US20130101595A1 - Antibodies that bind il-18 and methods of inhibiting il-18 activity - Google Patents

Antibodies that bind il-18 and methods of inhibiting il-18 activity Download PDF

Info

Publication number
US20130101595A1
US20130101595A1 US13/603,968 US201213603968A US2013101595A1 US 20130101595 A1 US20130101595 A1 US 20130101595A1 US 201213603968 A US201213603968 A US 201213603968A US 2013101595 A1 US2013101595 A1 US 2013101595A1
Authority
US
United States
Prior art keywords
antibody
human
antigen
disease
binding portion
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US13/603,968
Inventor
Tariq Ghayer
Richard W. Dixon
Michael Roguska
Michael White
Boris Labkovsky
Jochen Salfeld
Alexander Robert Duncan
Simon Mark Brocklehurst
John Mankovich
Celia Patricia Shorrock
Julia Elizabeth Thompson
Simon Nicholas Lennard
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
AbbVie Inc
Original Assignee
Abbott Laboratories
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=22665007&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=US20130101595(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Application filed by Abbott Laboratories filed Critical Abbott Laboratories
Priority to US13/603,968 priority Critical patent/US20130101595A1/en
Publication of US20130101595A1 publication Critical patent/US20130101595A1/en
Assigned to ABBVIE INC. reassignment ABBVIE INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: ABBOTT LABORATORIES
Abandoned legal-status Critical Current

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244—Interleukins [IL]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/56—Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/12—Cyclic peptides, e.g. bacitracins; Polymyxins; Gramicidins S, C; Tyrocidins A, B or C
    • A61K38/13—Cyclosporins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00—Drugs for disorders of the respiratory system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00—Drugs for disorders of the respiratory system
    • A61P11/06—Antiasthmatics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00—Drugs for disorders of the urinary system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00—Drugs for disorders of the urinary system
    • A61P13/12—Drugs for disorders of the urinary system of the kidneys
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00—Drugs for genital or sexual disorders; Contraceptives
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00—Drugs for genital or sexual disorders; Contraceptives
    • A61P15/08—Drugs for genital or sexual disorders; Contraceptives for gonadal disorders or for enhancing fertility, e.g. inducers of ovulation or of spermatogenesis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00—Drugs for genital or sexual disorders; Contraceptives
    • A61P15/10—Drugs for genital or sexual disorders; Contraceptives for impotence
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/06—Antipsoriatics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/14—Drugs for dermatological disorders for baldness or alopecia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/04—Drugs for skeletal disorders for non-specific disorders of the connective tissue
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/06—Antigout agents, e.g. antihyperuricemic or uricosuric agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00—Drugs for disorders of the muscular or neuromuscular system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/08—Antiepileptics; Anticonvulsants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16—Anti-Parkinson drugs
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/18—Antipsychotics, i.e. neuroleptics; Drugs for mania or schizophrenia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/24—Antidepressants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00—Drugs for disorders of the senses
    • A61P27/02—Ophthalmic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/10—Antimycotics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A61P31/18—Antivirals for RNA viruses for HIV
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00—Antiparasitic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/08—Antiallergic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P39/00—General protective or antinoxious agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P39/00—General protective or antinoxious agents
    • A61P39/02—Antidotes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00—Drugs for disorders of the endocrine system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00—Drugs for disorders of the endocrine system
    • A61P5/14—Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00—Drugs for disorders of the endocrine system
    • A61P5/14—Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
    • A61P5/16—Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4 for decreasing, blocking or antagonising the activity of the thyroid hormones
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00—Drugs for disorders of the endocrine system
    • A61P5/18—Drugs for disorders of the endocrine system of the parathyroid hormones
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00—Drugs for disorders of the endocrine system
    • A61P5/38—Drugs for disorders of the endocrine system of the suprarenal hormones
    • A61P5/40—Mineralocorticosteroids, e.g. aldosterone; Drugs increasing or potentiating the activity of mineralocorticosteroids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00—Drugs for disorders of the endocrine system
    • A61P5/48—Drugs for disorders of the endocrine system of the pancreatic hormones
    • A61P5/50—Drugs for disorders of the endocrine system of the pancreatic hormones for increasing or potentiating the activity of insulin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00—Drugs for disorders of the blood or the extracellular fluid
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00—Drugs for disorders of the blood or the extracellular fluid
    • A61P7/02—Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00—Drugs for disorders of the blood or the extracellular fluid
    • A61P7/04—Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00—Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06—Antianaemics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • A61P9/04—Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • A61P9/12—Antihypertensives
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • Interleukin-18 was originally described in 1989 as interferon-gamma inducing factor (IGIF) and is a pro-inflammatory cytokine with various functions in addition to an ability to induce interferon gamma. These biological properties include activation of NF- ⁇ b, Fas ligand expression, the induction of both CC and CXC chemokines, and increased production of competent human immunodeficiency virus.
  • IGIF interferon-gamma inducing factor
  • IL-18 Due to the ability of IL-18 to induce interferon gamma production in T cells and macrophages, it plays an important role in Th1-type immune responses and participates in both innate and acquired immunity.
  • IL-18 is related to the IL-1 family in terms of both structure and function. For reviews of IL-18 structure, function and biological activity, see for example Dinarello, C. et al. (1998) J. Leukoc. Biol. 63:658-654; Dinarello, C. A. (1999) Methods 19:121-132; and Dinarello, C. A. (1999) J. Allergy Clin. Immunol. 103:11-24.
  • IL-18 It would be desirable to use to modulate IL-18 in a variety of human immune responses.
  • antibodies that bind to and neutralize IL-18 are particularly desirable.
  • murine IL-18 antibodies are limited for their use in vivo due to problems associated with administration of mouse antibodies to humans, such as short serum half life, an inability to trigger certain human effector functions and elicitation of an unwanted immune response against the mouse antibody in a human (the “human anti-mouse antibody” (HAMA) reaction).
  • HAMA human anti-mouse antibody
  • chimeric antibodies in which the variable regions of the antibody chains are murine-derived and the constant regions of the antibody chains are human-derived, have been prepared (Junghans, et al. (1990) Cancer Res. 50:1495-1502; Brown et al. (1991) Proc. Natl. Acad. Sci. 88:2663-2667; Kettleborough et al. (1991) Protein Engineering. 4:773-783).
  • HAMA human anti-chimeric antibody
  • a preferred IL-18 inhibitory agent to murine antibodies or derivatives thereof would be an entirely human anti-IL-18 antibody, since such an agent should not elicit the HAMA reaction, even if used for prolonged periods.
  • such antibodies have not been described in the art and, therefore are still needed.
  • This invention pertains to compounds, such as antibodies, that bind human IL-18, as well as methods of making and using such compounds or antibodies.
  • the invention pertains to a compound capable of binding a human IL-18 amino acid sequence, or portion thereof, where the amino acid comprises an N- or C-terminal portion of human IL-18 such as provided in SEQ ID NO: 70 or SEQ ID NO: 71.
  • the compound is a small molecule, peptide, polypeptide, antibody, or antibody fragment, such as a fully human antibody or fragment.
  • the invention pertains to a human monoclonal antibody, or antigen-binding portion thereof, capable of binding to human IL-18.
  • the antibody or fragment thereof dissociates from human IL-18, as determined by plasmon resonance, with a koff rate constant of 0.1 s ⁇ 1 or less, 1 ⁇ 10E-2 s ⁇ 1 or less, 1 ⁇ 10E-3 s ⁇ 1 or less, 1 ⁇ 10E-4 s ⁇ 1 or less, 1 ⁇ 10E-5 s ⁇ 1 or less, 1 ⁇ 10E-6 s ⁇ 1 or less, or inhibits human IL-18 activity with an IC50 of 1 ⁇ 10E-6 or less, 1 ⁇ 10E-7 or less, 1 ⁇ 10E-8 or less, 1 ⁇ 10E-9, 1 ⁇ 10E-10 or less, or 1 ⁇ 10E-11 or less.
  • the invention pertains to an isolated antibody, or an antigen-binding portion thereof, that binds an epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1), VIRNLNDQVLFIDQ (SEQ ID NO: 33), or a portion of either.
  • the antibody is a neutralizing antibody.
  • the antibody is a human antibody.
  • the antibody is a recombinant antibody (e.g., a single-chain antibody (scFv)), or a monoclonal antibody.
  • the isolated antibody, or antigen-binding portion thereof binds to an epitope of human IL-18, or a portion of either, where the antibody, or antigen-binding portion thereof, dissociates from human IL-18 with a k off rate constant of 0.1 s ⁇ 1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC 50 of 1 ⁇ 10 ⁇ 6 M or less.
  • the antibody, or an antigen-binding portion thereof may dissociate from human IL-18 with a k off rate constant of 1 ⁇ 10 ⁇ 2 s ⁇ 1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC 50 of 1 ⁇ 10 ⁇ 7 M or less.
  • the antibody, or an antigen-binding portion thereof may dissociate from human IL-18 with a k off rate constant of 1 ⁇ 10 ⁇ 3 s ⁇ 1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC 50 of 1 ⁇ 10 ⁇ 8 M or less.
  • the antibody, or an antigen-binding portion thereof may dissociate from human IL-18 with a k off rate constant of 1 ⁇ 10 ⁇ 4 s ⁇ 1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC 50 of 1 ⁇ 10 ⁇ 9 M or less.
  • the antibody, or an antigen-binding portion thereof may dissociate from human IL-18 with a k off rate constant of 1 ⁇ 10 ⁇ 5 s ⁇ 1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC 50 of 1 ⁇ 10 ⁇ 10 M or less.
  • the antibody, or an antigen-binding portion thereof may dissociate from human IL-18 with a k off rate constant of 1 ⁇ 10 ⁇ 6 s ⁇ 1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC 50 of 1 ⁇ 10 ⁇ 11 M or less.
  • Another aspect of the invention pertains to an isolated human antibody, or an antigen-binding portion thereof, containing at least one variable region CDR domain capable of binding an epitope of human IL-18.
  • the isolated antibody, or an antigen-binding portion thereof has a variable region containing a heavy and/or light chain CDR1 domain, CDR2 domain, or CDR3 domain as set forth in Table 6 or 9 which can have, e.g., one or more amino acid substitutions or insertions at or adjacent to any of the Kabat positions indicated in Tables 7-8 and 10-11.
  • the isolated antibody, or an antigen-binding portion thereof contains a light chain variable region (LCVR) containing the amino acid sequence of SEQ ID NO: 29 and a heavy chain variable region (HCVR) containing the amino acid sequence of SEQ ID NO: 26.
  • the isolated antibody, or an antigen-binding portion thereof contains a light chain variable region (LCVR) having the amino acid sequence of SEQ ID NO: 29 and a heavy chain variable region (HCVR) having the amino acid sequence of SEQ ID NO: 27.
  • compositions comprising an antibody, or antigen-binding portion thereof, of the invention and a pharmaceutically acceptable carrier.
  • the pharmaceutical composition further comprises at least one additional therapeutic agent for treating a disorder in which IL-18 activity is detrimental.
  • Another aspect of the invention pertains to methods of making an antibody that binds human interleukin-18 (IL-18).
  • the invention provides a method comprising exposing an antibody repertoire to an antigen comprising an epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1)), VIRNLNDQVLFIDQ (SEQ ID NO: 33), or a portion of either; and selecting from the antibody repertoire an antibody that binds the epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1), VIRNLNDQVLFIDQ (SEQ ID NO: 33), or a portion of either.
  • the antibody repertoire is an in vivo repertoire in an animal and the method comprises immunizing the animal with the antigen comprising the epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1), VIRNLNDQVLFIDQ (SEQ ID NO: 33), the N- or C-terminal portion of human IL-18 (SEQ ID NOS: 70-71), or a portion of any of these epitopes.
  • the antigen comprising the epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1), VIRNLNDQVLFIDQ (SEQ ID NO: 33), the N- or C-terminal portion of human IL-18 (SEQ ID NOS: 70-71), or a portion of any of these epitopes.
  • the antibody repertoire is a recombinant antibody library and the method comprises screening the library with an antigen containing the epitope of human IL-18 having the amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1), VIRNLNDQVLFIDQ (SEQ ID NO: 33), peptides represented by SEQ ID NOS: 31-32 and 34-60, or a portion of any of the foregoing.
  • the library is a human antibody library.
  • the invention provides an isolated nucleic acid encoding an antibody of any of the above aspects, e.g., a heavy and/or light chain variable region, or portion thereof.
  • the isolated nucleic acid encoding the anti-IL-18 antibody, or portion thereof is in a recombinant expression vector, e.g., for expression in a host cell.
  • the invention pertains to a method of using the foregoing host cell into which the recombinant expression vector has been introduced, for synthesizing an antibody that binds human IL-18, by culturing the host cell in a culture medium until an antibody that binds human IL-18 is synthesized by the cell.
  • Another aspect of the invention pertains to a method for inhibiting human IL-18 activity comprising contacting human IL-18 with the antibody, or antigen-binding portion thereof, of the invention such that human IL-18 activity is inhibited.
  • Yet another aspect of the invention pertains to a method for inhibiting human IL-18 activity in a human subject suffering from a disorder in which IL-18 activity is detrimental, comprising administering to the human subject the antibody, or antigen-binding portion thereof, of the invention such that human IL-18 activity in the human subject is inhibited.
  • the anti-IL-18 antibody may be administered, e.g., before, concurrent, or after, an additional agent such as an anti-IL-12 antibody or antigen binding fragment thereof, methotrexate, anti-TNF antibody or antigen binding fragment thereof, corticosteroids, cyclosporin, rapamycin, FK506, or a non-steroidal anti-inflammatory agent.
  • FIG. 1 shows the structural model of IL-18 (center) as compared to IL-1 ⁇ (left) and IL1RA (right).
  • FIG. 2 shows a structural model of IL-18 complexed with the IL-18 receptor, wherein the peptide epitope comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) of IL-18 is indicated in dark gray. This peptide epitope is bound by the anti-IL-18 antibody 2E1.
  • FIG. 3 shows a structural model of IL-18 complexed with the IL-18 receptor, wherein the peptide epitope comprising amino acids YFGKLESKLSVIRN (SEQ ID NO: 33) of IL-18 is indicated in dark gray. This peptide epitope is bound by the anti-IL-18 antibody LT28.
  • FIG. 4 shows a structural model of full length IL-18 complexed with the IL-18 receptor.
  • the spherical light and dark gray epitopes represent the N and C terminal contact epitopes of IL-18 (respectively, SEQ ID NOS: 70 and 71).
  • FIG. 5 shows the potency of three different anti-IL-18 antibodies in neutralizing the biologic effects of IL-18 as a function of inhibition of IFN- ⁇ induction in KG1 cells.
  • the IC50 values for the antibodies 125H (boxes) and the 2E1 antibody as an IgG antibody (circles) or as a single chain antibody (triangles) are, respectively, 2.1E-10, 9.0E-10, and 3.3E-9.
  • This invention pertains to the selection of peptide epitopes that are capable of generating neutralizing antibodies to IL-18 mediated signal transduction, the preparation of antibodies to these epitopes and the use of such antibodies, including use to treat disorders involving IL-18.
  • the strategy of selecting epitopes entails construction of an homology model of the IL-18 protein and its corresponding receptor. A combination of visual inspection and computational evaluation is then used to select representative peptide segments for synthesis and antibody generation Amino acid sequences shown herein use the standard one-letter abbreviation code.
  • the program Modeler (Sali, A. et al., Evaluation of comparative protein modeling by MODELLER . Proteins: Struct., Funct., Genet. (1995), 23(3), pp. 318-26. CODEN: PSFGEY; ISSN: 0887-3585) was used to generate homology models for both IL-18 and the IL-18 receptor.
  • the X-ray crystal structures of IL-1 ⁇ (Priestle, J., et al. The three - dimensional structure of human interleukin -1. beta. refined to 2.0. ANG. resolution . Prog. Clin. Biol. Res. (1990), 349 (Cytokines Lipocortins Inflammation Differ.), pp.
  • IL-1RA (Schreuder, H. et al., Refined crystal structure of the interleukin -1 receptor antagonist: presence of a disulfide link and a cis - proline . Eur. J. Biochem. (1995), 227(3), pp. 838-47) are available and were used as reference coordinates for the model construction of IL-18.
  • the IL-1 receptor structure (Vigers, G., et al. Crystal structure of the type - I interleukin -1- receptor complexed with interleukin -1. beta . Nature (London) (1997), 386(6621), pp. 190-194) was used to model the IL-18 receptor.
  • IL-18 is a member of the IL-1 family (see Dinarello, C. A. IL -18: a TH 1- inducing, proinflammatory cytokine and new member of the IL -1 family . J. Allergy Clin. Immunol. (1999), 103(1, Pt. 1), pp. 11-24) and that the overall protein fold is very similar.
  • IL-1 ⁇ IL-18 is initially secreted in a pro form. Both pro-IL-1 ⁇ and pro-IL-18 are activated by IL-1 ⁇ -converting enzyme (ICE) (Fantuzzi, G. and Dinarello, C. A.
  • ICE IL-1 ⁇ -converting enzyme
  • Interleukin -18 and interleukin -1 ⁇ two cytokine substrates for ICE ( caspase -1). J. Clin. Immunol. (1999), 19(1), pp. 1-11). It is also known that the IL-1 receptor and the IL-18 receptor are similar (Dinarello, C. A. et al. Overview of interleukin -18: more than an interferon - ⁇ inducing factor . J. Leukocyte Biol. (1998), 63(6), 658-664). IL-1 ⁇ is capable of binding to the IL-18 receptor. As a final argument, IL-1 ⁇ and IL-1RA display an identical fold, even though the overall sequence homology between these two proteins is on a par with the sequence homology with IL-18. The sequence alignment between the three proteins (i.e., IL-18, IL-1 ⁇ and IL1-RA) was constructed manually with the program InsightII. This alignment can be seen in Table 1:
  • IL-18 YFGK-LESKLS-VIRNLNDQVLFIDQGNRPLFE--DMT-DSDCRD--NAP
  • IL-1 ⁇ AP-VRS-LNCTLRDSQQKSLVMS-G--P-YELKALHLQGQ--D--MEQ
  • IL-1RA SSKMQA-FR--IWDVNQKTFYLR-N--N--QLVAGYLQGP--NVNLEE
  • IL-18 RTIFIISMY-KDSQPRG-MAVTISVKCEKISTLSC----ENK-IISFKEM IL-1 ⁇ : QVVFSMS-FVQGEESNDKIPVALGLK-EKNLYLSCVLK-DDKPTLQLESV IL-1RA: KI--DV---VP-IEPH---ALFLGIH-GGKMCLSCV-KSGDETRLQLEAV 123
  • the resulting IL-18 structure is pictured in FIG. 1 along with IL-1 ⁇ and IL-1RA.
  • the overall quality as assessed by the program What_Check (Hooft, R. W. et al., Errors in Protein Structures . Nature (1996) 381, pp. 272) is reasonable, but a bit low (see Table 3 below).
  • the structure of the IL-18 receptor was also generated using the program Modeler.
  • the reference coordinates were from the IL-1 receptor.
  • the overall sequence identity is low, but sufficient to generate an alignment.
  • the sequence homology figures are included in Table 2 above. The alignment was generated manually using the program InsightII and is presented in Table 4.
  • the overall quality of the structure of the IL-18 receptor as determined using the Modeler program is reasonable but again scores somewhat low according to What_Check (see Table 3 above).
  • the confidence that can be placed on the overall fold comes primarily from the fact that IL-1 ⁇ binds to both the IL-1 and IL-18 receptor.
  • the low sequence homology certainly contributes to the quality of the final structure, however, as in the case of the associated cytokines above, this current structure is considered to be sufficient.
  • the IL-18 peptide epitope bound by LT28 SEQ ID NO: 33
  • a model of the IL-18/IL-18 receptor complex was generated based on the IL-1 ⁇ /IL-1 receptor structure ( FIG. 4 ). This structure was generated by superimposing the cytokine structures and the receptor structures. No attempt was made to energy minimize the final structure.
  • the primary purpose of generating structural models was to be able to select suitable peptides based primarily on a visual score. Solvent exposed sections of the proteins and portions of the proteins which were both hydrophilic and buried in the receptor/cytokine complex were considered. A final element considered was based on a selectivity criterion. The selected peptide epitope should be different in sequence from similar portions of other members of the family. Based on this criteria, a peptide from IL-18 was selected. In addition, a comprehensive overlapping panel of peptides (SEQ ID NOS: 31-60) representative of full length human IL-18 (SEQ ID NO: 61) was also made and the sequence of all of these IL-18 related peptides is shown in Table 5, below.
  • the N-terminal cysteine of the IL-18 peptide represented by SEQ ID NO: 2 is not part of the native IL-18 sequence, but was added as a conjugation site. Accordingly, within the native IL-18 amino acid sequence, the region corresponding to the selected epitope comprises amino acid residues having the amino acid sequence PLFEDMTDSDCRDNA (SEQ ID NO: 1).
  • FIG. 2 A schematic model of the IL-18 peptide (SEQ ID NO: 1) complexed with the IL-18 receptor is shown in FIG. 2 , with this peptide epitope indicated in dark gray.
  • IL-18 peptide sequences were synthesized and used as an epitope to generate antibodies in a rabbit host.
  • Molecular modeling data obtained using the IL-18 peptide PLFEDMTDSDCRDNA (SEQ ID NO: 1) or YFGKLESKLSVIRN (SEQ ID NO: 31) as compared to a cognate receptor, i.e., the IL-18 receptor, as depicted in FIGS. 2 and 3 provides an indication as to what residues a neutralizing antibody or compound may interact with.
  • An alternative method for peptide epitope selection can be accomplished in the absence of any molecular modeling by screening a panel of representative peptides using immunoselection.
  • overlapping peptides representative of the entire protein sequence can be used.
  • only certain epitopes are represented in the panel of peptides.
  • molecular modeling can be used to identify epitopes likely to be important.
  • the identified epitope(s) sequence can then be used to construct a panel of peptides (e.g., overlapping peptides) that are representative of the identified epitope(s).
  • Methods for manufacturing desired peptide sequences can be carried out using standard techniques known in the art.
  • the invention provides antibodies, as well as antibody portions thereof, that bind IL-18.
  • the antibodies, or portions thereof are isolated antibodies.
  • the antibodies, or portions thereof are neutralizing antibodies.
  • antibody is intended to refer to immunoglobulin molecules comprised of four polypeptide chains, two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds.
  • Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
  • the heavy chain constant region is comprised of three domains, CH1, CH2 and CH3.
  • Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
  • the light chain constant region is comprised of one domain, CL.
  • VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDR complementarity determining regions
  • FR framework regions
  • Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • antibody portion refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., hIL-18). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
  • binding fragments encompassed within the term “antigen-binding portion” of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′) 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR).
  • a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH1 domains
  • a F(ab′) 2 fragment a bivalent fragment comprising two Fab fragments linked by
  • the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
  • single chain Fv single chain Fv
  • Such single chain antibodies are also intended to be encompassed within the term “antigen-binding portion” of an antibody.
  • Other forms of single chain antibodies, such as diabodies are also encompassed.
  • Diabodies are bivalent, bispecific antibodies in which VH and VL domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, R. J., et al. (1994) Structure 2:1121-1123).
  • an antibody or antigen-binding portion thereof may be part of a larger immunoadhesion molecules, formed by covalent or noncovalent association of the antibody or antibody portion with one or more other proteins or peptides.
  • immunoadhesion molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov, S. M., et al. (1995) Human Antibodies and Hybridomas 6:93-101) and use of a cysteine residue, a marker peptide and a C-terminal polyhistidine tag to make bivalent and biotinylated scFv molecules (Kipriyanov, S. M., et al. (1994) Mol.
  • Antibody portions such as Fab and F(ab′) 2 fragments, can be prepared from whole antibodies using conventional techniques, such as papain or pepsin digestion, respectively, of whole antibodies.
  • antibodies, antibody portions and immunoadhesion molecules can be obtained using standard recombinant DNA techniques, as described herein.
  • an “isolated antibody”, as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds hIL-18 is substantially free of antibodies that specifically bind antigens other than hIL-18).
  • An isolated antibody that specifically binds hIL-18 may, however, have cross-reactivity to other antigens, such as IL-18 molecules from other species.
  • an isolated antibody may be substantially free of other cellular material and/or chemicals.
  • an isolated antibody, e.g., an isolated human antibody can be a chimeric antibody wherein, e.g., variable regions, CDR domains, or isotypes derived from a different human source are grafted to the parent human antibody.
  • a “compound” as used herein refers to binding molecules such as antibodies, e.g., polyclonal antibodies, monoclonal antibodies, binding fragments thereof (e.g., Fab fragments), single chain antibodies (e.g., scFv), peptides or peptide mimetics, as well as non-peptide based molecules, such as small molecules having ligand binding activity.
  • binding molecules such as antibodies, e.g., polyclonal antibodies, monoclonal antibodies, binding fragments thereof (e.g., Fab fragments), single chain antibodies (e.g., scFv), peptides or peptide mimetics, as well as non-peptide based molecules, such as small molecules having ligand binding activity.
  • a “neutralizing antibody”, as used herein (or an “antibody that neutralized hIL-18 activity”), is intended to refer to an antibody whose binding to hIL-18 results in inhibition of the biological activity of hIL-18.
  • This inhibition of the biological activity of hIL-18 can be assessed by measuring one or more indicators of hIL-18 biological activity. These indicators of hIL-18 biological activity can be assessed by one or more of several standard in vitro or in vivo assays known in the art.
  • surface plasmon resonance refers to an optical phenomenon that allows for the analysis of real-time biospecific interactions by detection of alterations in protein concentrations within a biosensor matrix, for example using the BIAcore system (Pharmacia Biosensor AB, Uppsala, Sweden and Piscataway, N.J.).
  • BIAcore Pharmaacia Biosensor AB, Uppsala, Sweden and Piscataway, N.J.
  • K off is intended to refer to the off rate constant for dissociation of an antibody from the antibody/antigen complex.
  • K d is intended to refer to the dissociation constant of a particular antibody-antigen interaction.
  • the invention pertains to an isolated antibody, or an antigen-binding portion thereof, that binds an epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) or VIRNLNDQVLFIDQ (SEQ ID NO: 33), or a portion of any of these epitopes.
  • the antibody is a neutralizing antibody.
  • the antibody is a human antibody.
  • the antibody is a recombinant antibody or a monoclonal antibody.
  • the isolated antibody, or antigen-binding portion thereof binds to an epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1), wherein the antibody, or antigen-binding portion thereof, dissociates from human IL-18 with a k off rate constant of 0.1 s ⁇ 1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC 50 of 1 ⁇ 10 ⁇ 6 M or less.
  • the antibody, or an antigen-binding portion thereof may dissociate from human IL-18 with a k off rate constant of 1 ⁇ 10 ⁇ 2 s ⁇ 1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC 50 of 1 ⁇ 10 ⁇ 7 M or less.
  • the antibody, or an antigen-binding portion thereof may dissociate from human IL-18 with a k off rate constant of 1 ⁇ 10 ⁇ 3 s ⁇ 1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC 50 of 1 ⁇ 10 ⁇ 8 M or less.
  • the antibody, or an antigen-binding portion thereof may dissociate from human IL-18 with a k off rate constant of 1 ⁇ 10 ⁇ 4 s ⁇ 1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC 50 of 1 ⁇ 10 ⁇ 9 M or less.
  • the antibody, or an antigen-binding portion thereof may dissociate from human IL-18 with a k off rate constant of 1 ⁇ 10 ⁇ 5 s ⁇ 1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC 50 of 1 ⁇ 10 ⁇ 10 M or less.
  • the antibody, or an antigen-binding portion thereof may dissociate from human IL-18 with a k off rate constant of 1 ⁇ 10 ⁇ 6 s ⁇ 1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC 50 of 1 ⁇ 10 ⁇ 11 M or less.
  • the invention also provides for the further modification of an antibody identified as binding to an IL-18 epitope.
  • the modification of the identified anti-IL-18 antibody is to improve binding and/or neutralization activity.
  • the invention also provides pharmaceutical compositions comprising an antibody, or antigen-binding portion thereof, of the invention and a pharmaceutically acceptable carrier.
  • the pharmaceutical composition further comprises at least one additional therapeutic agent for treating a disorder in which IL-18 activity is detrimental.
  • the antibodies and antibody-portions of the invention can be incorporated into pharmaceutical compositions suitable for administration to a subject.
  • the pharmaceutical composition comprises an antibody or antibody portion of the invention and a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • pharmaceutically acceptable carriers include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof.
  • isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
  • Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the antibody or antibody portion.
  • Sodium chloride can be used to modify the toxicity of the solution at a concentration of 0-300 mM (optimally 150 mM for a liquid dosage form).
  • Cryoprotectants can be included for a lyophilized dosage form, principally 0-10% sucrose (optimally 0.5-1.0%).
  • Other suitable cryoprotectants include trehalose and lactose.
  • Bulking agents can be included for a lyophilized dosage form, principally 1-10% mannitol (optimally 2-4%).
  • Stabilizers can be used in both liquid and lyophilized dosage forms, principally 1-50 mM L-Methionine (optimally 5-10 mM).
  • Other suitable bulking agents include glycine, arginine, can be included as 0-0.05% polysorbate-80 (optimally 0.005-0.01%).
  • Additional surfactants include but are not limited to polysorbate 20 and BRIJ surfactants.
  • compositions of this invention may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories.
  • liquid solutions e.g., injectable and infusible solutions
  • dispersions or suspensions tablets, pills, powders, liposomes and suppositories.
  • the preferred form depends on the intended mode of administration and therapeutic application. Typical preferred compositions are in the form of injectable or infusible solutions, such as compositions similar to those used for passive immunization of humans with other antibodies.
  • the preferred mode of administration is parenteral (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular).
  • the antibody is administered by intravenous infusion or injection.
  • the antibody is administered by intramuscular or subcutaneous injection.
  • compositions typically must be sterile and stable under the conditions of manufacture and storage.
  • the composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration.
  • Sterile injectable solutions can be prepared by incorporating the active compound (i.e., antibody or antibody portion) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum drying and spray-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
  • the antibodies and antibody-portions of the present invention can be administered by a variety of methods known in the art, although for many therapeutic applications, the preferred route/mode of administration is subcutaneous injection, intravenous injection or infusion. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results.
  • the active compound may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
  • a carrier such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid.
  • an antibody or antibody portion of the invention may be orally administered, for example, with an inert diluent or an assimilable edible carrier.
  • the compound (and other ingredients, if desired) may also be enclosed in a hard or soft shell gelatin capsule, compressed into tablets, or incorporated directly into the subject's diet.
  • the compounds may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
  • To administer a compound of the invention by other than parenteral administration it may be necessary to coat the compound with, or co-administer the compound with, a material to prevent its inactivation.
  • an antibody or antibody portion of the invention is coformulated with and/or coadministered with one or more additional therapeutic agents that are useful for treating disorders in which IL-18 activity is detrimental.
  • an anti-hIL-18 antibody or antibody portion of the invention may be coformulated and/or coadministered with one or more additional antibodies that bind other targets (e.g., antibodies that bind other cytokines or that bind cell surface molecules).
  • one or more antibodies of the invention may be used in combination with two or more of the foregoing therapeutic agents.
  • Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus avoiding possible toxicities or complications associated with the various monotherapies.
  • Interleukin 18 plays a critical role in the pathology associated with a variety of diseases involving immune and inflammatory elements. These diseases include, but are not limited to, rheumatoid arthritis, osteoarthritis, juvenile chronic arthritis, Lyme arthritis, psoriatic arthritis, reactive arthritis, spondyloarthropathy, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammatory bowel disease, insulin dependent diabetes mellitus, thyroiditis, asthma, allergic diseases, psoriasis, dermatitis scleroderma, graft versus host disease, organ transplant rejection, acute or chronic immune disease associated with organ transplantation, sarcoidosis, atherosclerosis, disseminated intravascular coagulation, Kawasaki's disease, Grave's disease, nephrotic syndrome, chronic fatigue syndrome, Wegener's granulomatosis, Henoch-Schoenlein purpurea, microscopic vasculitis of the kidneys
  • the human antibodies, and antibody portions of the invention can be used to treat humans suffering from autoimmune diseases, in particular those associated with inflammation, including, rheumatoid spondylitis, allergy, autoimmune diabetes, autoimmune uveitis, acute liver disease, chronic liver diseases, allergy and asthma, mental disorders (e.g., depression and schizophrenia), and Th2 Type and Th1 Type mediated diseases.
  • autoimmune diseases in particular those associated with inflammation, including, rheumatoid spondylitis, allergy, autoimmune diabetes, autoimmune uveitis, acute liver disease, chronic liver diseases, allergy and asthma, mental disorders (e.g., depression and schizophrenia), and Th2 Type and Th1 Type mediated diseases.
  • the antibodies of the invention or antigen-binding portions thereof are used to treat rheumatoid arthritis, Crohn's disease, multiple sclerosis, insulin dependent diabetes, mellitus, and psoriasis.
  • An antibody, or antibody portion, of the invention also can be administered with one or more additional therapeutic agents useful in the treatment of autoimmune and inflammatory diseases.
  • Antibodies of the invention, or antigen binding portions thereof can be used alone or in combination to treat such diseases. It should be understood that the antibodies of the invention or antigen binding portion thereof can be used alone or in combination with an additional agent, e.g., a therapeutic agent, said additional agent being selected by the skilled artisan for its intended purpose.
  • the additional agent can be a therapeutic agent art-recognized as being useful to treat the disease or condition being treated by the antibody of the present invention.
  • the additional agent also can be an agent which imparts a beneficial attribute to the therapeutic composition e.g., an agent which effects the viscosity of the composition.
  • the combinations which are to be included within this invention are those combinations useful for their intended purpose.
  • the agents set forth below are illustrative for purposes and not intended to be limited.
  • the combinations which are part of this invention can be the antibodies of the present invention and at least one additional agent selected from the lists below.
  • the combination can also include more than one additional agent, e.g., two or three additional agents if the combination is such that the formed composition can perform its intended function.
  • Preferred combinations are non-steroidal anti-inflammatory drug(s) also referred to as NSAIDS which include drugs like ibuprofen.
  • Other preferred combinations are corticosteroids including prednisolone; the well known side-effects of steroid use can be reduced or even eliminated by tapering the steroid dose required when treating patients in combination with the anti-IL-18 antibodies of this invention.
  • Non-limiting examples of therapeutic agents for rheumatoid arthritis with which an antibody, or antibody portion, of the invention can be combined include the following: cytokine suppressive anti-inflammatory drug(s) (CSAIDs); antibodies to or antagonists of other human cytokines or growth factors, for example, TNF, LT, IL-1, IL-2, IL-6, IL-7, IL-8, IL-12, IL-15, IL-16, EMAP-II, GM-CSF, FGF, and PDGF.
  • CSAIDs cytokine suppressive anti-inflammatory drug
  • Antibodies of the invention, or antigen binding portions thereof, can be combined with antibodies to cell surface molecules such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69, CD80 (B7.1), CD86 (B7.2), CD90, or their ligands including CD154 (gp39 or CD40L).
  • cell surface molecules such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69, CD80 (B7.1), CD86 (B7.2), CD90, or their ligands including CD154 (gp39 or CD40L).
  • Preferred combinations of therapeutic agents may interfere at different points in the autoimmune and subsequent inflammatory cascade; preferred examples include TNF antagonists like chimeric, humanized or human TNF antibodies, D2E7, (PCT Publication No. WO 97/29131), CA2 (RemicadeTM), CDP 571, and soluble p55 or p75 TNF receptors, derivatives, thereof, (p75TNFR1gG (EnbrelTM) or p55TNFR1gG (Lenercept), and also TNF ⁇ converting enzyme (TACE) inhibitors; similarly IL-1 inhibitors (Interleukin-1-converting enzyme inhibitors, IL-1RA etc.) may be effective for the same reason.
  • TNF antagonists like chimeric, humanized or human TNF antibodies, D2E7, (PCT Publication No. WO 97/29131), CA2 (RemicadeTM), CDP 571, and soluble p55 or p75 TNF receptors, derivatives, thereof, (p75TNFR1gG (
  • Yet another preferred combination are other key players of the autoimmune response which may act parallel to, dependent on or in concert with IL-18 function; especially preferred are IL-12 antagonists including IL-12 antibodies or soluble IL-12 receptors, or IL-12 binding proteins. It has been shown that IL-12 and IL-18 have overlapping but distinct functions and a combination of antagonists to both may be most effective. Yet another preferred combination are non-depleting anti-CD4 inhibitors. Yet other preferred combinations include antagonists of the co-stimulatory pathway CD80 (B7.1) or CD86 (B7.2) including antibodies, soluble receptors or antagonistic ligands.
  • the antibodies of the invention, or antigen binding portions thereof, may also be combined with agents, such as methotrexate, 6-MP, azathioprine sulphasalazine, mesalazine, olsalazine chloroquinine/hydroxychloroquine, pencillamine, aurothiomalate (intramuscular and oral), azathioprine, cochicine, corticosteroids (oral, inhaled and local injection), beta-2 adrenoreceptor agonists (salbutamol, terbutaline, salmeteral), xanthines (theophylline, aminophylline), cromoglycate, nedocromil, ketotifen, ipratropium and oxitropium, cyclosporin, FK506, rapamycin, mycophenolate mofetil, leflunomide, NSAIDs, for example, ibuprofen, cox-2 inhibitors, cox-2 selective inhibitors (e.
  • IL-1 ⁇ converting enzyme inhibitors IL-1 ⁇ converting enzyme inhibitors
  • TACE TNF ⁇ converting enzyme
  • T-cell signalling inhibitors such as kinase inhibitors, metalloproteinase inhibitors, sulfasalazine, azathioprine, 6-mercaptopurines, angiotensin converting enzyme inhibitors, soluble cytokine receptors and derivatives thereof (e.g.
  • soluble p55 or p75 TNF receptors and the derivatives p75TNFRIgG EnbrelTM and p55TNFRIgG (Lenercept)
  • sIL-1RI sIL-1RII
  • sIL-6R antiinflammatory cytokines
  • Preferred combinations include methotrexate or leflunomide and in moderate or severe rheumatoid arthritis cases, cyclosporine.
  • Non-limiting examples of therapeutic agents for inflammatory bowel disease with which an antibody, or antibody portion, of the invention can be combined include the following: budenoside; epidermal growth factor; corticosteroids; cyclosporin, sulfasalazine; aminosalicylates; 6-mercaptopurine; azathioprine; metronidazole; lipoxygenase inhibitors; mesalamine; olsalazine; balsalazide; antioxidants; thromboxane inhibitors; IL-1 receptor antagonists; anti-IL-1 ⁇ monoclonal antibodies; anti-IL-6 monoclonal antibodies; growth factors; elastase inhibitors; pyridinyl-imidazole compounds; antibodies to or antagonists of other human cytokines or growth factors, for example, TNF, LT, IL-1, IL-2, IL-6, IL-7, IL-8, IL-12, IL-15, IL-16, EMAP-II, GM
  • Antibodies of the invention, or antigen binding portions thereof can be combined with antibodies to cell surface molecules such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69, CD90 or their ligands.
  • the antibodies of the invention, or antigen binding portions thereof may also be combined with agents, such as methotrexate, cyclosporin, FK506, rapamycin, mycophenolate mofetil, leflunomide, NSAIDs, for example, ibuprofen, corticosteroids such as prednisolone, phosphodiesterase inhibitors, adenosine agonists, antithrombotic agents, complement inhibitors, adrenergic agents, agents which interfere with signalling by proinflammatory cytokines such as TNF ⁇ or IL-1 (e.g.
  • IL-1 ⁇ converting enzyme inhibitors IL-1 ⁇ converting enzyme inhibitors
  • TNF ⁇ converting enzyme inhibitors T-cell signalling inhibitors such as kinase inhibitors, metalloproteinase inhibitors, sulfasalazine, azathioprine, 6-mercaptopurines, angiotensin converting enzyme inhibitors, soluble cytokine receptors and derivatives thereof (e.g. soluble p55 or p75 TNF receptors, sIL-1RI, sIL-1RII, sIL-6R) and antiinflammatory cytokines (e.g. IL-4, IL-10, IL-11, IL-13 and TGF ⁇ ).
  • IL-4, IL-10, IL-11, IL-13 and TGF ⁇ antiinflammatory cytokines
  • TNF antagonists for example, anti-TNF antibodies, D2E7 (PCT Publication No. WO 97/29131), CA2 (RemicadeTM), CDP 571, TNFR-Ig constructs, (p75TNFRIgG (EnbrelTM) and p55TNFRIgG (Lenercept)) inhibitors and PDE4 inhibitors.
  • Antibodies of the invention or antigen binding portions thereof can be combined with corticosteroids, for example, budenoside and dexamethasone.
  • Antibodies of the invention or antigen binding portions thereof may also be combined with agents such as sulfasalazine, 5-aminosalicylic acid and olsalazine, and agents which interfere with synthesis or action of proinflammatory cytokines such as IL-1, for example, IL-1 ⁇ converting enzyme inhibitors and IL-1ra.
  • agents such as sulfasalazine, 5-aminosalicylic acid and olsalazine
  • agents which interfere with synthesis or action of proinflammatory cytokines such as IL-1, for example, IL-1 ⁇ converting enzyme inhibitors and IL-1ra.
  • Antibodies of the invention or antigen binding portion thereof may also be used with T cell signaling inhibitors, for example, tyrosine kinase inhibitors 6-mercaptopurines.
  • Antibodies of the invention or antigen binding portions thereof can be combined with IL-11.
  • Non-limiting examples of therapeutic agents for multiple sclerosis with which an antibody, or antibody portion, of the invention can be combined include the following: corticosteroids; prednisolone; methylprednisolone; azathioprine; cyclophosphamide; cyclosporine; methotrexate; 4-aminopyridine; tizanidine; interferon- ⁇ 1a (Avonex; Biogen); interferon- ⁇ 1b (Betaseron; Chiron/Berlex); Copolymer 1 (Cop-1; Copaxone; Teva Pharmaceutical Industries, Inc.); hyperbaric oxygen; intravenous immunoglobulin; clabribine; antibodies to or antagonists of other human cytokines or growth factors, for example, TNF, LT, IL-1, IL-2, IL-6, IL-7, IL-8, IL-12, IL-15, IL-16, EMAP-II, GM-CSF, FGF, and PDGF.
  • Antibodies of the invention, or antigen binding portions thereof, can be combined with antibodies to cell surface molecules such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69, CD80, CD86, CD90 or their ligands.
  • cell surface molecules such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69, CD80, CD86, CD90 or their ligands.
  • the antibodies of the invention, or antigen binding portions thereof, may also be combined with agents, such as methotrexate, cyclosporine, FK506, rapamycin, mycophenolate mofetil, leflunomide, NSAIDs, for example, ibuprofen, corticosteroids such as prednisolone, phosphodiesterase inhibitors, adensosine agonists, antithrombotic agents, complement inhibitors, adrenergic agents, agents which interfere with signalling by proinflammatory cytokines such as TNF ⁇ or IL-1 (e.g.
  • IL-1 ⁇ converting enzyme inhibitors TACE inhibitors
  • T-cell signalling inhibitors such as kinase inhibitors, metalloproteinase inhibitors, sulfasalazine, azathioprine, 6-mercaptopurines, angiotensin converting enzyme inhibitors, soluble cytokine receptors and derivatives thereof (e.g. soluble p55 or p75 TNF receptors, sIL-1RI, sIL-1RII, sIL-6R) and antiinflammatory cytokines (e.g. IL-4, IL-10, IL-13 and TGF ⁇ ).
  • IL-4, IL-10, IL-13 and TGF ⁇ antiinflammatory cytokines
  • interferon- ⁇ for example, IFN ⁇ 1a and IFN ⁇ 1b
  • copaxone corticosteroids
  • IL-1 inhibitors for example, TNF inhibitors, and antibodies to CD40 ligand and CD80.
  • compositions of the invention may include a “therapeutically effective amount” or a “prophylactically effective amount” of an antibody or antibody portion of the invention.
  • a “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result.
  • a therapeutically effective amount of the antibody or antibody portion may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody or antibody portion to elicit a desired response in the individual.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody or antibody portion are outweighed by the therapeutically beneficial effects.
  • a “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
  • Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
  • Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • An exemplary, non-limiting range for a therapeutically or prophylactically effective amount of an antibody or antibody portion of the invention is 0.1-20 mg/kg, more preferably 1-10 mg/kg. It is to be noted that dosage values may vary with the type and severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
  • anti-IL-18 antibodies of the invention are made using any one of a variety of techniques known in the art for preparing antibodies and using antigens comprising the IL-18 peptide epitope described in subsection I, i.e., an epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1).
  • IL-18 human interleukin-18
  • the antibody repertoire is an in vivo repertoire in an animal and the method comprises immunizing the animal with the antigen comprising the epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1).
  • the antibody repertoire is a recombinant antibody library and the method comprising screening the library with the antigen comprising the epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1).
  • the library is a human antibody library.
  • An IL-18 antigen comprising an epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) can be administered to an animal to elicit polyclonal antibodies and specific antibodies that bind the epitope can be isolated by selecting from the polyclonal antibodies those antibodies that bind to the epitope (e.g., by passing the polyclonal antisera over a column that comprises a peptide comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) of hIL-18).
  • the antigen used to elicit the polyclonal antibodies can be intact (i.e., full-length) hIL-18 or can be a portion of hIL-18 that includes the epitope of interest, e.g., a synthetic peptide comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) of hIL-18.
  • monoclonal antibodies to the epitope can be made from the aforementioned animals using standard hybridoma technology and selection for those hybridomas secreting an antibody that specifically binds the epitope of interest, e.g., by screening the hybridomas with a peptide comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) of hIL-18 and selecting for antibodies that bind specifically to the peptide.
  • In vitro methods also can be used to make the antibodies of the invention, wherein an antibody library is screened to identify an antibody having the desired binding specificity.
  • Methods for such screening of recombinant antibody libraries are well known in the art and include methods described in, for example, Ladner et al. U.S. Pat. No. 5,223,409; Kang et al. PCT Publication No. WO 92/18619; Dower et al. PCT Publication No. WO 91/17271; Winter et al. PCT Publication No. WO 92/20791; Markland et al. PCT Publication No. WO 92/15679; Breitling et al. PCT Publication No.
  • the recombinant antibody library may be from a subject immunized with IL-18, or a portion of IL-18 comprising the epitope of amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1).
  • the recombinant antibody library may be from a na ⁇ ve subject, i.e., one who has not been immunized with IL-18, such as a human antibody library from a human subject who has not been immunized with human IL-18.
  • Antibodies of the invention are selected by screening the recombinant antibody library with the epitope of amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) of human IL-18 to thereby select those antibodies that recognize this epitope. Methods for conducting such screening and selection are well known in the art, such as described in the references in the preceding paragraph.
  • the anti-hIL-18 antibodies, or portions thereof, of the invention can be used to detect hIL-18 (e.g., in a biological sample, such as serum or plasma), using a conventional immunoassay, such as an enzyme linked immunosorbent assays (ELISA), an radioimmunoassay (RIA) or tissue immunohistochemistry.
  • a conventional immunoassay such as an enzyme linked immunosorbent assays (ELISA), an radioimmunoassay (RIA) or tissue immunohistochemistry.
  • ELISA enzyme linked immunosorbent assays
  • RIA radioimmunoassay
  • tissue immunohistochemistry tissue immunohistochemistry.
  • the invention provides a method for detecting hIL-18 in a biological sample comprising contacting a biological sample with an antibody, or antibody portion, of the invention and detecting either the antibody (or antibody portion) bound to hIL-18 or unbound antibody (or antibody portion), to thereby detect hIL-18 in the biological sample.
  • Suitable detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials and radioactive materials.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase
  • suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin
  • suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin
  • an example of a luminescent material includes luminol
  • suitable radioactive material include 125 I, 131 I, 35 S, 32 P, 33 P, or 3 H.
  • hIL-18 can be assayed in biological fluids by a competition immunoassay utilizing rhIL-18 standards labeled with a detectable substance and an unlabeled anti-hIL-18 antibody.
  • the biological sample, the labeled rhIL-18 standards and the anti-hIL-18 antibody are combined and the amount of labeled rhIL-18 standard bound to the unlabeled antibody is determined.
  • the amount of hIL-18 in the biological sample is inversely proportional to the amount of labeled rhIL-18 standard bound to the anti-hIL-18 antibody.
  • the antibodies and antibody portions of the invention preferably are capable of neutralizing hIL-18 activity both in vitro and in vivo. Accordingly, such antibodies and antibody portions of the invention can be used to inhibit hIL-18 activity, e.g., in a cell culture containing hIL-18, in human subjects or in other mammalian subjects having IL-18 with which an antibody of the invention cross-reacts.
  • the invention provides a method for inhibiting IL-18 activity comprising contacting IL-18 with an antibody or antibody portion of the invention such that IL-18 activity is inhibited.
  • the IL-18 is human IL-18.
  • an antibody or antibody portion of the invention can be added to the culture medium to inhibit hIL-18 activity in the culture.
  • the invention provides a method for inhibiting IL-18 activity in a subject suffering from a disorder in which IL-18 activity is detrimental.
  • the invention provides methods for inhibiting IL-18 activity in a subject suffering from such a disorder, which method comprises administering to the subject an antibody or antibody portion of the invention such that IL-18 activity in the subject is inhibited.
  • the IL-18 is human IL-18 and the subject is a human subject.
  • the subject can be a mammal expressing an IL-18 with which an antibody of the invention cross-reacts.
  • the subject can be a mammal into which has been introduced hIL-18 (e.g., by administration of hIL-18 or by expression of an hIL-18 transgene).
  • An antibody of the invention can be administered to a human subject for therapeutic purposes. Moreover, an antibody of the invention can be administered to a non-human mammal expressing an IL-18 with which the antibody cross-reacts for veterinary purposes or as an animal model of human disease. Regarding the latter, such animal models may be useful for evaluating the therapeutic efficacy of antibodies of the invention (e.g., testing of dosages and time courses of administration).
  • one animal model for modulating IL-18 activity in an animal uses NOD-SCID mice which are transplanted with human peripheral blood mononuclear cells. Then, two to four weeks after engraftment (as measured by human IgG titers in serum) the mice are injected with LPS (lipopolysaccharide). Four to six hours later LPS-induced human interferon-gamma serum titers are determined.
  • LPS lipopolysaccharide
  • the efficacy (potency) of anti-IL-18 antibodies is determined by injecting the antibodies (ip) one day prior to LPS challenge followed by monitoring the test animals for a reduction in interferon-gamma serum titers (a function of IL-18 in vivo activity) as compared to controls (see, e.g., Holmes et al., Hybridoma, 19:363367 (2000)).
  • a disorder in which IL-18 activity is detrimental is intended to include diseases and other disorders in which the presence of IL-18 in a subject suffering from the disorder has been shown to be, or is suspected of being, either responsible for the pathophysiology of the disorder or a factor that contributes to a worsening of the disorder. Accordingly, a disorder in which IL-18 activity is detrimental is a disorder in which inhibition of IL-18 activity is expected to alleviate the symptoms and/or progression of the disorder. Such disorders may be evidenced, for example, by an increase in the concentration of IL-18 in a biological fluid of a subject suffering from the disorder (e.g., an increase in the concentration of IL-18 in serum, plasma, synovial fluid, etc. of the subject), which can be detected, for example, using an anti-IL-18 antibody as described above.
  • an increase in the concentration of IL-18 in a biological fluid of a subject suffering from the disorder e.g., an increase in the concentration of IL-18 in serum, plasma, synovial fluid, etc. of the subject
  • Non-limiting examples of disorders that can be treated with the antibodies of the invention include those disorders discussed in the section above pertaining to pharmaceutical compositions of the antibodies of the invention.
  • the practice of the present invention employs, unless otherwise indicated, conventional techniques of chemistry, molecular biology, recombinant DNA technology, PCR technology, immunology (especially, e.g., antibody technology), and any necessary cell culture or animal husbandry techniques, which are within the skill of the art and are explained fully in the literature. See, e.g., Sambrook, Fritsch and Maniatis, Molecular Cloning: Cold Spring Harbor Laboratory Press (1989); DNA Cloning , Vols. 1 and 2, (D. N. Glover, Ed. 1985); Oligonucleotide Synthesis (M. J. Gait, Ed. 1984); PCR Handbook Current Protocols in Nucleic Acid Chemistry , Beaucage, Ed.
  • Antibodies to hIL-18 were isolated by screening separate scFv phage display libraries prepared using human VL and VH cDNAs from mRNA derived from human B cells (e.g., tonsils and spleen). Construction of the library and methods for selection are described in Vaughan et al. (1996) Nature Biotech. 14: 309-314.
  • the libraries were screened using either full length human IL-18 (SEQ ID NO: 61), a peptide epitope of IL-18 (SEQ ID NOS: 1-3), or a panel of overlapping 15 amino acid peptides representing IL-18 (the epitope sequence of which is presented in Table 5; SEQ ID NOS: 31-60).
  • IL-18 specific antibodies were selected by coating the antigen onto immunotubes using standard procedures (Marks et al., (1991) J. Mol. Biol. 222: 581-597).
  • the scFv libraries were screened using either IL-18, a peptide epitope of IL-18, or an IL-18 peptide panel to generate a significant number of IL-18 specific binders.
  • Several different clonotypes were selected, determined by restriction enzyme digestion patterns, and confirmed by DNA sequencing.
  • IL-18 antibodies which preferentially bind either full length IL-18 or a representative peptide thereof
  • the supernatant containing scFv was titrated on biotin-captured IL-18 in an ELISA and binding characteristics were determined.
  • Two anti-IL-18 single chain antibodies were obtained, one termed 2E1, independently isolated using a peptide epitope and the peptide panel, and a second anti-IL-18 antibody termed LT28, isolated using full length IL-18. These parent anti-IL-18 antibodies were selected for further study and modification.
  • a single chain Fv version of antibody 2E1 having an identified IL-18 binding activity and the heavy chain and light chain sequence shown in Table 6 was further modified for improved neutralization of IL-18 activity.
  • the anti-IL-18 antibody 2E1 was independently selected using an IL-18 peptide and sequential, overlapping, peptide panel representative of IL-18 (see Table 6).
  • the nucleic acid sequence of the parent 2E1 antibody heavy and light chain is provided in SEQ ID NOS: 62 and 64.
  • the mutant oligonucleotides were then used to create a complementary DNA strand and eventually a double-stranded plasmid, thus incorporating the degeneracy or the different mutations in a given codon of the antibody.
  • the CDR3 region of the heavy and light chain of 2E1 was altered using the QuikChange Kit (Stratagene) according to the manufactures instruction.
  • a representative number of clones were then sequenced from each mutagenesis reaction (i.e., 7 to 36 clones) and those representing a change from the parent 2E1 single chain antibody sequence were expressed in bacteria and purified for further in vitro and in vivo testing as described infra.
  • a second anti-IL-18 antibody was identified and selected for further improvement using affinity maturation.
  • the LT28 antibody having the heavy chain and light chain sequence shown in Table 9 (and nucleic sequence provided in SEQ ID NOS: 66 and 68) was further modified.
  • amino acid substitutions were introduced at positions H31, H32, H33, and H35 of CDR1, positions H50, H51, H52, H52a, H53, H54, H56, and H58 of CDR2, and H95, H96, H97, H98, H99, H100, H100a, H101, and H102 of CDR3.
  • amino acid substitutions were introduced at positions L30, L31, L32, L34 of CDR1, positions L50, L52, L53, L55 of CDR2 and positions L89, L90, L91, L92, L93, L94, L95, L95a, L95b, L96, L97.
  • streptavidin is covalently linked via free amine groups to the dextran matrix by first activating carboxyl groups on the matrix with 100 mM N-hydroxysuccinimide (NHS) and 400 mM N-ethyl-N′-(3-diethylaminopropyl)carbodiimide hydrochloride (EDC). Next, streptavidin is injected across the activated matrix. Thirty-five microliters of streptavidin (25 ⁇ g/ml), diluted in sodium acetate, pH 4.5, is injected across the activated biosensor and free amines on the protein are bound directly to the activated carboxyl groups. Unreacted matrix EDC-esters are deactivated by an injection of 1 M ethanolamine Streptavidin-coupled biosensor chips also are commercially available (Pharmacia BR-1000-16, Pharmacia Biosensor, Piscataway, N.J.).
  • Biotinylated rhIL-18 was prepared by first dissolving 5.0 mg of biotin (D-biotinyl- ⁇ -aminocaproic acid N-hydroxysuccinimide ester; Boehringer Mannheim Cat. No. 1008 960) in 500 ⁇ l dimethylsulfoxide to make a 10 mg/ml solution. Ten microliters of biotin was added per ml of rhIL-18 (at 2.65 mg/ml) for a 2:1 molar ratio of biotin to rhIL-18. The reaction was mixed gently and incubated for two hours at room temperature in the dark. A PD-10 column, Sephadex G-25M (Pharmacia Catalog No.
  • Biotinylated rhIL-18 to be immobilized on the matrix via streptavidin was diluted in PBS running buffer (Gibco Cat. No. 14190-144, Gibco BRL, Grand Island, N.Y.) supplemented with 0.05% (BIAcore) surfactant P20 (Pharmacia BR-1000-54, Pharmacia Biosensor, Piscataway, N.J.).
  • PBS running buffer Gibco Cat. No. 14190-144, Gibco BRL, Grand Island, N.Y.
  • BIOAcore surfactant P20
  • Pharmacia BR-1000-54 Pharmacia Biosensor, Piscataway, N.J.
  • biotinylated rhIL-18 (25 nM; 10 ⁇ l aliquots) were injected through the streptavidin-coupled dextran matrix at a flow rate of 5 ⁇ l/min. Before injection of the protein and immediately afterward, PBS buffer alone flowed through each flow cell. The net difference in signal between baseline and approximately 30 sec. after completion of biotinylated rhIL-18 injection was taken to represent the binding value. Direct rhIL-18-specific antibody binding to immobilized biotinylated rhIL-18 was measured.
  • Antibodies (20 ⁇ g/ml) were diluted in PBS running buffer and 25 ⁇ l aliquots were injected through the immobilized protein matrices at a flow rate of 5 ⁇ l/min. Prior to injection of antibody, and immediately afterwards, PBS buffer alone flowed through each flow cell. The net difference in baseline signal and signal after completion of antibody injection was taken to represent the binding value of the particular sample. Biosensor matrices were regenerated using 100 mM HCl before injection of the next sample. To determine the off rate (K off ), on rate (K on ), association rate (K a ) and dissociation rate (K d ) constants, BIAcore kinetic evaluation software (version 2.1) was used.
  • the assay employs KG1 cells (ATCC #CCL-246, myelogenous leukemia bone marrow cells) which were cultured according to standard techniques (e.g., using RPMI 1640 Culture Medium Gibco #21870-076; (supplemented with 10% Fetal Bovine Serum (BioWhittaker #14-501F); 2 mM L-glutamine (Gibco #25030-081); 50 units/ml Penicillin, 50 ug/ml Streptomycin (Gibco #15070-063); and 0.075% Sodium Bicarbonate).
  • KG1 cells ATCC #CCL-246, myelogenous leukemia bone marrow cells
  • standard techniques e.g., using RPMI 1640 Culture Medium Gibco #21870-076; (supplemented with 10% Fetal Bovine Serum (BioWhittaker #14-501F); 2 mM L-glutamine (Gibco #25030-081); 50 units/ml Penicillin, 50 ug/ml Strept
  • mutant antibodies i.e., the 2E1 derived L34S, H53R, H53Y, and H58Q, were shown to have greater IL-18 neutralization potency than the parent 2E1 antibody (see Table 12).
  • the improvements in IC50 values using the KG-1 assay were in the range of 2 to 5 fold, and similar improved binding results were determined using BIAcore analysis.
  • mutant L95Y offered 5 to 8 fold better IC50 values than the parent 2E1 antibody.
  • mutants offered a 2 to 3 fold improvement and they are 2E1 mutants H96A, H96Q, H96S, H98S, L90C, L90W, L93C, L94P, L94P, L94Q, L94R, L94W, L95R, L95aA, L95aH, L95aP, L95aR, L95aW, L95bE, L95bW, L95bY, L97C, and L97E.
  • two mutants derived from the LT28 parent should improved 1L-18 neutralization activity compared to the parent antibody.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Diabetes (AREA)
  • Immunology (AREA)
  • Endocrinology (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Neurosurgery (AREA)
  • Hematology (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Molecular Biology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Virology (AREA)
  • Cardiology (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Reproductive Health (AREA)
  • Pain & Pain Management (AREA)
  • Pulmonology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Dermatology (AREA)
  • Psychiatry (AREA)
  • Urology & Nephrology (AREA)

Abstract

Antibodies that bind human interleukin-18 (hIL-18) are provided, in particular antibodies that bind epitope(s) of human IL-18. The antibodies can be, for example, entirely human antibodies, recombinant antibodies, or monoclonal antibodies. Preferred antibodies have high affinity for hIL-18 and neutralize hIL-18 activity in vitro and in vivo. An antibody of the invention can be a full-length antibody or an antigen-binding portion thereof. Method of making and method of using the antibodies of the invention are also provided. The antibodies, or antibody portions, of the invention are useful for detecting hIL-18 and for inhibiting hIL-18 activity, e.g., in a human subject suffering from a disorder in which hIL-18 activity is detrimental.

Description

    RELATED APPLICATIONS
  • This application is a continuation of, and claims priority from, U.S. patent application Ser. No. 12/786,095, filed on May 24, 2010, entitled, “Antibodies that Bind IL-18 and Methods of Inhibiting IL-18 Activity,” which claims priority to U.S. patent application Ser. No. 09/780,035, filed on Feb. 9, 2001, entitled, “Antibodies that Bind IL-18 and Methods of Inhibiting IL-18 Activity,” which claims the benefit of U.S. Provisional Application No. 60/181,608, filed Feb. 10, 2000, entitled, “Antibodies that Bind Human Interleukin-18 and Methods of Making and Using,” the contents of each which are hereby incorporated by reference.
  • BACKGROUND OF THE INVENTION
  • Interleukin-18 (IL-18) was originally described in 1989 as interferon-gamma inducing factor (IGIF) and is a pro-inflammatory cytokine with various functions in addition to an ability to induce interferon gamma. These biological properties include activation of NF-κb, Fas ligand expression, the induction of both CC and CXC chemokines, and increased production of competent human immunodeficiency virus.
  • Due to the ability of IL-18 to induce interferon gamma production in T cells and macrophages, it plays an important role in Th1-type immune responses and participates in both innate and acquired immunity. IL-18 is related to the IL-1 family in terms of both structure and function. For reviews of IL-18 structure, function and biological activity, see for example Dinarello, C. et al. (1998) J. Leukoc. Biol. 63:658-654; Dinarello, C. A. (1999) Methods 19:121-132; and Dinarello, C. A. (1999) J. Allergy Clin. Immunol. 103:11-24.
  • It would be desirable to use to modulate IL-18 in a variety of human immune responses. In particular, antibodies that bind to and neutralize IL-18 are particularly desirable. Moreover, murine IL-18 antibodies are limited for their use in vivo due to problems associated with administration of mouse antibodies to humans, such as short serum half life, an inability to trigger certain human effector functions and elicitation of an unwanted immune response against the mouse antibody in a human (the “human anti-mouse antibody” (HAMA) reaction).
  • In general, attempts to overcome the problems associated with use of fully-murine antibodies in humans, have involved genetically engineering the antibodies to be more “human-like.” For example, chimeric antibodies, in which the variable regions of the antibody chains are murine-derived and the constant regions of the antibody chains are human-derived, have been prepared (Junghans, et al. (1990) Cancer Res. 50:1495-1502; Brown et al. (1991) Proc. Natl. Acad. Sci. 88:2663-2667; Kettleborough et al. (1991) Protein Engineering. 4:773-783). However, because these chimeric and humanized antibodies still retain some murine sequences, they still may elicit an unwanted immune reaction, the human anti-chimeric antibody (HAMA) reaction, especially when administered for prolonged periods.
  • A preferred IL-18 inhibitory agent to murine antibodies or derivatives thereof (e.g., chimeric or humanized antibodies) would be an entirely human anti-IL-18 antibody, since such an agent should not elicit the HAMA reaction, even if used for prolonged periods. However, such antibodies have not been described in the art and, therefore are still needed.
  • SUMMARY OF THE INVENTION
  • This invention pertains to compounds, such as antibodies, that bind human IL-18, as well as methods of making and using such compounds or antibodies.
  • In one aspect, the invention pertains to a compound capable of binding a human IL-18 amino acid sequence, or portion thereof, where the amino acid comprises an N- or C-terminal portion of human IL-18 such as provided in SEQ ID NO: 70 or SEQ ID NO: 71. In one embodiment, the compound is a small molecule, peptide, polypeptide, antibody, or antibody fragment, such as a fully human antibody or fragment.
  • In another aspect, the invention pertains to a human monoclonal antibody, or antigen-binding portion thereof, capable of binding to human IL-18. In other embodiments, the antibody or fragment thereof, dissociates from human IL-18, as determined by plasmon resonance, with a koff rate constant of 0.1 s−1 or less, 1×10E-2 s−1 or less, 1×10E-3 s−1 or less, 1×10E-4 s−1 or less, 1×10E-5 s−1 or less, 1×10E-6 s−1 or less, or inhibits human IL-18 activity with an IC50 of 1×10E-6 or less, 1×10E-7 or less, 1×10E-8 or less, 1×10E-9, 1×10E-10 or less, or 1×10E-11 or less.
  • In another aspect, the invention pertains to an isolated antibody, or an antigen-binding portion thereof, that binds an epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1), VIRNLNDQVLFIDQ (SEQ ID NO: 33), or a portion of either. Preferably, the antibody is a neutralizing antibody. Preferably, the antibody is a human antibody. In various embodiments, the antibody is a recombinant antibody (e.g., a single-chain antibody (scFv)), or a monoclonal antibody.
  • In other embodiments, the isolated antibody, or antigen-binding portion thereof, binds to an epitope of human IL-18, or a portion of either, where the antibody, or antigen-binding portion thereof, dissociates from human IL-18 with a koff rate constant of 0.1 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−6M or less. Alternatively, the antibody, or an antigen-binding portion thereof, may dissociate from human IL-18 with a koff rate constant of 1×10−2 s−1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC50 of 1×10−7M or less. Alternatively, the antibody, or an antigen-binding portion thereof, may dissociate from human IL-18 with a koff rate constant of 1×10−3 s−1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC50 of 1×10−8M or less. Alternatively, the antibody, or an antigen-binding portion thereof, may dissociate from human IL-18 with a koff rate constant of 1×10−4 s−1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC50 of 1×10−9M or less. Alternatively, the antibody, or an antigen-binding portion thereof, may dissociate from human IL-18 with a koff rate constant of 1×10−5 s−1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC50 of 1×10−10M or less. Alternatively, the antibody, or an antigen-binding portion thereof, may dissociate from human IL-18 with a koff rate constant of 1×10−6 s−1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC50 of 1×10−11M or less.
  • Another aspect of the invention pertains to an isolated human antibody, or an antigen-binding portion thereof, containing at least one variable region CDR domain capable of binding an epitope of human IL-18. In related embodiments, the isolated antibody, or an antigen-binding portion thereof, has a variable region containing a heavy and/or light chain CDR1 domain, CDR2 domain, or CDR3 domain as set forth in Table 6 or 9 which can have, e.g., one or more amino acid substitutions or insertions at or adjacent to any of the Kabat positions indicated in Tables 7-8 and 10-11. In a preferred embodiment, the isolated antibody, or an antigen-binding portion thereof, contains a light chain variable region (LCVR) containing the amino acid sequence of SEQ ID NO: 29 and a heavy chain variable region (HCVR) containing the amino acid sequence of SEQ ID NO: 26. In another preferred embodiment, the isolated antibody, or an antigen-binding portion thereof, contains a light chain variable region (LCVR) having the amino acid sequence of SEQ ID NO: 29 and a heavy chain variable region (HCVR) having the amino acid sequence of SEQ ID NO: 27.
  • Another aspect of the invention pertains to pharmaceutical compositions comprising an antibody, or antigen-binding portion thereof, of the invention and a pharmaceutically acceptable carrier. In one embodiment, the pharmaceutical composition further comprises at least one additional therapeutic agent for treating a disorder in which IL-18 activity is detrimental.
  • Another aspect of the invention pertains to methods of making an antibody that binds human interleukin-18 (IL-18). The invention provides a method comprising exposing an antibody repertoire to an antigen comprising an epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1)), VIRNLNDQVLFIDQ (SEQ ID NO: 33), or a portion of either; and selecting from the antibody repertoire an antibody that binds the epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1), VIRNLNDQVLFIDQ (SEQ ID NO: 33), or a portion of either.
  • In one embodiment, the antibody repertoire is an in vivo repertoire in an animal and the method comprises immunizing the animal with the antigen comprising the epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1), VIRNLNDQVLFIDQ (SEQ ID NO: 33), the N- or C-terminal portion of human IL-18 (SEQ ID NOS: 70-71), or a portion of any of these epitopes. In another embodiment, the antibody repertoire is a recombinant antibody library and the method comprises screening the library with an antigen containing the epitope of human IL-18 having the amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1), VIRNLNDQVLFIDQ (SEQ ID NO: 33), peptides represented by SEQ ID NOS: 31-32 and 34-60, or a portion of any of the foregoing. Preferably, the library is a human antibody library.
  • In another aspect, the invention provides an isolated nucleic acid encoding an antibody of any of the above aspects, e.g., a heavy and/or light chain variable region, or portion thereof. In related embodiments, the isolated nucleic acid encoding the anti-IL-18 antibody, or portion thereof, is in a recombinant expression vector, e.g., for expression in a host cell.
  • Thus, in another aspect, the invention pertains to a method of using the foregoing host cell into which the recombinant expression vector has been introduced, for synthesizing an antibody that binds human IL-18, by culturing the host cell in a culture medium until an antibody that binds human IL-18 is synthesized by the cell.
  • Another aspect of the invention pertains to a method for inhibiting human IL-18 activity comprising contacting human IL-18 with the antibody, or antigen-binding portion thereof, of the invention such that human IL-18 activity is inhibited.
  • Yet another aspect of the invention pertains to a method for inhibiting human IL-18 activity in a human subject suffering from a disorder in which IL-18 activity is detrimental, comprising administering to the human subject the antibody, or antigen-binding portion thereof, of the invention such that human IL-18 activity in the human subject is inhibited. In one embodiment, the anti-IL-18 antibody may be administered, e.g., before, concurrent, or after, an additional agent such as an anti-IL-12 antibody or antigen binding fragment thereof, methotrexate, anti-TNF antibody or antigen binding fragment thereof, corticosteroids, cyclosporin, rapamycin, FK506, or a non-steroidal anti-inflammatory agent.
  • BRIEF DESCRIPTION OF THE DRAWINGS
  • FIG. 1 shows the structural model of IL-18 (center) as compared to IL-1β (left) and IL1RA (right).
  • FIG. 2 shows a structural model of IL-18 complexed with the IL-18 receptor, wherein the peptide epitope comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) of IL-18 is indicated in dark gray. This peptide epitope is bound by the anti-IL-18 antibody 2E1.
  • FIG. 3 shows a structural model of IL-18 complexed with the IL-18 receptor, wherein the peptide epitope comprising amino acids YFGKLESKLSVIRN (SEQ ID NO: 33) of IL-18 is indicated in dark gray. This peptide epitope is bound by the anti-IL-18 antibody LT28.
  • FIG. 4 shows a structural model of full length IL-18 complexed with the IL-18 receptor. The spherical light and dark gray epitopes represent the N and C terminal contact epitopes of IL-18 (respectively, SEQ ID NOS: 70 and 71).
  • FIG. 5 shows the potency of three different anti-IL-18 antibodies in neutralizing the biologic effects of IL-18 as a function of inhibition of IFN-γ induction in KG1 cells. The IC50 values for the antibodies 125H (boxes) and the 2E1 antibody as an IgG antibody (circles) or as a single chain antibody (triangles) are, respectively, 2.1E-10, 9.0E-10, and 3.3E-9.
  • DETAILED DESCRIPTION OF THE INVENTION
  • This invention pertains to the selection of peptide epitopes that are capable of generating neutralizing antibodies to IL-18 mediated signal transduction, the preparation of antibodies to these epitopes and the use of such antibodies, including use to treat disorders involving IL-18. The strategy of selecting epitopes entails construction of an homology model of the IL-18 protein and its corresponding receptor. A combination of visual inspection and computational evaluation is then used to select representative peptide segments for synthesis and antibody generation Amino acid sequences shown herein use the standard one-letter abbreviation code.
  • Selection of IL-18 Epitopes
  • The program Modeler (Sali, A. et al., Evaluation of comparative protein modeling by MODELLER. Proteins: Struct., Funct., Genet. (1995), 23(3), pp. 318-26. CODEN: PSFGEY; ISSN: 0887-3585) was used to generate homology models for both IL-18 and the IL-18 receptor. The X-ray crystal structures of IL-1β (Priestle, J., et al. The three-dimensional structure of human interleukin-1.beta. refined to 2.0.ANG. resolution. Prog. Clin. Biol. Res. (1990), 349 (Cytokines Lipocortins Inflammation Differ.), pp. 297-307) and IL-1RA (Schreuder, H. et al., Refined crystal structure of the interleukin-1 receptor antagonist: presence of a disulfide link and a cis-proline. Eur. J. Biochem. (1995), 227(3), pp. 838-47) are available and were used as reference coordinates for the model construction of IL-18. The IL-1 receptor structure (Vigers, G., et al. Crystal structure of the type-I interleukin-1-receptor complexed with interleukin-1.beta. Nature (London) (1997), 386(6621), pp. 190-194) was used to model the IL-18 receptor.
  • The structural model building for IL-18 and the IL-18 receptor is described further below.
  • IL-18 Model Building
  • The overall sequence homology with these two proteins (i.e., IL-1β and IL-18) is low, however, there is compelling evidence that IL-18 is a member of the IL-1 family (see Dinarello, C. A. IL-18: a TH1-inducing, proinflammatory cytokine and new member of the IL-1 family. J. Allergy Clin. Immunol. (1999), 103(1, Pt. 1), pp. 11-24) and that the overall protein fold is very similar. Like IL-1β, IL-18 is initially secreted in a pro form. Both pro-IL-1β and pro-IL-18 are activated by IL-1β-converting enzyme (ICE) (Fantuzzi, G. and Dinarello, C. A. Interleukin-18 and interleukin-1β: two cytokine substrates for ICE (caspase-1). J. Clin. Immunol. (1999), 19(1), pp. 1-11). It is also known that the IL-1 receptor and the IL-18 receptor are similar (Dinarello, C. A. et al. Overview of interleukin-18: more than an interferon-γ inducing factor. J. Leukocyte Biol. (1998), 63(6), 658-664). IL-1β is capable of binding to the IL-18 receptor. As a final argument, IL-1β and IL-1RA display an identical fold, even though the overall sequence homology between these two proteins is on a par with the sequence homology with IL-18. The sequence alignment between the three proteins (i.e., IL-18, IL-1β and IL1-RA) was constructed manually with the program InsightII. This alignment can be seen in Table 1:
  • TABLE 1
    Sequence alignment for IL-18 relative to IL-1β and IL-1RA
     24
    IL-18:  YFGK-LESKLS-VIRNLNDQVLFIDQGNRPLFE--DMT-DSDCRD--NAP
    IL-1β:    AP-VRS-LNCTLRDSQQKSLVMS-G--P-YELKALHLQGQ--D--MEQ
    IL-1RA:    SSKMQA-FR--IWDVNQKTFYLR-N--N--QLVAGYLQGP--NVNLEE
     80
    IL-18:  RTIFIISMY-KDSQPRG-MAVTISVKCEKISTLSC----ENK-IISFKEM
    IL-1β:  QVVFSMS-FVQGEESNDKIPVALGLK-EKNLYLSCVLK-DDKPTLQLESV
    IL-1RA:  KI--DV---VP-IEPH---ALFLGIH-GGKMCLSCV-KSGDETRLQLEAV
    123
    IL-18:  NPPDNI-KDTKSDIIF-FQRSVPGHDNKMQFESSSYEGYFLACE-KERDL
    IL-1β:  DPKNYP-KK-KMEKRFVFNK-I-EINNKLEFESAQFPNWYISTS-QAENM
    IL-1RA:  NITDLSENR-KQDKRFAFIR-S-DSGPTTSFESAACPGWFLCTAMEADQ-
    170
    IL-18:  FKLILKKED-ELGDRSIM-FTVQNED  (SEQ ID NO: 4)
    IL-1β:  -PVFL--GG-TKGGQDITDFTMQFVSS (SEQ ID NO: 5)
    IL-1RA:  -PVSL--TNMPDEGVMVTKFYFQED   (SEQ ID NO: 6)
  • The sequence homology between these sequences is listed in Table 2. The upper triangle is percent strict sequence identity and the lower triangle is percent conservative sequence homology. Only the portions of the total sequences reported in Table 1 are considered in Table 2. As was mentioned above, the overall homology is low but consistent across the family.
  • TABLE 2
    Sequence homology between IL-1 family members
    Molecule IL-18 IL-1β IL-1RA IL-1 Rec IL-18 Rec
    IL-18 — 20.0 21.8 — —
    IL-1b 53.5 — 27.5 — —
    IL-1RA 50.6 54.4 — — —
    IL-1 Rec — — — — 26.1
    IL-18 Rec — — — 50.5 —
  • The resulting IL-18 structure is pictured in FIG. 1 along with IL-1β and IL-1RA. The overall quality as assessed by the program What_Check (Hooft, R. W. et al., Errors in Protein Structures. Nature (1996) 381, pp. 272) is reasonable, but a bit low (see Table 3 below).
  • TABLE 3
    Structural Z-scores from What_Check
    (Positive is better than average)
    IL-18 IL-18 Rec
    IL-1β IL-1RA IL-1 Rec (model) (model)
    Packing Quality −1.6 −2.3 −3.6 −5.5 −5.7
    Ramachandran −2.0 −1.3 −2.9 −3.3 −2.3
    Plot
    Rotamer −1.6 −0.8 −1.5 −0.6 −0.6
    Normality
    Backbone −1.7 +0.5 −1.6 −5.6 −2.7
    Conformation
  • However, the assessment of the reference structures by What_Check is also low, suggesting that this protein fold is poorly represented in the database of reference structures. Undoubtedly though, the low sequence homology contributed to a less than perfect final structure in spite of our confidence in the overall protein fold. However, for the purpose of choosing epitopes for antibody generation, this structure is considered to be sufficient.
  • IL-18 Receptor Model Building
  • The structure of the IL-18 receptor was also generated using the program Modeler. The reference coordinates were from the IL-1 receptor. As in the case of the cytokines associated with these receptors, the overall sequence identity is low, but sufficient to generate an alignment. The sequence homology figures are included in Table 2 above. The alignment was generated manually using the program InsightII and is presented in Table 4.
  • TABLE 4
    Sequence alignment for the IL-18
    receptor relative to the IL-1 Receptor
     22
    IL-18 Rec:  CTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPR
    IL-1 Rec:  CKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDD-SKTPVSTEQA
     72
    IL-18 Rec:  SSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHS---
    IL-1 Rec:  S--RIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPN
     119
    IL-18 Rec:  -CFTERQVTSKIVEVKKFFQITCENSYYQTLVNST----SLYKNCKKLLL
    IL-1 Rec:  LCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLL
    163
    IL-18 Rec:  EN-----NKNPTIKKNAEFEDQGYYSCVHFLHHNGKLFNITKTFNITIVE
    IL-1 Rec:  DNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLE
    209
    IL-18 Rec:  DRSNIVPVLLGPKLNHVAVELGKNVRLNCSALLNEEDVIYWMF-GEE-NG
    IL-1 Rec:  ENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDE
    257
    IL-18 Rec:  SDPNIHEE-KEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTVASTGG
    IL-1 Rec:  DDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHG
    306
    IL-18 Rec:  TDTKSFILVRKAD (SEQ ID NO: 7)
    IL-1 Rec:  IDAAYIQLIYPVT (SEQ ID NO: 8)
  • The overall quality of the structure of the IL-18 receptor as determined using the Modeler program is reasonable but again scores somewhat low according to What_Check (see Table 3 above). The confidence that can be placed on the overall fold comes primarily from the fact that IL-1β binds to both the IL-1 and IL-18 receptor. The low sequence homology certainly contributes to the quality of the final structure, however, as in the case of the associated cytokines above, this current structure is considered to be sufficient. As an additional exercise, the IL-18 peptide epitope bound by LT28 (SEQ ID NO: 33) was modeled when complexed with the IL-18 receptor (FIG. 3). As a final exercise, a model of the IL-18/IL-18 receptor complex was generated based on the IL-1β/IL-1 receptor structure (FIG. 4). This structure was generated by superimposing the cytokine structures and the receptor structures. No attempt was made to energy minimize the final structure.
  • Peptide Epitope Selection
  • The primary purpose of generating structural models was to be able to select suitable peptides based primarily on a visual score. Solvent exposed sections of the proteins and portions of the proteins which were both hydrophilic and buried in the receptor/cytokine complex were considered. A final element considered was based on a selectivity criterion. The selected peptide epitope should be different in sequence from similar portions of other members of the family. Based on this criteria, a peptide from IL-18 was selected. In addition, a comprehensive overlapping panel of peptides (SEQ ID NOS: 31-60) representative of full length human IL-18 (SEQ ID NO: 61) was also made and the sequence of all of these IL-18 related peptides is shown in Table 5, below.
  • TABLE 5
    Selected Peptides Representative of IL-18
    Peptide Sequence SEQ ID NO:
    PLFEDMTDSDCRDNA (SEQ ID NO: 1)
    CPLFEDMTDSDCRDNA (SEQ ID NO: 2)
    PLFEDMTDSDCR (SEQ ID NO: 3)
    YFGKLESKLSVIRN (SEQ ID NO: 31)
    ESKLSVIRNLNDQV (SEQ ID NO: 32)
    VIRNLNDQVLFIDQ (SEQ ID NO: 33)
    (LT28 binding epitope)
    NDQVLFIDQGNRPL (SEQ ID NO: 34)
    FIDQGNRPLFEDMT (SEQ ID NO: 35)
    NRPLFEDMTDSDCR (SEQ ID NO: 36)
    (2E1 binding epitope)
    EDMTDSDCRDNAPR (SEQ ID NO: 37)
    SDCRDNAPRTIFII (SEQ ID NO: 38)
    NAPRTIFIISMYKD (SEQ ID NO: 39)
    IFIISMYKDSQPRG (SEQ ID NO: 40)
    MYKDSQPRGMAVTI (SEQ ID NO: 41)
    QPRGMAVTISVKCE (SEQ ID NO: 42)
    AVTISVKCEKISTL (SEQ ID NO: 43)
    VKCEKISTLSCENK (SEQ ID NO: 44)
    ISTLSCENKIISFK (SEQ ID NO: 45)
    CENKIISFKEMNPP (SEQ ID NO: 46)
    ISFKEMNPPDNIKD (SEQ ID NO: 47)
    MNPPDNIKDTKSDI (SEQ ID NO: 48)
    NIKDTKSDIIFFQR (SEQ ID NO: 49)
    KSDIIFFQRSVPGH (SEQ ID NO: 50)
    FFQRSVPGHDNKMQ (SEQ ID NO: 51)
    VPGHDNKMQFESSS (SEQ ID NO: 52)
    NKMQFESSSYEGYF (SEQ ID NO: 53)
    ESSSYEGYFLACEK (SEQ ID NO: 54)
    EGYFLACEKERDLF (SEQ ID NO: 55)
    ACEKERDLFKLILK (SEQ ID NO: 56)
    RDLFKLILKKEDEL (SEQ ID NO: 57)
    LILKKEDELGDRSI (SEQ ID NO: 58)
    EDELGDRSIMFTVQ (SEQ ID NO: 59)
    DRSIMFTVQNED (SEQ ID NO: 60)
    YFGKLESKLSVIRNLNDQVLFI (SEQ ID NO: 61)
    DQGNRPLFEDMTDSDCRDNAPR LT28 and 2E1
    TIFIISMYKDSQPRGMAVTISV epitopes indicated
    KCEKISTLSCENKIISFKEMNP in bold
    PDNIKDTKSDIIFFQRSVPGHD
    NKMQFESSSYEGYFLACEKERD
    LFKLILKKEDELGDRSIMFTVQ
    NED
  • The N-terminal cysteine of the IL-18 peptide represented by SEQ ID NO: 2 is not part of the native IL-18 sequence, but was added as a conjugation site. Accordingly, within the native IL-18 amino acid sequence, the region corresponding to the selected epitope comprises amino acid residues having the amino acid sequence PLFEDMTDSDCRDNA (SEQ ID NO: 1).
  • A schematic model of the IL-18 peptide (SEQ ID NO: 1) complexed with the IL-18 receptor is shown in FIG. 2, with this peptide epitope indicated in dark gray.
  • Subsequent antigenicity calculations were performed on IL-18 peptide sequences, with the result that this peptide scored particularly highly. This peptide was synthesized and used as an epitope to generate antibodies in a rabbit host. Molecular modeling data obtained using the IL-18 peptide PLFEDMTDSDCRDNA (SEQ ID NO: 1) or YFGKLESKLSVIRN (SEQ ID NO: 31) as compared to a cognate receptor, i.e., the IL-18 receptor, as depicted in FIGS. 2 and 3, provides an indication as to what residues a neutralizing antibody or compound may interact with.
  • An alternative method for peptide epitope selection can be accomplished in the absence of any molecular modeling by screening a panel of representative peptides using immunoselection. In one approach, overlapping peptides representative of the entire protein sequence can be used. In a more limited approach, only certain epitopes are represented in the panel of peptides. In a combined approach, molecular modeling can be used to identify epitopes likely to be important. The identified epitope(s) sequence can then be used to construct a panel of peptides (e.g., overlapping peptides) that are representative of the identified epitope(s). Methods for manufacturing desired peptide sequences can be carried out using standard techniques known in the art.
  • Once the binding peptide or peptides (e.g., panel of overlapping peptides) has been selected, an immunoscreen for a cognate receptor can be performed. Alternatively, an immunoscreen can be performed with a selected cognate receptor such that a peptide having a certain binding affinity can be identified. Any number of immunoscreens can be employed such that, either a desired receptor or desired peptide can be identified as a candidate binding molecule for further study. Such “bait” and “prey” techniques for analyzing protein-protein interactions, for identifying candidate biding molecules, and/or for scoring binding affinities are described in the art. One preferred technique utilizes phage display as described herein.
  • Anti-IL-18 Antibodies
  • The invention provides antibodies, as well as antibody portions thereof, that bind IL-18. Preferably, the antibodies, or portions thereof, are isolated antibodies. Preferably, the antibodies, or portions thereof, are neutralizing antibodies.
  • The term “antibody”, as used herein, is intended to refer to immunoglobulin molecules comprised of four polypeptide chains, two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • The term “antigen-binding portion” of an antibody (or simply “antibody portion”), as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., hIL-18). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Examples of binding fragments encompassed within the term “antigen-binding portion” of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR). Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883). Such single chain antibodies are also intended to be encompassed within the term “antigen-binding portion” of an antibody. Other forms of single chain antibodies, such as diabodies are also encompassed. Diabodies are bivalent, bispecific antibodies in which VH and VL domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, R. J., et al. (1994) Structure 2:1121-1123).
  • Still further, an antibody or antigen-binding portion thereof may be part of a larger immunoadhesion molecules, formed by covalent or noncovalent association of the antibody or antibody portion with one or more other proteins or peptides. Examples of such immunoadhesion molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov, S. M., et al. (1995) Human Antibodies and Hybridomas 6:93-101) and use of a cysteine residue, a marker peptide and a C-terminal polyhistidine tag to make bivalent and biotinylated scFv molecules (Kipriyanov, S. M., et al. (1994) Mol. Immunol. 31:1047-1058). Antibody portions, such as Fab and F(ab′)2 fragments, can be prepared from whole antibodies using conventional techniques, such as papain or pepsin digestion, respectively, of whole antibodies. Moreover, antibodies, antibody portions and immunoadhesion molecules can be obtained using standard recombinant DNA techniques, as described herein.
  • An “isolated antibody”, as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds hIL-18 is substantially free of antibodies that specifically bind antigens other than hIL-18). An isolated antibody that specifically binds hIL-18 may, however, have cross-reactivity to other antigens, such as IL-18 molecules from other species. Moreover, an isolated antibody may be substantially free of other cellular material and/or chemicals. Further, an isolated antibody, e.g., an isolated human antibody, can be a chimeric antibody wherein, e.g., variable regions, CDR domains, or isotypes derived from a different human source are grafted to the parent human antibody.
  • A “compound” as used herein, refers to binding molecules such as antibodies, e.g., polyclonal antibodies, monoclonal antibodies, binding fragments thereof (e.g., Fab fragments), single chain antibodies (e.g., scFv), peptides or peptide mimetics, as well as non-peptide based molecules, such as small molecules having ligand binding activity.
  • A “neutralizing antibody”, as used herein (or an “antibody that neutralized hIL-18 activity”), is intended to refer to an antibody whose binding to hIL-18 results in inhibition of the biological activity of hIL-18. This inhibition of the biological activity of hIL-18 can be assessed by measuring one or more indicators of hIL-18 biological activity. These indicators of hIL-18 biological activity can be assessed by one or more of several standard in vitro or in vivo assays known in the art.
  • The term “surface plasmon resonance”, as used herein, refers to an optical phenomenon that allows for the analysis of real-time biospecific interactions by detection of alterations in protein concentrations within a biosensor matrix, for example using the BIAcore system (Pharmacia Biosensor AB, Uppsala, Sweden and Piscataway, N.J.). For further descriptions, see Jönsson, U., et al. (1993) Ann. Biol. Clin. 51:19-26; Jönsson, U., et al. (1991) Biotechniques 11:620-627; Johnsson, B., et al. (1995) J. Mol. Recognit. 8:125-131; and Johnnson, B., et al. (1991) Anal. Biochem. 198:268-277.
  • The term “Koff”, as used herein, is intended to refer to the off rate constant for dissociation of an antibody from the antibody/antigen complex.
  • The term “Kd”, as used herein, is intended to refer to the dissociation constant of a particular antibody-antigen interaction.
  • In one aspect, the invention pertains to an isolated antibody, or an antigen-binding portion thereof, that binds an epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) or VIRNLNDQVLFIDQ (SEQ ID NO: 33), or a portion of any of these epitopes. Preferably, the antibody is a neutralizing antibody. Preferably, the antibody is a human antibody. In various embodiments, the antibody is a recombinant antibody or a monoclonal antibody.
  • In other embodiments, the isolated antibody, or antigen-binding portion thereof, binds to an epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1), wherein the antibody, or antigen-binding portion thereof, dissociates from human IL-18 with a koff rate constant of 0.1 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−6M or less. Alternatively, the antibody, or an antigen-binding portion thereof, may dissociate from human IL-18 with a koff rate constant of 1×10−2 s−1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC50 of 1×10−7M or less. Alternatively, the antibody, or an antigen-binding portion thereof, may dissociate from human IL-18 with a koff rate constant of 1×10−3 s−1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC50 of 1×10−8M or less. Alternatively, the antibody, or an antigen-binding portion thereof, may dissociate from human IL-18 with a koff rate constant of 1×10−4 s−1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC50 of 1×10−9M or less. Alternatively, the antibody, or an antigen-binding portion thereof, may dissociate from human IL-18 with a koff rate constant of 1×10−5 s−1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC50 of 1×10−10M or less. Alternatively, the antibody, or an antigen-binding portion thereof, may dissociate from human IL-18 with a koff rate constant of 1×10−6 s−1 or less, as determined by surface plasmon resonance, or may inhibit human IL-18 activity with an IC50 of 1×10−11M or less.
  • Affinity Maturation of Identified Anti-IL-18 Antibodies
  • The invention also provides for the further modification of an antibody identified as binding to an IL-18 epitope. The modification of the identified anti-IL-18 antibody is to improve binding and/or neutralization activity.
  • Therapeutic Compositions and Methods for Administering
  • The invention also provides pharmaceutical compositions comprising an antibody, or antigen-binding portion thereof, of the invention and a pharmaceutically acceptable carrier. In one embodiment, the pharmaceutical composition further comprises at least one additional therapeutic agent for treating a disorder in which IL-18 activity is detrimental.
  • The antibodies and antibody-portions of the invention can be incorporated into pharmaceutical compositions suitable for administration to a subject. Typically, the pharmaceutical composition comprises an antibody or antibody portion of the invention and a pharmaceutically acceptable carrier. As used herein, “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Examples of pharmaceutically acceptable carriers include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the antibody or antibody portion.
  • The antibodies and antibody-portions of the invention can be incorporated into a pharmaceutical composition suitable for parenteral administration. Preferably, the antibody or antibody-portions will be prepared as an injectable solution containing 0.1-250 mg/ml antibody. The injectable solution can be composed of either a liquid or lyophilized dosage form in a flint or amber vial, ampule or pre-filled syringe. The buffer can be L-histidine (1-50 mM), optimally 5-10 mM, at pH 5.0 to 7.0 (optimally pH 6.0). Other suitable buffers include but are not limited to, sodium succinate, sodium citrate, sodium phosphate or potassium phosphate. Sodium chloride can be used to modify the toxicity of the solution at a concentration of 0-300 mM (optimally 150 mM for a liquid dosage form). Cryoprotectants can be included for a lyophilized dosage form, principally 0-10% sucrose (optimally 0.5-1.0%). Other suitable cryoprotectants include trehalose and lactose. Bulking agents can be included for a lyophilized dosage form, principally 1-10% mannitol (optimally 2-4%). Stabilizers can be used in both liquid and lyophilized dosage forms, principally 1-50 mM L-Methionine (optimally 5-10 mM). Other suitable bulking agents include glycine, arginine, can be included as 0-0.05% polysorbate-80 (optimally 0.005-0.01%). Additional surfactants include but are not limited to polysorbate 20 and BRIJ surfactants.
  • The compositions of this invention may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories. The preferred form depends on the intended mode of administration and therapeutic application. Typical preferred compositions are in the form of injectable or infusible solutions, such as compositions similar to those used for passive immunization of humans with other antibodies. The preferred mode of administration is parenteral (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular). In a preferred embodiment, the antibody is administered by intravenous infusion or injection. In another preferred embodiment, the antibody is administered by intramuscular or subcutaneous injection.
  • Therapeutic compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration. Sterile injectable solutions can be prepared by incorporating the active compound (i.e., antibody or antibody portion) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile, lyophilized powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and spray-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. The proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
  • The antibodies and antibody-portions of the present invention can be administered by a variety of methods known in the art, although for many therapeutic applications, the preferred route/mode of administration is subcutaneous injection, intravenous injection or infusion. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. In certain embodiments, the active compound may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
  • In certain embodiments, an antibody or antibody portion of the invention may be orally administered, for example, with an inert diluent or an assimilable edible carrier. The compound (and other ingredients, if desired) may also be enclosed in a hard or soft shell gelatin capsule, compressed into tablets, or incorporated directly into the subject's diet. For oral therapeutic administration, the compounds may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like. To administer a compound of the invention by other than parenteral administration, it may be necessary to coat the compound with, or co-administer the compound with, a material to prevent its inactivation.
  • Supplementary active compounds can also be incorporated into the compositions. In certain embodiments, an antibody or antibody portion of the invention is coformulated with and/or coadministered with one or more additional therapeutic agents that are useful for treating disorders in which IL-18 activity is detrimental. For example, an anti-hIL-18 antibody or antibody portion of the invention may be coformulated and/or coadministered with one or more additional antibodies that bind other targets (e.g., antibodies that bind other cytokines or that bind cell surface molecules). Furthermore, one or more antibodies of the invention may be used in combination with two or more of the foregoing therapeutic agents. Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus avoiding possible toxicities or complications associated with the various monotherapies.
  • Therapeutic Uses
  • Interleukin 18 plays a critical role in the pathology associated with a variety of diseases involving immune and inflammatory elements. These diseases include, but are not limited to, rheumatoid arthritis, osteoarthritis, juvenile chronic arthritis, Lyme arthritis, psoriatic arthritis, reactive arthritis, spondyloarthropathy, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammatory bowel disease, insulin dependent diabetes mellitus, thyroiditis, asthma, allergic diseases, psoriasis, dermatitis scleroderma, graft versus host disease, organ transplant rejection, acute or chronic immune disease associated with organ transplantation, sarcoidosis, atherosclerosis, disseminated intravascular coagulation, Kawasaki's disease, Grave's disease, nephrotic syndrome, chronic fatigue syndrome, Wegener's granulomatosis, Henoch-Schoenlein purpurea, microscopic vasculitis of the kidneys, chronic active hepatitis, uveitis, septic shock, toxic shock syndrome, sepsis syndrome, cachexia, infectious diseases, parasitic diseases, acquired immunodeficiency syndrome, acute transverse myelitis, Huntington's chorea, Parkinson's disease, Alzheimer's disease, stroke, primary biliary cirrhosis, hemolytic anemia, malignancies, heart failure, myocardial infarction, Addison's disease, sporadic, polyglandular deficiency type I and polyglandular deficiency type II, Schmidt's syndrome, adult (acute) respiratory distress syndrome, alopecia, alopecia areata, seronegative arthopathy, arthropathy, Reiter's disease, psoriatic arthropathy, ulcerative colitic arthropathy, enteropathic synovitis, chlamydia, yersinia and salmonella associated arthropathy, spondyloarthopathy, atheromatous disease/arteriosclerosis, atopic allergy, autoimmune bullous disease, pemphigus vulgaris, pemphigus foliaceus, pemphigoid, linear IgA disease, autoimmune haemolytic anaemia, Coombs positive haemolytic anaemia, acquired pernicious anaemia, juvenile pernicious anaemia, myalgic encephalitis/Royal Free Disease, chronic mucocutaneous candidiasis, giant cell arteritis, primary sclerosing hepatitis, cryptogenic autoimmune hepatitis, Acquired Immunodeficiency Disease Syndrome, Acquired Immunodeficiency Related Diseases, Hepatitis C, common varied immunodeficiency (common variable hypogammaglobulinaemia), dilated cardiomyopathy, female infertility, ovarian failure, premature ovarian failure, fibrotic lung disease, cryptogenic fibrosing alveolitis, post-inflammatory interstitial lung disease, interstitial pneumonitis, connective tissue disease associated interstitial lung disease, mixed connective tissue disease associated lung disease, systemic sclerosis associated interstitial lung disease, rheumatoid arthritis associated interstitial lung disease, systemic lupus erythematosus associated lung disease, dermatomyositis/polymyositis associated lung disease, Sjögren's disease associated lung disease, ankylosing spondylitis associated lung disease, vasculitic diffuse lung disease, haemosiderosis associated lung disease, drug-induced interstitial lung disease, radiation fibrosis, bronchiolitis obliterans, chronic eosinophilic pneumonia, lymphocytic infiltrative lung disease, postinfectious interstitial lung disease, gouty arthritis, autoimmune hepatitis, type-1 autoimmune hepatitis (classical autoimmune or lupoid hepatitis), type-2 autoimmune hepatitis (anti-LKM antibody hepatitis), autoimmune mediated hypoglycaemia, type B insulin resistance with acanthosis nigricans, hypoparathyroidism, acute immune disease associated with organ transplantation, chronic immune disease associated with organ transplantation, osteoarthrosis, primary sclerosing cholangitis, psoriasis type 1, psoriasis type 2, idiopathic leucopaenia, autoimmune neutropaenia, renal disease NOS, glomerulonephritides, microscopic vasulitis of the kidneys, Lyme disease, discoid lupus erythematosus, male infertility idiopathic or NOS, sperm autoimmunity, multiple sclerosis (all subtypes), sympathetic ophthalmia, pulmonary hypertension secondary to connective tissue disease, Goodpasture's syndrome, pulmonary manifestation of polyarteritis nodosa, acute rheumatic fever, rheumatoid spondylitis, Still's disease, systemic sclerosis, Sjögren's syndrome, Takayasu's disease/arteritis, autoimmune thrombocytopaenia, idiopathic thrombocytopaenia, autoimmune thyroid disease, hyperthyroidism, goitrous autoimmune hypothyroidism (Hashimoto's disease), atrophic autoimmune hypothyroidism, primary myxoedema, phacogenic uveitis, primary vasculitis and vitiligo. The human antibodies, and antibody portions of the invention can be used to treat humans suffering from autoimmune diseases, in particular those associated with inflammation, including, rheumatoid spondylitis, allergy, autoimmune diabetes, autoimmune uveitis, acute liver disease, chronic liver diseases, allergy and asthma, mental disorders (e.g., depression and schizophrenia), and Th2 Type and Th1 Type mediated diseases.
  • Preferably, the antibodies of the invention or antigen-binding portions thereof, are used to treat rheumatoid arthritis, Crohn's disease, multiple sclerosis, insulin dependent diabetes, mellitus, and psoriasis.
  • An antibody, or antibody portion, of the invention also can be administered with one or more additional therapeutic agents useful in the treatment of autoimmune and inflammatory diseases.
  • Antibodies of the invention, or antigen binding portions thereof can be used alone or in combination to treat such diseases. It should be understood that the antibodies of the invention or antigen binding portion thereof can be used alone or in combination with an additional agent, e.g., a therapeutic agent, said additional agent being selected by the skilled artisan for its intended purpose. For example, the additional agent can be a therapeutic agent art-recognized as being useful to treat the disease or condition being treated by the antibody of the present invention. The additional agent also can be an agent which imparts a beneficial attribute to the therapeutic composition e.g., an agent which effects the viscosity of the composition.
  • It should further be understood that the combinations which are to be included within this invention are those combinations useful for their intended purpose. The agents set forth below are illustrative for purposes and not intended to be limited. The combinations which are part of this invention can be the antibodies of the present invention and at least one additional agent selected from the lists below. The combination can also include more than one additional agent, e.g., two or three additional agents if the combination is such that the formed composition can perform its intended function.
  • Preferred combinations are non-steroidal anti-inflammatory drug(s) also referred to as NSAIDS which include drugs like ibuprofen. Other preferred combinations are corticosteroids including prednisolone; the well known side-effects of steroid use can be reduced or even eliminated by tapering the steroid dose required when treating patients in combination with the anti-IL-18 antibodies of this invention. Non-limiting examples of therapeutic agents for rheumatoid arthritis with which an antibody, or antibody portion, of the invention can be combined include the following: cytokine suppressive anti-inflammatory drug(s) (CSAIDs); antibodies to or antagonists of other human cytokines or growth factors, for example, TNF, LT, IL-1, IL-2, IL-6, IL-7, IL-8, IL-12, IL-15, IL-16, EMAP-II, GM-CSF, FGF, and PDGF. Antibodies of the invention, or antigen binding portions thereof, can be combined with antibodies to cell surface molecules such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69, CD80 (B7.1), CD86 (B7.2), CD90, or their ligands including CD154 (gp39 or CD40L).
  • Preferred combinations of therapeutic agents may interfere at different points in the autoimmune and subsequent inflammatory cascade; preferred examples include TNF antagonists like chimeric, humanized or human TNF antibodies, D2E7, (PCT Publication No. WO 97/29131), CA2 (Remicade™), CDP 571, and soluble p55 or p75 TNF receptors, derivatives, thereof, (p75TNFR1gG (Enbrel™) or p55TNFR1gG (Lenercept), and also TNFα converting enzyme (TACE) inhibitors; similarly IL-1 inhibitors (Interleukin-1-converting enzyme inhibitors, IL-1RA etc.) may be effective for the same reason. Other preferred combinations include Interleukin 11. Yet another preferred combination are other key players of the autoimmune response which may act parallel to, dependent on or in concert with IL-18 function; especially preferred are IL-12 antagonists including IL-12 antibodies or soluble IL-12 receptors, or IL-12 binding proteins. It has been shown that IL-12 and IL-18 have overlapping but distinct functions and a combination of antagonists to both may be most effective. Yet another preferred combination are non-depleting anti-CD4 inhibitors. Yet other preferred combinations include antagonists of the co-stimulatory pathway CD80 (B7.1) or CD86 (B7.2) including antibodies, soluble receptors or antagonistic ligands.
  • The antibodies of the invention, or antigen binding portions thereof, may also be combined with agents, such as methotrexate, 6-MP, azathioprine sulphasalazine, mesalazine, olsalazine chloroquinine/hydroxychloroquine, pencillamine, aurothiomalate (intramuscular and oral), azathioprine, cochicine, corticosteroids (oral, inhaled and local injection), beta-2 adrenoreceptor agonists (salbutamol, terbutaline, salmeteral), xanthines (theophylline, aminophylline), cromoglycate, nedocromil, ketotifen, ipratropium and oxitropium, cyclosporin, FK506, rapamycin, mycophenolate mofetil, leflunomide, NSAIDs, for example, ibuprofen, cox-2 inhibitors, cox-2 selective inhibitors (e.g., rofecoxib (VIOXX™; Merck & Co., Inc.)) corticosteroids such as prednisolone, phosphodiesterase inhibitors, adensosine agonists, antithrombotic agents, complement inhibitors, adrenergic agents, agents which interfere with signalling by proinflammatory cytokines such as TNFα or IL-1 (e.g. IRAK, NIK, IKK, p38 or MAP kinase inhibitors), IL-1β converting enzyme inhibitors, TNFα converting enzyme (TACE) inhibitors, T-cell signalling inhibitors such as kinase inhibitors, metalloproteinase inhibitors, sulfasalazine, azathioprine, 6-mercaptopurines, angiotensin converting enzyme inhibitors, soluble cytokine receptors and derivatives thereof (e.g. soluble p55 or p75 TNF receptors and the derivatives p75TNFRIgG (Enbrel™ and p55TNFRIgG (Lenercept)), sIL-1RI, sIL-1RII, sIL-6R) and antiinflammatory cytokines (e.g. IL-4, IL-10, IL-11, IL-13 and TGFβ). Preferred combinations include methotrexate or leflunomide and in moderate or severe rheumatoid arthritis cases, cyclosporine.
  • Non-limiting examples of therapeutic agents for inflammatory bowel disease with which an antibody, or antibody portion, of the invention can be combined include the following: budenoside; epidermal growth factor; corticosteroids; cyclosporin, sulfasalazine; aminosalicylates; 6-mercaptopurine; azathioprine; metronidazole; lipoxygenase inhibitors; mesalamine; olsalazine; balsalazide; antioxidants; thromboxane inhibitors; IL-1 receptor antagonists; anti-IL-1β monoclonal antibodies; anti-IL-6 monoclonal antibodies; growth factors; elastase inhibitors; pyridinyl-imidazole compounds; antibodies to or antagonists of other human cytokines or growth factors, for example, TNF, LT, IL-1, IL-2, IL-6, IL-7, IL-8, IL-12, IL-15, IL-16, EMAP-II, GM-CSF, FGF, and PDGF. Antibodies of the invention, or antigen binding portions thereof, can be combined with antibodies to cell surface molecules such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69, CD90 or their ligands. The antibodies of the invention, or antigen binding portions thereof, may also be combined with agents, such as methotrexate, cyclosporin, FK506, rapamycin, mycophenolate mofetil, leflunomide, NSAIDs, for example, ibuprofen, corticosteroids such as prednisolone, phosphodiesterase inhibitors, adenosine agonists, antithrombotic agents, complement inhibitors, adrenergic agents, agents which interfere with signalling by proinflammatory cytokines such as TNFα or IL-1 (e.g. IRAK, NIK, IKK, p38 or MAP kinase inhibitors), IL-1β converting enzyme inhibitors, TNFα converting enzyme inhibitors, T-cell signalling inhibitors such as kinase inhibitors, metalloproteinase inhibitors, sulfasalazine, azathioprine, 6-mercaptopurines, angiotensin converting enzyme inhibitors, soluble cytokine receptors and derivatives thereof (e.g. soluble p55 or p75 TNF receptors, sIL-1RI, sIL-1RII, sIL-6R) and antiinflammatory cytokines (e.g. IL-4, IL-10, IL-11, IL-13 and TGFβ).
  • Preferred examples of therapeutic agents for Crohn's disease in which an antibody or an antigen binding portion can be combined include the following: TNF antagonists, for example, anti-TNF antibodies, D2E7 (PCT Publication No. WO 97/29131), CA2 (Remicade™), CDP 571, TNFR-Ig constructs, (p75TNFRIgG (Enbrel™) and p55TNFRIgG (Lenercept)) inhibitors and PDE4 inhibitors. Antibodies of the invention or antigen binding portions thereof, can be combined with corticosteroids, for example, budenoside and dexamethasone. Antibodies of the invention or antigen binding portions thereof, may also be combined with agents such as sulfasalazine, 5-aminosalicylic acid and olsalazine, and agents which interfere with synthesis or action of proinflammatory cytokines such as IL-1, for example, IL-1β converting enzyme inhibitors and IL-1ra. Antibodies of the invention or antigen binding portion thereof may also be used with T cell signaling inhibitors, for example, tyrosine kinase inhibitors 6-mercaptopurines. Antibodies of the invention or antigen binding portions thereof, can be combined with IL-11.
  • Non-limiting examples of therapeutic agents for multiple sclerosis with which an antibody, or antibody portion, of the invention can be combined include the following: corticosteroids; prednisolone; methylprednisolone; azathioprine; cyclophosphamide; cyclosporine; methotrexate; 4-aminopyridine; tizanidine; interferon-β1a (Avonex; Biogen); interferon-β1b (Betaseron; Chiron/Berlex); Copolymer 1 (Cop-1; Copaxone; Teva Pharmaceutical Industries, Inc.); hyperbaric oxygen; intravenous immunoglobulin; clabribine; antibodies to or antagonists of other human cytokines or growth factors, for example, TNF, LT, IL-1, IL-2, IL-6, IL-7, IL-8, IL-12, IL-15, IL-16, EMAP-II, GM-CSF, FGF, and PDGF. Antibodies of the invention, or antigen binding portions thereof, can be combined with antibodies to cell surface molecules such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69, CD80, CD86, CD90 or their ligands. The antibodies of the invention, or antigen binding portions thereof, may also be combined with agents, such as methotrexate, cyclosporine, FK506, rapamycin, mycophenolate mofetil, leflunomide, NSAIDs, for example, ibuprofen, corticosteroids such as prednisolone, phosphodiesterase inhibitors, adensosine agonists, antithrombotic agents, complement inhibitors, adrenergic agents, agents which interfere with signalling by proinflammatory cytokines such as TNFα or IL-1 (e.g. IRAK, NIK, IKK, p38 or MAP kinase inhibitors), IL-1β converting enzyme inhibitors, TACE inhibitors, T-cell signalling inhibitors such as kinase inhibitors, metalloproteinase inhibitors, sulfasalazine, azathioprine, 6-mercaptopurines, angiotensin converting enzyme inhibitors, soluble cytokine receptors and derivatives thereof (e.g. soluble p55 or p75 TNF receptors, sIL-1RI, sIL-1RII, sIL-6R) and antiinflammatory cytokines (e.g. IL-4, IL-10, IL-13 and TGFβ).
  • Preferred examples of therapeutic agents for multiple sclerosis in which the antibody or antigen binding portion thereof can be combined to include interferon-β, for example, IFNβ1a and IFNβ1b; copaxone, corticosteroids, IL-1 inhibitors, TNF inhibitors, and antibodies to CD40 ligand and CD80.
  • The pharmaceutical compositions of the invention may include a “therapeutically effective amount” or a “prophylactically effective amount” of an antibody or antibody portion of the invention. A “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result. A therapeutically effective amount of the antibody or antibody portion may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody or antibody portion to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody or antibody portion are outweighed by the therapeutically beneficial effects. A “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
  • Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic or prophylactic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
  • An exemplary, non-limiting range for a therapeutically or prophylactically effective amount of an antibody or antibody portion of the invention is 0.1-20 mg/kg, more preferably 1-10 mg/kg. It is to be noted that dosage values may vary with the type and severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
  • Methods of Making Anti-IL-18 Antibodies
  • The anti-IL-18 antibodies of the invention are made using any one of a variety of techniques known in the art for preparing antibodies and using antigens comprising the IL-18 peptide epitope described in subsection I, i.e., an epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1).
  • In general, the methods of the invention for making an antibody that binds human interleukin-18 (IL-18) involve:
      • exposing an antibody repertoire to an antigen comprising an epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1), or portion thereof (e.g., SEQ ID NO: 3 or 33); and
      • selecting from the antibody repertoire an antibody that binds the epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1), or portion thereof (e.g., SEQ ID NO: 3 or 33).
  • In one embodiment, the antibody repertoire is an in vivo repertoire in an animal and the method comprises immunizing the animal with the antigen comprising the epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1). In another embodiment, the antibody repertoire is a recombinant antibody library and the method comprising screening the library with the antigen comprising the epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1). Preferably, the library is a human antibody library.
  • Methods for immunizing an animal with an antigen to thereby raise specific antibodies to the antigen are well known in the art. An IL-18 antigen comprising an epitope of human IL-18 comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) can be administered to an animal to elicit polyclonal antibodies and specific antibodies that bind the epitope can be isolated by selecting from the polyclonal antibodies those antibodies that bind to the epitope (e.g., by passing the polyclonal antisera over a column that comprises a peptide comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) of hIL-18). The antigen used to elicit the polyclonal antibodies can be intact (i.e., full-length) hIL-18 or can be a portion of hIL-18 that includes the epitope of interest, e.g., a synthetic peptide comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) of hIL-18. Furthermore, monoclonal antibodies to the epitope can be made from the aforementioned animals using standard hybridoma technology and selection for those hybridomas secreting an antibody that specifically binds the epitope of interest, e.g., by screening the hybridomas with a peptide comprising amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) of hIL-18 and selecting for antibodies that bind specifically to the peptide.
  • In vitro methods also can be used to make the antibodies of the invention, wherein an antibody library is screened to identify an antibody having the desired binding specificity. Methods for such screening of recombinant antibody libraries are well known in the art and include methods described in, for example, Ladner et al. U.S. Pat. No. 5,223,409; Kang et al. PCT Publication No. WO 92/18619; Dower et al. PCT Publication No. WO 91/17271; Winter et al. PCT Publication No. WO 92/20791; Markland et al. PCT Publication No. WO 92/15679; Breitling et al. PCT Publication No. WO 93/01288; McCafferty et al. PCT Publication No. WO 92/01047; Garrard et al. PCT Publication No. WO 92/09690; Fuchs et al. (1991) Bio/Technology 9:1370-1372; Hay et al. (1992) Hum Antibod Hybridomas 3:81-85; Huse et al. (1989) Science 246:1275-1281; McCafferty et al., Nature (1990) 348:552-554; Griffiths et al. (1993) EMBO J 12:725-734; Hawkins et al. (1992) J Mol Biol 226:889-896; Clackson et al. (1991) Nature 352:624-628; Gram et al. (1992) PNAS 89:3576-3580; Garrad et al. (1991) Bio/Technology 9:1373-1377; Hoogenboom et al. (1991) Nuc Acid Res 19:4133-4137; and Barbas et al. (1991) PNAS 88:7978-7982, and PCT Publication No. WO 97/29131, the contents of each of which are incorporated herein by reference.
  • The recombinant antibody library may be from a subject immunized with IL-18, or a portion of IL-18 comprising the epitope of amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1). Alternatively, the recombinant antibody library may be from a naïve subject, i.e., one who has not been immunized with IL-18, such as a human antibody library from a human subject who has not been immunized with human IL-18. Antibodies of the invention are selected by screening the recombinant antibody library with the epitope of amino acids PLFEDMTDSDCRDNA (SEQ ID NO: 1) of human IL-18 to thereby select those antibodies that recognize this epitope. Methods for conducting such screening and selection are well known in the art, such as described in the references in the preceding paragraph.
  • To select antibodies of the invention having a particular binding affinity for hIL-18, the art-known method of surface plasmon resonance can be used. To select antibodies having a particular neutralizing activity for hIL-18, standard methods known in the art for assessing the inhibition of hIL-18 activity may be used. In addition, methods for immunizing mice that have been transgenically altered to encode a human immunoglobulin repertoire thereby enabling the organism to express fully human antibodies in response to an immunogen, are known in the art (see, e.g., U.S. Pat. Nos. 5,877,397 and 6,150,584).
  • Uses of Anti-IL-18 Antibodies
  • Given their ability to bind to hIL-18, the anti-hIL-18 antibodies, or portions thereof, of the invention can be used to detect hIL-18 (e.g., in a biological sample, such as serum or plasma), using a conventional immunoassay, such as an enzyme linked immunosorbent assays (ELISA), an radioimmunoassay (RIA) or tissue immunohistochemistry. The invention provides a method for detecting hIL-18 in a biological sample comprising contacting a biological sample with an antibody, or antibody portion, of the invention and detecting either the antibody (or antibody portion) bound to hIL-18 or unbound antibody (or antibody portion), to thereby detect hIL-18 in the biological sample. The antibody is directly or indirectly labeled with a detectable substance to facilitate detection of the bound or unbound antibody. Suitable detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; and examples of suitable radioactive material include 125I, 131I, 35S, 32P, 33P, or 3H.
  • Alternative to labeling the antibody, hIL-18 can be assayed in biological fluids by a competition immunoassay utilizing rhIL-18 standards labeled with a detectable substance and an unlabeled anti-hIL-18 antibody. In this assay, the biological sample, the labeled rhIL-18 standards and the anti-hIL-18 antibody are combined and the amount of labeled rhIL-18 standard bound to the unlabeled antibody is determined. The amount of hIL-18 in the biological sample is inversely proportional to the amount of labeled rhIL-18 standard bound to the anti-hIL-18 antibody.
  • The antibodies and antibody portions of the invention preferably are capable of neutralizing hIL-18 activity both in vitro and in vivo. Accordingly, such antibodies and antibody portions of the invention can be used to inhibit hIL-18 activity, e.g., in a cell culture containing hIL-18, in human subjects or in other mammalian subjects having IL-18 with which an antibody of the invention cross-reacts. In one embodiment, the invention provides a method for inhibiting IL-18 activity comprising contacting IL-18 with an antibody or antibody portion of the invention such that IL-18 activity is inhibited. Preferably, the IL-18 is human IL-18. For example, in a cell culture containing, or suspected of containing hIL-18, an antibody or antibody portion of the invention can be added to the culture medium to inhibit hIL-18 activity in the culture.
  • In another embodiment, the invention provides a method for inhibiting IL-18 activity in a subject suffering from a disorder in which IL-18 activity is detrimental. The invention provides methods for inhibiting IL-18 activity in a subject suffering from such a disorder, which method comprises administering to the subject an antibody or antibody portion of the invention such that IL-18 activity in the subject is inhibited. Preferably, the IL-18 is human IL-18 and the subject is a human subject. Alternatively, the subject can be a mammal expressing an IL-18 with which an antibody of the invention cross-reacts. Still further the subject can be a mammal into which has been introduced hIL-18 (e.g., by administration of hIL-18 or by expression of an hIL-18 transgene). An antibody of the invention can be administered to a human subject for therapeutic purposes. Moreover, an antibody of the invention can be administered to a non-human mammal expressing an IL-18 with which the antibody cross-reacts for veterinary purposes or as an animal model of human disease. Regarding the latter, such animal models may be useful for evaluating the therapeutic efficacy of antibodies of the invention (e.g., testing of dosages and time courses of administration).
  • In particular, one animal model for modulating IL-18 activity in an animal uses NOD-SCID mice which are transplanted with human peripheral blood mononuclear cells. Then, two to four weeks after engraftment (as measured by human IgG titers in serum) the mice are injected with LPS (lipopolysaccharide). Four to six hours later LPS-induced human interferon-gamma serum titers are determined. The efficacy (potency) of anti-IL-18 antibodies (e.g., IL-18 neutralizing antibodies) is determined by injecting the antibodies (ip) one day prior to LPS challenge followed by monitoring the test animals for a reduction in interferon-gamma serum titers (a function of IL-18 in vivo activity) as compared to controls (see, e.g., Holmes et al., Hybridoma, 19:363367 (2000)).
  • As used herein, the term “a disorder in which IL-18 activity is detrimental” is intended to include diseases and other disorders in which the presence of IL-18 in a subject suffering from the disorder has been shown to be, or is suspected of being, either responsible for the pathophysiology of the disorder or a factor that contributes to a worsening of the disorder. Accordingly, a disorder in which IL-18 activity is detrimental is a disorder in which inhibition of IL-18 activity is expected to alleviate the symptoms and/or progression of the disorder. Such disorders may be evidenced, for example, by an increase in the concentration of IL-18 in a biological fluid of a subject suffering from the disorder (e.g., an increase in the concentration of IL-18 in serum, plasma, synovial fluid, etc. of the subject), which can be detected, for example, using an anti-IL-18 antibody as described above.
  • Non-limiting examples of disorders that can be treated with the antibodies of the invention include those disorders discussed in the section above pertaining to pharmaceutical compositions of the antibodies of the invention.
  • Other features of the invention will be apparent from the following examples which should not be construed as limiting.
  • The contents of all cited references, including literature references, issued patents, and published patent applications, as cited throughout this application are hereby expressly incorporated by reference.
  • EXEMPLIFICATION
  • In general, the practice of the present invention employs, unless otherwise indicated, conventional techniques of chemistry, molecular biology, recombinant DNA technology, PCR technology, immunology (especially, e.g., antibody technology), and any necessary cell culture or animal husbandry techniques, which are within the skill of the art and are explained fully in the literature. See, e.g., Sambrook, Fritsch and Maniatis, Molecular Cloning: Cold Spring Harbor Laboratory Press (1989); DNA Cloning, Vols. 1 and 2, (D. N. Glover, Ed. 1985); Oligonucleotide Synthesis (M. J. Gait, Ed. 1984); PCR Handbook Current Protocols in Nucleic Acid Chemistry, Beaucage, Ed. John Wiley & Sons (1999) (Editor); Oxford Handbook of Nucleic Acid Structure, Neidle, Ed., Oxford Univ Press (1999); PCR Protocols: A Guide to Methods and Applications, Innis et al., Academic Press (1990); PCR Essential Techniques: Essential Techniques, Burke, Ed., John Wiley & Son Ltd (1996); The PCR Technique: RT-PCR, Siebert, Ed., Eaton Pub. Co. (1998); Quantitative PCR Protocols, Kochanowski et al., Eds., Humana Press (1999); Clinical Applications of PCR, Lo, Ed., Humana Press (1998); Antibody Engineering Protocols (Methods in Molecular Biology), 510, Paul, S., Humana Pr (1996); Antibody Engineering: A Practical Approach (Practical Approach Series, 169), McCafferty, Ed., Irl Pr (1996); Antibodies: A Laboratory Manual, Harlow et al., C.S.H.L. Press, Pub. (1999); Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons (1992); Large-Scale Mammalian Cell Culture Technology, Lubiniecki, A., Ed., Marcel Dekker, Pub., (1990); and Manipulating the Mouse Embryo, Hogan et al., C.S.H.L. Press, Pub (1994).
  • Throughout the examples, unless otherwise indicated, the above materials and methods were used.
  • Example 1 Isolation of Anti-IL-18 Antibodies
  • Antibodies to hIL-18 were isolated by screening separate scFv phage display libraries prepared using human VL and VH cDNAs from mRNA derived from human B cells (e.g., tonsils and spleen). Construction of the library and methods for selection are described in Vaughan et al. (1996) Nature Biotech. 14: 309-314.
  • The libraries were screened using either full length human IL-18 (SEQ ID NO: 61), a peptide epitope of IL-18 (SEQ ID NOS: 1-3), or a panel of overlapping 15 amino acid peptides representing IL-18 (the epitope sequence of which is presented in Table 5; SEQ ID NOS: 31-60). IL-18 specific antibodies were selected by coating the antigen onto immunotubes using standard procedures (Marks et al., (1991) J. Mol. Biol. 222: 581-597). The scFv libraries were screened using either IL-18, a peptide epitope of IL-18, or an IL-18 peptide panel to generate a significant number of IL-18 specific binders. Several different clonotypes were selected, determined by restriction enzyme digestion patterns, and confirmed by DNA sequencing.
  • In order to identify IL-18 antibodies which preferentially bind either full length IL-18 or a representative peptide thereof, the supernatant containing scFv was titrated on biotin-captured IL-18 in an ELISA and binding characteristics were determined.
  • Two anti-IL-18 single chain antibodies were obtained, one termed 2E1, independently isolated using a peptide epitope and the peptide panel, and a second anti-IL-18 antibody termed LT28, isolated using full length IL-18. These parent anti-IL-18 antibodies were selected for further study and modification.
  • Example 2 Affinity Maturation of an Anti-18 Antibodies
  • A single chain Fv version of antibody 2E1 having an identified IL-18 binding activity and the heavy chain and light chain sequence shown in Table 6 was further modified for improved neutralization of IL-18 activity.
  • TABLE 6
    Sequence of Single-Chain Anti-IL-18 Antibody 2E1
    2E1 Heavy Chain
    (SEQ ID NO: 18)
                                  CDR1 (SEQ ID NO: 9)
    QVQLVQSGAEVKKPGASMKVSCKTSGYTF TGYYIH WVRQAHGQGFEWI
          CDR2 (SEQ ID NO: 10)                        CDR3 (SEQ ID NO: 11)
    GRLNPTTGDANFAEKFQ GRVALTRDTSISTAYLQLDSLKSDDTAVYYCAG KEGA WGQGTLVTVSS
    2E1 Light Chain
    (SEQ ID NO: 19)
                            CDR1 (SEQ ID NO: 12)     CDR2 (SEQ ID NO: 13)
    SSELTQDPAVSVALGQTVRITC QGDSLRHFYPN WYQQKPGQAPVLVIY GKNNRPS
                                        CDR3 (SEQ ID NO: 14)
    GIPDRFSGSGSGNTGSLTITGAQAEDEADYYC GSRDSSGIHVV FGGGTKVTVLG
  • The anti-IL-18 antibody 2E1 was independently selected using an IL-18 peptide and sequential, overlapping, peptide panel representative of IL-18 (see Table 6).
  • The specific amino acid residues of the heavy chain variable region selected for mutagenesis are summarized in Table 7. In particular, with respect to the heavy chain region, individual amino acid substitutions were tested at positions H30, H31, H32, H33, and H35 of CDR1, positions H52, H52a, H53, H54, H56, and H58 of CDR2, and H95, H96, H97, and H98 of CDR3.
  • With regards to light chain amino acid residues selected for mutagenesis, individual amino acid substitutions were tested at positions L30, L31, L32, and L34 of CDR1, positions L50, L52, L53, and L55 of CDR2 and positions L89, L90, L91, L92, L93, L94, L95, L95a, L95b, L96, and L97 of CDR 3.
  • TABLE 7
    Heavy Chain Amino Acid Substitutions Introduced Into 2E1
    Heavy Chain Mutations
    CDR/Kabat
    Position substituted residue
    CDR1
    H30 A, R, N, D, C, G, H, I, F, P, S, or V
    H31 A, C, H, S, T, or Y
    H32 R, N, C, H, P, S, or T
    H33 N, D, C, Q, H, L, M, F, S, or V
    H35 N, D, L, or F
    CDR2
    H52 T
    H52a R, Q, L, S, T, or W
    H53 A, R, N, L, P, S, or Y
    H54 A, R, N, D, Q, L, K, M, P, S, or Y
    H56 A, R, N, C, G, H, I, L, or F
    H58 A, R, Q, E, H, I, L, K, M, F, S, T, Y, P, S, T, W, Y, or V
    CDR3
    H95 A, R, E, Q, S, Y, V, H, P, W, or C
    H96 A, R, Q, S, Y, V, H, P, W, or C
    H97 A, R, E, Q, S, Y, V, H, P, W, or C
    H98 R, E, Q, S, Y, V, H, P, W, or C
  • TABLE 8
    Light Chain Amino Acid Substitutions Introduced Into 2E1
    Light Chain Mutations
    CDR/Kabat
    Position substituted residue
    CDR1
    L30 N, D, C, G, I, L, S, W, or Y
    L31 R, N, D, C, G, H, I, L, P, S, T, or Y
    L32 R, N, D, E, G, I, L, P, S, T, or V
    L34 A, R, N, D, E, H, I, L, K, M, F, P, S, T, Y, or V
    CDR2
    L50 A, N, I, L, F, P, S, W, Y, or V
    L52 A, R, D, E, H, I, L, M, F, P, S, T, or V
    L53 A, R, C, I, L, K, M, P, S, or T
    L55 A, R, N, D, C, G, H, I, L, S, T, or Y
    CDR3
    L89 A, R, E, Q, S, Y, V, H, P, W, or C
    L90 A, R, E, Q, Y, V, H, P, W, or C
    L91 R, E, Q, S, Y, V, H, P, W, or C
    L92 A, R, E, Q, S, Y, V, H, P, W, or C
    L93 A, R, E, Q, Y, V, H, P, W, or C
    L94 A, R, E, Q, Y, V, H, P, W, or C
    L95 A, R, E, Q, S, Y, V, H, P, W, or C
    L95a A, R, E, Q, S, Y, V, H, P, W, or C
    L95b A, R, E, Q, S, Y, V, P, W, or C
    L96 A, R, E, Q, S, Y, H, P, W, or C
    L97 A, R, E, Q, S, Y, H, P, W, or C
  • Substitutions were introduced using standard techniques (e.g., as described in Taylor et al., Nucleic Acids Res. 13: 8764-8758 (1985); Nakamaye et al., Nucleic Acids Res. 14: 9679-9698 (1986); and Olsen et al., Methods in Enzymology, 217: 189 (1993)). In brief, oligonucleotides degenerate for a given codon were synthesized for each of the positions to be mutagenized. A single-stranded DNA template was prepared from the original plasmid containing a single-chain Fv version of the antibody 2E1 gene. The nucleic acid sequence of the parent 2E1 antibody heavy and light chain is provided in SEQ ID NOS: 62 and 64. The mutant oligonucleotides were then used to create a complementary DNA strand and eventually a double-stranded plasmid, thus incorporating the degeneracy or the different mutations in a given codon of the antibody. In particular, the CDR3 region of the heavy and light chain of 2E1 was altered using the QuikChange Kit (Stratagene) according to the manufactures instruction.
  • A representative number of clones were then sequenced from each mutagenesis reaction (i.e., 7 to 36 clones) and those representing a change from the parent 2E1 single chain antibody sequence were expressed in bacteria and purified for further in vitro and in vivo testing as described infra.
  • In another screen using a full length IL-18 ligand, a second anti-IL-18 antibody was identified and selected for further improvement using affinity maturation. In particular, using the techniques described above, the LT28 antibody having the heavy chain and light chain sequence shown in Table 9 (and nucleic sequence provided in SEQ ID NOS: 66 and 68) was further modified.
  • TABLE 9
    Sequence of Single-Chain Anti-IL-18 Antibody LT28
    LT28 Heavy Chain
    (SEQ ID NO: 28)
                        CDR1 (SEQ ID NO: 20) CDR2 (SEQ ID NO: 21)
    LVQPGGSLRLSCAASGFTFS SYAMS WVRQAPGKGLEWVS AISGSGGSTYYADSVKG
                                       CDR3 (SEQ ID NO: 22)
    RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR DDDDYDFDY WGRGTMVTVSS
    LT28 Light Chain
    (SEQ ID NO: 29)
                            CDR1 (SEQ ID NO: 23)        CDR2 (SEQ ID NO: 24)
    QSVLTQPPSASGTPGQRVTISC SGSSSNIGINAVN WYQQLPGTAPKLLIY GNDQRPS
                                       CDR3 (SEQ ID NO: 25)
    GVPDRFSGSKSGTSASLAISGLQSEDEADYYC AAWDDSLSGPV FGGGTKLTVLG
  • With respect to the heavy chain region, amino acid substitutions were introduced at positions H31, H32, H33, and H35 of CDR1, positions H50, H51, H52, H52a, H53, H54, H56, and H58 of CDR2, and H95, H96, H97, H98, H99, H100, H100a, H101, and H102 of CDR3.
  • With regards to light chain residues selected for mutation, amino acid substitutions were introduced at positions L30, L31, L32, L34 of CDR1, positions L50, L52, L53, L55 of CDR2 and positions L89, L90, L91, L92, L93, L94, L95, L95a, L95b, L96, L97.
  • TABLE 10
    Heavy Chain Amino Acid Substitutions Introduced into LT28
    Heavy Chain Mutations
    CDR/Kabat
    Position substituted residue
    CDR1
    H31 A, R, E, Q, S, Y, V, H, P, W, or C
    H32 A, R, E, Q, S, Y, V, H, P, W, or C
    H33 A, R, E, Q, S, Y, V, H, P, W, or C
    H35 A, R, E, Q, S, Y, V, H, P, W, or C
    CDR2
    H50 A, R, E, Q, S, Y, V, H, P, W, or C
    H51 A, R, E, Q, S, Y, V, H, P, W, or C
    H52 A, R, E, Q, S, Y, V, H, P, W, or C
    H52a A, R, E, Q, S, Y, V, H, P, W, or C
    H53 A, R, E, Q, S, Y, V, H, P, W, or C
    H54 A, R, E, Q, S, Y, V, H, P, W, or C
    H56 A, R, E, Q, S, Y, V, H, P, W, or C
    H58 A, R, E, Q, S, Y, V, H, P, W, C
    CDR3
    H95 A, R, E, Q, S, Y, V, H, P, W, or C
    H96 A, R, E, Q, S, Y, V, H, P, W, or C
    H97 A, R, E, Q, S, Y, V, H, P, W, or C
    H98 A, R, E, Q, S, Y, V, H, P, W, or C
    H99 A, R, E, Q, S, Y, V, H, P, W, or C
    H100 A, R, E, Q, S, Y, V, H, P, W, or C
    H100a A, R, E, Q, S, Y, V, H, P, W, or C
    H101 A, R, E, Q, S, Y, V, H, P, W, or C
    H102 A, R, E, Q, S, Y, V, H, P, W, or C
  • TABLE 11
    Light Chain Amino Acid Substitutions Introduced into LT28
    Light Chain Mutations
    CDR/Position substituted residue
    CDR1
    L30 A, R, E, Q, S, Y, V, H, P, W, C
    L31 A, R, E, Q, S, Y, V, H, P, W, C
    L32 R, E, Q, S, Y, V, H, P, W, C, G
    L34 A, R, E, Q, S, Y, V, H, P, W, C
    CDR2
    L50 A, R, E, Q, S, Y, V, H, P, C
    L52 A, R, E, S, Y, V, H, P, W, C
    L53 A, R, E, S, Y, V, H, P, W, C, N
    L55 A, E, Q, S, Y, V, H, P, W, C
    CDR3
    L89 A, R, E, Q, S, Y, V, H, P, W, C
    L90 A, R, E, Q, S, Y, V, H, P, W, C
    L91 A, R, E, Q, S, Y, V, H, P, W, C
    L92 A, R, E, Q, S, Y, V, H, P, W, C
    L93 A, R, E, Q, S, Y, V, H, P, W, C
    L94 A, R, E, Q, S, Y, V, H, P, W, C
    L95 A, R, E, Q, S, Y, V, H, P, W, C
    L95a A, R, E, Q, S, Y, V, H, P, W, C
    L95b A, R, E, Q, S, Y, V, H, P, W, C
    L96 A, R, E, Q, S, Y, V, H, P, W, C
    L97 A, R, E, Q, S, Y, V, H, P, W, C
  • Substitutions were introduced as described above. A representative number of clones were then sequenced from each mutagenesis reaction and those representing a change from the parent LT28 single chain antibody sequence were expressed in bacteria and purified for further testing as described below.
  • Example 3 Binding Activity of Human Antibodies to IL-18
  • Real-time binding interactions between ligand (biotinylated recombinant human IL-18 (rhIL-18) immobilized on a biosensor matrix) and analyte (antibodies in solution) were measured by surface plasmon resonance (SPR) using the BIAcore system (Pharmacia Biosensor, Piscataway, N.J.). The system utilizes the optical properties of SPR to detect alterations in protein concentrations within a dextran biosensor matrix. Proteins are covalently bound to the dextran matrix at known concentrations. Antibodies are injected through the dextran matrix and specific binding between injected antibodies and immobilized ligand results in an increased matrix protein concentration and resultant change in the SPR signal. These changes in SPR signal are recorded as resonance units (RU) and are displayed with respect to time along the y-axis of a sensorgram.
  • To facilitate immobilization of biotinylated rhIL-18 on the biosensor matrix, streptavidin is covalently linked via free amine groups to the dextran matrix by first activating carboxyl groups on the matrix with 100 mM N-hydroxysuccinimide (NHS) and 400 mM N-ethyl-N′-(3-diethylaminopropyl)carbodiimide hydrochloride (EDC). Next, streptavidin is injected across the activated matrix. Thirty-five microliters of streptavidin (25 μg/ml), diluted in sodium acetate, pH 4.5, is injected across the activated biosensor and free amines on the protein are bound directly to the activated carboxyl groups. Unreacted matrix EDC-esters are deactivated by an injection of 1 M ethanolamine Streptavidin-coupled biosensor chips also are commercially available (Pharmacia BR-1000-16, Pharmacia Biosensor, Piscataway, N.J.).
  • Biotinylated rhIL-18 was prepared by first dissolving 5.0 mg of biotin (D-biotinyl-ε-aminocaproic acid N-hydroxysuccinimide ester; Boehringer Mannheim Cat. No. 1008 960) in 500 μl dimethylsulfoxide to make a 10 mg/ml solution. Ten microliters of biotin was added per ml of rhIL-18 (at 2.65 mg/ml) for a 2:1 molar ratio of biotin to rhIL-18. The reaction was mixed gently and incubated for two hours at room temperature in the dark. A PD-10 column, Sephadex G-25M (Pharmacia Catalog No. 17-0851-01) was equilibrated with 25 ml of cold PBS and loaded with 2 ml of rhIL-18-biotin per column. The column was eluted with 10×1 ml cold PBS. Fractions were collected and read at OD280 (1.0 OD=1.25 mg/ml). The appropriate fractions were pooled and stored at −80° C. until use.
  • Biotinylated rhIL-18 to be immobilized on the matrix via streptavidin was diluted in PBS running buffer (Gibco Cat. No. 14190-144, Gibco BRL, Grand Island, N.Y.) supplemented with 0.05% (BIAcore) surfactant P20 (Pharmacia BR-1000-54, Pharmacia Biosensor, Piscataway, N.J.). To determine the capacity of rhIL-18-specific antibodies to bind immobilized rhIL-18, a binding assay was conducted as follows. Aliquots of biotinylated rhIL-18 (25 nM; 10 μl aliquots) were injected through the streptavidin-coupled dextran matrix at a flow rate of 5 μl/min. Before injection of the protein and immediately afterward, PBS buffer alone flowed through each flow cell. The net difference in signal between baseline and approximately 30 sec. after completion of biotinylated rhIL-18 injection was taken to represent the binding value. Direct rhIL-18-specific antibody binding to immobilized biotinylated rhIL-18 was measured. Antibodies (20 μg/ml) were diluted in PBS running buffer and 25 μl aliquots were injected through the immobilized protein matrices at a flow rate of 5 μl/min. Prior to injection of antibody, and immediately afterwards, PBS buffer alone flowed through each flow cell. The net difference in baseline signal and signal after completion of antibody injection was taken to represent the binding value of the particular sample. Biosensor matrices were regenerated using 100 mM HCl before injection of the next sample. To determine the off rate (Koff), on rate (Kon), association rate (Ka) and dissociation rate (Kd) constants, BIAcore kinetic evaluation software (version 2.1) was used.
  • Representative results of improved candidate anti-IL-18 antibodies binding to biotinylated rhIL-18, as compared to the parent antibodies 2E1 and LT28 (and murine controls), are shown below in Table 12. For comparison, IC50 values from the cell-based neutralization assay are also included and these are described in Example 4. All clones were prepared as single-chain Fv antibodies for testing using Biacore analysis and the cell-based assay described below. Parental clones listed comprise an unmutated parental heavy and light chain, whereas single chain mutants contain one parental chain and one mutated chain where the mutated chan is indicated as being either heavy (H) or light (L) followed by the Kabat position and nature of the amino acid substitution.
  • TABLE 12
    Binding of Anti-IL-18 Antibodies Derived From 2E1 and LT28
    Antibody On-rates Off-rates IC50
    Clone (M−1s−1) (s−1) Kd (M) Value*
    2E1 parent and mutants
    2E1 (parent) ScFv 2.6E+3  6.42E−03 1.5E−07 3.3E−8M
    2E1 (parent) IgG  9.0E−10M
    L34S 1.69E−04 1.5E−8M
    H53R 2.34E−03 2.5E−8M
    H53Y — 1.5E−8M
    H58Q — 1.6E−8M
    L34S + H53R 2.7E+03 6.82E−05 2.3E−08  3.0E−09M
    (2E1RS)
    L34S + H58Q — 1.5E−8M
    L34S + H53Y 5.28E−05 6.7E−9M
    H53R + H58Q — 1.2E−8M
    H53Y + H58Q — 1.2E−8M
    L34S + H53R + 6.18E−05 2.8E−9M
    H58Q
    L34S + H53Y + — 8.0E−9M
    H58Q
    L90C   4x
    L93C 2-4x
    L94P, Q, or R 2-4x
    L95R, Y 3-8x
    L95bE, W 2-4x
    LT28 parent and mutants
    LT28 (parent) 1.3E+04 4.8E−04 3.9E−08 9.0E−8M
    H54Q 2-3x
    H58W 2-3x
    1
    125-2H 1.7E+05 1.1E−04 6.2E−10 2.E−10M
    318-M 1.2E+04 1.1E−04 9.6E−09 4.0E−9M
    *Some values presented as fold improvement compared to the parent.
  • Example 4 Neutralizing Activity of Anti-IL-18 Antibodies
  • To examine the neutralizing activity of the anti-human IL-18 antibodies of the invention, an art recognized assay for monitoring IL-18 activity was used.
  • Briefly, the assay employs KG1 cells (ATCC #CCL-246, myelogenous leukemia bone marrow cells) which were cultured according to standard techniques (e.g., using RPMI 1640 Culture Medium Gibco #21870-076; (supplemented with 10% Fetal Bovine Serum (BioWhittaker #14-501F); 2 mM L-glutamine (Gibco #25030-081); 50 units/ml Penicillin, 50 ug/ml Streptomycin (Gibco #15070-063); and 0.075% Sodium Bicarbonate).
  • To test for IL-18 neutralization, 3×10E5 KG-1 cells stimulated with 20 ng/ml hTNF-alpha (Lot#19130132) was incubated with 50 ul of anti-IL-18 antibody (4×Conc.) and 50 ul of IL-18 (4×Conc.=8 ng/ml) and incubated for 37° C. for 1 hr or 16-20 hrs. To determine the amount of IL-18 neutralization that occurred as a function of induced hIFN-gamma production, an ELISA was performed using commercially available Elisa Kits (R & D #DIF00/Endogen #EH-IFNG), according to the manufacturers instructions, and hIFN-gamma production was calculated (pg/ml) off a standard curve.
  • In all, four mutant antibodies, i.e., the 2E1 derived L34S, H53R, H53Y, and H58Q, were shown to have greater IL-18 neutralization potency than the parent 2E1 antibody (see Table 12). The improvements in IC50 values using the KG-1 assay were in the range of 2 to 5 fold, and similar improved binding results were determined using BIAcore analysis.
  • Various mutation combination clones were also prepared and tested, and this data is summarized in the Table 12. The best combination clone L34S-H53R showed a greater than ten fold improvement over the parent antibody 2E1 in both the KG-1 cell-based assay and using the BIAcore analysis. The resulting antibody was designated the name of 2E1RS.
  • Several other mutant clones of 2E1 showed an improvement in potency, i.e., IL-18 neutralization, as determined using the KG-1 assay. The mutant L95Y offered 5 to 8 fold better IC50 values than the parent 2E1 antibody. Several other mutants offered a 2 to 3 fold improvement and they are 2E1 mutants H96A, H96Q, H96S, H98S, L90C, L90W, L93C, L94P, L94P, L94Q, L94R, L94W, L95R, L95aA, L95aH, L95aP, L95aR, L95aW, L95bE, L95bW, L95bY, L97C, and L97E.
  • The binding of 2E1 in the form of an ScFv antibody or IgG antibody was also compared (see FIG. 5).
  • Still further, two mutants derived from the LT28 parent should improved 1L-18 neutralization activity compared to the parent antibody.
  • These results demonstrate that fully human IL-18 neutralizing antibodies can be obtained using the methods and compositions of the invention.
  • EQUIVALENTS
  • Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.

Claims (42)

1-60. (canceled)
61. A human monoclonal antibody, or antigen-binding portion thereof, capable of binding to human IL-18.
62. The antibody of claim 61, wherein the antibody, or antigen-binding portion thereof, dissociates from human IL-18 with a koff rate constant of 0.1 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−6M or less.
63. The antibody of claim 61, wherein the antibody, or antigen-binding portion thereof, dissociates from human IL-18 with a koff rate constant of 1×10−2 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−7M or less.
64. The antibody of claim 61, wherein the antibody, or antigen-binding portion thereof, dissociates from human IL-18 with a koff rate constant of 1×10−3 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−8M or less.
65. The antibody of claim 61, wherein the antibody, or antigen-binding portion thereof, dissociates from human IL-18 with a koff rate constant of 1×10−4 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−9M or less.
66. The antibody of claim 61, wherein the antibody, or antigen-binding portion thereof, dissociates from human IL-18 with a koff rate constant of 1×10−5 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−10M or less.
67. The antibody of claim 61, wherein the antibody, or antigen-binding portion thereof, dissociates from human IL-18 with a koff rate constant of 1×10−6 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−11M or less.
68. The antibody, or antigen-binding portion thereof, of claim 61, that binds an epitope of human IL-18, or portion thereof, comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-3 and 31-60 and a combination thereof.
69. The antibody, or antigen-binding portion thereof, of claim 61, wherein the antibody is a neutralizing antibody, a human antibody, a recombinant antibody, or a monoclonal antibody.
70. An isolated antibody, or antigen-binding portion thereof, that binds to an epitope of human IL-18, wherein the antibody, or antigen-binding portion thereof, dissociates from human IL-18 with a koff rate constant of 0.1 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−6M or less.
71. The isolated antibody of claim 70, or an antigen-binding portion thereof, which dissociates from human IL-18 with a koff rate constant of 1×10−2 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−7M or less.
72. The isolated antibody of claim 70, or an antigen-binding portion thereof, which dissociates from human IL-18 with a koff rate constant of 1×10−3 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−8M or less.
73. The isolated antibody of claim 70, or an antigen-binding portion thereof, which dissociates from human IL-18 with a koff rate constant of 1×10−4 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−9 M or less.
74. The isolated antibody of claim 70, or an antigen-binding portion thereof, which dissociates from human IL-18 with a koff rate constant of 1×10−5 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−10M or less.
75. The isolated antibody of claim 70, or an antigen-binding portion thereof, which dissociates from human IL-18 with a koff rate constant of 1×10−6 s−1 or less, as determined by surface plasmon resonance, or which inhibits human IL-18 activity with an IC50 of 1×10−11 M or less.
76. An isolated human antibody, or an antigen-binding portion thereof, comprising at least one variable region CDR domain capable of binding an epitope of human IL-18.
77. The isolated antibody, or an antigen-binding portion thereof, of claim 76, wherein said antibody, or an antigen-binding portion thereof, contains at least one amino acid substitution or insertion that improves IL-18 binding as compared to the unmodified antibody or antigen-binding portion thereof.
78. The isolated antibody, or an antigen-binding portion thereof, of claim 76, wherein said antibody, or an antigen-binding portion thereof, contains at least one amino acid substitution or insertion that improves neutralization of IL-18 as compared to the unmodified antibody or antigen-binding portion thereof.
79. An isolated nucleic acid encoding an antibody CDR amino acid sequence of claim 61.
80. The isolated nucleic acid of claim 79, which is in a recombinant expression vector.
81. A host cell into which the recombinant expression vector of claim 80 has been introduced.
82. A method of synthesizing an antibody that binds human IL-18, comprising culturing the host cell of claim 81 in a culture medium until an antibody that binds human IL-18 is synthesized by the cell.
83. The method of claim 82, wherein said antibody is human.
84. A pharmaceutical composition comprising the antibody, or antigen-binding portion thereof, of claim 61, and a pharmaceutically acceptable carrier.
85. The pharmaceutical composition of claim 84 which further comprises at least one additional therapeutic agent for treating a disorder in which IL-18 activity is detrimental.
86. The pharmaceutical composition of claim 85, wherein said additional agent is selected from the group consisting of an antibody, or antigen binding portion thereof, capable of binding human IL-12, methotrexate, an antibody, or antigen binding portion thereof, capable of binding TNF, corticosteroids, cyclosporin, rapamycin, FK506, and non-steroidal anti-inflammatory agents.
87. A method of making the antibody, or antigen binding portion thereof, of claim 61, comprising:
exposing an antibody repertoire to an antigen comprising an epitope of human IL-18 or portion thereof; and
selecting from the antibody repertoire an antibody that binds the epitope of human IL-18, or portion thereof.
88. The method of claim 87, wherein the antibody repertoire is an in vivo repertoire in an animal and the method comprises immunizing the animal with the antigen comprising an epitope of human IL-18 or portion thereof.
89. The method of claim 87, wherein said epitope comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 1-3 and 31-60 and a combination thereof.
90. The method of claim 87, wherein said in vivo repertoire is a fully human immunoglobulin repertoire integrated into the genome of the animal.
91. The method of claim 87, wherein the antibody repertoire is a recombinant antibody library and the method comprises screening the library with an antigen comprising the epitope of human IL-18 or portion thereof.
92. The method of claim 87, wherein the library is a human antibody library.
93. A method for inhibiting human IL-18 activity comprising contacting human IL-18 with the antibody, or antigen-binding portion thereof, of claim 61 such that human IL-18 activity is inhibited.
94. A method for inhibiting human IL-18 activity in a human subject suffering from a disorder in which IL-18 activity is detrimental, comprising administering to the human subject the antibody, or antigen-binding portion thereof, of claim 61 such that human IL-18 activity in the human subject is inhibited.
95. A method for treating a human subject suffering from a disorder in which IL-18 activity is detrimental by administering an antibody of claim 61 such that treatment is achieved.
96. The method of claim 95, wherein said disorder is selected from the group comprising rheumatoid arthritis, osteoarthritis, juvenile chronic arthritis, Lyme arthritis, psoriatic arthritis, reactive arthritis, spondyloarthropathy, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammatory bowel disease, insulin dependent diabetes mellitus, thyroiditis, asthma, allergic diseases, psoriasis, dermatitis scleroderma, graft versus host disease, organ transplant rejection, acute or chronic immune disease associated with organ transplantation, sarcoidosis, atherosclerosis, disseminated intravascular coagulation, Kawasaki's disease, Grave's disease, nephrotic syndrome, chronic fatigue syndrome, Wegener's granulomatosis, Henoch-Schoenlein purpurea, microscopic vasculitis of the kidneys, chronic active hepatitis, uveitis, septic shock, toxic shock syndrome, sepsis syndrome, cachexia, infectious diseases, parasitic diseases, acquired immunodeficiency syndrome, acute transverse myelitis, Huntington's chorea, Parkinson's disease, Alzheimer's disease, stroke, primary biliary cirrhosis, hemolytic anemia, malignancies, heart failure, myocardial infarction, Addison's disease, sporadic, polyglandular deficiency type I and polyglandular deficiency type II, Schmidt's syndrome, adult (acute) respiratory distress syndrome, alopecia, alopecia areata, seronegative arthopathy, arthropathy, Reiter's disease, psoriatic arthropathy, ulcerative colitic arthropathy, enteropathic synovitis, chlamydia, yersinia and salmonella associated arthropathy, spondyloarthopathy, atheromatous disease/arteriosclerosis, atopic allergy, autoimmune bullous disease, pemphigus vulgaris, pemphigus foliaceus, pemphigoid, linear IgA disease, autoimmune haemolytic anaemia, Coombs positive haemolytic anaemia, acquired pernicious anaemia, juvenile pernicious anaemia, myalgic encephalitis/Royal Free Disease, chronic mucocutaneous candidiasis, giant cell arteritis, primary sclerosing hepatitis, cryptogenic autoimmune hepatitis, Acquired Immunodeficiency Disease Syndrome, Acquired Immunodeficiency Related Diseases, Hepatitis C, common varied immunodeficiency (common variable hypogammaglobulinaemia), dilated cardiomyopathy, female infertility, ovarian failure, premature ovarian failure, fibrotic lung disease, cryptogenic fibrosing alveolitis, post-inflammatory interstitial lung disease, interstitial pneumonitis, connective tissue disease associated interstitial lung disease, mixed connective tissue disease associated lung disease, systemic sclerosis associated interstitial lung disease, rheumatoid arthritis associated interstitial lung disease, systemic lupus erythematosus associated lung disease, dermatomyositis/polymyositis associated lung disease, Sjögren's disease associated lung disease, ankylosing spondylitis associated lung disease, vasculitic diffuse lung disease, haemosiderosis associated lung disease, drug-induced interstitial lung disease, radiation fibrosis, bronchiolitis obliterans, chronic eosinophilic pneumonia, lymphocytic infiltrative lung disease, postinfectious interstitial lung disease, gouty arthritis, autoimmune hepatitis, type-1 autoimmune hepatitis (classical autoimmune or lupoid hepatitis), type-2 autoimmune hepatitis (anti-LKM antibody hepatitis), autoimmune mediated hypoglycaemia, type B insulin resistance with acanthosis nigricans, hypoparathyroidism, acute immune disease associated with organ transplantation, chronic immune disease associated with organ transplantation, osteoarthrosis, primary sclerosing cholangitis, psoriasis type 1, psoriasis type 2, idiopathic leucopaenia, autoimmune neutropaenia, renal disease NOS, glomerulonephritides, microscopic vasulitis of the kidneys, Lyme disease, discoid lupus erythematosus, male infertility idiopathic or NOS, sperm autoimmunity, multiple sclerosis (all subtypes), sympathetic ophthalmia, pulmonary hypertension secondary to connective tissue disease, Goodpasture's syndrome, pulmonary manifestation of polyarteritis nodosa, acute rheumatic fever, rheumatoid spondylitis, Still's disease, systemic sclerosis, Sjögren's syndrome, Takayasu's disease/arteritis, autoimmune thrombocytopaenia, idiopathic thrombocytopaenia, autoimmune thyroid disease, hyperthyroidism, goitrous autoimmune hypothyroidism (Hashimoto's disease), atrophic autoimmune hypothyroidism, primary myxoedema, phacogenic uveitis, primary vasculitis, vitiligo, acute liver disease, chronic liver diseases, allergy and asthma, mental disorders (e.g., depression and schizophrenia) and Th2 Type and Th1 Type mediated diseases.
97. A method of treating a patient suffering from a disorder in which IL-18 is detrimental comprising the step of administering the antibody, or antigen binding portion thereof, of claim 61, before, concurrent, or after the administration of a second agent, wherein the second agent is selected from the group consisting of an anti-IL-12 antibody or antigen binding fragment thereof, methotrexate, anti-TNF antibody or antigen binding fragment thereof, corticosteroids, cyclosporin, rapamycin, FK506, and non-steroidal anti-inflammatory agents.
98. The method of claim 95, wherein the disorder is selected from the group consisting of asthma, SLE, osteoarthritis, psoriatic arthritis and psoriasis.
99. The antibody, or antigen binding portion thereof, of claim 76, wherein the epitope is selected from the group consisting of SEQ ID NOs: 1-3 and 31-60 and a combination thereof.
100. The antibody, or antigen binding portion thereof, of claim 76, wherein the epitope is selected from the group consisting of SEQ ID NOs: 3, 33, 51-59 and a combination thereof.
101. The antibody, or antigen binding portion thereof, of claim 76, wherein the epitope comprises SEQ ID NOs:51 and 58 or SEQ ID NOs:51 and 59.
US13/603,968 2000-02-10 2012-09-05 Antibodies that bind il-18 and methods of inhibiting il-18 activity Abandoned US20130101595A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US13/603,968 US20130101595A1 (en) 2000-02-10 2012-09-05 Antibodies that bind il-18 and methods of inhibiting il-18 activity

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US18160800P 2000-02-10 2000-02-10
US09/780,035 US7767207B2 (en) 2000-02-10 2001-02-09 Antibodies that bind IL-18 and methods of inhibiting IL-18 activity
US12/786,095 US20110008357A1 (en) 2000-02-10 2010-05-24 Antibodies that bind il-18 and methods of inhibiting il-18 activity
US13/603,968 US20130101595A1 (en) 2000-02-10 2012-09-05 Antibodies that bind il-18 and methods of inhibiting il-18 activity

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US12/786,095 Continuation US20110008357A1 (en) 2000-02-10 2010-05-24 Antibodies that bind il-18 and methods of inhibiting il-18 activity

Publications (1)

Publication Number Publication Date
US20130101595A1 true US20130101595A1 (en) 2013-04-25

Family

ID=22665007

Family Applications (3)

Application Number Title Priority Date Filing Date
US09/780,035 Expired - Fee Related US7767207B2 (en) 2000-02-10 2001-02-09 Antibodies that bind IL-18 and methods of inhibiting IL-18 activity
US12/786,095 Abandoned US20110008357A1 (en) 2000-02-10 2010-05-24 Antibodies that bind il-18 and methods of inhibiting il-18 activity
US13/603,968 Abandoned US20130101595A1 (en) 2000-02-10 2012-09-05 Antibodies that bind il-18 and methods of inhibiting il-18 activity

Family Applications Before (2)

Application Number Title Priority Date Filing Date
US09/780,035 Expired - Fee Related US7767207B2 (en) 2000-02-10 2001-02-09 Antibodies that bind IL-18 and methods of inhibiting IL-18 activity
US12/786,095 Abandoned US20110008357A1 (en) 2000-02-10 2010-05-24 Antibodies that bind il-18 and methods of inhibiting il-18 activity

Country Status (22)

Country Link
US (3) US7767207B2 (en)
EP (4) EP2332579A3 (en)
JP (2) JP2004500086A (en)
KR (4) KR101111103B1 (en)
CN (3) CN102504024A (en)
AR (2) AR027404A1 (en)
AU (3) AU2001236807A1 (en)
BG (2) BG107045A (en)
BR (1) BR0108188A (en)
CA (2) CA2399148A1 (en)
CL (1) CL2012001063A1 (en)
HU (1) HUP0300423A3 (en)
IL (2) IL151044A0 (en)
MX (1) MXPA02007756A (en)
MY (1) MY146017A (en)
NO (1) NO20023788L (en)
NZ (1) NZ520392A (en)
PL (1) PL356836A1 (en)
SK (1) SK12942002A3 (en)
TW (3) TW201305214A (en)
WO (1) WO2001058956A2 (en)
ZA (1) ZA200206266B (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018162724A1 (en) 2017-03-09 2018-09-13 Mab Discovery Gmbh Antibodies specifically binding to human il-1r7
WO2025229563A1 (en) * 2024-05-03 2025-11-06 Glaxosmithkline Intellectual Property Development Limited Methods of treating inflammatory bowel disease

Families Citing this family (182)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7153827B1 (en) 1994-03-08 2006-12-26 Human Genome Sciences, Inc. Vascular endothelial growth factor 2 and methods of use
US7109308B1 (en) 1994-03-08 2006-09-19 Human Genome Sciences, Inc. Antibodies to human vascular endothelial growth factor 2
US7186688B1 (en) 1994-03-08 2007-03-06 Human Genome Sciences, Inc. Methods of stimulating angiogenesis in a patient by administering vascular endothelial growth factor 2
EP0751992B1 (en) 1994-03-08 2005-11-09 Human Genome Sciences, Inc. Vascular endothelial growth factor 2
US5932540A (en) 1994-03-08 1999-08-03 Human Genome Sciences, Inc. Vascular endothelial growth factor 2
US6608182B1 (en) 1994-03-08 2003-08-19 Human Genome Sciences, Inc. Human vascular endothelial growth factor 2
US6040157A (en) 1994-03-08 2000-03-21 Human Genome Sciences, Inc. Vascular endothelial growth factor 2
US7223724B1 (en) 1999-02-08 2007-05-29 Human Genome Sciences, Inc. Use of vascular endothelial growth factor to treat photoreceptor cells
PL356836A1 (en) 2000-02-10 2004-07-12 Abbott Laboratories Antibodies that bind human interleukin-18 and methods of making and using
NZ535299A (en) * 2000-02-21 2006-06-30 Applied Research Systems Use of IL-18 inhibitors
US20020025317A1 (en) * 2000-07-20 2002-02-28 Schering Ag Bispecific monoclonal antibodies to IL-12 and IL-18
US7273751B2 (en) 2000-08-04 2007-09-25 Human Genome Science, Inc. Vascular endothelial growth factor-2
KR100857376B1 (en) * 2001-01-29 2008-09-05 라보라토리스 세로노 에스.에이. IL-18 inhibitors used to treat and / or prevent heart disease
DE60236646D1 (en) * 2001-04-13 2010-07-22 Human Genome Sciences Inc Anti-VEGF-2 antibodies
US7402312B2 (en) 2001-04-13 2008-07-22 Human Genome Sciences, Inc. Antibodies to vascular endothelial growth factor 2 (VEGF-2)
CN100556450C (en) * 2001-05-16 2009-11-04 耶达研究发展有限公司 Application of IL-18 inhibitor in treatment or prevention of sepsis
US20040213786A1 (en) * 2001-08-24 2004-10-28 Rappaport Family Institute For Research In The Medical Sciences Compositions and methods for treating T-cell mediated autoimmune diseases
RU2318829C2 (en) 2001-11-14 2008-03-10 Сентокор, Инк. Anti-il-6 antibodies, methods and using
EP1494710A4 (en) * 2002-03-26 2007-03-21 Centocor Inc Diabetes-related immunoglobulin derived proteins, compostions, methods and uses
AU2002247905A1 (en) * 2002-03-28 2003-10-13 Markus Fritzsche Antibody against an epitope of the b. burgdorferi flagellar basal rod protein (fbrp)
US7253260B2 (en) * 2002-04-17 2007-08-07 Smithkline Beecham Corporation Human IL-18 crystal structure
US7601351B1 (en) 2002-06-26 2009-10-13 Human Genome Sciences, Inc. Antibodies against protective antigen
AU2003256299A1 (en) 2002-07-01 2004-01-19 Human Genome Sciences, Inc. Antibodies that specifically bind to reg iv
US20050271660A1 (en) 2002-09-06 2005-12-08 Alexion Pharmaceuticals, Inc. Nebulization of monoclonal antibodies for treating pulmonary diseases
US9415102B2 (en) 2002-09-06 2016-08-16 Alexion Pharmaceuticals, Inc. High concentration formulations of anti-C5 antibodies
US7261893B2 (en) 2002-10-22 2007-08-28 Wyeth Neutralizing antibodies against GDF-8 and uses therefor
US9320792B2 (en) 2002-11-08 2016-04-26 Ablynx N.V. Pulmonary administration of immunoglobulin single variable domains and constructs thereof
EP1558647B1 (en) * 2002-11-08 2015-06-10 Ablynx N.V. Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor
EP2284192A3 (en) 2002-11-08 2011-07-20 Ablynx N.V. Camelidae antibodies for sublingual administration
US20060034845A1 (en) 2002-11-08 2006-02-16 Karen Silence Single domain antibodies directed against tumor necrosis factor alpha and uses therefor
CA2523912A1 (en) * 2003-04-30 2004-11-11 Japan Science And Technology Agency Human antihuman interleukin-18 antibody, fragment thereof and method of using the same
GB0323965D0 (en) * 2003-10-13 2003-11-19 Glaxosmithkline Biolog Sa Immunogenic compositions
US7968684B2 (en) * 2003-11-12 2011-06-28 Abbott Laboratories IL-18 binding proteins
US20050100965A1 (en) * 2003-11-12 2005-05-12 Tariq Ghayur IL-18 binding proteins
AU2011224023C1 (en) * 2003-11-12 2013-08-29 Abbvie Inc. IL-18 binding proteins
US20050227289A1 (en) 2004-04-09 2005-10-13 Reilly Edward B Antibodies to erythropoietin receptor and uses thereof
EP1780542A4 (en) * 2004-06-30 2008-05-14 Atsuo Sekiyama Indicator agent for noninflammatory stress response and use thereof
US7141382B1 (en) 2004-10-12 2006-11-28 Parikh Chirag R Methods for detection of IL-18 as an early marker for diagnosis of acute renal failure and predictor of mortality
PA8672101A1 (en) 2005-04-29 2006-12-07 Centocor Inc ANTI-IL-6 ANTIBODIES, COMPOSITIONS, METHODS AND USES
EP2500353A3 (en) 2005-08-19 2012-10-10 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
JP5364870B2 (en) 2005-08-19 2013-12-11 アッヴィ・インコーポレイテッド Dual variable domain immunoglobulins and uses thereof
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
CN101277974A (en) 2005-09-30 2008-10-01 阿伯特有限及两合公司 Binding domains of proteins of the Repulsive Guide Molecule (RGM) protein family, functional fragments thereof and their uses
HUE039865T2 (en) * 2005-12-20 2019-02-28 Sbi Biotech Co Ltd Anti-ILT7 antibody
TWI417301B (en) * 2006-02-21 2013-12-01 Wyeth Corp Antibodies against human il-22 and uses therefor
AU2007267213B2 (en) * 2006-05-25 2012-03-29 Glaxo Group Limited Modified humanised anti-interleukin-18 antibodies
MX353340B (en) 2006-09-13 2018-01-09 Abbvie Inc Cell culture improvements.
US8911964B2 (en) 2006-09-13 2014-12-16 Abbvie Inc. Fed-batch method of making human anti-TNF-alpha antibody
EP2500414A1 (en) 2006-09-13 2012-09-19 Abbott Laboratories Cell culture improvements
EP2115035B1 (en) 2007-01-04 2018-04-25 SK Chemicals Co., Ltd. Polyarylene sulfide resin with excellent luminosity and preparation method thereof
WO2008150431A1 (en) * 2007-05-29 2008-12-11 Yale University Il- 18 and protein kinase r inhibition for the treatment of copd
CL2008002153A1 (en) 2007-07-24 2009-06-05 Amgen Inc Isolated antibody or antigen-binding fragment thereof that binds to the yl-18 (yl-18r) receptor; encoding nucleic acid molecule; host cell comprising it; pharmaceutical composition; medical use to treat or prevent a condition associated with il-18r; In vitro method to inhibit the binding of yl-18 to yl-18r.
ES2539026T3 (en) 2007-12-27 2015-06-25 Abbott Laboratories Anti-T antibodies. cruzi and methods of use
US8962803B2 (en) 2008-02-29 2015-02-24 AbbVie Deutschland GmbH & Co. KG Antibodies against the RGM A protein and uses thereof
JP5646457B2 (en) 2008-04-29 2014-12-24 アッヴィ・インコーポレイテッド Dual variable domain immunoglobulins and uses thereof
PE20100054A1 (en) 2008-06-03 2010-03-03 Abbott Lab DUAL VARIABLE DOMAIN IMMUNOGLOBULIN
EP3002299A1 (en) 2008-06-03 2016-04-06 AbbVie Inc. Dual variable domain immunoglobulins and uses thereof
US8188235B2 (en) 2008-06-18 2012-05-29 Pfizer Inc. Antibodies to IL-6 and their uses
MX2010014574A (en) 2008-07-08 2011-04-27 Abbott Lab Prostaglandin e2 dual variable domain immunoglobulins and uses thereof.
WO2010048190A2 (en) * 2008-10-20 2010-04-29 Abbott Laboratories Antibodies that bind to il-12 and methods of purifying the same
EP2346901A1 (en) * 2008-10-20 2011-07-27 Abbott Laboratories Antibodies that bind to il-18 and methods of purifying the same
TW201024318A (en) * 2008-10-20 2010-07-01 Abbott Lab Isolation and purification of antibodies using protein A affinity chromatography
SG195577A1 (en) * 2008-10-20 2013-12-30 Abbott Lab Viral inactivation during purification of antibodies
KR101593285B1 (en) 2008-10-29 2016-02-11 아블린쓰 엔.브이. Formulations of single domain antigen binding molecules
CA2739352C (en) 2008-10-29 2021-07-13 Wyeth Llc Methods for purification of single domain antigen binding molecules
US8168165B2 (en) 2008-12-23 2012-05-01 Abbott Laboratories Alkylated interleukin-18 compositions
US8349325B2 (en) 2008-12-23 2013-01-08 Abbott Laboratories Soluble FMS-like tyrosine kinase-1 (sFLT-1) antibody and related composition, kit, methods of using, and materials and method for making
AR078254A1 (en) 2009-09-01 2011-10-26 Abbott Lab IMMUNOGLOBULINS WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME
MX2012004415A (en) 2009-10-15 2012-05-08 Abbott Lab Dual variable domain immunoglobulins and uses thereof.
UY32979A (en) 2009-10-28 2011-02-28 Abbott Lab IMMUNOGLOBULINS WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME
KR20120118002A (en) 2009-12-08 2012-10-25 애보트 게엠베하 운트 콤파니 카게 Monoclonal antibodies against the rgm a protein for use in the treatment of retinal nerve fiber layer degeneration
US20120308564A1 (en) * 2010-02-09 2012-12-06 Andrew Ian Bayliffe Treatment of a metabolic disorder
US20110229921A1 (en) 2010-03-18 2011-09-22 Abbott Laboratories METHODS OF ASSAYING URINARY NEUTROPHIL GELATINASE-ASSOCIATED LIPOCALIN (uNGAL) IN THE PROGNOSIS OF CADAVERIC KIDNEY TRANSPLANT FUNCTION IN A PATIENT, INCLUDING A PATIENT DIAGNOSED WITH DELAYED GRAFT FUNCTION (DGF), A METHOD OF ASSAYING uNGAL IN THE ASSESSMENT OF RISK OF DGF IN A PATIENT DIAGNOSED WITH EARLY GRAFT FUNCTION (EGF), AND RELATED KITS
US8735546B2 (en) 2010-08-03 2014-05-27 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
PH12013500337A1 (en) 2010-08-26 2017-08-23 Abbvie Inc Dual variable domain immunoglobulins and uses thereof
CN102443063B (en) * 2010-09-30 2013-10-23 成都康弘生物科技有限公司 Anti-TNFalpha humanized Fab, humanized antibody and its application
US20120115244A1 (en) 2010-11-09 2012-05-10 Abbott Laboratories Materials and methods for immunoassay of pterins
CA2822515C (en) * 2010-12-20 2023-04-25 Medimmune Limited Anti-il-18 antibodies and their uses
CA2822288A1 (en) * 2010-12-22 2012-06-28 Medimmune, Llc Anti-c5/c5a/c5adesr antibodies and fragments
KR101839640B1 (en) 2011-01-11 2018-03-16 제이에스알 가부시끼가이샤 Radiation-sensitive resin composition and radiation-sensitive acid generator
US9062106B2 (en) 2011-04-27 2015-06-23 Abbvie Inc. Methods for controlling the galactosylation profile of recombinantly-expressed proteins
EP2791175A2 (en) 2011-12-14 2014-10-22 Abbvie Deutschland GmbH & Co. KG Composition and method for the diagnosis and treatment of iron-related disorders
CN104144947B (en) 2011-12-14 2017-10-27 艾伯维德国有限责任两合公司 Compositions and methods for diagnosing and treating iron-related disorders
US9120870B2 (en) 2011-12-30 2015-09-01 Abbvie Inc. Dual specific binding proteins directed against IL-13 and IL-17
US8993248B2 (en) 2011-12-31 2015-03-31 Abbott Laboratories Truncated human vitamin D binding protein and mutation and fusion thereof and related materials and methods of use
EP3369746A1 (en) 2012-01-27 2018-09-05 AbbVie Deutschland GmbH & Co KG Composition and method for diagnosis and treatment of diseases associated with neurite degeneration
WO2013158273A1 (en) 2012-04-20 2013-10-24 Abbvie Inc. Methods to modulate c-terminal lysine variant distribution
US9067990B2 (en) 2013-03-14 2015-06-30 Abbvie, Inc. Protein purification using displacement chromatography
WO2013158279A1 (en) 2012-04-20 2013-10-24 Abbvie Inc. Protein purification methods to reduce acidic species
US9249182B2 (en) 2012-05-24 2016-02-02 Abbvie, Inc. Purification of antibodies using hydrophobic interaction chromatography
KR20150043523A (en) 2012-09-02 2015-04-22 애브비 인코포레이티드 Methods to control protein heterogeneity
US9512214B2 (en) 2012-09-02 2016-12-06 Abbvie, Inc. Methods to control protein heterogeneity
US9376489B2 (en) 2012-09-07 2016-06-28 Novartis Ag IL-18 binding molecules
AU2013337775B2 (en) 2012-11-01 2017-03-30 Abbvie Inc. Anti-VEGF/DLL4 dual variable domain immunoglobulins and uses thereof
ES2742413T3 (en) * 2012-11-21 2020-02-14 Km Biologics Co Ltd New human antibody against IL-18
CN105102978B (en) 2013-02-02 2018-11-02 杜克大学 Method for Isolating Circulating Tumor Cells
SG11201507230PA (en) 2013-03-12 2015-10-29 Abbvie Inc Human antibodies that bind human tnf-alpha and methods of preparing the same
WO2014151878A2 (en) 2013-03-14 2014-09-25 Abbvie Inc. Methods for modulating protein glycosylation profiles of recombinant protein therapeutics using monosaccharides and oligosacharides
US8921526B2 (en) 2013-03-14 2014-12-30 Abbvie, Inc. Mutated anti-TNFα antibodies and methods of their use
US9017687B1 (en) 2013-10-18 2015-04-28 Abbvie, Inc. Low acidic species compositions and methods for producing and using the same using displacement chromatography
US9469686B2 (en) 2013-03-15 2016-10-18 Abbott Laboratories Anti-GP73 monoclonal antibodies and methods of obtaining the same
EP2970459A2 (en) 2013-03-15 2016-01-20 AbbVie Inc. Dual specific binding proteins directed against il-1beta and il-17
WO2014197885A2 (en) 2013-06-07 2014-12-11 Duke University Inhibitors of complement factor h
WO2015031626A1 (en) 2013-08-28 2015-03-05 Abbvie Inc. Soluble cmet assay
PT3041864T (en) 2013-09-05 2021-10-26 Ab2 Bio Sa Il-18 binding protein (il-18bp) in inflammatory diseases
JP2016533318A (en) 2013-09-17 2016-10-27 ユニバーシティ ヘルス ネットワーク (ユーエイチエヌ): テクノロジー ディベロップメント アンド コマーシャリゼーション Agents targeting RGMA / neogenin cis interaction or lipid rafts and use of the agents in therapeutic methods
EP3052640A2 (en) 2013-10-04 2016-08-10 AbbVie Inc. Use of metal ions for modulation of protein glycosylation profiles of recombinant proteins
US8946395B1 (en) 2013-10-18 2015-02-03 Abbvie Inc. Purification of proteins using hydrophobic interaction chromatography
US9085618B2 (en) 2013-10-18 2015-07-21 Abbvie, Inc. Low acidic species compositions and methods for producing and using the same
US9181337B2 (en) 2013-10-18 2015-11-10 Abbvie, Inc. Modulated lysine variant species compositions and methods for producing and using the same
WO2015073884A2 (en) 2013-11-15 2015-05-21 Abbvie, Inc. Glycoengineered binding protein compositions
WO2016044736A1 (en) * 2014-09-18 2016-03-24 Cell Signaling Technology, Inc. Altered antibodies and methods of making the same
WO2016061632A1 (en) * 2014-10-23 2016-04-28 La Trobe University Fn14-binding proteins and uses thereof
US10093733B2 (en) 2014-12-11 2018-10-09 Abbvie Inc. LRP-8 binding dual variable domain immunoglobulin proteins
UA128752C2 (en) 2015-03-05 2024-10-16 Аб2 Біо Са Il-18 binding protein (il-18bp) and antibodies in inflammatory diseases
RU2719033C2 (en) 2015-04-23 2020-04-16 Нантомикс, Ллс Method of producing a pharmaceutical agent for cancer immunotherapy
TW201710286A (en) 2015-06-15 2017-03-16 艾伯維有限公司 Binding proteins against VEGF, PDGF, and/or their receptors
BR112018004867A2 (en) 2015-09-11 2018-10-16 Abbvie Deutschland Methods for Treatment of Recurrent Forms of Multiple Sclerosis
WO2017087768A1 (en) 2015-11-18 2017-05-26 Duke University Targeted delivery of interleukin-10 to tumor infiltrating lymphocytes
JP6979976B2 (en) 2016-03-10 2021-12-15 ヴィエラ バイオ,インコーポレーテッド ILT7 binding molecule and its usage
JP2019517480A (en) 2016-06-01 2019-06-24 アッヴィ・インコーポレイテッド Anti-RGMa (Repulsive Guidance Molecule A) antagonist antibody for treating spinal cord injury and pain
WO2017218911A1 (en) 2016-06-17 2017-12-21 Abbott Laboratories BIOMARKERS TO PREDICT NEW ONSET HEART FAILURE WITH PRESERVED EJECTION FRACTION (HFpEF)
EP3279667A1 (en) 2016-08-02 2018-02-07 Abbott Laboratories Cardiac troponin i and copeptin as biomarkers for short-term mortality in acute exacerbation of chronic obstructive pulmonary disease (aecopd)
EP4521116A3 (en) 2016-10-03 2025-05-28 Abbott Laboratories Improved methods of assessing uch-l1 status in patient samples
US10324041B2 (en) 2016-12-21 2019-06-18 Abbott Japan Co., Ltd. Optical imaging system using lateral illumination for digital assays
US11047854B2 (en) 2017-02-06 2021-06-29 Abbott Japan Llc Methods for reducing noise in signal-generating digital assays
JP2020506405A (en) 2017-02-08 2020-02-27 シルバイオテック・インコーポレイテッド How to determine breast cancer risk
CA3261113A1 (en) 2017-03-23 2025-10-27 Abbott Laboratories Methods for aiding in the diagnosis and determination of the extent of traumatic brain injury in a human subject using the early biomarker ubiquitin carboxy-terminal hydrolase l1
CN110546513A (en) 2017-04-15 2019-12-06 雅培实验室 Methods for using early biomarkers to aid in hyperacute diagnosis and determination of traumatic brain injury in human subjects
ES3053676T3 (en) 2017-04-28 2026-01-23 Abbott Lab Methods for aiding in the hyperacute diagnosis and determination of traumatic brain injury using early biomarkers on at least two samples from the same human subject
US10865238B1 (en) 2017-05-05 2020-12-15 Duke University Complement factor H antibodies
AU2018272054B2 (en) 2017-05-25 2024-10-31 Abbott Laboratories Methods for aiding in the determination of whether to perform imaging on a human subject who has sustained or may have sustained an injury to the head using early biomarkers
JP7269182B2 (en) 2017-05-30 2023-05-08 アボット・ラボラトリーズ Methods for aiding in the diagnosis and assessment of mild traumatic brain injury in human subjects using cardiac troponin I and early biomarkers
CA3068041C (en) 2017-07-03 2024-06-25 Abbott Laboratories Improved methods for measuring ubiquitin carboxy-terminal hydrolase l1 levels in blood
US11426389B2 (en) 2017-07-28 2022-08-30 Duke University Compositions and methods for promoting hematopoietic stem cell regeneration
US11022617B2 (en) 2017-12-09 2021-06-01 Abbott Laboratories Methods for aiding in the diagnosis and evaluation of a subject who has sustained an orthopedic injury and that has or may have sustained an injury to the head, such as mild traumatic brain injury (TBI), using glial fibrillary acidic protein (GFAP) and/or ubiquitin carboxy-terminal hydrolase L1 (UCH-L1)
EP3721234A1 (en) 2017-12-09 2020-10-14 Abbott Laboratories Methods for aiding in diagnosing and evaluating a traumatic brain injury in a human subject using a combination of gfap and uch-l1
AU2018395255B2 (en) 2017-12-29 2025-02-20 Abbott Laboratories Novel biomarkers and methods for diagnosing and evaluating traumatic brain injury
JPWO2019194217A1 (en) * 2018-04-04 2021-04-15 株式会社mAbProtein Antibodies to highly sensitive interleukin-18 protein and its applications
GB201809699D0 (en) * 2018-06-13 2018-08-01 Singapore Health Serv Pte Ltd IL-11 antibodies
US12269874B2 (en) 2018-12-03 2025-04-08 mAbProtein Co., Ltd. Antibody that recognizes neoepitope of activated interleukin-18 proteins and application thereof
WO2020132536A1 (en) 2018-12-20 2020-06-25 The University Of Chicago Compositions and methods related to site-specific identification of rna modifications
US11079395B2 (en) 2019-03-01 2021-08-03 Abbott Laboratories Methods for predicting major adverse cardiovascular events in subjects with coronary artery disease
KR102265432B1 (en) * 2019-08-20 2021-06-15 주식회사 케어젠 Peptide having activities of skin whitening and uses thereof
WO2021211331A1 (en) 2020-04-13 2021-10-21 Abbott Point Of Care Inc. METHODS, COMPLEXES AND KITS FOR DETECTING OR DETERMINING AN AMOUNT OF A ß-CORONAVIRUS ANTIBODY IN A SAMPLE
KR20230012539A (en) 2020-05-13 2023-01-26 디스크 메디슨, 인크. Anti-hemojuvelin (HJV) antibodies to treat myelofibrosis
EP4193149A1 (en) 2020-08-04 2023-06-14 Abbott Laboratories Improved methods and kits for detecting sars-cov-2 protein in a sample
EP4193151A1 (en) 2020-08-04 2023-06-14 Abbott Rapid Diagnostics International Unlimited Company Assays for detecting sars-cov-2
CN114773466B (en) * 2020-11-26 2023-08-29 江苏荃信生物医药股份有限公司 Anti-human interleukin 23, kit containing same and detection method thereof
WO2023102384A1 (en) 2021-11-30 2023-06-08 Abbott Laboratories Use of one or more biomarkers to determine traumatic brain injury (tbi) in a subject having received a head computerized tomography scan that is negative for a tbi
CA3198161A1 (en) 2020-12-01 2022-06-09 Beth MCQUISTON Use of one or more biomarkers to determine traumatic brain injury (tbi) in a subject having received a head computerized tomography scan that is negative for a tbi
WO2022147178A1 (en) 2020-12-30 2022-07-07 Abbott Laboratories Improved methods, reagents and kits for detergent-based inactivation of betacoronavirus prior to and/or while assessing a biological sample for sars-cov-2 antigen or antibody
EP4271998A1 (en) 2020-12-30 2023-11-08 Abbott Laboratories Methods for determining sars-cov-2 antigen and anti-sars-cov-2 antibody in a sample
CA3214962A1 (en) * 2021-03-26 2022-09-29 The General Hospital Corporation Humanized mab107
EP4067375A1 (en) * 2021-03-30 2022-10-05 Universität Ulm Fibril peptides
US20220381796A1 (en) 2021-05-18 2022-12-01 Abbott Laboratories Methods of evaluating brain injury in a pediatric subject
EP4356129A1 (en) 2021-06-14 2024-04-24 Abbott Laboratories Methods of diagnosing or aiding in diagnosis of brain injury caused by acoustic energy, electromagnetic energy, an over pressurization wave, and/or blast wind
EP4371573A4 (en) 2021-07-13 2025-08-20 National Univ Corporation Tokai National Higher Education And Research System MEDICAL COMPOSITION FOR THE TREATMENT OF INFLAMMATORY BOWEL DISEASE
EP4392783A1 (en) 2021-08-27 2024-07-03 Abbott Laboratories Methods for detecting immunoglobulin g, subclass 4 (igg4) in a biological sample
CN118715440A (en) 2021-08-31 2024-09-27 雅培实验室 Method and system for diagnosing brain injury
EP4396587A1 (en) 2021-08-31 2024-07-10 Abbott Laboratories Methods and systems of diagnosing brain injury
EP4409294A1 (en) 2021-09-30 2024-08-07 Abbott Laboratories Methods and systems of diagnosing brain injury
WO2023114978A1 (en) 2021-12-17 2023-06-22 Abbott Laboratories Systems and methods for determining uch-l1, gfap, and other biomarkers in blood samples
EP4473311A1 (en) 2022-02-04 2024-12-11 Abbott Laboratories Lateral flow methods, assays, and devices for detecting the presence or measuring the amount of ubiquitin carboxy-terminal hydrolase l1 and/or glial fibrillary acidic protein in a sample
AU2023226005A1 (en) * 2022-02-23 2024-08-29 Bright Peak Therapeutics Ag Activatable il-18 polypeptides
CA3257731A1 (en) 2022-06-29 2024-01-04 Abbott Laboratories Magnetic point-of-care systems and assays for determining gfap in biological samples
JP2025532597A (en) 2022-09-15 2025-10-01 アボット・ラボラトリーズ Biomarkers and methods for distinguishing between mild and very mild traumatic brain injury
WO2024102383A1 (en) 2022-11-10 2024-05-16 Abbott Laboratories Methods of identifying macrotroponin in biological samples
WO2024211475A1 (en) 2023-04-04 2024-10-10 Abbott Laboratories Use of biomarkers to determine whether a subject has sustained, may have sustained or is suspected of sustaining a subacute acquired brain injury (abi)
KR20260003222A (en) 2023-04-28 2026-01-06 아보트 러보러터리즈 Diagnosis of terminal hepatocellular carcinoma
EP4713682A1 (en) 2023-04-28 2026-03-25 Abbott Point of Care Inc. Improved assays, cartridges, and kits for detection of biomarkers, including brain injury biomarkers
WO2024243819A1 (en) * 2023-05-30 2024-12-05 上海洛启生物医药技术有限公司 Anti-interleukin-18 receptor nanobody and use thereof
CN120518762B (en) * 2023-06-05 2025-12-26 北京东方百泰生物科技股份有限公司 Antibody for binding IL-11, antigen binding fragment and application thereof
CN121586728A (en) 2023-06-20 2026-02-27 阿波罗Ap43有限公司 Anti-IL-18 antibody therapy for the treatment of atopic dermatitis
WO2025081059A1 (en) * 2023-10-13 2025-04-17 The Regents Of The University Of Michigan Carriers for drug conjugates
WO2025111147A1 (en) 2023-11-21 2025-05-30 Abbott Laboratories Two-dimensional matrix droplet array
WO2025111148A1 (en) 2023-11-21 2025-05-30 Abbott Laboratories Sample analysis device and methods
WO2025145020A2 (en) 2023-12-28 2025-07-03 Abbott Laboratories Methods, systems, compounds, and kits for determining an analyte of interest in a test sample
WO2025193825A1 (en) 2024-03-13 2025-09-18 Abbott Laboratories Diagnosis and monitoring of liver disease
WO2025191541A1 (en) 2024-03-15 2025-09-18 Tocris Cookson Limited Horseradish peroxidase copolymers, conjugates, and uses thereof
WO2025198859A1 (en) 2024-03-21 2025-09-25 Abbott Laboratories Synthesis of thyroid hormone derivatives and their role as calibrators for thyroid hormone immunoassays
WO2025230857A1 (en) 2024-05-01 2025-11-06 Abbott Laboratories Improved methods for determining cardiac myosin binding protein c in biological samples

Family Cites Families (113)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5019385A (en) * 1984-11-09 1991-05-28 Kabushiki Kaisha Hayashibara Seibutsu Kagaku Kenkyujo Novel lymphopine LK 2 and pharmaceutic compositions containing same
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US5530101A (en) * 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5060283A (en) 1989-04-20 1991-10-22 Fuji Photo Film Co. , Ltd. Method and system for reading images with a movable light intercepting plate
ES2284161T3 (en) 1990-01-12 2007-11-01 Amgen Fremont Inc. GENERATION OF XENOGENIC ANTIBODIES.
US6075181A (en) * 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5427908A (en) 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
GB9015198D0 (en) 1990-07-10 1990-08-29 Brien Caroline J O Binding substance
CA2109602C (en) 1990-07-10 2002-10-01 Gregory P. Winter Methods for producing members of specific binding pairs
CA2090126C (en) 1990-08-02 2002-10-22 John W. Schrader Methods for the production of proteins with a desired function
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5789650A (en) 1990-08-29 1998-08-04 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
DE69133557D1 (en) 1990-08-29 2007-03-15 Pharming Intellectual Pty Bv HOMOLOGOUS RECOMBINATION IN MAMMALIAN CELLS
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
ES2113940T3 (en) 1990-12-03 1998-05-16 Genentech Inc ENRICHMENT METHOD FOR PROTEIN VARIANTS WITH ALTERED UNION PROPERTIES.
DE69233769D1 (en) 1991-03-01 2009-09-24 Dyax Corp Chimeric protein with microprotein having two or more disulfide bonds and embodiments thereof
AU662148B2 (en) 1991-04-10 1995-08-24 Scripps Research Institute, The Heterodimeric receptor libraries using phagemids
DE4122599C2 (en) 1991-07-08 1993-11-11 Deutsches Krebsforsch Phagemid for screening antibodies
WO1993004169A1 (en) 1991-08-20 1993-03-04 Genpharm International, Inc. Gene targeting in animal cells using isogenic dna constructs
ES2301158T3 (en) 1992-07-24 2008-06-16 Amgen Fremont Inc. XENOGENIC ANTIBODY PRODUCTION.
US5625825A (en) 1993-10-21 1997-04-29 Lsi Logic Corporation Random number generating apparatus for an interface unit of a carrier sense with multiple access and collision detect (CSMA/CD) ethernet data network
DE69519454T2 (en) 1994-07-14 2001-05-03 Kabushiki Kaisha Hayashibara Seibutsu Kagaku Kenkyujo, Okayama Protein that induces interferon gamma production and monoclonal antibodies against it
US6309636B1 (en) 1995-09-14 2001-10-30 Cancer Research Institute Of Contra Costa Recombinant peptides derived from the Mc3 anti-BA46 antibody, methods of use thereof, and methods of humanizing antibody peptides
JPH08101497A (en) 1994-09-30 1996-04-16 Shin Etsu Chem Co Ltd Pellicle
US5643763A (en) 1994-11-04 1997-07-01 Genpharm International, Inc. Method for making recombinant yeast artificial chromosomes by minimizing diploid doubling during mating
US7135458B1 (en) * 1995-11-15 2006-11-14 Kabushiki Kaisha Hayashibara Seibutsu Kagaku Kenkyujo Interferon-γ inducing polypeptide, pharmaceutical composition thereof, monoclonal antibody thereto, and methods of use
TW581771B (en) 1994-11-15 2004-04-01 Hayashibara Biochem Lab Recombinant production of a polypeptide for inducing interferon-gamma production, and monoclonal antibody against the polypeptide
US6207641B1 (en) * 1995-03-10 2001-03-27 Kabushiki Kaisha Hayashibara Seibutsu Kagaku Kenkyujo Pharmaceutical composition containing IFN-γ inducing polypeptide or factor for treating and/or preventing IFN-γ susceptive diseases
JP4004088B2 (en) * 1995-09-26 2007-11-07 株式会社林原生物化学研究所 Protein that induces production of interferon-γ in immunocompetent cells
JP2724987B2 (en) * 1994-11-15 1998-03-09 株式会社林原生物化学研究所 Polypeptide that induces interferon-γ production
JP2952750B2 (en) * 1995-02-23 1999-09-27 株式会社林原生物化学研究所 Monoclonal antibody
US6130364A (en) 1995-03-29 2000-10-10 Abgenix, Inc. Production of antibodies using Cre-mediated site-specific recombination
US6091001A (en) 1995-03-29 2000-07-18 Abgenix, Inc. Production of antibodies using Cre-mediated site-specific recombination
AU705616B2 (en) 1995-04-21 1999-05-27 Cell Genesys, Inc. Generation of large genomic DNA deletions
EP0822830B1 (en) 1995-04-27 2008-04-02 Amgen Fremont Inc. Human anti-IL-8 antibodies, derived from immunized xenomice
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1997002479A2 (en) * 1995-06-30 1997-01-23 Yale University Human monoclonal anti-tumor antibodies
US6127977A (en) 1996-11-08 2000-10-03 Cohen; Nathan Microstrip patch antenna with fractal structure
CA2230759C (en) * 1995-08-29 2012-02-21 Kirin Beer Kabushiki Kaisha Chimeric animal and method for producing the same
CA2238885A1 (en) 1995-12-29 1997-07-10 Incyte Pharmaceuticals, Inc. Nucleic acids encoding interferon gamma inducing factor-2
HU230048B1 (en) 1996-02-09 2015-06-29 Abbvie Biotechnology Ltd Use of human tnf-alpha binding antibodies
US5714352A (en) 1996-03-20 1998-02-03 Xenotech Incorporated Directed switch-mediated DNA recombination
US5994619A (en) 1996-04-01 1999-11-30 University Of Massachusetts, A Public Institution Of Higher Education Of The Commonwealth Of Massachusetts, As Represented By Its Amherst Campus Production of chimeric bovine or porcine animals using cultured inner cell mass cells
US5834597A (en) 1996-05-20 1998-11-10 Protein Design Labs, Inc. Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same
CA2255906A1 (en) 1996-05-20 1997-11-27 Schering Corporation Human interleukin-1j and antagonists thereof
US6790442B1 (en) * 1996-06-27 2004-09-14 Kabushiki Kaisha Hayashibara Seibutsu Kagaku Kenkyujo Genomic DNA encoding a polypeptide capable of inducing the production of interferon-γ
US6060283A (en) * 1996-06-27 2000-05-09 Kabushiki Kaisha Hayashibara Seibutsu Kagaku Kenkyujo Genomic DNA encoding human interleukin-18 (IL-18, interferon-γ inducing factor)
TW515843B (en) * 1996-07-25 2003-01-01 Hayashibara Biochem Lab Process for producing an active polypeptide inducing interferon-γ production
US5916771A (en) 1996-10-11 1999-06-29 Abgenix, Inc. Production of a multimeric protein by cell fusion method
JP4024366B2 (en) * 1996-11-29 2007-12-19 株式会社林原生物化学研究所 Polypeptide
ATE549918T1 (en) 1996-12-03 2012-04-15 Amgen Fremont Inc HUMAN ANTIBODIES THAT EXPRESSLY BIND HUMAN TNF ALPHA
US7141393B2 (en) 1996-12-26 2006-11-28 Kabushiki Kaisha Hayashibara Seibutsu Kagaku Kenkyujo Interleukin-18-receptor proteins
US6087116A (en) * 1997-03-12 2000-07-11 Kabushiki Kaisha Hayashibara Seibutsu Kagaku Kenkyujo Interleukin-18 (IL-18) receptor polypeptides and their uses
WO1998041232A2 (en) 1997-03-18 1998-09-24 Basf Aktiengesellschaft Compositions for modulating responsiveness to corticosteroids
US6054487A (en) 1997-03-18 2000-04-25 Basf Aktiengesellschaft Methods and compositions for modulating responsiveness to corticosteroids
US6235883B1 (en) 1997-05-05 2001-05-22 Abgenix, Inc. Human monoclonal antibodies to epidermal growth factor receptor
IL121860A0 (en) * 1997-08-14 1998-02-22 Yeda Res & Dev Interleukin-18 binding proteins their preparation and use
US7220717B2 (en) * 1997-08-14 2007-05-22 Yeda Research And Development Company Ltd. Interleukin-18 binding proteins, their preparation and use
WO1999022760A1 (en) 1997-11-03 1999-05-14 The Wistar Institute Of Anatomy And Biology Method and compositions for inhibiting angiogenesis and treating cancer
US6541606B2 (en) * 1997-12-31 2003-04-01 Altus Biologics Inc. Stabilized protein crystals formulations containing them and methods of making them
ATE272114T1 (en) * 1998-01-23 2004-08-15 Immunex Corp RECEPTORS FOR IL-18
AU750767B2 (en) 1998-01-23 2002-07-25 Immunex Corporation ACPL DNA and polypeptides
AU2978899A (en) 1998-03-03 1999-09-20 Abgenix, Inc. Cd147 binding molecules as therapeutics
US20020029391A1 (en) 1998-04-15 2002-03-07 Claude Geoffrey Davis Epitope-driven human antibody production and gene expression profiling
AU757698C (en) * 1998-06-01 2004-04-08 Agensys, Inc. Novel serpentine transmembrane antigens expressed in human cancers and uses thereof
CA2276216A1 (en) * 1998-06-24 1999-12-24 Kabushiki Kaisha Hayashibara Seibutsu Kagaku Kenkyujo An artificial peptide capable of neutralizing the biological activity of interleukin-18
EP1105427A2 (en) 1998-08-17 2001-06-13 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
CA2340579A1 (en) 1998-09-01 2000-03-09 Kabushiki Kaisha Hayashibara Seibutsu Kagaku Kenkyujo Interleukin 18-binding protein
US6270758B1 (en) * 1998-10-08 2001-08-07 Duke University Substantially non-toxic biologically active mucosal adjuvants in vertebrate subjects
HRP20130077A2 (en) 1998-12-23 2013-07-31 Pfizer Inc. HUMAN MONOCLONAL ANTIBODIES FOR CTLA-4
AR022952A1 (en) * 1999-03-19 2002-09-04 Smithkline Beecham Corp MONOCLONAL ANTIBODY OF ROEDOR SPECIFICALLY NEUTRALIZING FOR HUMAN INTERLEUQUINE-18, A FAB NEUTRALIZING FRAGMENT OR FRAGMENT F (AB ') 2, A COMPLEMENTARITY REGION OF IMMONOGLOBULIN LIGHT CHAIN (CDR), WHICH MAKES IT COMPRESSED , THE
EP2168984B1 (en) 1999-03-25 2012-08-29 Abbott GmbH & Co. KG Human antibodies that bind human IL-12 and methods for producing
US6946129B1 (en) 1999-06-08 2005-09-20 Seattle Genetics, Inc. Recombinant anti-CD40 antibody and uses thereof
IL131047A0 (en) 1999-07-22 2001-01-28 Yeda Res & Dev Use of il-18 inhibitors
PL356836A1 (en) 2000-02-10 2004-07-12 Abbott Laboratories Antibodies that bind human interleukin-18 and methods of making and using
NZ535299A (en) * 2000-02-21 2006-06-30 Applied Research Systems Use of IL-18 inhibitors
DE10019967A1 (en) * 2000-04-20 2001-10-25 Fenning Biomed Gmbh Dr New recombinant antibody specific for native gp96, useful for isolating gp96 as complex with endogenous peptides, used for autologous immunotherapy of e.g. tumor
AU5943201A (en) 2000-05-03 2001-11-12 Amgen Inc Modified peptides as therapeutic agents
CZ300792B6 (en) * 2000-05-05 2009-08-12 Applied Research Systems Ars Holding N. V. Pharmaceutical composition
PE20011350A1 (en) * 2000-05-19 2002-01-15 Vertex Pharma PROPHARMAC OF AN INHIBITOR OF INTERLEUKIN-1ß CONVERTER ENZYME (ICE)
PL366134A1 (en) * 2000-06-15 2005-01-24 Smithkline Beecham Corporation Method for preparing a physiologically active il-18 polypeptide
AU2002224417A1 (en) * 2000-10-18 2002-04-29 Immunex Corporation Methods for treating il-18 mediated disorders
KR20100031769A (en) * 2000-12-28 2010-03-24 알투스 파마슈티컬스 인코포레이티드 Crystals of whole antibodies and fragments thereof and methods for making and using them
KR100857376B1 (en) 2001-01-29 2008-09-05 라보라토리스 세로노 에스.에이. IL-18 inhibitors used to treat and / or prevent heart disease
ES2372030T3 (en) * 2001-07-12 2012-01-13 Taiho Pharmaceutical Co., Ltd. TRANSGENIC ANIMAL IL-18.
SI1487541T1 (en) * 2002-03-22 2009-02-28 Serono Lab Use of il-18 inhibitors for the treatment and/or prevention of peripheral vascular diseases
US7253260B2 (en) * 2002-04-17 2007-08-07 Smithkline Beecham Corporation Human IL-18 crystal structure
US20060177871A1 (en) * 2002-08-13 2006-08-10 Janson Cheryl A Murine IL-18 crystal structure
US7279155B2 (en) * 2002-10-08 2007-10-09 Ares Trading S.A. Method of treatment using a cytokine able to bind IL-18BP to inhibit the activity of a second cytokine
EP1685282A2 (en) * 2003-04-17 2006-08-02 Fluidigm Corporation Crystal growth devices and systems, and methods for using same
CA2523912A1 (en) * 2003-04-30 2004-11-11 Japan Science And Technology Agency Human antihuman interleukin-18 antibody, fragment thereof and method of using the same
DK1622939T3 (en) * 2003-05-13 2012-04-10 Merck Serono Sa Active variants of the IL-18 binding protein and medical applications thereof
JP2007528721A (en) * 2003-08-14 2007-10-18 ダイアックス コーポレイション Endotheliase-2 ligand
GB0323965D0 (en) * 2003-10-13 2003-11-19 Glaxosmithkline Biolog Sa Immunogenic compositions
US7968684B2 (en) * 2003-11-12 2011-06-28 Abbott Laboratories IL-18 binding proteins
DE602005002829T2 (en) * 2004-03-01 2008-07-10 Ares Trading S.A. USE OF A SERUM-FREE CELL CULTURE MEDIUM FOR THE PRODUCTION OF IL-18BP IN MAMMALIAN CELLS
US20080090766A1 (en) * 2004-03-11 2008-04-17 Tomoaki Hoshino Preventive or therapeutic agents for diseases including interleukin-18 inhibitor as an active ingredient
WO2005097998A2 (en) * 2004-03-31 2005-10-20 Regeneron Pharmaceuticals, Inc. Il-18 specific polypeptides and therapeutic uses thereof
FI116804B (en) * 2004-05-18 2006-02-28 Ekspansio Engineering Ltd Oy Optical examination of the surfaces of the material pieces open in different directions
AU2005259269B2 (en) * 2004-06-29 2010-12-09 Ares Trading S.A. Process for the purification of IL-18 binding protein
EP1808446B1 (en) * 2004-07-16 2012-01-18 Atsuo Sekiyama Il-18 receptor antagonist and pharmaceutical composition containing the antagonist
PL1793859T3 (en) * 2004-08-20 2009-08-31 Smithkline Beecham Corp Treatment of oral and intestinal mucositis by administering human il-18
ES2385639T3 (en) * 2005-06-03 2012-07-27 Ares Trading S.A. Production of a recombinant IL-18 binding protein
US7612181B2 (en) * 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
US7615220B2 (en) * 2006-04-07 2009-11-10 Regeneron Pharmaceuticals, Inc. High affinity human antibodies to human IL-18 receptor
AR065803A1 (en) * 2007-03-23 2009-07-01 Smithkline Beecham Corp USE OF A HUMAN IL-18 POLYPEPTIDE AND AN ANTI-CD ANTIBODY TO PREPARE A MEDICINE

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018162724A1 (en) 2017-03-09 2018-09-13 Mab Discovery Gmbh Antibodies specifically binding to human il-1r7
EP4623992A2 (en) 2017-03-09 2025-10-01 MAB Discovery GmbH Antibodies specifically binding to human il-1r7
WO2025229563A1 (en) * 2024-05-03 2025-11-06 Glaxosmithkline Intellectual Property Development Limited Methods of treating inflammatory bowel disease

Also Published As

Publication number Publication date
AU2006252098B2 (en) 2011-02-24
HUP0300423A2 (en) 2003-06-28
BR0108188A (en) 2003-02-25
CN102206277A (en) 2011-10-05
CN1461310A (en) 2003-12-10
KR20110032012A (en) 2011-03-29
KR20090078372A (en) 2009-07-17
KR101111103B1 (en) 2012-02-13
TWI373343B (en) 2012-10-01
US20110008357A1 (en) 2011-01-13
EP2332579A3 (en) 2011-09-21
EP2360184A3 (en) 2011-11-16
MY146017A (en) 2012-06-15
AU2011201536B2 (en) 2013-07-04
AU2011201536A1 (en) 2011-04-28
AR027404A1 (en) 2003-03-26
TWI335336B (en) 2011-01-01
EP2338515A2 (en) 2011-06-29
CA2399148A1 (en) 2001-08-16
IL151044A0 (en) 2003-04-10
KR20120011898A (en) 2012-02-08
TW201305214A (en) 2013-02-01
HUP0300423A3 (en) 2008-07-28
IL206980A0 (en) 2010-12-30
CL2012001063A1 (en) 2013-06-21
AR077568A2 (en) 2011-09-07
TW201036638A (en) 2010-10-16
PL356836A1 (en) 2004-07-12
US20100104563A1 (en) 2010-04-29
CA2800450A1 (en) 2001-08-16
NO20023788L (en) 2002-10-09
US7767207B2 (en) 2010-08-03
AU2001236807A1 (en) 2001-08-20
BG111004A (en) 2011-11-30
NO20023788D0 (en) 2002-08-09
JP2012139224A (en) 2012-07-26
AU2006252098A1 (en) 2007-01-11
KR20030021153A (en) 2003-03-12
EP1257585A2 (en) 2002-11-20
WO2001058956A2 (en) 2001-08-16
BG107045A (en) 2003-05-30
MXPA02007756A (en) 2004-09-10
EP2338515A3 (en) 2011-11-16
CN102504024A (en) 2012-06-20
CN1461310B (en) 2013-06-12
KR100951067B1 (en) 2010-04-07
NZ520392A (en) 2005-04-29
SK12942002A3 (en) 2003-05-02
JP2004500086A (en) 2004-01-08
WO2001058956A3 (en) 2002-03-07
AU2006252098B9 (en) 2011-04-14
ZA200206266B (en) 2003-11-06
EP2332579A2 (en) 2011-06-15
EP2360184A2 (en) 2011-08-24

Similar Documents

Publication Publication Date Title
US7767207B2 (en) Antibodies that bind IL-18 and methods of inhibiting IL-18 activity
JP4841038B2 (en) Human antibody binding to human IL-12 and method for producing the same
US8475766B2 (en) Dual specificity antibodies and methods of making and using
AU2007202323A1 (en) Dual specificity antibodies and methods of making and using
HK1159658A (en) Antibodies that bind human interleukin-18 and methods of making and using
HK1158663A (en) Antibodies that bind human interleukin-18 and methods of making and using
HK1158084A (en) Antibodies that bind human interleukin-18 and methods of making and using
AU2013224707A1 (en) Antibodies that bind human interleukin-18 and methods of making and using

Legal Events

Date Code Title Description
STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION

AS Assignment

Owner name: ABBVIE INC., ILLINOIS

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:ABBOTT LABORATORIES;REEL/FRAME:034268/0986

Effective date: 20130531