Connect public, paid and private patent data with Google Patents Public Datasets

Biomarkers associated with nephropathy

Download PDF


Publication number
US20100209948A1 US12694639 US69463910A US20100209948A1 US 20100209948 A1 US20100209948 A1 US 20100209948A1 US 12694639 US12694639 US 12694639 US 69463910 A US69463910 A US 69463910A US 20100209948 A1 US20100209948 A1 US 20100209948A1
Grant status
Patent type
Prior art keywords
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Application number
Mary Ya-Ping Yeh
Tzu-Ling Tseng
Ching-Fang Lu
Wei-Ya Lin
Tsai-Wei Hsu
Yi-Ting Chen
Chwei-Shiun Yang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Industrial Technology Research Institute
Original Assignee
Industrial Technology Research Institute
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date




    • G01N33/00Investigating or analysing materials by specific methods not covered by the preceding groups
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/46Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
    • G01N2333/47Assays involving proteins of known structure or function as defined in the subgroups
    • G01N2333/4701G01N2333/4701
    • G01N2333/4728G01N2333/4701 alpha-Glycoproteins
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70503Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/34Genitourinary disorders
    • G01N2800/347Renal failures; Glomerular diseases; Tubulointerstitial diseases, e.g. nephritic syndrome, glomerulonephritis; Renovascular diseases, e.g. renal artery occlusion, nephropathy
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/52Predicting or monitoring the response to treatment; Prognosis
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/56Staging of a disease; Further complications associated with the disease


Use of urine biomarkers for diagnosing nephropathy, monitoring nephropathy progress, and assessing efficacy of a nephropathy treatment. These urine biomarkers include leukocyte-associated Ig-like receptor-2, alpha-1 acid glycoprotein, their fragments, and combinations thereof.


  • [0001]
    This application claims priority to U.S. Provisional Application No. 61/147,785, filed on Jan. 28, 2009, the content of which is hereby incorporated by reference in its entirety.
  • [0002]
    Nephropathy, commonly known as kidney damage, is caused by, among others, diabetes, high blood pressure, drug toxicity, and inflammation.
  • [0003]
    Typically, nephropathy is diagnosed by determining the level of proteinuria (e.g., the level of urine albumin), or by examining the glomerular filtration rate (GFR), an indicator of renal function. Both approaches are not suitable for detecting early stage nephropathy, which typically displays no symptoms. While nephropathy can also be detected by renal biopsy, this invasive procedure is not an ideal diagnostic approach.
  • [0004]
    It is of great importance to develop a method for detecting early stage nephropathy. The key to achieving this goal is to identify reliable biomarkers associated with incipient nephropathy.
  • [0005]
    The present invention is based on unexpected discoveries that the urine levels of leukocyte-associated Ig-like receptor-2, alpha-1 acid glycoprotein, and fragments of these two proteins are significantly higher in a nephropathy patient than in a nephropathy-free patient. These protein molecules are therefore reliable biomarkers for diagnosis of early stage nephropathy.
  • [0006]
    Accordingly, one aspect of this invention features a nephropathy diagnostic method. This method includes at least the following steps: (a) obtaining a urine sample from a subject suspected of having nephropathy, (b) determining in the urine sample a level of a biomarker, and (c) assessing whether the subject has nephropathy based on the level of the biomarker. The biomarker used in the just-described method is one of the following: (i) leukocyte-associated Ig-like receptor-2 or a fragment thereof having at least ten amino acid residues, such as DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1), (ii) a fragment of alpha-1 acid glycoprotein having at least ten amino acid residues, such as GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2), (iii) a combination of (i) and (ii), or (iv) a combination of (i) and alpha-1 acid glycoprotein.
  • [0007]
    An increase in the level of one of the four biomarkers, as compared to that in a nephropathy-free subject, indicates that the subject has nephropathy. In one example, the biomarker level is determined by a mass spectrometry assay (e.g., MALDI-MS, LC-MS, and LC-MS/MS). In another example, it is determined by an immune assay (e.g., ELISA, Westernblot, RIA, FIA and LIA).
  • [0008]
    The above-described nephropathy diagnostic method is applicable to both humans and laboratory animals, e.g., those free of proteinuria. The term “a laboratory animal” used herein refers to a vertebrate animal commonly used in animal testing, e.g., mouse, rat, rabbit, cat, dog, pig, and non-human primate.
  • [0009]
    Another aspect of this invention features a method for monitoring nephropathy progress in a subject. This method includes (a) obtaining a first urine sample from a subject suffering from nephropathy (e.g., a human or a laboratory animal), (b) determining in the first urine sample a level of one of the four biomarkers listed above, (c) obtaining a second urine sample from the subject 2 weeks to 12 months after the first urine sample is obtained, (d) determining in the second urine sample a level of the biomarker, and (e) assessing nephropathy progress in the subject. An increase in the level of the biomarker in the second urine sample, as compared to that in the first urine sample, indicates that nephropathy is exacerbated in the subject. When the subject is a human in early stage nephropathy, the second urine sample is obtained 6 to 12 months after the first urine sample is obtained. For a human subject in late stage nephropathy, the second urine sample can be obtained 3 to 6 months later than the first urine sample. When this method is applied to a laboratory animal, the second urine sample can be obtained 2 to 24 weeks after the first urine sample is obtained.
  • [0010]
    In still another aspect, the present invention provides a method for monitoring efficacy of a nephropathy treatment in a nephropathy patient, including (a) determining a level of one of the biomarkers listed above in a urine sample from the nephropathy patient before the treatment, (b) determining a level of the biomarker in a urine sample from the patient after the treatment, and (c) assessing efficacy of the treatment based on a change in the level of the biomarker after the treatment. The treatment is found to be effective when the post-treatment biomarker level remains the same or decreases as compared with the pre-treatment biomarker level.
  • [0011]
    This invention also provides a method of assessing renal toxicity of an agent, including (a) obtaining a plurality of urine samples from a subject treated with an agent at various time points during treatment, (b) determining in each of the urine samples a level of one of the above-described biomarkers, and (c) assessing renal toxicity of the agent based on a change in the level of the biomarker during the treatment. An increase in the biomarker level in the course of the treatment indicates that the agent is renal toxic. The agent can be a compound (e.g., a drug or a drug candidate), an herb product, and a food product
  • [0012]
    This invention further provides a kit useful in any of the methods described above. This kit contains a first antibody specifically binding to leukocyte-associated Ig-like receptor-2 and a second antibody specifically binding to alpha-1 acid glycoprotein. Both antibodies can be whole immunoglobulin molecules. In one example, this kit contains only antibodies specific to antigens to be detected (e.g., biomarkers associated with nephropathy) for practicing one of the methods disclosed herein. Namely, it consists essentially of such antibodies.
  • [0013]
    Also within the scope of this invention is an isolated antibody specifically binding to DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1), or GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2). The term “isolated antibody” used herein refers to an antibody substantially free from naturally associated molecules. More specifically, a preparation containing the antibody is deemed as “an isolated antibody” when the naturally associated molecules in the preparation constitute at most 20% by dry weight. Purity can be measured by any appropriate method, e.g., column chromatography, polyacrylamide gel electrophoresis, and HPLC.
  • [0014]
    Any of the antibodies described above can be used in manufacturing a kit useful in practicing any of the methods of this invention.
  • [0015]
    The details of one or more embodiments of the invention are set forth in the description below. Other features or advantages of the present invention will be apparent from the following detailed description of several examples, and also from the appended claims.
  • [0016]
    The drawings are first described.
  • [0017]
    FIG. 1 is a diagram showing boxplots for combined levels of a fragment of leukocyte-associated Ig-like receptor-2 and a fragment of alpha-1 acid glycoprotein in healthy controls and patients having various types of nephropathy. DN, IgAN, CHN, and MGN refer to diabetic nephropathy, IgA nephropathy, Chinese herb nephropathy, and membranous glomerulonephritis nephropathy. The upper and lower limits of the boxes mark the 25% and 75% values with the medians as the lines across the boxes. The upper whisker marks the largest value below the upper fence, which is the 75% value plus 1.5 interquartile range and the lower whisker marks the smallest value above the lower fence, which is the 25% value minus 1.5 interquartile range.
  • [0018]
    FIG. 2 is a diagram showing boxplots for combined levels of a fragment of leukocyte-associated Ig-like receptor-2 and a fragment of alpha-1 acid glycoprotein in healthy controls and patients having CHN. The upper and lower limits of the boxes mark the 25% and 75% values with the medians as the lines across the boxes. The upper whisker marks the largest value below the upper fence, which is the 75% value plus 1.5 interquartile range and the lower whisker marks the smallest value above the lower fence, which is the 25% value minus 1.5 interquartile range.
  • [0019]
    In one aspect, the present invention relates to a method for diagnosing nephropathy based on the level of a urine biomarker, which can be leukocyte-associated Ig-like receptor-2 (GenBank accession number CAQ08962; 10-Jan.-2010), alpha-1 acid glycoprotein (GenBank accession number EAW87416; 10-Jan.-2010), a fragment of either protein, or a combination thereof. The fragment of either protein has a minimum length of ten amino acids and preferably, a maximum length of 120 to 200 amino acids. For example, fragments of leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycoprotein can contain up to 125 and 191 amino acid residues, respectively. In one example, the fragment of leukocyte-associated Ig-like receptor-2 is DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and a fragment of alpha-1 acid glycoprotein is GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2).
  • [0020]
    Each of the urine biomarkers mentioned above can be used to diagnose any type of nephropathy, including those related to diabetes (i.e., diabetic nephropathy), glomerulonephritis resulting from deposition of IgA in kidney tissues (i.e., IgA nephropathy), inflammation (e.g., membranous glomerulonephritis), Chinese herb-induced renal fibrosis (i.e., Chinese herbal nephropathy), chronic tubulointerstitial damage, which lead to renal failure (i.e., chronic interstitial nephritis), and focal segmental glomerulosclerosis.
  • [0021]
    To practice the diagnostic method of this invention, a urine sample is obtained from a subject suspected of having nephropathy and the level of any of the biomarkers mentioned above is then determined by conventional methods, e.g., ELISA and Westernblot. When the biomarker is a peptide or a combination of peptides, its level can be determined by a mass spectrometry assay. The level of the urine biomarker can then be compared with a reference point representing the level of the same urine biomarker in a nephropathy-free subject. The reference point can be determined via routine practice based on the representative level of a urine biomarker in a group of nephropathy patients versus that in a group of nephropathy-free subjects. For example, it can be the middle point between the mean levels of these two groups. When the level of the urine biomarker in the subject is greater than the reference point, it indicates that the subject has nephropathy.
  • [0022]
    When necessary, patients having minimal change nephropathy (MCN) or minimal change disease (MCD) can be used as control groups for determining the reference point mentioned above. Generally, MCN and MCD patients exhibit obvious proteinuria but normal renal functions.
  • [0023]
    When a fragment of leukocyte-associated Ig-like receptor-2 or a fragment of alpha-1 acid glycoprotein is used, the diagnostic method of this invention can be applied to detect incipient nephropathy when presence of proteins (e.g., albumin) in urine is not detectable, i.e., free of proteinuria. In another aspect, this invention relates to a method of monitoring nephropathy progress in a subject based on any of the urine biomarkers described above. To practice this method, two urine samples from a subject can be obtained within a suitable time span (e.g., 2 weeks to 12 months) and examined to determine the levels of one of the urine biomarkers described above. If the urine biomarker level in the later-obtained urine sample is greater than that in the earlier-obtained urine sample, it indicates that nephropathy progresses in the subject.
  • [0024]
    The monitoring method can be applied to a human subject suffering from or at risk for nephropathy. When the human subject is at risk for or in early stage nephropathy, the level of the urine biomarker can be determined once every 6 to 12 months to monitor nephropathy progress. When the human subject is already in late stage of nephropathy, it is preferred that the urine biomarker level be determined once every 3 to 6 months. While carrying kidney damage, patients in early stage nephropathy are generally asymptomatic and display normal kidney functions. These patients are at risk for nephropathy progress. Later stage nephropathy is characterized by a progressive decline in GFR (e.g., <15 mL/minute/1.73 m2).
  • [0025]
    The monitoring method described above is also applicable a laboratory animal, following routine procedures, to study nephropathy. Preferably, the laboratory animal is examined once every 2 to 24 weeks to determine the level of one of the urine biomarkers mentioned above. An increase in the biomarker level over time indicates that the disease progresses in the animal.
  • [0026]
    In yet another aspect, the present invention provides a method for assessing efficacy of a nephropathy treatment in a subject in need (i.e., a human nephropathy patient or a laboratory animal bearing renal damage). In this method, the levels of one of the urine biomarkers described above are determined before, during, and/or after the treatment. If the urine biomarker level remains the same or decreases over the course of the treatment, it indicates that the treatment is effective.
  • [0027]
    Any of the urine biomarkers can also be used to monitor renal toxicity of a target agent, i.e., whether an agent induces renal damage. The target agent can be any compound or composition for human administration. Examples include, but are not limited to, chemical compounds, which can be drugs (e.g., non-steroidal anti-inflammatory drugs) or drug candidates, food products or supplements, and herb supplements. Renal toxicity of a target agent is indicated by its ability to increase the level of a urine biomarker over time.
  • [0028]
    Also disclosed herein is a kit useful in practicing any of the above-described methods. This kit contains at least two antibodies, one specific to Ig-like receptor-2, e.g., capable of binding to its fragment DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) or any epitope contained therein, and the other specific to alpha-1 acid glycoprotein, e.g., capable of binding to its fragment GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2) or any epitope contained therein. In one example, the kit includes two different antibodies (i.e., a coating antibody and a detecting antibody) that bind to the same biomarker. Typically, the detecting antibody is conjugated with a molecule which emits a detectable signal either on its own or via binding to another agent. The term “antibody” used herein refers to a whole immunoglobulin or a fragment thereof, such as Fab or F(ab′)2 that retains antigen-binding activity. It can be naturally occurring or genetically engineered (e.g., single-chain antibody, chimeric antibody, or humanized antibody).
  • [0029]
    The antibodies included in the kit of this invention can be obtained from commercial vendors. Alternatively, they can be prepared by conventional methods. See, for example, Harlow and Lane, (1988) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York. To produce antibodies against a particular biomarker as listed above, the marker, optionally coupled to a carrier protein (e.g., KLH), can be mixed with an adjuvant, and injected into a host animal. Antibodies produced in the animal can then be purified by affinity chromatography. Commonly employed host animals include rabbits, mice, guinea pigs, and rats. Various adjuvants that can be used to increase the immunological response depend on the host species and include Freund's adjuvant (complete and incomplete), mineral gels such as aluminum hydroxide, CpG, surface-active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol. Useful human adjuvants include BCG (bacille Calmette-Guerin) and Corynebacterium parvum. Polyclonal antibodies, i.e., heterogeneous populations of antibody molecules, are present in the sera of the immunized animal.
  • [0030]
    Monoclonal antibodies, i.e., homogeneous populations of antibody molecules, can be prepared using standard hybridoma technology (see, for example, Kohler et al. (1975) Nature 256, 495; Kohler et al. (1976) Eur. J. Immunol. 6, 511; Kohler et al. (1976) Eur J Immunol 6, 292; and Hammerling et al. (1981) Monoclonal Antibodies and T Cell Hybridomas, Elsevier, N.Y.). In particular, monoclonal antibodies can be obtained by any technique that provides for the production of antibody molecules by continuous cell lines in culture such as described in Kohler et al. (1975) Nature 256, 495 and U.S. Pat. No. 4,376,110; the human B-cell hybridoma technique (Kosbor et al. (1983) Immunol Today 4, 72; Cole et al. (1983) Proc. Natl. Acad. Sci. USA 80, 2026, and the EBV-hybridoma technique (Cole et al. (1983) Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96). Such antibodies can be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD, and any subclass thereof. The hybridoma producing the monoclonal antibodies of the invention may be cultivated in vitro or in vivo. The ability to produce high titers of monoclonal antibodies in vivo makes it a particularly useful method of production.
  • [0031]
    Moreover, antibody fragments can be generated by known techniques. For example, such fragments include, but are not limited to, F(ab′)2 fragments that can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab′)2 fragments.
  • [0032]
    Without further elaboration, it is believed that one skilled in the art can, based on the above description, utilize the present invention to its fullest extent. The following specific embodiments are, therefore, to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. All publications cited herein are incorporated by reference.
  • Example 1 Diagnosing Nephropathy Using Urine Leukocyte-Associated Ig-Like Receptor-2 or Alpha-1 Acid Glycorprotein as a Biomarker Material and Methods (i) Subjects
  • [0033]
    The following groups of human subjects were participated in this study:
  • [0034]
    (a) healthy donors: free of diabetic mellitus with normal renal functions,
  • [0035]
    (b) DM patients: having type 2 diabetic mellitus, but free from nephropathy,
  • [0036]
    (c) DN patients: having diabetic nephropathy,
  • [0037]
    (d) DN uremia patients: having DN associated with uremia,
  • [0038]
    (e) IgAN patients: having IgA nephropathy,
  • [0039]
    (f) MGN patients: having membranous glomerulonephritis,
  • [0040]
    (g) CHN patients: having nephropathy induced by Chinese herb, and
  • [0041]
    (h) CIN patients: having chronic interstitial nephritis.
  • [0000]
    Clinical characteristics of the healthy donors and the patients are summarized in Table 1 below:
  • [0000]
    TABLE 1
    Patient Characteristics
    Healthy DM DN DN uremia IgAN MGN CHN CIN
    Age, mean(SD) 67.94 57.33 72.38 58.14 28.33 38.00 47.42 59.88
    (12.30) (10.52) (7.44) (12.79) (12.31) (13.11) (10.43) (7.62)
    Female, n (%) 6 2 1 2 4 2 14 4
    (37.5) (33.33) (12.5) (28.57) (44.44) (66.67) (73.68) (50.00)
    Serum Creatinine (mg/dL), 0.86 0.85 1.39 4.23 1.03 0.60 5.39 3.54
    mean(SD) (0.14) (0.24) (0.49) (4.65) (0.48) (0.20) (5.39) (2.28)
    MDRD_S_GFR, mean(SD) 86.28 106.86 58.60 58.02 104.29 144.96 22.70 24.32
    (13.19) (70.47) (20.75) (61.53) (56.19) (55.15) (17.07) (15.91)
  • (ii) MALDI-MS Assay
  • [0042]
    Midstream urinary samples were collected from the groups of human subjects listed above in early morning. These urine samples from both healthy donors and patients, mixed with protease inhibitors, were analyzed by MALDI-TOF-MS. Peptide candidates that were differentially presented in the healthy donor group and the various patient groups were identified upon comparison of polypeptide patterns between each patient group and the healthy donor group, taking into consideration statistical evaluation of demographic and sample parameters. These peptides were purified, their amino acid sequences determined via routine technology.
  • [0000]
    (iii) Westernblot Assay
  • [0043]
    Western blotting analysis was performed using antibodies specific to leukocyte-associated Ig-like receptor-2 fragment DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and alpha-1 acid glycoprotein fragment GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2), following routine technology. The results were normalized against the level of creatinine or protein in the same sample.
  • (iv) ELISA
  • [0044]
    Urine samples were mixed with protease inhibitors and diluted at 1:100 with a dilution buffer and serum samples were diluted at 1:10. The diluted samples were placed in ELISA plates in triplicates. The concentrations of leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycoprotein were determined via the standard sandwich ELISA method and normalized against the level of creatinine or protein in the same sample
  • Results
  • [0045]
    Via the MALDI-MS assay described above, peptides DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2) were detected in urine samples from nephropathy patients at much higher levels as compared to urine samples from healthy controls. SEQ ID NOs:1 and 2 are fragments of leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycoprotein, respectively. The positive rates of these two peptides in the healthy donor group and in the various patient groups are shown in Table 2 below:
  • [0000]
    Positive rates of Positive rates of
    Patient SEQ ID NO: 2 SEQ ID NO: 1
    Categories Groups Numbers N (%) N (%)
    Healthy Health 19 0 (0%) 1 (5.3%)
    Diabetic DM 7 0 (0%) 2 (28.6%)
    Nephropathy DN 8 2 (25%) 8 (100%)
    DN uremia 11 6 (54.5%) 8 (72.7%)
    Immune-mediated IgAN 12 0 (0%) 8 (66.7%)
    Nephropathy MGN 3 0 (0%) 2 (66.7%)
    Interstitial CHN 18 10 (55.6%) 17 (94.4%)
    Nephritis CIN 7 3 (42.9%) 7 (100%)
    Total 85 21 53
  • [0046]
    The results also show that the urine levels of these two peptides in nephropathy patients were not correlated with proteinuria, indicating that they can be used to detect kidney lesions prior to the appearance of proteins, particularly albumin, in urine.
  • [0047]
    Further, the urine levels of these two peptides in nephropathy patients were found to exhibit reverse correlations with GFR, indicating that they can serve as markers for monitoring renal function changes and nephropathy progress.
  • [0048]
    Via the ELISA and Westernblot assays described above, leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycorprotein were found to be differentially presented in urine samples from nephropathy patients (e.g., patients having Chinese herb-induced nephropathy) versus urine samples from healthy controls. See Table 3 below. More specifically, presence of either protein in urine samples from healthy controls was barely detectable; while a higher level of the protein was found in urine samples from nephropathy patients. This result indicates that either protein can be used as a marker for diagnosing nephropathy.
  • [0000]
    TABLE 2
    Ratios of Alpha-1 Acid Glycoprotein to Creatinine in Various Patient Groups
    Healthy DM DN IgAN MGN CHN CIN uremia
    AGP/Cr 2.57 2.91 29.18 15.52 139.51 19.55 51.31 97.13
    (ng/mg) × 1000 (2.52) (1.68) (30.93) (20.87) (137.53) (39.36) (65.46) (140.60)
  • Example 2 Diagnosing Nephropathy Using the Combination of Leukocyte-Associated Ig-Like Receptor-2 and Alpha-1 Acid Glycorprotein as a Biomarker
  • [0049]
    The levels of urine leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycorprotein from both healthy controls and nephropathy patients (including patients having diabetic nephropathy, uremia, IgA nephropathy, Chinese herb-induced nephropathy, and membranous glomerulonephritis nephropathy) were determined as described in Example 1 above.
  • [0050]
    As shown in FIG. 1, the combined level of the above-mentioned two protein markers was much higher in all types of nephropathy patients as compared to that in healthy controls (AUROC=0.93). This indicates that leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycorprotein, in combination, can be used as a reliable biomarker for diagnosing nephropathy with high sensitivity and specificity.
  • [0051]
    The combination of urine leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycorprotein was found to be particularly reliable in detecting nephropathy induced by Chinese herb. See FIG. 2. The AUROC obtained from this study reaches 1.0, indicating that the diagnosing accuracy is 100% when using this biomarker in diagnosing patients having Chinese herb-induced nephropathy.
  • Other Embodiments
  • [0052]
    All of the features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature serving the same, equivalent, or similar purpose. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features.
  • [0053]
    From the above description, one skilled in the art can easily ascertain the essential characteristics of the present invention, and without departing from the spirit and scope thereof, can make various changes and modifications of the invention to adapt it to various usages and conditions. Thus, other embodiments are also within the claims.

Claims (22)

1. A method of diagnosing nephropathy in a subject, comprising:
obtaining a urine sample from a subject suspected of having nephropathy,
determining in the urine sample a level of a biomarker selected from the group consisting of (i) a first protein molecule that is leukocyte-associated Ig-like receptor-2 or a fragment thereof having at least ten amino acid residues, (ii) a second protein molecule that is a fragment of alpha-1 acid glycoprotein having at least ten amino acid residues, (iii) a combination of the first and second protein molecules, and (iv) a combination of the first protein molecule and alpha-1 acid glycoprotein; and
assessing whether the subject has nephropathy based on the level of the biomarker,
wherein an increase in the level of the biomarker, as compared to that in a nephropathy-free subject, indicates that the subject has nephropathy.
2. The method of claim 1, wherein the fragment of leukocyte-associated Ig-like receptor-2 is DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and the fragment of alpha-1 acid glycoprotein is
3. The method of claim 1, wherein the level of the biomarker is determined by a mass spectrometry assay or an immune assay.
4. The method of claim 3, wherein the mass spectrometry assay is selected from the group consisting of MALDI-MS, LC-MS, and LC-MS/MS.
5. The method of claim 3, wherein the immune assay is selected from the group consisting of ELISA, Westernblot, RIA, FIA and LIA.
6. The method of claim 1, wherein the subject is a human.
7. The method of claim 1, wherein the subject is a laboratory animal.
8. The method of claim 1, wherein the biomarker is the first protein molecule.
9. The method of claim 8, wherein the first protein molecule is leukocyte-associated Ig-like receptor-2.
10. The method of claim 8, wherein the first protein molecule is
11. The method of claim 10, wherein the subject is free of proteinuria.
12. The method of claim 1, wherein the biomarker is the second protein molecule.
13. The method of claim 12, wherein the second protein molecule is
14. The method of claim 13, wherein the subject is free of proteinuria.
15. The method of claim 1, wherein the biomarker is the combination of the first and second protein molecules or the combination of the first protein molecule and alpha-1 acid glycoprotein.
16. The method of claim 15, wherein the first protein molecule is leukocyte-associated Ig-like receptor-2 or a fragment thereof that is DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and the second protein molecule is GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2).
17. A method for monitoring nephropathy progress in a subject, comprising
obtaining a first urine sample from a subject suffering from nephropathy;
determining in the first urine sample a level of a biomarker selected from the group consisting of (i) a first protein molecule that is leukocyte-associated Ig-like receptor-2 or a fragment thereof having at least ten amino acid residues, (ii) a second protein molecule that is a fragment of alpha-1 acid glycoprotein having at least ten amino acid residues, (iii) a combination of the first and second protein molecules, and (iv) a combination of the first protein molecule and alpha-1 acid glycoprotein;
obtaining a second urine sample from the subject 2 weeks to 12 months after the first urine sample is obtained;
determining in the second urine sample a level of the biomarker; and
assessing nephropathy progress in the subject,
wherein an increase in the level of the biomarker in the second urine sample, as compared to that in the first urine sample, indicates that nephropathy is exacerbated in the subject.
18. The method of claim 17, wherein the fragment of leukocyte-associated Ig-like receptor-2 is DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and the fragment of alpha-1 acid glycoprotein is
19. The method of claim 18, wherein the subject is a human in early stage nephropathy and the second urine sample is obtained 6 to 12 months after the first urine sample is obtained.
20. The method of claim 18, wherein the subject is a human in later stage nephropathy and the second urine sample is obtained 3 to 6 months after the first urine sample is obtained.
21. The method of claim 18, wherein the subject is a laboratory animal and the second urine sample is obtained 2 to 24 weeks after the first urine sample is obtained.
22-30. (canceled)
US12694639 2009-01-28 2010-01-27 Biomarkers associated with nephropathy Abandoned US20100209948A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US14778509 true 2009-01-28 2009-01-28
US12694639 US20100209948A1 (en) 2009-01-28 2010-01-27 Biomarkers associated with nephropathy

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US12694639 US20100209948A1 (en) 2009-01-28 2010-01-27 Biomarkers associated with nephropathy
US12968841 US20110081667A1 (en) 2009-01-28 2010-12-15 Biomarkers associated with nephropathy
US12969731 US8470547B2 (en) 2009-01-28 2010-12-16 Biomarkers associated with nephropathy
US12973018 US20110086372A1 (en) 2009-01-28 2010-12-20 Biomarkers associated with nephropathy
US13912531 US9442120B2 (en) 2009-01-28 2013-06-07 Biomarkers associated with nephropathy

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US12969731 Continuation US8470547B2 (en) 2009-01-28 2010-12-16 Biomarkers associated with nephropathy

Publications (1)

Publication Number Publication Date
US20100209948A1 true true US20100209948A1 (en) 2010-08-19



Family Applications (5)

Application Number Title Priority Date Filing Date
US12694639 Abandoned US20100209948A1 (en) 2009-01-28 2010-01-27 Biomarkers associated with nephropathy
US12968841 Abandoned US20110081667A1 (en) 2009-01-28 2010-12-15 Biomarkers associated with nephropathy
US12969731 Active 2030-02-06 US8470547B2 (en) 2009-01-28 2010-12-16 Biomarkers associated with nephropathy
US12973018 Abandoned US20110086372A1 (en) 2009-01-28 2010-12-20 Biomarkers associated with nephropathy
US13912531 Active 2031-08-28 US9442120B2 (en) 2009-01-28 2013-06-07 Biomarkers associated with nephropathy

Family Applications After (4)

Application Number Title Priority Date Filing Date
US12968841 Abandoned US20110081667A1 (en) 2009-01-28 2010-12-15 Biomarkers associated with nephropathy
US12969731 Active 2030-02-06 US8470547B2 (en) 2009-01-28 2010-12-16 Biomarkers associated with nephropathy
US12973018 Abandoned US20110086372A1 (en) 2009-01-28 2010-12-20 Biomarkers associated with nephropathy
US13912531 Active 2031-08-28 US9442120B2 (en) 2009-01-28 2013-06-07 Biomarkers associated with nephropathy

Country Status (8)

Country Link
US (5) US20100209948A1 (en)
JP (1) JP5524241B2 (en)
CN (1) CN102300875B (en)
CA (1) CA2748852A1 (en)
DK (1) DK2391653T3 (en)
EP (1) EP2391653B8 (en)
ES (1) ES2530574T3 (en)
WO (1) WO2010085878A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130252267A1 (en) * 2009-01-28 2013-09-26 Industrial Technology Research Institute Urine and serum biomarkers associated with diabetic nephropathy

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4640909A (en) * 1985-05-07 1987-02-03 J. T. Baker Chemical Company Bonded phase of silica and carboalkoxyalkyl silanes for solid phase extraction
WO1998024906A2 (en) * 1996-12-06 1998-06-11 Schering Corporation Isolated mammalian monocyte cell genes; related reagents
US6447989B1 (en) * 1998-12-21 2002-09-10 Monash University Kidney disease detection and treatment
US6664385B1 (en) * 1996-05-24 2003-12-16 Biogen, Inc. Kidney injury-related molecules
US6682917B1 (en) * 1999-06-28 2004-01-27 Takeda Chemical Industries, Ltd Protein having a ribonucleotide Reductase activity and a DNA thereof
US20050191664A1 (en) * 1998-12-21 2005-09-01 Monash University Method for kidney disease detection
US20080124752A1 (en) * 2006-10-13 2008-05-29 Metabolon, Inc. Biomarkers related to metabolic age and methods using the same
US20080187944A1 (en) * 2007-01-31 2008-08-07 Appa Rao Allam Butyrylcholinesterase as a marker of low-grade systemic inflammation
US20090030037A1 (en) * 2005-04-21 2009-01-29 Decode Genetics Ehf. Sustained Release Formulation and Dosing Schedules of Leukotriene Synthesis Inhibitor for Human Therapy
US7993832B2 (en) * 2006-08-14 2011-08-09 Xdx, Inc. Methods and compositions for diagnosing and monitoring the status of transplant rejection and immune disorders

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4376110A (en) 1980-08-04 1983-03-08 Hybritech, Incorporated Immunometric assays using monoclonal antibodies
US6140076A (en) * 1996-12-06 2000-10-31 Schering Corporation Ig superfamily `dlair` receptors expressed in monocytes
JP4160263B2 (en) * 1998-12-21 2008-10-01 モナッシュ ユニバーシティ How to measure the total content of a given protein in a urine sample
JP4578235B2 (en) * 2002-05-13 2010-11-10 アレクシス・アクチボラゲットArexis Ab Autoimmune conditions and nadph oxidase deficiency
GB0215509D0 (en) * 2002-07-04 2002-08-14 Novartis Ag Marker genes
US20040219603A1 (en) * 2003-03-27 2004-11-04 Prasad Devarajan Method and kit for detecting the early onset of renal tubular cell injury
EP1839057B1 (en) * 2004-12-15 2010-08-25 Beth Israel Deaconess Medical Center Nucleic acids and polypeptides useful for diagnosing and treating complications of pregnancy
US20090304686A1 (en) * 2006-03-08 2009-12-10 Universotair Medisch Centrum Utrecht Interfering in activation of an immune cell by influencing interaction of lair and collagen
US7662578B2 (en) * 2006-04-21 2010-02-16 Children's Hospital Medical Center Method and kit for the early detection of impaired renal status
EP2057465A4 (en) 2006-08-09 2010-04-21 Homestead Clinical Corp Organ-specific proteins and methods of their use
WO2008113363A1 (en) * 2007-03-21 2008-09-25 Bioporto Diagnostics A/S Diagnostic test for renal injury
EP2153234A2 (en) * 2007-05-11 2010-02-17 The Institutes for Pharmaceutical Discovery, LLC Methods for early diagnosis of kidney disease
ES2552467T3 (en) * 2009-01-28 2015-11-30 Industrial Technology Research Institute Biomarkers urine and serum associated with diabetic nephropathy

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4640909A (en) * 1985-05-07 1987-02-03 J. T. Baker Chemical Company Bonded phase of silica and carboalkoxyalkyl silanes for solid phase extraction
US6664385B1 (en) * 1996-05-24 2003-12-16 Biogen, Inc. Kidney injury-related molecules
WO1998024906A2 (en) * 1996-12-06 1998-06-11 Schering Corporation Isolated mammalian monocyte cell genes; related reagents
US6447989B1 (en) * 1998-12-21 2002-09-10 Monash University Kidney disease detection and treatment
US20050191664A1 (en) * 1998-12-21 2005-09-01 Monash University Method for kidney disease detection
US6682917B1 (en) * 1999-06-28 2004-01-27 Takeda Chemical Industries, Ltd Protein having a ribonucleotide Reductase activity and a DNA thereof
US20090030037A1 (en) * 2005-04-21 2009-01-29 Decode Genetics Ehf. Sustained Release Formulation and Dosing Schedules of Leukotriene Synthesis Inhibitor for Human Therapy
US7993832B2 (en) * 2006-08-14 2011-08-09 Xdx, Inc. Methods and compositions for diagnosing and monitoring the status of transplant rejection and immune disorders
US20080124752A1 (en) * 2006-10-13 2008-05-29 Metabolon, Inc. Biomarkers related to metabolic age and methods using the same
US20080187944A1 (en) * 2007-01-31 2008-08-07 Appa Rao Allam Butyrylcholinesterase as a marker of low-grade systemic inflammation

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Christiansen et al. "Increased urinary orosomucoid excretion is not related to impaired renal function in patients with type 2 diabetes", Journal of Diabetes and Its Complications 24 (2010) 28-36, available online September 25, 2008 *
Harlow, E. and Lane, D., Antibodies: A Laboratory Manual (1988) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, pages 72-76 *
Wolfe, S.L., Molecular and Cellular Biology, 1993, pages 790-793 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130252267A1 (en) * 2009-01-28 2013-09-26 Industrial Technology Research Institute Urine and serum biomarkers associated with diabetic nephropathy

Also Published As

Publication number Publication date Type
EP2391653B8 (en) 2015-09-30 grant
EP2391653A4 (en) 2012-06-27 application
US20130266976A1 (en) 2013-10-10 application
US20110086372A1 (en) 2011-04-14 application
DK2391653T3 (en) 2015-02-09 grant
US20110081667A1 (en) 2011-04-07 application
US9442120B2 (en) 2016-09-13 grant
EP2391653B1 (en) 2014-12-31 grant
WO2010085878A1 (en) 2010-08-05 application
US20110081668A1 (en) 2011-04-07 application
CN102300875A (en) 2011-12-28 application
JP5524241B2 (en) 2014-06-18 grant
CN102300875B (en) 2014-07-16 grant
JP2012516430A (en) 2012-07-19 application
ES2530574T3 (en) 2015-03-03 grant
EP2391653A1 (en) 2011-12-07 application
US8470547B2 (en) 2013-06-25 grant
CA2748852A1 (en) 2010-08-05 application

Similar Documents

Publication Publication Date Title
Ortona et al. Native and recombinant antigens in the immunodiagnosis of human cystic echinococcosis
US6451547B1 (en) Process for differential diagnosis of Alzheimer&#39;s dementia and device therefor
US20060105394A1 (en) Methods and compositions for treatment and prevention of major depressive disorder
US5830450A (en) Compositions of leptin bound to an apolipoprotein
US20060115856A1 (en) 2&#39;-5&#39;-oligoadenylate synthetase like protein as a biomarker for neurodegenerative disease
US20060115867A1 (en) TRIM 5 related protein as a biomarker of neurodegenerative disease
US20060115854A1 (en) Acetyl-LDL receptor related proteins and peptides as a biomarker for neurodegenerative disease
US20060115855A1 (en) FK506-binding protein 7 related protein as a biomarker for neurodegenerative disease
US20100143954A1 (en) Galectin-3 Immunoassay
US20050181466A1 (en) Immunosorbent blood tests for assessing paroxysmal cerebral discharges
US20070281319A1 (en) Method Of Diagnosing Infectious Disease By Measuring The Level Of Soluble Trem-1 In A Sample
US7196169B2 (en) Isolated post-translationally modified mammalian proteins for monitoring and diagnosing muscle damage
US20070065886A1 (en) Antibodies and methods for predicting dental caries
JP2007319127A (en) Method for diagnosing alzheimer&#39;s disease
US20070178442A1 (en) Method for diagnosing liver fibrosis
JP2005106694A (en) Early detection of blood poisoning and evaluation on seriousness
EP2261660A1 (en) Biomarker for the estimation of acute renal disorder and prognosis of the disorder, and use of the biomarker
WO2007124361A2 (en) Soluble b7-h1
US7745150B2 (en) Methods for the detection and monitoring of congestive heart failure
US20070161041A1 (en) Identification of feline or canine probnp
US7070945B2 (en) Process for determining the presence of monomeric brain associated human glutamine synthetase in patients exhibiting mild cognitive impairment
US20130244259A1 (en) Novel testing method and testing reagent for angiitis
US20120164667A1 (en) Method for test on diabetic nephropathy
WO2009114699A2 (en) High molecular weight ngal as a biomarker for chronic kidney disease
WO2006063213A2 (en) Serum amyloid a protein in inflammation and obesity

Legal Events

Date Code Title Description
AS Assignment