC (BD Biosciences, San Jose, Calif.).
- Peripheral blood mononuclear cells from a healthy donor known to be HLA-A6801 negative were used as a negative control.
- T-cell clone cells (#83-18) were mixed with peripheral blood mononuclear cells from this negative control donor (10% T-cell clone cells), and used as the positive control.
- the samples were analyzed using Becton Dickinson FACSCalibur (BD Bioscience). A lymphocyte gate was drawn in the forward and side scatters, and this population was further gated for CD4/14/19-FITC negativity to eliminate non-specific staining of CD4 T-cells, monocytes, and B-cells. One hundred thousand events were acquired per sample. The percentages of tetramer + CD8 + T-cells were calculated by dividing the number of cells in the circle in the right upper corner (region determined using the positive control sample) by the sum of cell numbers in the upper right and lower right quadrants (CD8 + T-cells) and the corresponding reciprocal frequencies were calculated. Whether these tetramer + CD8 + T-cells were CD45RO + T-cells were also determined.
- the patterns of CD8 T-cell epitopes in women who had cleared their HPV 16 infection were described (37).
- further characterizations of the T-cell responses in subjects 2 and 18 were performed. They were participants of a longitudinal study of Human Papilloma virus infection, and they were monitored using cervical Human Papilloma virus DNA testing by PCR, cytology, and colposcopy every 4 months.
- Subject 2's HPV 16 infection was detected at a single visit and the blood to establish the CD8 T-cell line was drawn 53 months later.
- subject 18 had an HPV 16 infection, which lasted for over 4 years, and the blood sample was taken 53 months after clearance ( FIGS. 1A-1 B).
- interferon- ⁇ secreting cells were isolated from the CD8 T-cell line from subject 2 as described above. Limiting dilution analysis was performed to isolate T-cell clones and a total of 344 T-cell clones were expanded. A random selection of 94 T-cell clones were used for enzyme-linked immunospot assay screening, and eight T-cell clones (#8-2, #15-2, #40-2, #74-2, #76-2, #78-2, #93-2, #94-2) were positive for the peptide pool covering the HPV 16 E6 61-85 region (dominant peak), but none of the T-cell clones were positive for the peptide pool covering the E6 31-55 (subdominant peak).
- FIG. 2C-2E To determine the minimal and optimal epitope amino acid sequence, a series of enzyme-linked immunospot assays were performed ( FIG. 2C-2E ). Of the series of 9-mer peptides within the E6 71-85 peptide tested, the SEQ ID NO. 1 (E6 75-83) peptide showed the most number of spot forming units per well for all clones tested followed by the E6 74-82 peptide ( FIG. 2C ). When the two 10-mer peptides surrounding the SEQ ID NO. 1 (E6 75-83) peptide and two 8-mer peptides within were compared, the SEQ ID NO.
- a chromium release assay was performed with the T-cell clones (clones #76-2 and #78-2) as effectors and Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells pulsed with the SEQ ID NO. 1 (E6 75-83) as targets ( FIG. 2F ).
- Three of the Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells were allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells expressing the HLA-B62 molecule, and all of them were lysed by the T-cell clones confirming that the restriction element of the SEQ ID NO. 1 (E6 75-83) epitope is the HLA-B62 molecule.
- a panel of allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells matched to one or more Human Leukocyte Antigen class I molecules of subject 18 were used in an enzyme-linked immunospot assay (clones #1-18, #4-18, #13-18, #21-18, #74-18, #80-18, #83-18, and #87-18 were tested), and allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells matched with the HLA-A68 molecule showed a positive response along with the autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells for all eight T-cell clones tested.
- a chromium release assay was performed with the T-cell clones (clones #83-18 and #87-18) as effectors and Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells pulsed with the E6 peptide (E6 131-145) as targets.
- E6 131-1405 Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells pulsed with the E6 peptide (E6 131-145) as targets.
- E6 131-1405 Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells
- E6 75-83-specific T cell clones (#76-2 and #78-2) were examined by pulsing the peptides with autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells and five allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells expressing the HLA-B62 molecule.
- Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells were recognized as measured by the number of spot forming units an enzyme-linked immunospot assay when they were pulsed with the HPV 16 E6 75-83 peptide but not with any other homologous peptides.
- the results were the same for the HPV 16 E6 133-142 epitope in that the Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells (autologous and 5 allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells expressing the HLA-A68 molecule) were recognized only when pulsed with the SEQ ID NO. 2 (E6 133-142) peptide but not with the others (#83-18 and #87-18. These data imply that the recognition of these E6 epitopes is type-specific.
- Flow cytometric analysis was used to determine the surface phenotype of SEQ ID NO. 1 (E6 75-83) and SEQ ID NO. 2 (E6 133-142) specific T-cell clones. All the tested T-cell clones (#40-2, #76-2, #78-2, #94-2 for subject 2 and #1-18, #4-18, #13-18, #21-18, #74-18, #80-18, #83-18, #87-18 for subject 18) were CD3 + CD4 ⁇ CD8 + CD16 ⁇ .
- Peripheral blood mononuclear cell samples from subject 18 collected at 4 months, 22 months, 27 months, 48 months, and 74 months ( FIG. 3 ) after the clearance of HPV 16 infection but prior to isolation of the T-cell clones were analyzed with and without in vitro stimulation with the SEQ ID NO. 2 (E6 133-142) peptide ( FIG. 3 and Table 4).
- the frequencies of these tetramer + CD8 + T-cells increased noticeably in the peripheral blood mononuclear cell samples taken at 4 months and 22 months (one in 512, and one in 510 respectively).
- the SEQ ID NO. 2 (E6 133-142)-specific memory T-cells were detectable at 4 months and 22 months after HPV 16 clearance.
- regions of the Human Papilloma virus HPV16 E6 protein which contain multiple T cell epitopes termed “hot spots”, have been identified and shown to be restricted by several Human Leukocyte Antigen Major Histocompatibility Complex I molecules.
- the CD8 T cell epitopes contained in these epitopes “hot spots” are relevant to 99% of the US population (Table 5).
- HPV 16 E6 antigens are useful in the development of therapeutic vaccines for prevention and treatment of cervical cancer, such as but not limited to, increasing or enhancing regression of cervical lesions in HPV positive individuals.
- a peptide mixture from two or more of SEQ ID NOS: 29-31 and/or from epitope sequences from HPV 16 E6 protein of SEQ ID NOS: 32-35 may be useful as immunogenic compositions or vaccines.
- a dominant CD8 T-cell epitope was characterized from one of the subjects and was determined to be HPV16 E6 52-61 FAFRDLCIVY (SEQ ID NO: 23) restricted by the HLA-B5701 and -B5801 molecules.
- the utility of the HPV 16/HPV 18 E6 and E7 CD8 T-cell epitopes as the source of antigens for dendritic cell immunotherapy would be broader if the specific T-cells also recognized homolous epitopes in HPV 16 variants and other high-risk HPV types.
- Such homologous epitopes were tested with the use of the T-cell clones generated to define the HPV 16 E6 52-61 epitope restricted by the HLA-B5701 and -B5801 molecules.
- HPV 16 variants and other high-risk HPV types were examined for the presence of homologous epitopes in the same region as the HPV 16 E6 CD8 T-cell epitopes.
- Homologous epitopes were present in 13 other high risk HPV types including HPV 18,31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 68, and 73.
- ELISPOT assays were performed using the HPV 16 52-61 specific T-cell clones (nos.
- Human papillomavirus type 16 (HPV 16) E6 46-80 (35-mer, SEQ ID No: 33, CH 3 —) peptide was used as a model antigen since it is known to contain the dominant CD8 T-cell epitope in the C57/BL6 background.
- SEQ ID No: 33 is acetylated (CH 3 —) at the amino terminus and amidated at the carboxyl ternius (—NH 2 ) to enhance stability.
- the effect of CANDIN as adjuvant on enhancing immune responses was assessed by vaccinating C57BL/6 mice with the HPV 16 E6 46-80 peptide.
- HPV-16 E6 protein contains CD8 and CD4 epitopes.
- the advantages of using synthetic peptides as vaccine are numerous, however available adjuvants for peptide vaccines are limited.
- the only widely used adjuvant for peptide vaccine is an aluminum-based adjuvant that is known to elicit predominantly a Th2 immune response, which is ineffective at producing CD8 T-cells (40). Therefore, the aluminum-based adjuvant would not be useful for a vaccine designed to stimulate T-cell responses, such as instant HPV peptide vaccine.
- CANDIN Allermed, San Diego, Calif.
- a whole cell extract of Candida albicans approved by FDA for skin testing of tuberculosis was selected as adjuvant for HPV E6 peptides vaccines.
- Mice were sacrificed one week after the last injection, and intracellular cytokine staining was performed.
- the spleen cells were incubated overnight in the presence or absence of HPV 16 E6 48-57 (SEQ ID No: 36, 10-mer, EVYDFAFRDL), E6 46-60 (SEQ ID No: 37, 15-mer, RREVYDFAFRDLCIV), or E6 46-80 (SEQ ID No: 33, 35-mer, CH 3 —) peptide.
- Spleen cells were labeled (IFN-g FITC and CD8 PE), and 3 ⁇ 10 5 events were acquired. The number of IFN-gamma expressing antigen-specific T-cells were compared among groups.
- mice vaccinated with the 20 ug/200 ul combination were found in mice vaccinated with the 20 ug/200 ul combination, followed closely by mice injected with 200 ug/200 ul (data not shown).
- the vaccinations were repeated using the 20 ug/200 ul combination (3 intradermal injections 4 days, 1 week, 2 weeks, or 3 weeks apart).
- FIG. 5A shows the results obtained using HPV 16 E6 48-57 (SEQ ID No: 36, 10-mer, EVYDFAFRDL) as antigen.
- FIG. 5B shows the results obtained using HPV 16 E6 46-60 (SEQ ID No: 37, 15-mer, RREVYDFAFRDLCIV) as antigen.
- SEQ ID No: 33 is acetylated (CH 3 —) at the amino terminus and amidated at the carboxyl ternius (—NH 2 ) to enhance stability.
- IL-1 beta, IL-6, IL-9, IL-10, IL-12p40, IL-23Ap19, IL-27p28, IFN-gamma, and TNF-alpha was examined in monocyte-derived Langerhan cells stimulated by CANDIN using qRT-PCR.
- Monocytes from PBMCs taken from a healthy donor were negatively selected (Monocyte Isolation Kit II, Miltenyi Biotec, Auburn, Calif.) and were treated with GM-CSF, IL-4, and TGF-b1 for 7 days as described by Fahey and colleagues.
- the threshold cycles were normalized to human glyceraldehyde 3-phosphate dehydrogenase (GAPDH) expression as FIGS. 6A-6B .
- GPDH glyceraldehyde 3-phosphate dehydrogenase
- FIG. 7 shows ELISA results of supernatants of Langerhan cells treated with CANDIN (Allermed, San Diego, Calif.). Supernatants from the experiment shown in FIG. 6 were analyzed for the IL-12p40 protein expression.
- CD8+ T-cell immune responses against the HPV-16 E6 protein but not the E7 protein were significantly associated with a favorable clinical trend in subjects being followed for cervical abnormalities (41).
- the role of CD4+ T-cell responses to the HPV-16 E6 and E7 proteins was examined in the outcomes of subjects being studied for abnormal Papanicolaouu (Pap) smear results. Subjects with a recent history of abnormal Papanicolaouu smear were eligible, and colposcopy guided biopsy was performed at enrollment. Interferon- ⁇ enzyme-linked immunospot assay, and fluorescent activated cell sorter analysis were performed.
- the CD4+ responses to certain E6 regions [E6(16-40), E6(91-115), E6(106-130), and E6(136-158)] were also significantly higher in the regressors.
- HPV-DNA typing was performed on THINPREP specimens collected on the day of enrollment from all 88 subjects. Overall, at least 1 type of HPV-DNA was detected in 83 (95.4%) of 87 subjects.
- 28 (32.2%) of 87 subjects had a single detectable HPV type; 2 HPV types were detected in 14 (16.1%) subjects; 3 HPV types in 14 (16.1%) subjects; and 4 or more types in 27 (31.0%) subjects.
- HPV-16 infected subjects were removed in the analysis of CD4+ T-cell responses (non-HPV-16-positive subjects).
- positive CD4+ T-cell responses were detected against the HPV-16 E6 protein (20/63 or 31.7%) or the E7 protein (7/63 or 11.1%) in subjects without detectable HPV-16 infection.
- the vaccine consists of four HPV-16 E6 peptides, all of which are acetylated (CH 3 —) at the amino terminus and amidated at the carboxyl ternius (—NH 2 ) to enhance stability:
- E6 1-45 (SEQ ID No: 32, CH 3 -MHQKRTAMFQDPQERPRKLPQLCTELQTT IHDIILECVYCKQQLL-NH 2 ), E6 46-80 (SEQ ID No: 33, CH 3 -RREVYDFAFRDLCIVYRDGNPYAVCDKCL KFYSKI-NH 2 ), E6 81-115 (SEQ ID No: 34, CH 3 -SEYRHYCYSLYGTTLEQQYNKPLCDLLIR CINCQK-NH 2 ), and E6 116-158 (SEQ ID No: 35, CH 3 -PLCPEEKQRHLDKKQRFHNIRGRWTGRCM SCCRSSRTRRETQL-NH 2 ).
- cGMP-grade peptides (90% purity; CPC Scientific, San Jose, Calif.) is examined. Their safety for human use is ensured, in accordance with FDA requirements, by testing 14-day sterility (USP ⁇ 71>), testing pyrogens, describing appearance and identity, analyzing amino acids, determining impurities by HPLC, assessing H 2 O content and net active peptide, and describing any organic solvents (each peptide to be assessed individually as per the FDA).
- the lyophilized peptide mixture is dissolved using one drop ( ⁇ 20 ⁇ l) of sterile, pyrogen-free, endotoxin-free, and mycoplasma-free dimethylsulfoxide (DMSO; WAK-Chemie Medical GMBH, Steinbach, Germany), and then 300 ⁇ l of CANDIN (dose used for treating skin warts) will be added.
- DMSO sterile, pyrogen-free, endotoxin-free, and mycoplasma-free dimethylsulfoxide
- CANDIN dose used for treating skin warts
- the immunodominant HPV-16 E6 CD8 T-cell epitope has been shown to be E6 48-57, presented by the H-2K b molecule (43).
- the T-cell response to this epitope is examined using intracellular cytokine staining of IFN-g, using spleen cells from five mice each from Groups 3-6 (spleens from the other five mice will be used for histology) that are sacrificed on days 32 and 60.
- Phorbol myristate acetate and ionomycin are used as a positive control
- medium is used as a negative control for IFN-g secretion
- a pool of peptides included in the vaccine will also be tested for IFN-g secretion.
- HPV-specific T-cells # spot-forming units in antigen wells minus # spot-forming units in medium-only wells
- mice in ‘core’ and ‘recovery’ groups will be analyzed separately.
- HPV therapeutic vaccine containing E6 peptides and CANDIN in women with biopsy-proven high-grade squamous intraepithelial lesions (HSIL) is performed.
- the vaccine consists of HPV peptides and CANDIN.
- the vaccine consists of four HPV-16 E6 peptides, all of which are acetylated (CH 3 —) at the amino terminus and amidated at the carboxyl ternius (—NH 2 ) to enhance stability:
- E6 1-45 (SEQ ID No: 32, CH 3 -MHQKRTAMFQDPQERPRKLPQLCTELQTT IHDIILECVYCKQQLL-NH 2 ), E6 46-80 (SEQ ID No: 33, CH 3 -RREVYDFAFRDLCIVYRDGNPYAVCDKCL KFYSKI-NH 2 ), E6 81-115 (SEQ ID No: 34, CH 3 -SEYRHYCYSLYGTTLEQQYNKPLCDLLIR CINCQK-NH 2 ), and E6 116-158 (SEQ ID No: 35, CH 3 -PLCPEEKQRHLDKKQRFHNIRGRWTGRCM SCCRSSRTRRETQL-NH 2 ).
- Vaccine recipients are women with untreated biopsy-proven HSILs. Four injections (one every 3 weeks) of the vaccine are intradermally administered in upper extremities. Blood is drawn for CD3 ELISPOT (to assess CD4 and CD8 responses) and immune suppressor cell analysis before and after the second and fourth injections. Clinical response is assessed by performing LEEP excision after four injections. HPV-DNA testing is performed before and after four injections ( FIG. 8 ). Each subject is given a single dose level for all four injections. The first cohort of six subjects receives a 50 pg dose; when the cohort is completed, the next subject receives the next higher dose level (detailed below and in FIG. 9 ). After all doses are tested (assuming no dose-limiting toxicity was observed), maximum tolerated dose (MTD), immunologically optimal dose (IOD), and clinically optimal dose (COD) are determined. An additional 30 subjects are vaccinated at the final dose (see below).
- the first six subjects each receive the lowest dose (50 micrograms) of peptide as long as dose-limiting toxicity is not seen in more than one recipient.
- the first two subjects in each dose level are staggered by at least one week as per FDA recommendations.
- the dose level is increased as shown in FIG. 9 until maximum tolerated dose is reached or the study is completed. Thirty additional subjects are vaccinated at the final dose for further assessment of clinical response.
- THINPREP samples are tested for 37 HPV genotypes using the “Linear Array HPV Genotyping Test” according to the manufacturer's instructions (Roche Molecular Diagnostics, Inc., Alameda, Calif.).
- the HPV types to be tested include 6, 11, 16, 18, 26, 31, 33, 35, 39, 40, 42, 45, 51, 52, 53, 54, 55, 56, 58, 59, 61, 62, 64, 66, 67, 68, 69, 70, 71, 72, 73, 81, 82, 83, 84, IS39, and CP6108.
- the human b-globin signal is be assayed as a positive control for sample adequacy for DNA content from each sample.
- Positive-control samples with added HPV plasmid DNA and plasmid-encoded human b-globin gene
- negative-control samples no HPV plasmid DNA and no human b-globin gene
- PBMCs are separated into CD14 + and CD14 ⁇ populations and cryopreserved.
- all three blood samples (before vaccination, after two vaccinations, and after four vaccinations) are used to establish T-cell lines and to perform ELISPOT assays.
- CD3 T-cell lines are established by stimulating in vitro magnetically selected CD3 cells with autologous mature dendritic cells exposed to HPV 16 E6-vac, E7-vac, E6-GST, and E7-GST.
- ELISPOT assays are performed as described (45).
- PBMCs circulating Treg cells and Myeloid-derived suppressor cells
- CD4 + CD25 + forkhead box (FOX) P3 + cytotoxic T lymphocyte-associated antigen-4 (CTLA-4) + cells are determined by flow cytometry using anti-human FoxP3 staining kit (allophycocyanin, eBiosciences, San Diego, Calif.), CTLA-4 peridinin-chlorophyll-protein complex (BD PharMingen, San Jose, Calif.), CD25 phycoerythrin, and CD4 fluorescein isothiocyanate (BD Biosciences, San Jose, Calif.) (48). Cells are analyzed by flow cytometry (XL-MCL, Beckman Coulter Inc., Fullerton, Calif.).
- the percent of circulating Treg cells (% CD4 + CD25 + FoxP3 + CTLA-4 + /total CD4 + ) is determined before vaccination, after two, and after four injections.
- the Treg cells are considered to have increased if after two or four injections, the percent is at least two-fold greater than before injections.
- PBMCs are stained with CD14 and HLA-DR antibodies, and the percentage of CD14+HLA-DR ⁇ /low are assessed (49).
- Representative sections of LEEP specimens are used for immunohistochemical staining using FOXP3 (rabbit polyclonal; Abcam, Cambridge, Mass.) to innumerate the number of cervical Tregs (50).
- the densities of FOXP3+ cells are determined using an image analysis software, and only cells with nuclear staining are counted.
Abstract
Description
- This continuation-in-part application claims benefit of priority under 35 U.S.C. §120 of pending non-provisional application U.S. Ser. No. 12/286,822, filed on Oct. 2, 2008, which claims benefit of priority under 35 U.S.C. §119(e) of provisional application U.S. Ser. No. 60/997,405 filed on Oct. 3, 2007, now abandoned, the entirety of both of which are herein incorporated by references.
- This invention was made with government under grant number CA051323 awarded by the National Institutes of Health. The government has certain rights in this invention.
- 1. Field of the Invention
- The present invention relates generally to the field of immunology. More specifically, the present invention involves identification of dominant CD8 T cell epitopes in the Human Papilloma virus (HPV) proteins and its use in treating cancer such as cervical cancer.
- 2. Description of the Related Art
- Cervical cancer is the second most common malignancy among women worldwide (1) with 400,000 new cases annually (2). Annually 12,000 to 14,000 new cases of squamous cell cancer of the cervix are reported in the United States (3), resulting in about 3,500 deaths per year. High-risk Human Papilloma virus, the most commonly HPV16, is the major cause of cervical cancer (4-5). Among the over one hundred different types of Human Papilloma virus, at least 15 are strongly associated with invasive squamous cell cancer of the cervix (6). HPV16 is the one most commonly found associated with this cancer (7-8).
- Human Papilloma virus infection is also associated with the precursor lesion of cervical cancer, squamous intraepithelial lesion (7-12). While most low-grade squamous intraepithelial lesions prospectively regress spontaneously (13-14), some progress to high-grade squamous intraepithelial lesions. These high-grade lesions, in particular, cervical intraepithelial neoplasia-3 is associated with a high rate progression to invasive cervical cancer (15-16).
- Two early gene products, E6 and E7, mediate transformation to a malignant phenotype by Human Papilloma virus. Both of these viral proteins have been shown to interact with the products of cellular human tumor suppressor genes. The E6 protein can bind and promote degradation of cell-encoded p53, while the E7 protein interacts with the retinoblastoma susceptibility gene product. Constitutive expression of HPV E6/E7 proteins is required for the maintenance of a malignant phenotype of cervical cancer (5, 17). Moreover, HPV16 E6 and E7 proteins contain many antigenic epitopes and are foreign viral antigens. These proteins may, therefore, represent targets of antigen-specific immunotherapeutic strategies for the prevention and treatment of cervical cancer.
- Cell-mediated immunity plays an important role in controlling Human Papilloma virus infection and Human Papilloma virus-associated diseases. CD4 T cells are important in the development of anti-tumor responses (18-21). It is believed that the effectiveness of these CD4 T cells lies in their ability to deliver help for priming and maintaining CD8 cytotoxic T lymphocytes, which are thought to serve as the dominant effector cells in tumor elimination. Immunohistochemical analyses of squamous intraepithelial lesions and cervical cancer specimens have demonstrated the presence of activated cytotoxic T lymphocytes in lesions (22). The CD4 T cells activate cytotoxic T lymphocytes by producing
T helper 1 cytokines (23) and by providing activation signals for priming of tumor-specific cytotoxic T lymphocytes to professional antigen presenting cells (24-27). CD8-positive cytotoxic T lymphocytes recognize foreign peptides that are 8 to 11 amino acids in length and bound to and presented by Human Leukocyte Antigen class I molecules. These peptides are called T cell epitopes. - A study identified epitopes of HPV16 E6 and E7 proteins by using overlapping peptides of these proteins to stimulate peripheral blood mononuclear cells from a healthy donor and binding assays to find candidate epitopes (28). This approach enabled the identification of Human Leukocyte Antigen-B18 epitopes, E6 80-88 (ISEYRHYCY; SEQ ID NO: 24) and E7 44-52 (QAEPDRAHY: SEQ ID NO: 28). It was also shown that E6 80-88 was a naturally processed epitope that could be recognized by T cells from a patient with high-grade squamous intraepithelial lesion. Although the binding of the peptide to the Human Leukocyte Antigen molecule was demonstrated, the strength of the T cell response to these antigenic epitopes compared with other T cell epitopes was not assessed, and it was not clear whether this peptide had a protective effect.
- A study using stimulated peripheral blood mononuclear cells from cervical cancer patients with an Human Leukocyte Antigen-A2-restricted HPV16 E7 peptide (E7 11-20) showed that cytotoxic T lymphocytes were capable of lysing Human Leukocyte Antigen-matched HPV16 E7 11-20-pulsed targets in two of three patients (29). Further, another group identified HPV-specific cytotoxic T lymphocytes in lymph nodes and tumors of cervical cancer patients (30). In previous work examining cytotoxic T lymphocyte responses to HPV16 in HPV16-infected women (no squamous intraepithelial lesion), cytotoxic T lymphocyte responses to the HPV16 E6 protein, but not to the E7 protein, were significantly associated with the clearance of HPV16 infection (31).
- These observations have demonstrated HPV16 E6- and/or E7-specific cytotoxic T lymphocytes in women with and without squamous intraepithelial lesion and in women with cervical cancer. Efforts have been made to define the viral epitopes inducing the Human Papilloma virus-specific cytotoxic T lymphocyte that are responsible for the clearance of virus-infected and virus-transformed cells. Using the same approach as was taken for HPV16, Human Leukocyte Antigen-A2.1 binding synthetic peptides of HPV18 E6 protein were identified (32). Some of these binding peptides were also shown to be antigenic by demonstrating in vitro cytotoxicity.
- High-risk human Papilloma virus peptide antigens for CD8 T lymphocytes have been shown to be antigenic in human experimental systems by demonstrating peptide-specific cytotoxicity or interferon-γ secretion. Except for the Human Leukocyte Antigen-B18-restricted epitopes identified by Bourgault Villada et al., all were pre-selected for the given Human Leukocyte Antigen types. None of the antigenic epitopes were identified based on the magnitude of T cell response regardless of the restricting Human Leukocyte Antigen molecules.
- Memory T cells play an important role in maintaining long-term immunity to previously encountered pathogens or tumor antigens. They may proliferate, and rapidly acquire effector functions to kill virus-infected cells or tumor cells, and secrete cytokines that inhibit replication of the pathogen after re-stimulation with re-exposure to antigen (33). Antigen presenting cells, which may transfer peripheral antigenic signals to the lymphoid organs, play a crucial role in the induction of antigen-specific T cell immunity responses to Human Papilloma virus infection and Human Papilloma virus-associated tumors. Dendritic cells as professional antigen presenting cells express high level of major histocompatibility complex and co-stimulatory molecules. Insufficient or improper activation of dendritic cells, caused by lack of pro-inflammatory signal, leading to antigen presentation not in an appropriate co-stimulatory context is one reason for the failure of antitumor immunity. Vaccination with autologous, tumor antigen loaded properly activated dendritic cells in vitro present promising immunotherapy modality for tumors. With the development of techniques for dendritic cell isolation, antigen loading and maturation, dendritic cell-based vaccines has progressed in recent decade (34-35).
- Thus, the prior art is deficient in peptide antigens, derived from the Human Papilloma virus E6 protein useful as vaccine antigens or for dendritic cell immunotherapy to treat cervical cancers. The present invention fulfills this long-standing need and desire in the art.
- In one embodiment of the present invention, there is provided a method of determining immunodominant T cell epitopes within a protein in an individual. This method comprises pulsing dendritic cells obtained from the individual with a recombinant protein and establishing T cell lines by stimulating peripheral blood mononuclear cells (PBMCs) with the dendritic cells. The T cell lines thus established are then incubated with peptides representative of the protein and the specific T cell response in the incubated cells is then measured. Subsequently, peptides that induce T cell response are identified, where the sequence of the peptide corresponds to a region within the protein, thereby determining the immunodominant T cell epitopes within the protein in the individual. The peptides that induce a T cell response are identified, wherein the sequence of the peptides corresponds to a region within the Human Papilloma virus protein. Thus, the pattern of the immunodominant T cell epitopes within the Human Papilloma virus protein is determined.
- In another related embodiment of the present invention, there is provided a method of immunotherapy targeted towards a protein in an individual. This method comprises isolating immune cells from the individual and incubating the isolated immune cells with peptides comprising one or more of the immunodominant T cell epitopes identified using the method described supra. These immune cells are then transferred back to the individual such that the transferred immune cells produce a specific immune response in the individual, thereby generating immunotherapy targeted towards the protein in the individual.
- In yet another related embodiment of the present invention, there are provided synthetic peptides selected from the group consisting of SEQ ID NO.1, SEQ ID NO.2, SEQ ID NO. 3, SEQ ID NO. 4; SEQ ID NO. 5; SEQ ID NO. 6; SEQ ID NO. 7, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, or SEQ ID NO: 37.
- In still another related embodiment of the present invention, there is provided an immunogenic composition comprising one or more of the synthetic peptides identified supra.
- In yet another embodiment of the present invention, there is provided a method of preventing or treating a pathophysiological condition involving expression of protein in an individual. Such a method comprises administering an immunologically effective amount of the immunogenic composition identified herein, where the composition activates a specific immune response in the individual, thereby preventing or treating the pathophysiological condition in the individual.
- In yet another embodiment of the present invention, there is provided a method for increasing regression of human papilloma virus (HPV)-associated cervical lesions in an HPV positive individual. Such a method comprises administering an immunogenic composition comprising two or more peptides derived from two or more immunodominant epitopes of HPV E6 or E7 protein effective to generate CD8 T-cell responses specific against the HPV.
- In yet another embodiment of the present invention, there is provided a method to predict the probability of developing persistent cervical neoplasia in an individual, consisting the steps of: 1) obtaining whole blood from the individual; 2) establishing mature dendritic cells by pulsing the dendritic cells from the whole blood with a peptide fragment of an E6 protein of a Human Papilloma Virus; 3) establishing a T cell line by combining T cells from the whole blood with the mature dendritic cells; 4) determining the percentage of T cells in the T cell line that respond to the peptide fragment of an E6 protein of a Human Papilloma Virus. In such a method, a higher T cell response to the peptide fragment from the individual being diagnosed than a T cell response to the same peptide fragment from an individual without cervical neoplasia indicates that the individual with higher T cell response is more likely to develop persistent cervical neoplasia.
- So that the matter in which the above-recited features, advantages and objects of the invention, as well as others which will become clear, are attained and can be understood in detail, more particular descriptions of the invention are briefly summarized. The above may be better understood by reference to certain embodiments thereof which are illustrated in the appended drawings. These drawings form a part of the specification. It is to be noted; however, that the appended drawings illustrate preferred embodiments of the invention and therefore are not to be considered limiting in their scope.
-
FIGS. 1A-1B show the natural history of HPV16 infection.FIG. 1A shows forsubject 2, the Human Papilloma virus infection was detected at one visit, the T cell clones isolated to define the dominant CD8 T cell epitope are derived from a blood sample drawn 53 months after Human Papilloma virus clearance.FIG. 1B shows subject 18, whose HPV16 infection persisted for about 4 years. Peripheral blood mononuclear cells for the cultured enzyme-linked immunospot assay were isolated from blood sample collected 4, 22, 27, 48 and 74 months after the clearance of this infection. The T cell clones isolated to define the dominant CD8 T cell epitope derived from a blood sample drawn 78 months after Human Papilloma virus clearance. -
FIGS. 2A-2F show the characterization of subject 2's dominant CD8 T cell epitope in terms of its minimal and optimal amino acid sequence and the Human Leukocyte Antigen restricting molecule. The bars represent standard errors of the means.FIG. 2A shows an enzyme-linked immunospot assay performed to retest the screen-positive T cell clones. Three 15-mer peptides contained in the positive pool were tested individually in duplicate or triplicate. Seven of eight positive T cell clones demonstrated positive responses with the E6 71-85 peptide, but not with E6 61-75 and E6 66-80 peptides.FIG. 2B shows an enzyme-linked immunospot assay was performed using the screen-positive T cell clones, with vaccinia virus expressing E6 protein (E6-vac) or wild type vaccinia virus, Western Reserve (WR-vac), at a multiplicity of infection of 5. Seven of eight screen-positive T cell clones demonstrated a strong positive response with vaccinia virus expressing E6 protein infected autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells, but not with wild type vaccinia virus infected autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells.FIG. 2C shows an enzyme-linked immunospot assay performed using the T cell clones, with 9-mer peptides overlapping by 8 amino acids, contained within the screen-positive 15-mer peptide. Seven T cell clones demonstrated a strong positive response with the SEQ ID NO. 1 E6 75-83 peptide, followed by the E6 74-82 peptide.FIG. 2D shows an enzyme-linked immunospot assay performed using the T cell clones, with two 10-mer peptides surrounding SEQ ID NO. 1 E6 75-83 and two 8-mer peptides within it. The results were equally strong with the SEQ ID NO. 1 E6 75-83 9-mer and the E6 74-83 10-mer.FIG. 2E shows a comparison of the SEQ ID NO. 1 E6 75-83 9-mer peptide and the E6 74-83 10-mer peptide, ranging from 10−5M to 10−10M, demonstrating that the optimal peptide of minimum length is the SEQ ID NO. 1 E6 75-83 9-mer.FIG. 2F shows a chromium release assay was performed using peptides-pulsed autologous or a panel of partially Human Leukocyte Antigen-matched autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells as antigen presenting cells. Human Leukocyte Antigen-B62 was demonstrated to be the restricting molecule for the CD8 epitope of SEQ ID NO. 1 E6 75-83. A representative (#78-2) of the two clones was shown. E:T ratio, effector-to-target T cell ratio. θ, autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells. *, Human Leukocyte Antigen type determined using one of the molecular methods. -
FIGS. 3A-3F show the characterization of the dominant CD8 T cell epitope of subject 18 in terms of its minimal and optimal amino acid sequence and the Human Leukocyte Antigen restricting molecule.FIG. 3A shows an enzyme-linked immunospot assay performed using eight screen-positive T cell clones, with the three 15-mer peptides contained in the HPV16 E6 121-145 region. All T cell clones demonstrated positive responses with the E6 131-145 peptide, but not with the E6 121-135 and E6 126-140 peptides.FIG. 3B shows an enzyme-linked immunospot assay was performed using eight screen-positive T cell clones, with vaccinia virus expressing E6 protein, vaccinia virus expressing E7 protein or Western Reserve wild type vaccinia virus at multiplicity of infection of 5. All eight tested T cell clones demonstrated a strong positive response with vaccinia virus expressing E6 protein, yet not with vaccinia virus expressing E7 protein and wild type vaccinia virus.FIG. 3C shows an enzyme-linked immunospot assay was performed using two T cell clones, with 10-mer peptides overlapping by 9 amino acids contained within the screen-positive 15-mer peptide. Both T cell clones demonstrated a strong positive response with the SEQ ID NO. 2 E6 133-142 peptide, but not with other 10-mer peptides.FIG. 3D shows an enzyme-linked immunospot assay was performed using four T cell clones, with different length of peptides surrounding the SEQ ID NO. 2 E6 133-142 10-mer peptide. The two 11-mer peptides surrounding this SEQ ID NO. 2 E6 133-142 10-mer peptides and the 10-mer were positive but not the 9-mer peptides within the 10-mer.FIG. 3E shows a comparison of the SEQ ID NO. 2 E6 133-142 10-mer peptide, the E6 132-142 11-mer peptide, and the E6 133-143 11-mer peptide ranging from 10−5M to 10−10M, demonstrating that the optimal peptide of minimum length is the SEQ ID NO. 2 E6 133-142 10-mer.FIG. 3F shows a chromium release assay was performed using peptide-pulsed autologous or a panel of partially Human Leukocyte Antigen-matched autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells as the antigen presenting cells. The Human Leukocyte Antigen-A6801 molecule but not the Human Leukocyte Antigen-A6802 molecule appears to be the restricting molecule for the CD8 epitope of SEQ ID NO. 2 E6 133-142. A representative (#1-18) of the two clones was shown. E:T ratio, effector-to-target T cell ratio. 0, autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells. *, Human Leukocyte Antigen type determined using one of the molecular methods. The bars represent standard errors of the means. -
FIG. 4 shows T cell epitope “hot spots” identified in the HPV16 E6 protein. Regions of the Human Papilloma virus HPV16 E6 protein, which contain multiple T cell epitopes termed “hot spots”, have been identified and shown to be restricted by several Human Leukocyte Antigen major histocompatibility complex I molecules. The CD8 T cell epitopes contained in these epitopes “hot spots” are relevant to 99% of the US population. -
FIGS. 5A-5C show intracellular cytokine staining of spleen cells from vaccinated C57BL/6 mice. A higher numbers of T-cells specific for HPV E6 were detected in mice vaccinated with HPV E6 peptides with CAN DIN (Allermed, San Diego, Calif.) as adjuvant, compared to the number of specific T cells from mice vaccinated with either the antigen or the adjutant alone.FIG. 5A shows the results obtained usingHPV 16 E6 48-57 (SEQ ID No: 36, 10-mer, EVYDFAFRDL) as antigen.FIG. 5B shows the results obtained usingHPV 16 E6 46-60 (SEQ ID No: 37, 15-mer, RREVYDFAFRDLCIV) as antigen.FIG. 5C shows the results obtained usingHPV 16 E6 46-80 (SIQ ID No: 33, 35-mer, CH3—NH2) as antigen. SEQ ID No: 33 is acetylated (CH3—) at the amino terminus and amidated at the carboxyl ternius (—NH2) to enhance stability. The results from one of the two experiments in which mice were injected thrice every two weeks are shown. -
FIGS. 6A-6B show quantitative RT-PCR analysis of monocyte-derived Langerhan cells treated with CANDIN (Allermed, San Diego, Calif.). Langerhan cells treated with E. coli LPS were used as positive control (FIG. 6A ) and Langerhan cells treated with CANDIN revealed the expression of IL-12p40 consistently (FIG. 6B ). The experiment was performed three times. -
FIG. 7 shows ELISA results of supernatants of Langerhan cells treated with CANDIN (Allermed, San Diego, Calif.). Supernatants from the above experiment were analyzed for the IL-12p40 protein expression. The results from the 24 hour time point are shown. -
FIG. 8 shows diagram of a vaccination scheme. Each subject receives all the injections at the same dose. CRC, clinical Research Center; Colpo, colposcopy; Bx, biopsy. -
FIG. 9 shows dose-escalation plan of vaccination. A total of 24 subjects are enrolled in the dose-escalation phase, and an additional 30 subjects are recruited at the final dose. - As used herein, the term, “a” or “an” may mean one or more. As used herein in the claim(s), when used in conjunction with the word “comprising”, the words “a” or “an” may mean one or more than one.
- As used herein “another” or “other” may mean at least a second or more of the same or different claim element or components thereof. Some embodiments of the invention may consist of or consist essentially of one or more elements, method steps, and/or methods of the invention. It is contemplated that any method or composition described herein can be implemented with respect to any other method or composition described herein.
- As used herein, the term “immunologically effective amount” refers to an amount that results in an improvement or remediation of the symptoms of the disease or condition due to induction of an immune response. Those of skill in the art understand that the effective amount may improve the patient's or subject's condition, but may not be a complete cure of the disease and/or condition.
- The present invention examined the pattern of Human Papilloma virus-specific CD8 T cell epitopes in the HPV16 E6 protein recognized by T lymphocytes from women demonstrating evidence of HPV-16 clearance (i.e., at least two consecutive HPV-16-negative tests after an initial HPV-16-positive test). The female subjects were participants of a longitudinal study of Human Papilloma virus infection, and were monitored using cervical Human Papilloma virus DNA testing by PCR (36), cytology, and colposcopy every 4 months. Subject 2's HPV16 infection was detected at a single visit and the blood to establish the CD8 T cell line was drawn 53 months later. Subject 18 had an HPV16 infection lasting more than 4 years, and the blood sample was taken 53 months after clearance (
FIGS. 1A-1B ). CD8 T cell lines, obtained from blood samples drawn after Human Papilloma virus infection clearance, were established by in vitro stimulation of CD8 T cells with autologous dendritic cells infected with vaccinia virus expressing the Human Papilloma virus E6 recombinant protein. - An object of the present invention is to further define for Human Papilloma virus HPV16 E6 protein the minimal and optimal amino acid sequences and the corresponding Human Leukocyte Antigen restricting molecules of the dominant CD8 T cell epitopes within those regions. Two novel HPV16 E6 CD8 T cell epitopes, SEQ ID NO. 1 E6 75-83 (KFYSKISEY) restricted by HLA-B62 and SEQ ID NO. 2 E6 133-142 (HNIRGRWTGR) restricted by HLA-A68, were determined. Additional regions which contain multiple T cell epitopes were identified as follows: SEQ ID NO. 3 (E6 49-61) restricted by HLA-A24, -B35, and -B57 molecules; SEQ ID NO. 4 (E6 75-88) restricted by HLA-B18 and -B62 molecules; SEQ ID NO. 5 (E6 127-142) restricted by HLA-A68 and -DR1 molecules; SEQ ID NO. 6 (E6 11-38) restricted by HLA-A2.1, -B48 and -B61 molecules; SEQ ID NO. 7 (E6 49-88) restricted by HLA-A24, -B18, -B35, -B57 and -B62 molecules (Table 1).
-
TABLE 1 Human Papilloma virus HPV16 E6-specific dominant T cell epitopes and peptide regions of multiple T cell epitopes Sequence HPV16 Human Leukocyte Identification # E6 Peptide Peptide Amino Acid Antigen Restriction (SEQ ID NO.) Region Sequence Element 1 HPV16 E6 KFYSKISEY HLA-B62 75-83 2 HPV16 E6 HNIRGRWTGR HLA-A68 133-142 3 HPV16 E6 VYDFAFRDLCIVY HLA-A24, -B35, and 49-61 - B57 4 HPV E6 KFYSKISEYRHYCY HLA-B18 and -B62 75-88 5 HPV16 E6 DKKQRFHNIRGRWTGR HLA-A68 and -DR1 127-142 6 HPV16 E6 DPQERPRKLPQLCTEL HLA-A2.1, -B48 and 11-38 QTTIHDIILECV - B61 7 HPV16 E6 VYDFAFRDLCIVYRDGN HLA-A24, -B18, -B35, 49-88 PYAVCDKCLKFYSKISE -B57 and -B62 YRHYCY - These epitopes were endogenously processed and are human papilloma virus-type specific. To evaluate whether these CD8 T cell epitopes may be similar enough to potential epitopes from other high-risk Human Papilloma virus types, recognition of homologous peptides by the SEQ ID NO.1 (E6 75-83) or SEQ ID NO. 2 (E6 133-142) specific T cell clones was examined (Tables 2 and 3). The SEQ ID NO. 1 (E6 75-83) or SEQ ID NO. 2 (E6 132-142) specific T cell clones did not recognize these epitopes demonstrating that they are Human Papilloma virus type-specific.
-
TABLE 2 Amino acid sequences of peptides of high-risk Human Papilloma virus types homologous to SEQ ID NO. 1 (E6 75-83) CD8 T cell epitope. Human Papilloma virus Amino Acid Sequence SEQ ID Type Sequence Position Length (aa) NO: HPV16 KFYSKISEY 75-83 9 1 HPV33 RFLSKISEY 68-76 9 8 HPV51 LFYSKIREY 68-76 9 9 HPV52 RFLSKISEY 68-76 9 10 HPV56 LFYSKVRKY 71-79 9 11 HPV73 KFYSKIREY 69-77 9 12 Bolded amino acid residues are different from those in HPV E6 75-83 CD8 T cell epitope. -
TABLE 3 Amino acid sequences of peptides of high-risk Human Papilloma virus types homologous to SEQ ID NO. 2 (E6 133-142) CD8 T cell epitope. Human Papilloma Sequence SEQ ID Virus Type Amino Acid Sequence Position Length (aa) NO: HPV16 HNIRGRWTGR 133-142 10 2 HPV31 HNIGGRWTGR 126-135 10 13 HPV33 HNISGRWAGR 126-135 10 14 HPV51 ANCWQRTRQR 137-146 10 15 HPV52 HNIMGRWTGR 126-135 10 16 HPV58 HNISGRWTGR 126-135 10 17 Bolded amino acid residues are different from those in SEQ ID NO. 2 (E6 133-142) CD8 T cell epitope. - Memory T cells play an important role in maintaining long-term immunity to previously encountered pathogens or tumor antigens. They may proliferate, rapidly acquire effector functions to kill virus-infected cells or tumor cells and secrete cytokines that inhibit replication of the pathogen after re-stimulation with re-exposure to antigen (33). The identification of HPV16 E6 132-142 specific memory T cells was examined using tetramer staining on cells obtained from drawn blood samples obtained after HPV16 clearance, and before isolation of the T cell clones. The frequencies of tetramer+CD8+ T cells were above the negative control in three of the five samples. Upon peptide-stimulation in vitro for ten days, the frequencies of tetramer+CD8+ T cells expanded in two of the three samples, and almost all the epitope-specific T cells expressed the phenotype of memory T cell CD45RO+ (Table 4).
-
TABLE 4 The reciprocal frequency of Human Leukocyte Antigen-A68/HPV16 Months after Peripheral Peptide-stimulated Human Papilloma blood mononu- peripheral blood mono- virus clearance clear cells (%) nuclear cells (%) † 4 2,146 (0.047) 512 (0.2) 22 3,116 (0.032) 510 (0.2) 27 5,002 (0.020) 11,572 (0.0086) 48 5,214 (0.019) 19,350 (0.0052) 74 2,311 (0.043) 10,209 (0.0098) Positive control 11 (9.0) 8 (12.6) Negative control 5,010 (0.020) 11,939 (0.0084) † Peripheral blood mononuclear cells were stimulated with SEQ ID NO. 2 (E6 133-142) for ten days before analysis. - Since this method of in vitro stimulation is used to increase the number of memory T cells, the data indicates the Human Papilloma virus-specific T cells can be detected at 22 months, or almost 2 years, after the Human Papilloma virus-DNA has become undetectable. It may be that the SEQ ID NO. 2 (E6 133-142) specific T cells were isolated 78 months after HPV16 clearance because mature dendritic cells, which are the most potent antigen presenting cells, were used for in vitro stimulation. The challenge in the future is to determine whether these memory cells confer long-term protection to Human Papilloma virus re-infection and whether these memory T cells are capable of quickly differentiating into a potent effector response during Human Papilloma virus re-infection.
-
TABLE 5 SEQ U.S. Phenotype (%)~ ID Afr. Epitope Sequence NO: HLA Cauc. Amer. Hisp. Asian E6(11-19) KLPQLCTEL 18 A2 50.7 26.7 65.8 54.3* E6(29-37) TIHDIILEC 19 B48 0.0 0.0 7.3 7.6 E6(29-38) TIHDIILECV 20 A2 50.7 26.7 65.8 54.3* E6(31-38) HDIILECV 21 B61 2.4 0.0 7.3 6.4 E6(49-57) VYDFAFRDL 22 A24 21.3 8.9 24.4{circumflex over ( )} 48.0* E6(52-61) FAFRDLCIVY 23 B57 7.0 6.4 2.4 2.6* E6(52-61) FAFRDLCIVY 23 B35 20.9 11.7 26.8 10.6* E6(75-83) KFYSKISEY 1 B62 10.8 3.2 5.6 9.4 E6(80-88) ISEYRHYCY 24 B18 4.6 8.5 12.2{circumflex over ( )} 1.8* E6(133-142) HNIRGRWTGR 2 A68 4.4 15.8 29.2{circumflex over ( )} 2.6* E7(7-15) TLHEYMLDL 25 A2 50.7 26.7 65.8 54.3* E7(7-15) TLHEYMLDL 25 B8 22.5 12.8 4.9 2.8 E7(7-15) TLHEYMLDL 25 B48 0.0 0.0 7.3 7.6 E7(11-20) YMLDLQPETT 26 A2 50.7 26.7 65.8 54.3* E7(79-87) LEDLLMGTL 27 B60 12.4 4.2 3.0 18.4 E7(44-52) QAEPDRAHY 28 B18 Cuml 100 98.2 100 100 - Thus, considerable effort has been made to identify antigenic epitopes of Human Papilloma virus. However, the present invention differs from others in that the approach has an advantage of being able to select T cell epitopes based on the magnitude of the T cell response. Hence, these epitopes may play a significant role in viral clearance. Additionally, the present invention studied women who demonstrated Human Papilloma virus clearance and identified several dominant CD8 T cell epitopes and regions of multiple T cell epitopes, which are relevant to approximately 99% of the U.S. population. Table 5 shows the CD8 T-cell epitopes contained in the
HPV 16 E6 and E7 epitope hot spots. Taken together, SEQ ID NO. 1 through SEQ ID NO. 7 E6 peptides are immunodominant regions in which several T cell epitopes are contained. It is contemplated that one may determine whether these memory cells confer long-term protection to Human Papilloma virus re-infection and whether these memory T-cells are capable of differentiating into a effector response during Human Papilloma virus re-infection. - The method in the present invention used to identify the Human Papilloma virus SEQ ID NO. 1 (E6 75-83) and SEQ ID NO. 2 (E6 133-142) epitopes and Human Papilloma virus regions of multiple epitopes SEQ ID NO. 3 (E6 49-61), SEQ ID NO. 4 (E6 75-88), SEQ ID NO. 5 (E6 127-142), SEQ ID NO. 6 (E6 11-38), and SEQ ID NO. 7 (E6 49-88) incorporated key technical advances, which make it feasible to identify new epitopes even when particular T lymphocytes with the specificity may be relatively infrequent. These advances included (i) use of overlapping 15-mer peptides covering the entire protein to identify the region in which the epitope is contained; (ii) magnetically selecting for interferon-γ-secreting epitope peptide-specific T lymphocytes and (iii) seeding autologous and allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells for the enzyme-linked immunospot assay, thereby minimizing the number of T cell clone cells required to 1000 cells per well.
- The present invention is directed to a method of determining a pattern of immunodominant T cell epitopes within a protein expressed in an individual, comprising: establishing T cell lines from an individual by stimulating in vitro the individual's immune cells with autologous dendritic cells which had been previously incubated with Human Papilloma virus protein or Human Papilloma virus peptides; further incubating the stimulated T cell line with peptides representing the Human Papilloma virus protein; determining the T cell response in the incubated cells; and identifying peptides that induce a specific T cell response, wherein a sequence of the peptide corresponds to a region within the protein, thereby determining the pattern of the immunodominant T cell epitopes within the protein in the individual.
- Generally, a set of peptides is 15-amino acid residues long and overlaps by the 10 central amino acids and is representative of the entire protein. These peptides allow identification of what comprises the immunodominant T cell epitope. These peptides are used to select T cell lines based on the secretion of interferon-γ. Specifically, these peptides are fragments of Human Papilloma virus protein having amino acid sequence of SEQ ID NO. 1 (E6 75-83), SEQ ID NO. 2 (E6 133-142), SEQ ID NO.3 (E6 49-61), SEQ ID NO. 4 (E6 75-88), SEQ ID NO. 5 (E6 127-142), SEQ ID NO. 6 (E6 11-38), and SEQ ID NO. 7 (E6 49-88); or have amino acid sequences of these peptides comprising at least 80% and up to and including 90% similarity of the composition of the immunodominant T cell epitopes in Human Papilloma virus protein of amino acid sequences SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7 (Table 1).
- Hence, the present invention contemplates investigating human papilloma virus epitopes as tumor antigens and using them as sources of antigens for dendritic cell immunotherapies or as a therapeutic vaccine to treat cervical cancer patients who express the particular Human Leukocyte Antigen types. The small size of these epitopes makes it easier to produce a large quantity of the antigen at Good Manufacturing Practice grade compared to a whole protein. Additionally, it is safer to use these epitopes in the treatment since the small size of the peptide makes it unlikely to have oncogenic potential. It is further contemplated to identify a large number of similar epitopes restricted by a wide variety of Human Leukocyte Antigen types, to be used either singly or together in concert, to develop a preventative vaccine, which could be used for the general population. Such a vaccine might comprise use of recombinant viral vector, a plasmid or a peptide.
- Generally, such methods can be performed on an individual who is diagnosed with a pathophysiological condition, is in remission, or is diagnosed with a precursor of the pathophysiological condition. Examples of such pathophysiological conditions include but are not limited to a neoplastic disease or disorder, an autoimmune disease or disorder, or a pathogen-related infection or disease. Further, examples of the neoplastic disease include but are not limited to prostate cancer, ovarian cancer, or cervical cancer. In the case of cervical cancer, the individual might have been infected with Human Papilloma virus, had atypical cells of undetermined significance (ACUS), had abnormal pap smear results, or had been diagnosed with precursor of cervical cancer for example, squamous intraepithelial lesion. Although the present invention used the method to identify immunodominant epitopes of Human Papilloma virus protein, this method may be used to identify dominant epitopes of any protein such as prostate specific antigen or cancer antigen-125 or Human Immunodeficiency virus or malaria or melanoma as long as the protein or peptides can be cloned into a recombinant virus that can infect dendritic cells. Therefore, this method can be used to identify epitopes from many other pathogens or self-antigens.
- Furthermore, the present invention is contemplated for use as an immunogenic composition comprising a sequence or a combination of sequences identified herein and an immunogenic composition comprising an adjuvant to enhance the immune response in said individuals. Such a peptide sequence may be acetylated at the amino terminus, amidated at the carboxyl terminus or acetylated at the amino terminus and amidated at the carboxyl terminus. Such a sequence or sequences may be expressed in a recombinant viral vector, a plasmid or a peptide. Representative adjuvants comprises antigens from Candida albicans, mumps, or Trichophyton. Such an adjuvant can also be nanoemulsions or nanoparticles. Such an adjuvant includes, but is not limited, to concentrated whole cell extract made from lyophilized cells of Candida albicans. Such an adjuvant is contained in a composition in an antigen/adjuvant ratio of about 20 micrograms antigen per 200 microliter of adjuvant to about 20 micrograms antigen per 500 microliter of adjuvant. Such an immunogenic composition may be administered intradermally.
- The present invention is directed to a method of determining immunodominant T cell epitopes within a protein expressed in an individual, comprising: pulsing dendritic cells obtained from the individual with a recombinant protein, establishing T cell lines by stimulating peripheral blood mononuclear cells (PBMCs) with the dendritic cells, incubating the T cells with peptides representative of the protein, measuring the specific T cell response in the incubated cells and identifying peptides that induce T cell response, where sequence of the peptide corresponds to a region within the protein, thereby determining the immunodominant T cell epitopes within the protein in the individual. This method may further comprise determining the amino acid sequence of the immunodominant T cell epitope identified therein. In general, the individual may include but is not limited to one who is diagnosed with a pathophysiological disorder, is in remission, or is diagnosed with a precursor of the pathophysiological condition.
- Further, the pathophysiological condition may include but is not limited to a neoplastic disease or disorder, an autoimmune disease or disorder or a pathogen-related disease. Examples of the neoplastic disease or disorder may include but is not limited to Human Papilloma virus infection, atypical cells of undetermined significance (ACUS), squamous intraepithelial lesion, cervical intraepithelial lesion, cervical cancer, prostate cancer, ovarian cancer, vulvar cancer, anal cancer, head cancer, neck cancer or other types of cancer. Additionally, the T cell epitopes determined by this method may be CD4 T cell epitopes or CD8 T cell epitopes. Still further, the peptides that comprise the immunodominant T cell epitopes may have amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 and SEQ ID NO: 7; or have amino acid sequences of these peptides comprising at least 80% and up to and including 90% similarity of the composition of the immunodominant T cell epitopes in Human Papilloma virus protein of amino acid sequences SEQ ID NO.1, SEQ ID NO.2, SEQ ID NO. 3, SEQ ID NO. 4; SEQ ID NO. 5; SEQ ID NO. 6; SEQ ID NO. 7, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, or SEQ ID NO: 37 (Tables 1 and 6-7, and
FIG. 5 ). - The present invention is further directed to a method of immunotherapy targeted towards a protein in an individual, comprising: isolating immune cells from the individual; incubating the isolated immune cells with peptide comprising one or more of the immunodominant T cell epitope identified using the method described supra; and transferring the incubated immune cells back into the individual such that the immune cells induce a specific immune response in the individual, thus generating immunotherapy targeted towards the protein in the individual. Such a peptide may be acetylated at the amino terminus, amidated at the carboxyl terminus or acetylated at the amino terminus and amidated at the carboxyl terminus. Specifically, the protein towards which the immunotherapy is targeted may include but is not limited to a Human Papilloma virus E6 or E7 protein. The immune cells used in this method may be T cells or dendritic cells. The individual likely to benefit from this immunotherapy may include but is not limited to one who has abnormal pap smear results has been diagnosed with precursor of cervical cancer, has been diagnosed with cervical cancer or is suspected or at risk of suffering from cervical cancer. Since antigenic epitopes for many other pathogens and self antigens can be identified using the method described in the present invention, the immunotherapy described above will benefit individuals suffering from other cancers, pathogen-related diseases and autoimmune diseases.
- The present invention is also directed to synthetic peptides having a sequence selected from the group consisting of SEQ ID NO.1, SEQ ID NO.2, SEQ ID NO. 3, SEQ ID NO. 4; SEQ ID NO. 5; SEQ ID NO. 6; SEQ ID NO. 7, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, or SEQ ID NO: 37; or have amino acid sequences of these peptides comprising at least 80% and up to and including 90% similarity of the amino acid sequences SEQ ID NO.1, SEQ ID NO.2, SEQ ID NO. 3, SEQ ID NO. 4; SEQ ID NO. 5; SEQ ID NO. 6; SEQ ID NO. 7, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, or SEQ ID NO: 37 (Tables 1 and 6-7, and
FIG. 5 ). - Furthermore, the present invention is further directed to an immunogenic composition comprising one or more of the synthetic peptides identified herein. Such synthetic peptides may be acetylated at the amino terminus, amidated at the carboxyl terminus or acetylated at the amino terminus and amidated at the carboxyl terminus. Such an immunogenic composition may also comprise an adjuvant to enhance the immune response in the individuals. Such a sequence or sequences may be expressed in a recombinant viral vector, a plasmid or a peptide. Such an adjuvant comprises antigens from Candida albicans, mumps, or Trichophyton. Such an adjuvant can also be nanoemulsions or nanoparticles. Such an adjuvant includes, but is not limited, to concentrated whole cell extract made from lyophilized cells of Candida albicans. Such an adjuvant is contained in a composition in an antigen/adjuvant ratio of about 20 micrograms antigen per 200 microliter of adjuvant to about 20 micrograms antigen per 500 microliter of adjuvant. Such an immunogenic composition may be administered intradermally.
- Additionally, the present invention is also directed to a method of preventing or treating a pathophysiological condition involving expression of a protein in an individual, comprising administering an immunologically effective amount of the immunogenic composition described herein to the individual, where the composition activates a specific immune response in the individual, thereby preventing or treating the pathophysiological condition in the individual. Generally, the individual who might benefit from this method may include but is not limited to one who has Human Papilloma virus infection, one who has atypical cells of undetermined significance, one who has abnormal pap smear results, one who has been diagnosed with a precursor of cervical cancer such as squamous intraepithelial lesion or is suspected or at risk of suffering from cervical cancer. The cancer may include but is not limited to one that is Human Papilloma virus positive.
- Furthermore, the present invention is directed to a method for increasing regression of Human Papilloma Virus (HPV)-associated cervical lesions in an HPV positive individual, comprising administering an immunogenic composition comprising two or more peptides derived from two or more immunodominant epitopes of HPV E6 or E7 protein effective to generate CD8 T-cell responses specific against the HPV thereby increasing regression of the cervical lesions. Such immunogenic peptides are acetylated at the amino terminus, amidated at the carboxyl terminus or acetylated at the amino terminus and amidated at the carboxyl terminus. The immunogenic composition may further comprise an adjuvant, such as, but not limited to, antigens from Candida albicans, antigens from mumps, antigens from Trichophyton, a nanoemulsion or nanoparticles. Such an adjuvant includes, but is not limited, to concentrated whole cell extract made from lyophilized cells of Candida albicans. Also, the immunogenic composition may be expressed in a recombinant viral vector, a plasmid or as a peptide. The immunodominant epitopes may include, but are not limited to, a sequence shown in SEQ ID NOs: 29-37. The HPV type may be
HPV 16 orHPV 16 related types or HPV 18. Such adjuvant is contained in the composition in an antigen/adjuvant ratio of about 20 micrograms antigen per 200 microliter of adjuvant to about 20 micrograms antigen per 500 microliter of adjuvant. Such immunogenic composition may be administered intradermally. - Additionally, the present invention is also directed to a method to predict the probability of developing persistent cervical neoplasia in an individual, consisting the steps of: 1) obtaining whole blood from the individual; 2) establishing mature dendritic cells by pulsing the dendritic cells from the whole blood with a peptide fragment of an E6 protein of a Human Papilloma Virus; 3) establishing a T cell line by combining T cells from the whole blood with the mature dendritic cells; 4) determining the percentage of T cells in the T cell line that respond to a peptide fragment of an E6 protein of a Human Papilloma Virus. In such a method, a higher T cell response to the peptide fragment mentioned supra from the individual being diagnosed than a T cell response to the same peptide fragment from an individual without cervical neoplasia indicates that the individual with higher T cell response is more likely to develop persistent cervical neoplasia. The individual undertaking the diagnosis includes, but is not limited to, an individual who has an abnormal Papanicolaou smear or is suspected to have cervical neoplasia. The peptide fragment of an E6 protein of a Human Papilloma Virus used in the diagnosis method includes, but is not limited to, a peptide fragment of an E6 protein of a Human
Papilloma Virus type 16. The peptide fragment of an E6 protein of a Human Papilloma Virus used in the diagnosis method includes, but is not limited to, a peptide sequence having at least 80% identical to a sequence that is SEQ ID NO.1, SEQ ID NO.2, SEQ ID NO. 3, SEQ ID NO. 4; SEQ ID NO. 5; SEQ ID NO. 6; SEQ ID NO. 7, SEQ ID NO: 29, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, or SEQ ID NO: 37. The T cells used in the diagnosis method includes, but is not limited to, CD4 positive T cells. - The immunogenic compositions disclosed herein may be administered either alone or in combination with another drug or a compound. Such a drug or a compound may be administered concurrently or sequentially with the immunogenic composition. The effect of co-administration with the immunogenic composition is to lower the dosage of the drug or the compound normally required that is known to have at least a minimal pharmacological or therapeutic effect against the disease that is being treated. Concomitantly, toxicity of the drug or the compound to normal cells, tissues and organs is reduced without reducing, ameliorating, eliminating or otherwise interfering with any cytotoxic, cytostatic, apoptotic or other killing or inhibitory therapeutic effect of the drug or the compound.
- The composition described herein and the drug or compound may be administered independently, either systemically or locally, by any method standard in the art, for example, subcutaneously, parenterally, intraperitoneally, intradermally, intramuscularly, topically, nasally, or by inhalation spray, by drug pump or contained within transdermal patch or an implant. Dosage formulations of the composition described herein may comprise conventional non-toxic, physiologically or pharmaceutically acceptable carriers, or vehicles suitable for the method of administration.
- The immunogenic composition described herein and the drug or compound may be administered independently one or more times to achieve, maintain or improve upon a therapeutic effect. It is well within the skill of an artisan to determine dosage or whether a suitable dosage of either or both of the immunogenic composition and the drug or compound comprises a single administered dose or multiple administered doses.
- As is well known in the art, a specific dose level of such an immunogenic composition for any particular patient depends upon a variety of factors including the activity of the specific compound employed, the age, body weight, general health, sex, diet, time of administration, route of administration, rate of excretion, drug combination, and the severity of the particular disease undergoing therapy. The person responsible for administration will determine the appropriate dose for the individual subject. Moreover, for human administration, preparations should meet sterility, pyrogenicity, and general safety and purity standards as required by Food and Drug Administration Office of Biologics standards.
- The following examples are given for the purpose of illustrating various embodiments of the invention and are not meant to limit the present invention in any fashion. One skilled in the art will appreciate readily that the present invention is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those objects, ends and advantages inherent herein. Changes therein and other uses which are encompassed within the spirit of the invention as defined by the scope of the claims will occur to those skilled in the art.
- The generation of CD8 T-cell lines from women who were able to clear their Human Papilloma virus infections has been described (Nakagawa et al., 2005). Briefly, the CD8 T-cell lines were established by stimulation peripheral blood mononuclear cells using autologous dendritic cells infected with recombinant vaccinia viruses expressing the
HPV 16 E6 protein. Using enzyme-linked immunospot assay, the presence of potential CD8 T-cell epitopes in the E6 31-55 and E6 61-85 regions was demonstrated forsubject 2, and that in the E6 31-55, E6 76-100, E6 121-145 regions for subject 18. The blood samples used to establish these CD8 T-cell lines were drawn 53 or 78 months afterHPV 16 clearance insubjects 2 or 18 respectively. These findings were extended by defining the minimal/optimal amino acid sequences and the Human Leukocyte Antigen restriction molecules of the CD8 T-cell epitopes. - A series of 15-mer peptides overlapping each other by 10 amino acids and a series of 9-mer peptides overlapping each other by 8 amino acids covering the
HPV 16 E6 protein have been described (37). To define the minimal and optimal amino acids sequences of the CD8 T-cell epitope, 8-mer, 10-mer, 11-mer, and homologous peptides were synthesized (CPC Scientific, Inc, San Jose, Calif.). All peptides were dissolved in small amounts of dimethylsulfoxide (˜50 μl), diluted to 5 mM with phosphate buffered saline, and kept frozen at −80° C. until final dilution for their use in the assay. - The CD8 T cell lines from
subjects 2 and 18 were stimulated for two additional 7-day cycles to increase the frequency of targeted antigen specific T-cells as described (37). TheHPV 16 E6 antigen-specific CD8 T-cell lines (2×107 cells from each line) were then stimulated with 10 μM of each peptide contained in positive peptide pools (three 15-mer peptides contained in each peptide pool) for 3-6 h. Following this incubation, the interferon-γ secreting cells were selected using a commercially available kit according to the manufacturer's instructions (Interferon-γ Secretion Assay, Miltenyi Biotec). - To isolate
HPV 16 E6 peptide-specific T-cell clones, interferon-γ positive T-cells were plated at a 0.5 cell/well concentration in a 0.5×feeder cell mixture [Yssel's medium containing 1% human serum, penicillin G 100 U/ml,streptomycin 100 μg/ml, 5×105/ml irradiated allogeneic peripheral blood mononuclear cells 5×104/ml irradiated JY cells, phytohemagglutinin at a concentration of 0.1 μg/ml] and incubated at 37° C. 5% CO2. OnDay 5, 100 μl of Yssel's medium with 20 u/ml of recombinant human interleukin-2 was added to each well. After identification of growing T-cell clones, the cells were transferred to a well of a 24-wells plate containing 1 ml of 1×feeder cell mixture (Yessel's medium, 1×106/ml irradiated allogeneic peripheral blood mononuclear cells, 1×105/ml irradiated JY cells, 0.1 μg/ml phytohemagglutinin). Growing cultures were split using Yssel's medium containing 20 u/ml of recombinant IL-2 for enzyme-linked immunospot assay screening assay. - Cells secreting interferon-γ in an antigen-specific manner were detected by enzyme-linked immunospot assays. A 96-wells plate (MultiScreen; Millipore, Bedford, Mass.) was coated with primary anti-interferon-γ monoclonal antibody, 1-DIK (Mabtech, Stockholm, Sweden) at a concentration of 5 μg/ml overnight at 4° C. The plate was washed 4 times with phosphate-buffered saline and blocked with 50 μl RPMI 1640 medium supplement with 5% human serum for 1 hr at 37° C. One-hundred thousand autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells were added to all wells. Media containing T-clone cells was plated to one well at the same position in triplicate (to test two peptide pools and media only control for subject 2) or in quadruplicate (to test three peptide pools and media only control for subject 18) plates. The final concentration was 10 μM for each peptide). One phytohemagglutinin (10 μg/ml) as a positive control and one without T-clone cells as a negative control was included on each plate. After 20 hr incubation, wells were washed 4 times with phosphate buffered saline containing 0.05% Tween-20.
- A total of 50 μl biotin-conjugated anti-interferon-γ monoclonal antibody (1 μg/ml, Mabtech) was added to each well and incubated for 2 hr at 37° C. After washing the plate with phosphate buffered saline containing 0.1% Tween-20 four times, 50 μl of Avidin-bound biotinylated horseradish peroxidase H (Vectastain Elite Kit; Vector laboratories, Inc., Burlingame, Calif.) was added to each well and the plate was incubated for 1 hr at 37° C. Wells were washed with phosphate buffered saline containing 0.1% Tween-20 for 4 times and spots were developed using stable diaminobenzene (Research Genetics, Huntsville, Ala.) at room temperature. Wells were washed 3 times with deionized water and air-dried. Spot-forming units were counted using an automated enzyme-linked immunospot assay analyzer (Cell Technology, Inc., Jessup, Md.). The wells that showed spots in an enzyme-linked immunospot assay plate with one peptide pool, yet not in other plates, were considered to potentially contain T-cell clones with specificity of interest.
- An Epstein-Barr virus-transformed B-lymphoblastoid cell line is established for each subject that CD8 T cell epitopes are characterized (38). In short, CD3- and CD14-depleted peripheral blood mononuclear cells are incubated, with occasional mixing, for 90 minutes with a supernatant fluid of B958 containing free Epstein-Barr virus virions. Ninety percent of Epstein-Barr virus virions are removed by centrifugation, and the peripheral blood mononuclear cells are grown in RPMI 1640 containing 10% fetal calf serum, penicillin G (1,000 U/mL), streptomycin (1,000 pg/mL), and cyclosporin A. The peripheral blood mononuclear cells are incubated and monitored for growth of characteristic cell clumps. Once a stable Epstein-Barr virus-transformed B-lymphoblastoid cell line is established, it is cryopreserved to prevent loss due to contamination. Epstein-Barr virus-transformed B-lymphoblastoid cell line cells are utilized to reduce the number of T cell clones necessary to define the minimal/optimal amino acid sequences and the restriction element of the T cell epitope.
- To confirm the specificity of the potential-epitope positive T-cell clones identified in screening, enzyme-linked immunospot assays were repeated using 15-mer peptides contained in the positive peptide pools individually in duplicate or triplicate. One thousand T-clone cells were co-incubated with 1×105 autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells along with 20 U/ml of recombinant human IL-2 in the presence of 15-mer peptide at a concentration of 10 μM. The enzyme-linked immunospot assays were otherwise performed as described above. To determine the minimal and optimal amino acid sequences of the CD8 T-cell epitopes, additional enzyme-linked immunospot assays were performed using peptides of various lengths. Serial dilutions of these peptides were also performed whenever necessary as described. A peptide of a particular length was considered optimal if noticeably larger numbers of spot forming units were observed at multiple concentrations.
- To determine whether the
HPV 16 E6 epitopes were being endogenously processed, autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells infected with recombinant vaccinia virus expressing the E6 protein (E6-vac) at a multiplicity of infection of 5 were used as antigen-presenting cells in enzyme-linked immunospot assays. The wild-type virus, Western Reserve (WR), and/or recombinant vacciniavirus expressing HPV 16 E7 (E7-vac) served as negative controls. Otherwise, enzyme-linked immunospot assays were carried out as described above. Human Leukocyte Antigen typing was performed by serological method or sequence-specific primers and polymerase chain reaction method. - To identify putative restricting Human Leukocyte Antigen class I molecule, enzyme-linked immunospot assays were performed, as described above, using autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells sharing one or a few class I molecules with the subjects. The results were confirmed using chromium release assays in which at least two autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells expressing the putative Human Leukocyte Antigen class I molecule were tested. The Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells were labeled with 100 μCi of sodium chromate (Na2 51CrO4), and were incubated with 10 μM of positive peptide. After plating the cells in 96-wells plate at 3×103/well, effector cells were added at multiple effector to target cell (E:T) ratios. After 5 hr of incubation, the supernatants were harvested and radioactivity was counted with a gamma counter (Packard Instruments, Meriden, Conn.). Percentage specific lysis was calculated as described (39).
- 5×105 T-clone cells were stained with CD4-PE/CD8-FITC cocktail, CD3-FITC/CD16-PE cocktail and corresponding antibody isotype controls (Caltag, Burlingame, Calif.) for 30 min at 4° C. The cells were washed with RPMI 1640 medium plus 5% fetal bovine serum, and resuspended in phosphate buffered saline containing 1% formalin. Events were analyzed using the Coulter EPICS XL-MLC flow cytometer (Beckman Coulter, Fullerton, Calif.).
- The utility of the newly described HPV16 E6 CD8 T-cell epitopes as the source of antigens for vaccine or immunotherapy would be broader if the specific T-cells also recognized homologous epitopes in other high-risk Human Papilloma virus types. Therefore, homologous epitopes, defined as peptides containing the same anchor residues (amino acid no. 2 and the last amino acid residue of the CD8 T-cell epitope) located within the 20-amino-acid region from the original HPV16 epitope, were identified by examining the protein sequences of the E6 proteins of HPV31, -33, -35, -39, -45, -51, -52, -56, -58, -59, -68, and -73 (http://hpv-web.lanl.gov/stdgen/virus/hpv/). The recognition of the homologous peptides by SEQ ID NO. 1 (E6 75-83) specific T-cells clones (1,000 cells of insert clones #s tested) were tested using Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells (1×105 cells per well) from
subject 2 and Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells (1×105 cells per well) from five additional individuals expressing the HLA-B62 molecule. - Similarly, the recognition of the homologous peptides by SEQ ID NO. 2 (E6 133-142) specific T-cell clones (1,000 cells of insert clones #s tested) were tested using Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells (1×105 cells per well) from subject 18 and Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells (1×105 cells per well) from five more individuals expressing the HLA-A68 molecule. The SEQ ID NO. 1 (E6 75-83) or SEQ ID NO. 2 (E6 133-142) peptides were used as a positive control. Peptides were added at a concentration of 10 μM along with 20 U/ml of recombinant IL-2, and the wells were set up in duplicate or triplicate. The enzyme-linked immunospot assay was performed as described above.
- During the process of stimulating and isolating epitope-specific T-cells clones, the CD8 T-cells from women who had cleared their
HPV 16 infection were incubated with autologous mature dendritic cells infected with vaccinia virus expressing E6 protein since dendritic cells are the most potent antigen presenting cells. One drawback of this approach is that one cannot be certain whether the antigen-specific T-cells are primed during the course of theirnatural HPV 16 infection in vivo or during the course of the in vitro stimulation. If the former scenario is true, then the epitope-specific memory T-cells may be detectable in peripheral blood mononuclear cells from the same subjects. In order to assess this possibility, a tetramer designed to bind T-cells specific for the SEQ ID NO. 2 (E6 133-142) epitope restricted by the HLA-A6801 molecule was obtained from the National Institutes of Health tetramer facility. A tetramer could not be made for the other epitope restricted by the HLA-B62 molecule since this Human Leukocyte Antigen type was not available for production. - Peripheral blood mononuclear cells from subject 18 collected 4 months, 22 months, 27 months, 48 months, and 74 months after
HPV 16 clearance were available for this analysis (FIGS. 1A-1B ). These peripheral blood mononuclear cell samples were analyzed immediately after thawing and after in vitro stimulation in a manner known to enhance the number of memory T-cells. In short, cryopreserved peripheral blood mononuclear cells were thawed and incubated at 2×106/ml in medium (RPMI 1640 plus 10% human serum, penicillin 100 U/ml andstreptomycin 100 pg/ml; referred to as RP-10H) overnight. Then, the cells were recounted and were incubated at 1×106 peripheral blood mononuclear cells/ml/well in the presence of SEQ ID NO. 2 (E6 133-142) peptide at a concentration of 10 μM (day 0). - After a 3d incubation, recombinant human IL-2 was added to each well to a concentration of 1,800 U/ml. One more ml of RP-10H with recombinant human IL-2 (1,800 U/ml) was added to each well on
day 7. Three days later (day 10), the cells were pooled and washed three times and cultured in RP-10H at 106/ml (without peptide and recombinant human IL-2) in a 24-wells plate overnight, and the tetramer staining was performed on the following day. - The optimal amount of SEQ ID NO. 2 (E6 133-142) PE-labeled tetramer to be used was determined by serial dilution as recommended by the National Institutes of Health tetramer facility (1:50, 1:100, 1:200, 1:400, 1:800, 1:1600). The lowest concentration, 1:1600, was chosen because minimal amount of background staining was observed without decrease in the detection of the T-cell clones (#83-18, designates clone #83 from subject 18) used as positive control. Three different incubating conditions were tested (4° C. for 30 min, room temperature for 30 min, or 37° C. for 15 min), but no difference in staining was observed. Therefore, the standard condition for tetramer staining (i.e., room temperature for 30 min) was used.
- In addition the peripheral blood mononuclear cell samples were stained with CD4-FITC, CD14-FITC, CD19-FITC, CD8-PerCP, and CD45RO-APC (BD Biosciences, San Jose, Calif.). Peripheral blood mononuclear cells from a healthy donor known to be HLA-A6801 negative were used as a negative control. T-cell clone cells (#83-18) were mixed with peripheral blood mononuclear cells from this negative control donor (10% T-cell clone cells), and used as the positive control.
- The samples were analyzed using Becton Dickinson FACSCalibur (BD Bioscience). A lymphocyte gate was drawn in the forward and side scatters, and this population was further gated for CD4/14/19-FITC negativity to eliminate non-specific staining of CD4 T-cells, monocytes, and B-cells. One hundred thousand events were acquired per sample. The percentages of tetramer+ CD8+ T-cells were calculated by dividing the number of cells in the circle in the right upper corner (region determined using the positive control sample) by the sum of cell numbers in the upper right and lower right quadrants (CD8+ T-cells) and the corresponding reciprocal frequencies were calculated. Whether these tetramer+ CD8+ T-cells were CD45RO+ T-cells were also determined.
- The patterns of CD8 T-cell epitopes in women who had cleared their
HPV 16 infection were described (37). Here, further characterizations of the T-cell responses insubjects 2 and 18 were performed. They were participants of a longitudinal study of Human Papilloma virus infection, and they were monitored using cervical Human Papilloma virus DNA testing by PCR, cytology, and colposcopy every 4 months. Subject 2'sHPV 16 infection was detected at a single visit and the blood to establish the CD8 T-cell line was drawn 53 months later. On the other hand, subject 18 had anHPV 16 infection, which lasted for over 4 years, and the blood sample was taken 53 months after clearance (FIGS. 1A-1 B). - Approximately 1.8×104 (0.09%) interferon-γ secreting cells were isolated from the CD8 T-cell line from
subject 2 as described above. Limiting dilution analysis was performed to isolate T-cell clones and a total of 344 T-cell clones were expanded. A random selection of 94 T-cell clones were used for enzyme-linked immunospot assay screening, and eight T-cell clones (#8-2, #15-2, #40-2, #74-2, #76-2, #78-2, #93-2, #94-2) were positive for the peptide pool covering theHPV 16 E6 61-85 region (dominant peak), but none of the T-cell clones were positive for the peptide pool covering the E6 31-55 (subdominant peak). - When the enzyme-linked immunospot assay was repeated using individual 15-mer peptides, seven (#8-2, #15-2, #40-2, #74-2, #76-2, #78-2, #94-2) of the eight screen-positive T-cell clones were positive with the E6 71-85 peptide but not with the E6 61-75 and E6 66-80 peptides (
FIG. 2A ). To examine the nature of the antigen processing, vaccinia virus expressing E6 protein (E6-vac) or Western Reserve wild type vaccinia virus infected autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells were used as antigen presenting cells. The same seven T-cell clones positive for the E6 71-85 peptide were positive when tested with E6-vac infected Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells suggesting that this E6 epitope is endogenously processed (FIG. 2B ). - To determine the minimal and optimal epitope amino acid sequence, a series of enzyme-linked immunospot assays were performed (
FIG. 2C-2E ). Of the series of 9-mer peptides within the E6 71-85 peptide tested, the SEQ ID NO. 1 (E6 75-83) peptide showed the most number of spot forming units per well for all clones tested followed by the E6 74-82 peptide (FIG. 2C ). When the two 10-mer peptides surrounding the SEQ ID NO. 1 (E6 75-83) peptide and two 8-mer peptides within were compared, the SEQ ID NO. 1 (E6 75-83) 9-mer peptide and the E6 74-83 10-mer peptide demonstrated comparable number of spot forming units for all T-cell clones tested (FIG. 2D ). A serial dilution of these two peptides showed that they were equivalent over a wide-range of peptide concentration (FIG. 2E ). Therefore, the SEQ ID NO. 1 E6 75-83 (9 amino acids) appeared to be the minimal and optimal sequence for this epitope. - To identify the Human Leukocyte Antigen restriction element of this novel epitope, a panel of allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells matched to one or more Human Leukocyte Antigen class I molecules of
subject 2 were used in an enzyme-linked immunospot assay (clones #40-2, #76-2, #78-2, and #94-2 were tested). An allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells matched with the HLA-B62 molecule showed a positive response along with the autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells for all four T-cell clones tested. To confirm this result, a chromium release assay was performed with the T-cell clones (clones #76-2 and #78-2) as effectors and Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells pulsed with the SEQ ID NO. 1 (E6 75-83) as targets (FIG. 2F ). Three of the Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells were allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells expressing the HLA-B62 molecule, and all of them were lysed by the T-cell clones confirming that the restriction element of the SEQ ID NO. 1 (E6 75-83) epitope is the HLA-B62 molecule. - From this subject, 6.5×104 (0.31%) interferon-γ secreting cells were selected, and 504 of 1,048 T-cell clones that grew were expanded. A random selection of 94 T-cell clones was used for screening enzyme-linked immunospot assay. Sixty-four of 94 T-cell clones tested were positive for the E6 121-146 region (dominant peak), and none of them were positive for the E6 31-55 and E6 76-100 regions (subdominant peaks).
- Eight (#1-18, #4-18, #13-18, #21-18, #74-18, #83-18, #87-18) of 64 screen positive T-cell clones that grew well were re-tested with three individual 15-mer peptide in the region as well as with autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells infected with vaccinia virus expressing E6 protein, or E7 protein, or wild type vaccinia virus Western reserve (WR). All 8 T-cell clones were positive with the E6 131-145 peptide and E6-vac (
FIG. 3A-3B ). As with the previous subject, a series of enzyme-linked immunospot assays were performed to determine the optimal peptide of minimal length (FIG. 3C-3E ). Since none of the 9-mer peptides included in the E6 131-145 regions was positive, the enzyme-linked immunospot assay was repeated with a series of 10-mer peptides, and only SEQ ID NO. 2 (E6 133-142) was positive among the 10-mers (FIG. 3C ). When two 11-mers surrounding this SEQ ID NO. 2 (E6 133-142) 10-mer and two 9-mers within it were tested, the 10-mer and the two 11-mers appeared equivalent (FIG. 3D ). This was true even over a wide range of concentrations (FIG. 3E ); therefore, the SEQ ID NO. 2 (E6 133-142) 10-mer peptide was designated to be the optimal peptide of minimal length. - A panel of allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells matched to one or more Human Leukocyte Antigen class I molecules of subject 18 were used in an enzyme-linked immunospot assay (clones #1-18, #4-18, #13-18, #21-18, #74-18, #80-18, #83-18, and #87-18 were tested), and allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells matched with the HLA-A68 molecule showed a positive response along with the autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells for all eight T-cell clones tested. To confirm this result, a chromium release assay was performed with the T-cell clones (clones #83-18 and #87-18) as effectors and Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells pulsed with the E6 peptide (E6 131-145) as targets. Of the three HLA-A68 positive Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells, one was known to be HLA-A6801 while another one was known to be HLA-A6802 (
FIG. 3F ). The results were positive for autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells, Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells expressing A68 or A6801. Other allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells were negative including the allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells expressing the HLA-6802 molecule. Taken together, these data suggest that the restriction element of the SEQ ID NO. 2 (E6 133-142) epitope is the HLA-A6801 molecule. - To determine recognition by epitope-specific T-clone cells, the presence of homologous peptides from other high risk Human Papilloma virus types were examined. Five homologous peptides for the SEQ ID NO. 1 (E6 75-83) CD8 T-cell epitope (
HPV 33, 51, 52, 56, 73), and for the SEQ ID NO. 2 (E6 133-142) epitope (HPV 31, 33, 51, 52, 58) were identified (Tables 2 and 3). These peptides were synthesized and recognition by the SEQ ID NO. 1 (E6 75-83)-specific T cell clones (#76-2 and #78-2) were examined by pulsing the peptides with autologous Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells and five allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells expressing the HLA-B62 molecule. - All of the Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells were recognized as measured by the number of spot forming units an enzyme-linked immunospot assay when they were pulsed with the
HPV 16 E6 75-83 peptide but not with any other homologous peptides. The results were the same for theHPV 16 E6 133-142 epitope in that the Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells (autologous and 5 allogeneic Epstein-Barr Virus-transformed B-lymphoblastoid cell line cells expressing the HLA-A68 molecule) were recognized only when pulsed with the SEQ ID NO. 2 (E6 133-142) peptide but not with the others (#83-18 and #87-18. These data imply that the recognition of these E6 epitopes is type-specific. - Flow cytometric analysis was used to determine the surface phenotype of SEQ ID NO. 1 (E6 75-83) and SEQ ID NO. 2 (E6 133-142) specific T-cell clones. All the tested T-cell clones (#40-2, #76-2, #78-2, #94-2 for
subject 2 and #1-18, #4-18, #13-18, #21-18, #74-18, #80-18, #83-18, #87-18 for subject 18) were CD3+CD4−CD8+CD16−. - Peripheral blood mononuclear cell samples from subject 18 collected at 4 months, 22 months, 27 months, 48 months, and 74 months (
FIG. 3 ) after the clearance ofHPV 16 infection but prior to isolation of the T-cell clones were analyzed with and without in vitro stimulation with the SEQ ID NO. 2 (E6 133-142) peptide (FIG. 3 and Table 4). Three (one in 2,146 at 4 months, one in 3,116 at 22 months, and one in 2,311 at 74 months) of the five peripheral blood mononuclear cell samples (without in vitro stimulation) demonstrated staining for the tetramer+CD8+ T-cells above that of the negative control (one in 5,010). - Upon stimulation with the SEQ ID NO. 2 (E6 133-142) peptide, the frequencies of these tetramer+CD8+ T-cells increased noticeably in the peripheral blood mononuclear cell samples taken at 4 months and 22 months (one in 512, and one in 510 respectively). Ninety eight percent and 100% of the tetramer+CD8+ T-cells were CD45RO+ in these samples respectively. Taken together, the SEQ ID NO. 2 (E6 133-142)-specific memory T-cells were detectable at 4 months and 22 months after
HPV 16 clearance. - Further, regions of the Human Papilloma virus HPV16 E6 protein, which contain multiple T cell epitopes termed “hot spots”, have been identified and shown to be restricted by several Human Leukocyte Antigen Major Histocompatibility Complex I molecules. The CD8 T cell epitopes contained in these epitopes “hot spots” are relevant to 99% of the US population (Table 5).
- Women who were followed, but untreated for abnormal Pap smear results, were enrolled. HPV-DNA testing using the Linear Array HPV Geotyping Test (Roche Diagnostics, Indianapolis, Ind.) and enzyme-linked immunospot (ELISPOT) assay using the
HPV 16 E6 and E7 antigens were performed. The subjects were categorized into three groups: regressor (n=32), persistor/progressor (n=33), or indeterminate (n=20) based on comparisons of pathological diagnoses (Pap smear or biopsy) between the last clinic visit and the current clinic visit at which blood samples were collected. - There was a higher rate of CD8 T-cell responses to the
HPV 16 E6 antigen in the regressor group (17 of 32 or 53.1%) compared to the persistor/progressor group (8 of 33 or 24.2%, p=0.0225), but not for the E7 antigen (4 of 32 or 12.5% for the regressor group and 4 of 33 or 12.1% for the persistor/progressor group, p=1.0000). The results were the same when the analyses included only subjects who were HPV 16-positive (n=27, p=0.0464 for E6 and 1.0000 for E7), HPV 16-related positive (types types types -
TABLE 6 Epitope Responses Sequence SEQ ID NO E6 91-115 11 YGTTLEQQYNK 29 PLCDLLIRCINCQK E7 46-70 10 EPDRAHYNIVTFC 30 CKCDSTLRLCVQ E6 46-70 8 RREVYDFAFRDLC 31 IVYRDGNPYAVC - CD8 T-cell immune responses to the
HPV 16 E6 antigens, but not to E7 antigens are associated with SIL regression and such responses appear to be cross-reactive to other high risk HPV types. Thus, it is contemplated thatHPV 16 E6 antigens are useful in the development of therapeutic vaccines for prevention and treatment of cervical cancer, such as but not limited to, increasing or enhancing regression of cervical lesions in HPV positive individuals. For example, in addition to the immunodominant epitope sequences of SEQ ID NOS: 1 and 29-31, a peptide mixture from two or more of SEQ ID NOS: 29-31 and/or from epitope sequences fromHPV 16 E6 protein of SEQ ID NOS: 32-35 (Table 7) may be useful as immunogenic compositions or vaccines. -
TABLE 7 Epitope Sequence SEQ ID NO E6 1-45 MHQKRTAMFQDPQERPRKLPQ 32 LCTELQTTIHDIILECVYCKQQLL E7 46-80 RREVYDFAFRDLCIVYRD 33 GNPYAVCDKCLKFYSKI E6 81-115 SEYRHYCYSLYGTTLEQ 34 QYNKPLCDLLIRCINCQK E6 116-158 PLCPEEKQRHLDKKQRFHNIRG 35 RWTGRCMSCCRSSRTRRETQL - A dominant CD8 T-cell epitope was characterized from one of the subjects and was determined to be HPV16 E6 52-61 FAFRDLCIVY (SEQ ID NO: 23) restricted by the HLA-B5701 and -B5801 molecules. The utility of the
HPV 16/HPV 18 E6 and E7 CD8 T-cell epitopes as the source of antigens for dendritic cell immunotherapy would be broader if the specific T-cells also recognized homolous epitopes inHPV 16 variants and other high-risk HPV types. Such homologous epitopes were tested with the use of the T-cell clones generated to define theHPV 16 E6 52-61 epitope restricted by the HLA-B5701 and -B5801 molecules. - Published sequences of
HPV 16 variants and other high-risk HPV types were examined for the presence of homologous epitopes in the same region as theHPV 16 E6 CD8 T-cell epitopes. Homologous epitopes were present in 13 other high risk HPVtypes including HPV HPV 16 52-61 specific T-cell clones (nos. 55 and 54/82; two T-cell clones were combined due to low cell numbers) with autologous and two allogeneic EBV-transformed B-lymphoblastoid cell line (B-LCL) expressing the HLA-B5801 molecule, pulsed with these peptides. For clone no. 55, positive responses were seen forpeptides HPV 16 52-61, HPV 35 45-54, HPV 45 47-56, and HPV 73 45-54. Larger number of peptides demonstrated positive responses for clone no. 54/82 includingHPV 16 52-61, HPV 31 45-54, HPV33 45-54, HPV 35 45-54, HPV 39 47-56 HPV 45 47-56, HPV 51 45-54, HPV 58 45-54, and HPV 73 45-54. These results suggest that recognition of these T-cell epitopes are cross-reactive with homologous epitopes of many other high risk HPV types. - Human papillomavirus type 16 (HPV 16) E6 46-80 (35-mer, SEQ ID No: 33, CH3—) peptide was used as a model antigen since it is known to contain the dominant CD8 T-cell epitope in the C57/BL6 background. SEQ ID No: 33 is acetylated (CH3—) at the amino terminus and amidated at the carboxyl ternius (—NH2) to enhance stability. The effect of CANDIN as adjuvant on enhancing immune responses was assessed by vaccinating C57BL/6 mice with the
HPV 16 E6 46-80 peptide. - It is well known in the art that the HPV-16 E6 protein contains CD8 and CD4 epitopes. The advantages of using synthetic peptides as vaccine are numerous, however available adjuvants for peptide vaccines are limited. The only widely used adjuvant for peptide vaccine is an aluminum-based adjuvant that is known to elicit predominantly a Th2 immune response, which is ineffective at producing CD8 T-cells (40). Therefore, the aluminum-based adjuvant would not be useful for a vaccine designed to stimulate T-cell responses, such as instant HPV peptide vaccine. CANDIN (Allermed, San Diego, Calif.), a whole cell extract of Candida albicans approved by FDA for skin testing of tuberculosis, was selected as adjuvant for HPV E6 peptides vaccines.
- Initially, a dose range-finding study was performed in which mice (n=2 per group) were vaccinated intradermally once a week for three weeks with one of the six different combinations of peptide and CANDIN (1 ug/100 ul, 10 ug/100 ul, 100 ug/100 ul, 2 ug/200 ul, 20 ug/200 ul, or 200 ug/200 ul). Mice were sacrificed one week after the last injection, and intracellular cytokine staining was performed. The spleen cells were incubated overnight in the presence or absence of
HPV 16 E6 48-57 (SEQ ID No: 36, 10-mer, EVYDFAFRDL), E6 46-60 (SEQ ID No: 37, 15-mer, RREVYDFAFRDLCIV), or E6 46-80 (SEQ ID No: 33, 35-mer, CH3—) peptide. Spleen cells were labeled (IFN-g FITC and CD8 PE), and 3×105 events were acquired. The number of IFN-gamma expressing antigen-specific T-cells were compared among groups. The greatest number of antigen-specific T-cells were found in mice vaccinated with the 20 ug/200 ul combination, followed closely by mice injected with 200 ug/200 ul (data not shown). Such results suggested that the amount of adjuvant (CANDIN), rather than the amount of antigen (HPV E6 peptides), has a more significant effect in enhancing immune responses. The vaccinations were repeated using the 20 ug/200 ul combination (3intradermal injections 4 days, 1 week, 2 weeks, or 3 weeks apart). Intracellular cytokine staining results for spleen cells among mice injected with the “peptide with CANDIN” (n=5), “peptide alone” (n=5), “CANDIN alone” (n=5), and the “PBS control” (n=5) groups were compared and shown inFIGS. 5A-5C .FIG. 5A shows the results obtained usingHPV 16 E6 48-57 (SEQ ID No: 36, 10-mer, EVYDFAFRDL) as antigen.FIG. 5B shows the results obtained usingHPV 16 E6 46-60 (SEQ ID No: 37, 15-mer, RREVYDFAFRDLCIV) as antigen.FIG. 5C shows the results obtained usingHPV 16 E6 46-80 (SEQ ID No: 33, 35-mer, CH3—) as antigen. SEQ ID No: 33 is acetylated (CH3—) at the amino terminus and amidated at the carboxyl ternius (—NH2) to enhance stability. - Quantitative RT-PCR Analysis of Monocyte-Derived Human Langerhan Cells Treated with CANDIN
- Since Langerhan cells are likely to be the antigen presenting cells in the skin, expression of various cytokines (IL-1 beta, IL-6, IL-9, IL-10, IL-12p40, IL-23Ap19, IL-27p28, IFN-gamma, and TNF-alpha) was examined in monocyte-derived Langerhan cells stimulated by CANDIN using qRT-PCR. Monocytes from PBMCs taken from a healthy donor were negatively selected (Monocyte Isolation Kit II, Miltenyi Biotec, Auburn, Calif.) and were treated with GM-CSF, IL-4, and TGF-b1 for 7 days as described by Fahey and colleagues. Successful conversion to a Langerhan cell phenotype was demonstrated by the expression of CD1a, Langrin, and E-cadherin using FACS analysis. One million Langerhan cells each were treated with 50 ul/ml or 150 ul/ml of CANDIN, along with E. Coli LPS as a positive control and media only as a negative control. Cells were harvested at 3, 8, and 24 hr for RNA extraction, and qRT-PCR analysis was performed in duplicate for IL-1 beta, IL-6, IL-8, IL-10, IL-12p40, IL-23Ap19, IL-27p28, IFN-gamma, and TNF-alpha. The threshold cycles were normalized to human glyceraldehyde 3-phosphate dehydrogenase (GAPDH) expression as
FIGS. 6A-6B . Langerhan cells treated with E. coli LPS were used as positive control (FIG. 6A ) and Langerhan cells treated with CANDIN revealed the expression of IL-12p40 consistently (FIG. 6B ). - Supernatants (50 ul) from the above experiments were analyzed for the presence of IL-12p40 protein using the OptEIA™ kit (BD, Franklin Lakes, N.J.) according to the manufacturer's instructions.
FIG. 7 shows ELISA results of supernatants of Langerhan cells treated with CANDIN (Allermed, San Diego, Calif.). Supernatants from the experiment shown inFIG. 6 were analyzed for the IL-12p40 protein expression. - CD8+ T-cell immune responses against the HPV-16 E6 protein but not the E7 protein were significantly associated with a favorable clinical trend in subjects being followed for cervical abnormalities (41). The role of CD4+ T-cell responses to the HPV-16 E6 and E7 proteins was examined in the outcomes of subjects being studied for abnormal Papanicolaouu (Pap) smear results. Subjects with a recent history of abnormal Papanicolaouu smear were eligible, and colposcopy guided biopsy was performed at enrollment. Interferon-γ enzyme-linked immunospot assay, and fluorescent activated cell sorter analysis were performed. Subjects with histological diagnoses of cervical
intraepithelial neoplasia - HPV-DNA typing was performed on THINPREP specimens collected on the day of enrollment from all 88 subjects. Overall, at least 1 type of HPV-DNA was detected in 83 (95.4%) of 87 subjects. HPV-16 was the most commonly detected type (n=22, 25.3%) followed by HPV-39 (n=17, 19.5%), HPV-54 (n=15, 17.2%), HPV-51 (n=14, 16.1%), and HPV-35 (n=13, 14.9%). In regard to the number of HPV types detected, 28 (32.2%) of 87 subjects had a single detectable HPV type; 2 HPV types were detected in 14 (16.1%) subjects; 3 HPV types in 14 (16.1%) subjects; and 4 or more types in 27 (31.0%) subjects. Fifty subjects (57.5%) were positive for at least 1 HPV-16-related types, and 72 (82.8%) for high-risk HPV types.
- The CD4+ T-cell responses to HPV-16 E6 peptides were significantly higher in the regressors (15/33 or 45.5%) compared with the persistors (10/51 or 19.6%) (p=0.015). Although the percentage in the CD4+ T-cell responses to HPV-16 E7 antigens was also higher in the regressor group (5/33 or 15.2%) compared to the persistor group (3/51 or 5.9%), the difference was not statistically significant (p=0.25). Additional comparisons were made for subgroups of subjects based on HPV-DNA detected (Table 8).
-
TABLE 8 HPV-16 E6- or E7-specific IFN-γ ELISPOT assay results based on clinical trend. Stratifi- cation by HPV types Regressors Persistors p Regressors Persistors p E6-positive, no. (%) E7-positive, no. (%) All 15/33 (45) 10/51 (20) .015 5/33 (15) 3/51 (6) .25 High- risk 8/22 (36) 9/46 (20) .15 2/22 (9) 3/46 (7) .66 HPV HPV-16- 6/18 (33) 5/30 (17) .29 2/18 (11) 1/30 (3) .55 related HPV-16 3/10 (30) 3/11 (27) .64 0/10 (0) 1/11 (9) 1.0 - Further comparisons were made for each of the ten E6 regions or six E7 regions. The comparisons reached statistical significance for the following regions between the regressors and the persistors: E6(16-40) (24% vs. 2%, p=0.0020), E6(31-55) (21% vs. 6%, p=0.044), E6(61-85) (12% vs. 0%, p=0.021), and E6(91-115) (18% vs. 2%, p=0.013). Among the subjects who were high-risk HPV-positive, the comparisons reached statistical significance for the following regions: E6(1-25) (18% vs. 2%, p=0.035), E6(16-40) (23% vs. 2%, p=0.012), E6(61-85) (14% vs. 0%, p=0.031), E6(91-115) (23% vs. 2%, p=0.012), E6(106-130) (27% vs. 4%, p=0.012), and E6(136-158) (18% vs. 2%, p=0.035). Among subjects who were positive for HPV-16 related types, the comparisons were significant for E6(1-25)(17% vs. 0%, p=0.047), E6(16-40)(22% vs. 0%, p=0.016), E6(61-85)(17% vs, 0%, p=0.047), E6(91-115)(22% vs. 0%, p=0.016), E6(106-130)(28% vs. 3%, p=0.023), and E6 (136-158)(17% vs. 0%, p=0.047).
- Overall, 27 (32.1%) of 84 subjects demonstrated at least 1 positive peptide region within E6 and/or E7. Fourteen subjects (16.7%) were positive for 1 region; 3 subjects (3.6%) for 2 regions; 2 subjects (2.4%) for 3 regions; 3 subjects (3.6%) for 4 regions; 1 subject (1.2%) for 6 regions; 1 subject (1.2%) for 7 regions; 1 subject (1.2%) for 8 regions; 1 subject (1.2%) for 10 regions; and 1 subject (1.2%) for 12 regions. Additionally, the numbers of positive peptide regions within E6 or E7 were compared, and the regressors were more likely to have 2 or more E6-positive (p=0.0035) or E7-positive (p=0.042) peptide regions as compared to the persistors (Table 9).
-
TABLE 9 Table 9. Comparison between regressors and persistors in the number of positive CD4+ T-cell peptide region(s) in E6 or E7. Number of positive peptide region(s) 0 1 ≧2 Total E6-positive Regressor, no. 18 5 10 33 Persistor, no. 41 8 2 51 Total 59 13 12 84 E7-positive Regressor, no. 28 1 4 33 Persistor, no. 48 3 0 51 Total 76 4 4 84 - To examine whether the positive CD4+ T-cell responses to HPV-16 E6 and E7 peptides may be attributed to cross-reactivity to other HPV types, HPV-16 infected subjects were removed in the analysis of CD4+ T-cell responses (non-HPV-16-positive subjects). Overall, positive CD4+ T-cell responses were detected against the HPV-16 E6 protein (20/63 or 31.7%) or the E7 protein (7/63 or 11.1%) in subjects without detectable HPV-16 infection. When the results were evaluated based on clinical trends, the CD4+ T-cell responses to the HPV-16 E6 peptides were detected in 12 of 23 regressors and 8 of 40 persistors (52.2% vs. 20.0%, p=0.012). The responses to the HPV-16 E7 peptides were positive in 5 of 23 regressors and 2 of 40 persistors (21.7% vs. 5.0%, p=0.089). In the non-HPV-16-positive group, positive CD4+ T-cell responses were detected against both HPV-16 E6 and E7. Moreover, a favorable clinical outcome remained significantly associated with positive responses to regions within the HPV-16 E6 protein. Since the sequences of these peptides were based on HPV-16, positive responses detected in the subjects with non-HPV-16 HPV types may be due either to memory HPV-16 E6-specific T-cells from previous HPV-16 infection or to cross-recognition of HPV-16 E6 peptides by CD4+ T-cells specific for homologous peptides of other HPV types.
- Although CANDIN (Allermed, San Diego, Calif.) antigen is FDA-approved for human use, the HPV peptide—CANDIN combination has never been tested. The safety of the HPV peptide—CANDIN combination is examined in mice by a multiple-dose toxicity study (GLP) to examine the doses equivalent to the two highest human doses (250 and 500 micrograms per peptide). To examine whether CANDIN adjuvant enhances T-cell immunity to an HPV antigen, IFN-g ELISPOT assays is performed and the results of mice injected with peptides alone with those of mice injected with peptides and adjuvant at the same dose are compared.
- Because the CD4 and CD8 T-cell responses to HPV-16 E6 protein are significantly associated with cervical lesion regression (42, 44), the vaccine consists of four HPV-16 E6 peptides, all of which are acetylated (CH3—) at the amino terminus and amidated at the carboxyl ternius (—NH2) to enhance stability:
-
E6 1-45 (SEQ ID No: 32, CH3-MHQKRTAMFQDPQERPRKLPQLCTELQTT IHDIILECVYCKQQLL-NH2), E6 46-80 (SEQ ID No: 33, CH3-RREVYDFAFRDLCIVYRDGNPYAVCDKCL KFYSKI-NH2), E6 81-115 (SEQ ID No: 34, CH3-SEYRHYCYSLYGTTLEQQYNKPLCDLLIR CINCQK-NH2), and E6 116-158 (SEQ ID No: 35, CH3-PLCPEEKQRHLDKKQRFHNIRGRWTGRCM SCCRSSRTRRETQL-NH2).
Commercially produced cGMP-grade peptides (90% purity; CPC Scientific, San Jose, Calif.) is examined. Their safety for human use is ensured, in accordance with FDA requirements, by testing 14-day sterility (USP <71>), testing pyrogens, describing appearance and identity, analyzing amino acids, determining impurities by HPLC, assessing H2O content and net active peptide, and describing any organic solvents (each peptide to be assessed individually as per the FDA). The lyophilized peptide mixture is dissolved using one drop (˜20 μl) of sterile, pyrogen-free, endotoxin-free, and mycoplasma-free dimethylsulfoxide (DMSO; WAK-Chemie Medical GMBH, Steinbach, Germany), and then 300 μl of CANDIN (dose used for treating skin warts) will be added. The mixture is vortexed lightly prior to inoculation. - Four
administrations 3 weeks apart are planned for the Phase I trial; therefore, five administrations in the animal study are performed (days - The immunodominant HPV-16 E6 CD8 T-cell epitope has been shown to be E6 48-57, presented by the H-2Kb molecule (43). The T-cell response to this epitope is examined using intracellular cytokine staining of IFN-g, using spleen cells from five mice each from Groups 3-6 (spleens from the other five mice will be used for histology) that are sacrificed on
days 32 and 60. Phorbol myristate acetate and ionomycin are used as a positive control, medium is used as a negative control for IFN-g secretion, and a pool of peptides included in the vaccine will also be tested for IFN-g secretion. The number of HPV-specific T-cells (# spot-forming units in antigen wells minus # spot-forming units in medium-only wells) is compared betweenGroups 3 and 5 as well asGroups -
TABLE 10 Table 10. Six groups to be examined in the multiple-dose toxicology study Antigen(s) Adjuvant Number of Animals Dose Dose Day 32 Day 60 Group Treatment (μg/peptide) (μL) Core* Recovery† 1 Saline control 0 0 10 F 10 F 2 Adjuvant alone 0 300 10 F 10 F 3 Antigens alone 250 0 10 F 10 F 4 Antigens alone 500 0 10 F 10 F 5 Antigens + 250 300 10 F 10 F Adjuvant 6 Antigens + 500 300 10 F 10 F Adjuvant *Core, to be sacrificed 3 days after injection. †Recovery, to be sacrificed 4 weeks after the last injection. F, female. - A single-arm, open-label, dose-escalation Phase I clinical trial of a HPV therapeutic vaccine containing E6 peptides and CANDIN in women with biopsy-proven high-grade squamous intraepithelial lesions (HSIL) is performed. The vaccine consists of HPV peptides and CANDIN. The vaccine consists of four HPV-16 E6 peptides, all of which are acetylated (CH3—) at the amino terminus and amidated at the carboxyl ternius (—NH2) to enhance stability:
-
E6 1-45 (SEQ ID No: 32, CH3-MHQKRTAMFQDPQERPRKLPQLCTELQTT IHDIILECVYCKQQLL-NH2), E6 46-80 (SEQ ID No: 33, CH3-RREVYDFAFRDLCIVYRDGNPYAVCDKCL KFYSKI-NH2), E6 81-115 (SEQ ID No: 34, CH3-SEYRHYCYSLYGTTLEQQYNKPLCDLLIR CINCQK-NH2), and E6 116-158 (SEQ ID No: 35, CH3-PLCPEEKQRHLDKKQRFHNIRGRWTGRCM SCCRSSRTRRETQL-NH2).
Vaccine recipients are women with untreated biopsy-proven HSILs. Four injections (one every 3 weeks) of the vaccine are intradermally administered in upper extremities. Blood is drawn for CD3 ELISPOT (to assess CD4 and CD8 responses) and immune suppressor cell analysis before and after the second and fourth injections. Clinical response is assessed by performing LEEP excision after four injections. HPV-DNA testing is performed before and after four injections (FIG. 8 ). Each subject is given a single dose level for all four injections. The first cohort of six subjects receives a 50 pg dose; when the cohort is completed, the next subject receives the next higher dose level (detailed below and inFIG. 9 ). After all doses are tested (assuming no dose-limiting toxicity was observed), maximum tolerated dose (MTD), immunologically optimal dose (IOD), and clinically optimal dose (COD) are determined. An additional 30 subjects are vaccinated at the final dose (see below). - The first six subjects each receive the lowest dose (50 micrograms) of peptide as long as dose-limiting toxicity is not seen in more than one recipient. The first two subjects in each dose level are staggered by at least one week as per FDA recommendations. The dose level is increased as shown in
FIG. 9 until maximum tolerated dose is reached or the study is completed. Thirty additional subjects are vaccinated at the final dose for further assessment of clinical response. - THINPREP samples are tested for 37 HPV genotypes using the “Linear Array HPV Genotyping Test” according to the manufacturer's instructions (Roche Molecular Diagnostics, Inc., Alameda, Calif.). The HPV types to be tested include 6, 11, 16, 18, 26, 31, 33, 35, 39, 40, 42, 45, 51, 52, 53, 54, 55, 56, 58, 59, 61, 62, 64, 66, 67, 68, 69, 70, 71, 72, 73, 81, 82, 83, 84, IS39, and CP6108. The human b-globin signal is be assayed as a positive control for sample adequacy for DNA content from each sample. Positive-control samples (with added HPV plasmid DNA and plasmid-encoded human b-globin gene) and negative-control samples (no HPV plasmid DNA and no human b-globin gene) are provided by the manufacturer and are included in each experiment.
- After each blood draw, PBMCs are separated into CD14+ and CD14− populations and cryopreserved. To eliminate interassay variability, all three blood samples (before vaccination, after two vaccinations, and after four vaccinations) are used to establish T-cell lines and to perform ELISPOT assays. CD3 T-cell lines are established by stimulating in vitro magnetically selected CD3 cells with autologous mature dendritic cells exposed to
HPV 16 E6-vac, E7-vac, E6-GST, and E7-GST. ELISPOT assays are performed as described (45). 16 regions within the HPV-16 E6 and E7 proteins (E6 1-25, E6 16-40, E6 31-55, E6 46-70, E6 61-85, E6 76-100, E6 91-115, E6 106-130, E6 121-145, E6 136-158, E7 1-25, E7 16-40, E7 31-55, E7 46-70, E7 61-85, and E7 76-98) are examined. The assay is performed in triplicate. In order to compare each region before vaccination and after 2 or 4 injections, a t test for paired samples is performed, as described previously (46). Therefore, each subject is assessed in terms of the number of regions with statistically significant increased T-cell responses after two injections or four injections. - To measure circulating Treg cells and Myeloid-derived suppressor cells (MDSC), a small amount of PBMCs (2×106 cells) from each blood draw are used to monitor levels of circulating Tregs and MDSC to assess whether vaccination may inadvertently stimulate them (47). The number of CD4+ CD25+ forkhead box (FOX) P3+ cytotoxic T lymphocyte-associated antigen-4 (CTLA-4)+ cells are determined by flow cytometry using anti-human FoxP3 staining kit (allophycocyanin, eBiosciences, San Diego, Calif.), CTLA-4 peridinin-chlorophyll-protein complex (BD PharMingen, San Jose, Calif.), CD25 phycoerythrin, and CD4 fluorescein isothiocyanate (BD Biosciences, San Jose, Calif.) (48). Cells are analyzed by flow cytometry (XL-MCL, Beckman Coulter Inc., Fullerton, Calif.). The percent of circulating Treg cells (% CD4+CD25+FoxP3+CTLA-4+/total CD4+) is determined before vaccination, after two, and after four injections. The Treg cells are considered to have increased if after two or four injections, the percent is at least two-fold greater than before injections. To enumerate MDSC, PBMCs are stained with CD14 and HLA-DR antibodies, and the percentage of CD14+HLA-DR−/low are assessed (49). Representative sections of LEEP specimens are used for immunohistochemical staining using FOXP3 (rabbit polyclonal; Abcam, Cambridge, Mass.) to innumerate the number of cervical Tregs (50). The densities of FOXP3+ cells are determined using an image analysis software, and only cells with nuclear staining are counted.
- The following references were cited herein:
- 1. World Health Organization, (1990) Global Estimates for Health Situationa Assessment and Projections 29-30.
- 2. Parkin et al. (1999) Intl J Cancer 80:827-841.
- 3. Silverberg and Lubera, (1988) Cancer Journal for Clinicians 38:5-22.
- 4. Walboomers, J. M. et al. (1999) J Pathol 189:12-19.
- 5. zur Hausen, H. (1996) Biochim Biophys Acta1288:F55-78.
- 6. Munoz et al. (2003) N Engl J Med 348(6):518-527.
- 7. Beaudenon et al. (1986) Nature 321(6067):246-249.
- 8. Crum et al. (1985) J Virol 54(3):675-681.
- 9. Reid et al. (1987) Obstet Gynecol Clin North Am 14(2):407-429.
- 10. Lorincz et al. (1986) J Virol 58:225-229.
- 11. Lorincz et al. (1987) Virol 159:187-190.
- 12. Fuchs et al. (1988) Int J Cancer 41(1):41-45.
- 13. Koutsky et al. (1992) N Engl J Med 327(18):1272-1278.
- 14. Richart et al. (1969) Am J Obstet Gynecol 105:383-393.
- 15. Nash et al. (1987) Obstet Gynecol 69:160-162.
- 16. Campion et al. (1986) Lancet 2:236-240.
- 17. zur Hausen, H. (1999) Semin Cancer Biol 9:405-411.
- 18. Greenberg, P. D. (1991) Adv Immunol 49:281-355.
- 19. Ossendorp et al. (1998) J Exp Med 187:693-702.
- 20. Romerdahl et al. (1988) Cancer Res 48:2325-2328.
- 21. Schild et al. (1987) Eur J Immunol 17:1863-1866.
- 22. Bontkes et al. (1997) Br J Cancer 76(10):1353-1360.
- 23. Toes et al. (1999) J Exp Med 189:753-756.
- 24. Bennett, S. R. et al. (1998) Nature 393:478-480.
- 25. Ridge, J. P. et al. (1998) Nature 393:474-478.
- 26. Schoenberger et al. (1998) Nature 393:480-483.
- 27. Snijders et al. (1998) Int Immunol 10:1593-1598.
- 28. Bourgault et al. (2000) Eur J Immunol 30:2281-2289.
- 29. Alexander, M. et al. (1996) Am J Obstet Gynecol 175:1586-1593.
- 30. Evans, E. M. et al. (1997) Cancer Res 57:2943-2950.
- 31. Nakagawa, M. et al. (2000) J Infect Dis 182:595-598.
- 32. Yoon, H. et al. (1998) Virus Res 54(1):23-29.
- 33. Kaech, S. M, et al. (2002) Nat Rev Immunol 2:251-62.
- 34. Romani, N. et al. (1996) J Immunol Methods 196:137-151.
- 35. Osada, T. et al. (2006) Int Rev Immunol 25:377-413.
- 36. Ting and Manos, In: Innis, et al, eds. Polymerase Chain Reaction Protocols: A Guide To Methods and Applications. San Diego, Calif.: Academic Press 1990.
- 37. Nakagawa et al. (2004) Clinical and Diagnostic Lab. Immunology 11:889-896.
- 38. Walls, E. V. and Crawford L H, In: Klaus G G B, ed. Lymphocytes: A Practical Approach. Oxford, U. K.: IRL Press, 1987
- 39. Nakagawa et al. (1997) J Infect Dis 175:927-931.
- 40. Gupta R K. Adv Drug Deliv Rev. 1998; 32:155-172.
- 41. Nakagawa M et al. J Low Genit Tract Dis. 2010; 14:124-9.
- 42. Kim K H et al. Cancer Immun 6:9.
- 43. Peng S et al. J Virol. 2004; 78:8468-76.
- 44. Kim K H et al. Submitted.
- 45. Nakagawa M et al. Clin Diagn Lab Immunol. 2005; 12:1003-5.
- 46. Kim K H et al. Clin Vaccine Immunol. 2007; 14:362-8.
- 47. Banerjee D K et al. Blood. 2006; 108:2655-61.
- 48. Moiling J W et al. International Journal of Cancer. 2007; 121:1749-55.
- 49. Hoechst B et al. Gastroenterology. 2008; 135:234-43.
- 50. Kobayashi A et al. Mucosal Immunology. 2008; 1:412-20.
- Any patents or publications mentioned in this specification are indicative of the levels of those skilled in the art to which the invention pertains. Further, these patents and publications are incorporated by reference herein to the same extent as if each individual publication was specifically and individually indicated to be incorporated by reference.
Claims (16)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US14/566,604 US20150224186A1 (en) | 2007-10-03 | 2014-12-10 | Hpv e6 protein t cell epitopes and uses thereof |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US99740507P | 2007-10-03 | 2007-10-03 | |
US12/286,822 US8652482B2 (en) | 2007-10-03 | 2008-10-02 | HPV E6 protein T cell epitopes and uses thereof |
US13/136,557 US8926961B2 (en) | 2007-10-03 | 2011-08-04 | HPV E6 protein T cell epitopes and uses thereof |
US14/566,604 US20150224186A1 (en) | 2007-10-03 | 2014-12-10 | Hpv e6 protein t cell epitopes and uses thereof |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/136,557 Division US8926961B2 (en) | 2007-10-03 | 2011-08-04 | HPV E6 protein T cell epitopes and uses thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
US20150224186A1 true US20150224186A1 (en) | 2015-08-13 |
Family
ID=45022323
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/136,557 Active 2029-10-27 US8926961B2 (en) | 2007-10-03 | 2011-08-04 | HPV E6 protein T cell epitopes and uses thereof |
US14/566,604 Abandoned US20150224186A1 (en) | 2007-10-03 | 2014-12-10 | Hpv e6 protein t cell epitopes and uses thereof |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/136,557 Active 2029-10-27 US8926961B2 (en) | 2007-10-03 | 2011-08-04 | HPV E6 protein T cell epitopes and uses thereof |
Country Status (1)
Country | Link |
---|---|
US (2) | US8926961B2 (en) |
Cited By (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10927158B2 (en) | 2016-12-22 | 2021-02-23 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US10927161B2 (en) | 2017-03-15 | 2021-02-23 | Cue Biopharma, Inc. | Methods for modulating an immune response |
US11226339B2 (en) | 2012-12-11 | 2022-01-18 | Albert Einstein College Of Medicine | Methods for high throughput receptor:ligand identification |
US11339201B2 (en) | 2016-05-18 | 2022-05-24 | Albert Einstein College Of Medicine | Variant PD-L1 polypeptides, T-cell modulatory multimeric polypeptides, and methods of use thereof |
US11505591B2 (en) | 2016-05-18 | 2022-11-22 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US11702461B2 (en) | 2018-01-09 | 2023-07-18 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides |
US11851471B2 (en) | 2017-01-09 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US11878062B2 (en) | 2020-05-12 | 2024-01-23 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
Families Citing this family (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9974849B2 (en) | 2013-10-13 | 2018-05-22 | Bioventures, Llc | Human Papilloma virus therapeutic vaccine |
CA2977281A1 (en) * | 2015-02-26 | 2016-09-01 | Bioventures, Llc | Recall antigen for promoting t-helper type 1 response |
CA3096909A1 (en) * | 2018-04-26 | 2019-10-31 | Agenus Inc. | Heat shock protein-binding peptide compositions and methods of use thereof |
CN109726557B (en) * | 2018-12-14 | 2021-02-26 | 麒麟合盛网络技术股份有限公司 | Virus prevention method and device |
EP4240833A1 (en) * | 2020-11-06 | 2023-09-13 | BioVentures, LLC | T cells and bifunctional protein against human papillomavirus |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5858378A (en) * | 1996-05-02 | 1999-01-12 | Galagen, Inc. | Pharmaceutical composition comprising cryptosporidium parvum oocysts antigen and whole cell candida species antigen |
WO2007121895A2 (en) * | 2006-04-21 | 2007-11-01 | Transgene S.A. | Hpv-16-based papillomavirus vaccine |
WO2008014521A2 (en) * | 2006-07-28 | 2008-01-31 | The Trustees Of The University Of Pennsylvania | Improved vaccines and methods for using the same |
US8652482B2 (en) * | 2007-10-03 | 2014-02-18 | The Board Of Trustees Of The University Of Arkansas | HPV E6 protein T cell epitopes and uses thereof |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
IL105554A (en) * | 1992-05-05 | 1999-08-17 | Univ Leiden | Peptides of human papilloma virus for use in human t cell response inducing compositions |
WO2004105681A2 (en) * | 2003-04-28 | 2004-12-09 | Innogenetics N.V. | Cd4+ human papillomavirus (hpv) epitopes |
US8252893B2 (en) * | 2005-01-31 | 2012-08-28 | Board Of Trustees Of The University Of Arkansas | CD8 T cell epitopes in HPV 16 E6 and E7 proteins and uses thereof |
-
2011
- 2011-08-04 US US13/136,557 patent/US8926961B2/en active Active
-
2014
- 2014-12-10 US US14/566,604 patent/US20150224186A1/en not_active Abandoned
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5858378A (en) * | 1996-05-02 | 1999-01-12 | Galagen, Inc. | Pharmaceutical composition comprising cryptosporidium parvum oocysts antigen and whole cell candida species antigen |
WO2007121895A2 (en) * | 2006-04-21 | 2007-11-01 | Transgene S.A. | Hpv-16-based papillomavirus vaccine |
WO2008014521A2 (en) * | 2006-07-28 | 2008-01-31 | The Trustees Of The University Of Pennsylvania | Improved vaccines and methods for using the same |
US8652482B2 (en) * | 2007-10-03 | 2014-02-18 | The Board Of Trustees Of The University Of Arkansas | HPV E6 protein T cell epitopes and uses thereof |
Non-Patent Citations (15)
Title |
---|
A_GENESEQ Accession No. AEJ93346, 2006 * |
A_GENESEQ Accession No. AEJ93395, 2006 * |
A_GENESEQ Accession No. ANN59321, 2007 * |
Bergmann et al (J. Virol. 68(8): 5306-5310, 1994) * |
biology online (2016) * |
Bond, C. (Meth. Molec. Biol. 368, Cryopreservation and Freeze-Drying Protocols, 2nd Ed., Day and Stacey, Eds., Humana Press, NJ, 2007) * |
Celis et al (Mol. Immunol. 1994, 31(18): 1423-1430) * |
Eisenlohr et al (J. Exp. Med. 175: 481-487, 1992) * |
Gileadi et al (Eur. J. Immunol. 29: 2213-2222, 1999) * |
Medical Dictionary (2016) * |
Ochoa-Garay et al (Mol. Immunol. 1997, 34(3): 273-281) Eisenlohr et al (J. Exp. Med. 175: 481-487, 1992) * |
Perkins et al (J. Immunol. 146: 2137-2144, 1991) * |
Shastri et al (J. Immunol. 155: 4339-4346, 1995) * |
Theobald et al (J. Exp. Med. 6: 1017-1028, 1998) * |
Wang et al (Cell. Immunol. 143: 284-297, 1992) * |
Cited By (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11226339B2 (en) | 2012-12-11 | 2022-01-18 | Albert Einstein College Of Medicine | Methods for high throughput receptor:ligand identification |
US11505591B2 (en) | 2016-05-18 | 2022-11-22 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US11339201B2 (en) | 2016-05-18 | 2022-05-24 | Albert Einstein College Of Medicine | Variant PD-L1 polypeptides, T-cell modulatory multimeric polypeptides, and methods of use thereof |
US11505588B2 (en) | 2016-12-22 | 2022-11-22 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US11530248B2 (en) | 2016-12-22 | 2022-12-20 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US11905320B2 (en) | 2016-12-22 | 2024-02-20 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US11370821B2 (en) | 2016-12-22 | 2022-06-28 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US11377478B2 (en) | 2016-12-22 | 2022-07-05 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US11401314B2 (en) | 2016-12-22 | 2022-08-02 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US11851467B2 (en) | 2016-12-22 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US10927158B2 (en) | 2016-12-22 | 2021-02-23 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US11739133B2 (en) | 2016-12-22 | 2023-08-29 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US11117945B2 (en) | 2016-12-22 | 2021-09-14 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US11708400B2 (en) | 2016-12-22 | 2023-07-25 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US11851471B2 (en) | 2017-01-09 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
US10927161B2 (en) | 2017-03-15 | 2021-02-23 | Cue Biopharma, Inc. | Methods for modulating an immune response |
US11767355B2 (en) | 2017-03-15 | 2023-09-26 | Cue Biopharma, Inc. | Methods for modulating an immune response |
US11479595B2 (en) | 2017-03-15 | 2022-10-25 | Cue Biopharma, Inc. | Methods for modulating an immune response |
US11104712B2 (en) | 2017-03-15 | 2021-08-31 | Cue Biopharma, Inc. | Methods for modulating an immune response |
US11958893B2 (en) | 2017-03-15 | 2024-04-16 | Cue Biopharma, Inc. | Methods for modulating an immune response |
US11702461B2 (en) | 2018-01-09 | 2023-07-18 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides |
US11878062B2 (en) | 2020-05-12 | 2024-01-23 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
Also Published As
Publication number | Publication date |
---|---|
US20110293651A1 (en) | 2011-12-01 |
US8926961B2 (en) | 2015-01-06 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8926961B2 (en) | HPV E6 protein T cell epitopes and uses thereof | |
Steller et al. | Cell-mediated immunological responses in cervical and vaginal cancer patients immunized with a lipidated epitope of human papillomavirus type 16 E7. | |
EP2152729B1 (en) | Hpv epitopes targeted by t cells infiltrating cervical malignancies for use in vaccines | |
US8252893B2 (en) | CD8 T cell epitopes in HPV 16 E6 and E7 proteins and uses thereof | |
US7202034B2 (en) | Long peptides of 22-45 amino acid residues that induce and/or enhance antigen specific immune responses | |
Greenfield et al. | A phase I dose-escalation clinical trial of a peptide-based human papillomavirus therapeutic vaccine with Candida skin test reagent as a novel vaccine adjuvant for treating women with biopsy-proven cervical intraepithelial neoplasia 2/3 | |
TW201934748A (en) | Generation of HPV-specific T-cells | |
US8652482B2 (en) | HPV E6 protein T cell epitopes and uses thereof | |
US9974849B2 (en) | Human Papilloma virus therapeutic vaccine | |
WO2023184861A1 (en) | Hpv epitope and identification method therefor, and application thereof | |
JP4803460B2 (en) | HLA-A24 molecule-binding squamous cell carcinoma antigen-derived peptide | |
US20090117140A1 (en) | Human papilloma virus dominant CD4 T cell epitopes and uses thereof | |
Lee et al. | Cell‐mediated immune response to human papillomavirus 16 E7 peptide pools in patients with cervical neoplasia | |
Simões et al. | Papillomavirus: Viral vectors in the gene therapy and new therapeutic targets | |
Wang et al. | A novel CD4 T-cell epitope described from one of the cervical cancer patients vaccinated with HPV 16 or 18 E7-pulsed dendritic cells | |
KR20190068529A (en) | Immunotherapy for polyoma virus | |
TWI684602B (en) | Immunogenic peptide composition | |
Delgado et al. | Increase of human papillomavirus‐16 E7‐specific T helper type 1 response in peripheral blood of cervical cancer patients after radiotherapy | |
EP1288292A1 (en) | Long peptides of 22-40 amino acid residues that induce and/or enhance antigen specific immune responses. | |
US20180043008A1 (en) | Recall antigen for promoting t-helper type 1 response | |
EP2363406B1 (en) | Long peptides of 22-45 amino acid residues that induce and/or enhance antigen specific immune responses | |
WO2016102554A1 (en) | Immunotherapeutic vaccine comprising e7 proteins of hpv16 and hpv18 fused with cyaa, for use in subjects infected with hpv |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: THE BOARD OF TRUSTEES OF THE UNIVERSITY OF ARKANSA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:NAKAGAWA, MAYUMI;REEL/FRAME:042620/0289 Effective date: 20130117 Owner name: BIOVENTURES, LLC, ARKANSAS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:THE BOARD OF TRUSTEES OF THE UNIVERSITY OF ARKANSAS;REEL/FRAME:042705/0339 Effective date: 20170222 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- AFTER EXAMINER'S ANSWER OR BOARD OF APPEALS DECISION |
|
AS | Assignment |
Owner name: NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF Free format text: CONFIRMATORY LICENSE;ASSIGNOR:UNIVERSITY OF ARKANSAS FOR MED SCIS;REEL/FRAME:048854/0354 Effective date: 20180731 |