US20080188640A1 - Immunodeficiency recombinant poxvirus - Google Patents

Immunodeficiency recombinant poxvirus Download PDF

Info

Publication number
US20080188640A1
US20080188640A1 US11/891,027 US89102707A US2008188640A1 US 20080188640 A1 US20080188640 A1 US 20080188640A1 US 89102707 A US89102707 A US 89102707A US 2008188640 A1 US2008188640 A1 US 2008188640A1
Authority
US
United States
Prior art keywords
virus
alvac
vaccinia
seq
dna
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US11/891,027
Inventor
Enzo Paoletti
James Tartaglia
William I. Cox
Robert Gallo
Genoveffa Franchini
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Individual
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US08/105,483 external-priority patent/US5494807A/en
Application filed by Individual filed Critical Individual
Priority to US11/891,027 priority Critical patent/US20080188640A1/en
Publication of US20080188640A1 publication Critical patent/US20080188640A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A61P31/18—Antivirals for RNA viruses for HIV
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/04—Immunostimulants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/33—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Clostridium (G)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86—Viral vectors
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525—Virus
    • A61K2039/5254—Virus avirulent or attenuated
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/16011—Herpesviridae
    • C12N2710/16211—Lymphocryptovirus, e.g. human herpesvirus 4, Epstein-Barr Virus
    • C12N2710/16222—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/16011—Herpesviridae
    • C12N2710/16611—Simplexvirus, e.g. human herpesvirus 1, 2
    • C12N2710/16622—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/16011—Herpesviridae
    • C12N2710/16711—Varicellovirus, e.g. human herpesvirus 3, Varicella Zoster, pseudorabies
    • C12N2710/16722—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/24011—Poxviridae
    • C12N2710/24022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/24011—Poxviridae
    • C12N2710/24041—Use of virus, viral particle or viral elements as a vector
    • C12N2710/24043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/24011—Poxviridae
    • C12N2710/24111—Orthopoxvirus, e.g. vaccinia virus, variola
    • C12N2710/24122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/24011—Poxviridae
    • C12N2710/24111—Orthopoxvirus, e.g. vaccinia virus, variola
    • C12N2710/24141—Use of virus, viral particle or viral elements as a vector
    • C12N2710/24143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2730/00—Reverse transcribing DNA viruses
    • C12N2730/00011—Details
    • C12N2730/10011—Hepadnaviridae
    • C12N2730/10111—Orthohepadnavirus, e.g. hepatitis B virus
    • C12N2730/10122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/13011—Gammaretrovirus, e.g. murine leukeamia virus
    • C12N2740/13022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/16011—Human Immunodeficiency Virus, HIV
    • C12N2740/16111—Human Immunodeficiency Virus, HIV concerning HIV env
    • C12N2740/16122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/16011—Human Immunodeficiency Virus, HIV
    • C12N2740/16211—Human Immunodeficiency Virus, HIV concerning HIV gagpol
    • C12N2740/16222—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/16011—Human Immunodeficiency Virus, HIV
    • C12N2740/16311—Human Immunodeficiency Virus, HIV concerning HIV regulatory proteins
    • C12N2740/16322—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011—Details
    • C12N2750/14011—Parvoviridae
    • C12N2750/14311—Parvovirus, e.g. minute virus of mice
    • C12N2750/14322—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011—Details
    • C12N2760/12011—Bunyaviridae
    • C12N2760/12022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011—Details
    • C12N2760/16011—Orthomyxoviridae
    • C12N2760/16111—Influenzavirus A, i.e. influenza A virus
    • C12N2760/16122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011—Details
    • C12N2760/18011—Paramyxoviridae
    • C12N2760/18111—Avulavirus, e.g. Newcastle disease virus
    • C12N2760/18122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011—Details
    • C12N2760/18011—Paramyxoviridae
    • C12N2760/18711—Rubulavirus, e.g. mumps virus, parainfluenza 2,4
    • C12N2760/18722—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011—Details
    • C12N2760/20011—Rhabdoviridae
    • C12N2760/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011—Details
    • C12N2760/20011—Rhabdoviridae
    • C12N2760/20111—Lyssavirus, e.g. rabies virus
    • C12N2760/20122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011—Details
    • C12N2770/24011—Flaviviridae
    • C12N2770/24022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011—Details
    • C12N2770/24011—Flaviviridae
    • C12N2770/24111—Flavivirus, e.g. yellow fever virus, dengue, JEV
    • C12N2770/24122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011—Details
    • C12N2770/24011—Flaviviridae
    • C12N2770/24111—Flavivirus, e.g. yellow fever virus, dengue, JEV
    • C12N2770/24141—Use of virus, viral particle or viral elements as a vector
    • C12N2770/24143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • the present invention relates to a modified poxvirus and to methods of making and using the same. More in particular, the invention relates to improved vectors for the insertion and expression of foreign genes for use as safe immunization vehicles to elicit an immune response against immunodeficiency virus.
  • the invention relates to a recombinant poxvirus, which virus expresses gene products of immunodeficiency virus and to immunogenic compositions which induce an immunological response against immunodeficiency virus infections when administered to a host, or in vitro (e.g.
  • ex vivo modalities as well as to the products of expression of the poxvirus which by themselves are useful for eliciting an immune response e.g., raising antibodies, which antibodies are useful against immunodeficiency virus infection, in either seropositive or seronegative individuals, or are useful if isolated from an animal or human for preparing a diagnostic kit, test or assay for the detection of the virus or infected cells.
  • Vaccinia virus and more recently other poxviruses have been used for the insertion and expression of foreign genes.
  • the basic technique of inserting foreign genes into live infectious poxvirus involves recombination between pox DNA sequences flanking a foreign genetic element in a donor plasmid and homologous sequences present in the rescuing poxvirus (Piccini et al., 1987).
  • the recombinant poxviruses are constructed in two steps known in the art and analogous to the methods for creating synthetic recombinants of poxviruses such as the vaccinia virus and avipox virus described in U.S. Pat. Nos. 4,769,330, 4,772,848, 4,603,112, 5,100,587, and 5,179,993, the disclosures of which are incorporated herein by reference.
  • the DNA gene sequence to be inserted into the virus is placed into an E. coli plasmid construct into which DNA homologous to a section of DNA of the poxvirus has been inserted.
  • the DNA gene sequence to be inserted is ligated to a promoter.
  • the promoter-gene linkage is positioned in the plasmid construct so that the promoter-gene linkage is flanked on both ends by DNA homologous to a DNA sequence flanking a region of pox DNA containing a nonessential locus.
  • the resulting plasmid construct is then amplified by growth within E. coli bacteria (Clewell, 1972) and isolated (Clewell et al., 1969; Maniatis et al., 1982).
  • the isolated plasmid containing the DNA gene sequence to be inserted is transfected into a cell culture, e.g. chick embryo fibroblasts, along with the poxvirus.
  • a cell culture e.g. chick embryo fibroblasts
  • Recombination between homologous pox DNA in the plasmid and the viral genome respectively gives a poxvirus modified by the presence, in a nonessential region of its genome, of foreign DNA sequences.
  • the term “foreign” DNA designates exogenous DNA, particularly DNA from a non-pox source, that codes for gene products not ordinarily produced by the genome into which the exogenous DNA is placed.
  • RNA may replace DNA.
  • homologous sections of nucleic acid are sections of nucleic acid (DNA or RNA) which have the same sequence of nucleotide bases.
  • Genetic recombination may take place naturally during the replication or manufacture of new viral genomes within the infected host cell.
  • genetic recombination between viral genes may occur during the viral replication cycle that takes place in a host cell which is co-infected with two or more different viruses or other genetic constructs.
  • a section of DNA from a first genome is used interchangeably in constructing the section of the genome of a second co-infecting virus in which the DNA is homologous with that of the first viral genome.
  • recombination can also take place between sections of DNA in different genomes that are not perfectly homologous. If one such section is from a first genome homologous with a section of another genome except for the presence within the first section of, for example, a genetic marker or a gene coding for an antigenic determinant inserted into a portion of the homologous DNA, recombination can still take place and the products of that recombination are then detectable by the presence of that genetic marker or gene in the recombinant viral genome. Additional strategies have recently been reported for generating recombinant vaccinia virus.
  • Successful expression of the inserted DNA genetic sequence by the modified infectious virus requires two conditions. First, the insertion must be into a nonessential region of the virus in order that the modified virus remain viable.
  • the second condition for expression of inserted DNA is the presence of a promoter in the proper relationship to the inserted DNA. The promoter must be placed so that it is located upstream from the DNA sequence to be expressed.
  • Vaccinia virus has been used successfully to immunize against smallpox, culminating in the worldwide eradication of smallpox in 1980.
  • many strains of vaccinia have arisen. These different strains demonstrate varying immunogenicity and are implicated to varying degrees with potential complications, the most serious of which are post-vaccinial encephalitis and generalized vaccinia (Behbehani, 1983).
  • the genetic background of the vaccinia vector has been shown to affect the protective efficacy of the expressed foreign immunogen.
  • EBV Epstein Barr Virus
  • expression of Epstein Barr Virus (EBV) gp340 in the Wyeth vaccine strain of vaccinia virus did not protect cottontop tamarins against EBV virus induced lymphoma, while expression of the same gene in the WR laboratory strain of vaccinia virus was protective (Morgan et al., 1988).
  • a fine balance between the efficacy and the safety of a vaccinia virus-based recombinant vaccine candidate is extremely important.
  • the recombinant virus must present the immunogen(s) in a manner that elicits a protective immune response in the vaccinated animal but lacks any significant pathogenic properties. Therefore attenuation of the vector strain would be a highly desirable advance over the current state of technology.
  • vaccinia genes have been identified which are non-essential for growth of the virus in tissue culture and whose deletion or inactivation reduces virulence in a variety of animal systems.
  • TK thymidine kinase
  • herpes simplex virus type 2 intravaginal inoculation of guinea pigs with TK ⁇ virus resulted in significantly lower virus titers in the spinal cord than did inoculation with TK + virus (Stanberry et al., 1985). It has been demonstrated that herpesvirus encoded TK activity in vitro was not important for virus growth in actively metabolizing cells, but was required for virus growth in quiescent cells (Jamieson et al., 1974).
  • TK ⁇ vaccinia Attenuation of TK ⁇ vaccinia has been shown in mice inoculated by the intracerebral and intraperitoneal routes (Buller et al., 1985). Attenuation was observed both for the WR neurovirulent laboratory strain and for the Wyeth vaccine strain. In mice inoculated by the intradermal route, TK ⁇ recombinant vaccinia generated equivalent anti-vaccinia neutralizing antibodies as compared with the parental TK + vaccinia virus, indicating that in this test system the loss of TK function does not significantly decrease immunogenicity of the vaccinia virus vector.
  • mice with TK ⁇ and TK + recombinant vaccinia virus Following intranasal inoculation of mice with TK ⁇ and TK + recombinant vaccinia virus (WR strain), significantly less dissemination of virus to other locations, including the brain, has been found (Taylor et al., 1991a).
  • ribonucleotide reductase Another enzyme involved with nucleotide metabolism is ribonucleotide reductase. Loss of virally encoded ribonucleotide reductase activity in herpes simplex virus (HSV) by deletion of the gene encoding the large subunit was shown to have no effect on viral growth and DNA synthesis in dividing cells in vitro, but severely compromised the ability of the virus to grow on serum starved cells (Goldstein et al., 1988).
  • HSV herpes simplex virus
  • the vaccinia virus hemagglutinin gene has been mapped and sequenced (Shida, 1986).
  • the HA gene of vaccinia virus is nonessential for growth in tissue culture (Ichihashi et al., 1971). Inactivation of the HA gene of vaccinia virus results in reduced neurovirulence in rabbits inoculated by the intracranial route and smaller lesions in rabbits at the site of intradermal inoculation (Shida et al., 1988).
  • the HA locus was used for the insertion of foreign genes in the WR strain (Shida et al., 1987), derivatives of the Lister strain (Shida et al., 1988) and the Copenhagen strain (Guo et al., 1989) of vaccinia virus.
  • Recombinant HA vaccinia virus expressing foreign genes have been shown to be immunogenic (Guo et al., 1989; Itamura et al., 1990; Shida et al., 1988; Shida et al., 1987) and protective against challenge by the relevant pathogen (Guo et al., 1989; Shida et al., 1987).
  • Cowpox virus (Brighton red strain) produces red (hemorrhagic) pocks on the chorioallantoic membrane of chicken eggs. Spontaneous deletions within the cowpox genome generate mutants which produce white pocks (Pickup et al., 1984).
  • the hemorrhagic function maps to a 38 kDa protein encoded by an early gene (Pickup et al., 1986). This gene, which has homology to serine protease inhibitors, has been shown to inhibit the host inflammatory response to cowpox virus (Palumbo et al., 1989) and is an inhibitor of blood coagulation.
  • the u gene is present in WR strain of vaccinia virus (Kotwal et al., 1989b). Mice inoculated with a WR vaccinia virus recombinant in which the u region has been inactivated by insertion of a foreign gene produce higher antibody levels to the foreign gene product compared to mice inoculated with a similar recombinant vaccinia virus in which the u gene is intact (Zhou et al., 1990). The u region is present in a defective nonfunctional form in Copenhagen strain of vaccinia virus (open reading frames B13 and B14 by the terminology reported in Goebel et al., 1990a,b).
  • Cowpox virus is localized in infected cells in cytoplasmic A type inclusion bodies (ATI) (Kato et al., 1959).
  • the function of ATI is thought to be the protection of cowpox virus virions during dissemination from animal to animal (Bergoin et al., 1971).
  • the ATI region of the cowpox genome encodes a 160 kDa protein which forms the matrix of the ATI bodies (Funahashi et al., 1988; Patel et al., 1987).
  • Vaccinia virus though containing a homologous region in its genome, generally does not produce ATI.
  • a WR strain of vaccinia virus with a 10 kb spontaneous deletion (Moss et al., 1981; Panicali et al., 1981) was shown to be attenuated by intracranial inoculation in mice (Buller et al., 1985). This deletion was later shown to include 17 potential ORFs (Kotwal et al., 1988b). Specific genes within the deleted region include the virokine N1L and a 35 kDa protein (C3L, by the terminology reported in Goebel et al., 1990a,b). Insertional inactivation of N1L reduces virulence by intracranial inoculation for both normal and nude mice (Kotwal et al., 1989a).
  • the 35 kDa protein is secreted like N1L into the medium of vaccinia virus infected cells.
  • the protein contains homology to the family of complement control proteins, particularly the complement 4B binding protein (C4 bp) (Kotwal et al., 1988a).
  • C4 bp complement 4B binding protein
  • the vaccinia 35 kDa protein binds the fourth component of complement and inhibits the classical complement cascade (Kotwal et al., 1990).
  • the vaccinia 35 kDa protein appears to be involved in aiding the virus in evading host defense mechanisms.
  • the left end of the vaccinia genome includes two genes which have been identified as host range genes, K1L (Gillard et al., 1986) and C7L (Perkus et al., 1990). Deletion of both of these genes reduces the ability of vaccinia virus to grow on a variety of human cell lines (Perkus et al., 1990).
  • avipoxviruses Two additional vaccine vector systems involve the use of naturally host-restricted poxviruses, avipoxviruses. Both fowlpoxvirus (FPV) and canarypoxvirus (CPV) have been engineered to express foreign gene products.
  • Fowlpox virus (FPV) is the prototypic virus of the Avipox genus of the Poxvirus family. The virus causes an economically important disease of poultry which has been well controlled since the 1920's by the use of live attenuated vaccines. Replication of the avipox viruses is limited to avian species (Matthews, 1982) and there are no reports in the literature of avipoxvirus causing a productive infection in any non-avian species including man. This host restriction provides an inherent safety barrier to transmission of the virus to other species and makes use of avipoxvirus based vaccine vectors in veterinary and human applications an attractive proposition.
  • FPV has been used advantageously as a vector expressing antigens from poultry pathogens.
  • the hemagglutinin protein of a virulent avian influenza virus was expressed in an FPV recombinant (Taylor et al., 1988a).
  • an immune response was induced which was protective against either a homologous or a heterologous virulent influenza virus challenge (Taylor et al., 1988a).
  • FPV recombinants expressing the surface glycoproteins of Newcastle Disease Virus have also been developed (Taylor et al., 1990; Edbauer et al., 1990).
  • recombinants derived from these viruses were found to express extrinsic proteins in cells of nonavian origin. Further, such recombinant viruses were shown to elicit immunological responses directed towards the foreign gene product and where appropriate were shown to afford protection from challenge against the corresponding pathogen (Tartaglia et al., 1993a,b; Taylor et al., 1992; 1991b; 1988b).
  • HIV1 human immunodeficiency virus type 1
  • SIV simian immunodeficiency virus
  • chimpanzees have been protected against an HIV1 challenge with an HIV1 gp120 subunit vaccine (Berman et al, 1990). Chimps have also been protected against an HIV1 challenge by a vaccination protocol involving multiple injections of either inactivated HIV1, gp160 and/or V3 peptide or gp160, p17 (a Gag protein) and/or V3 peptide (Girard et al., 1991).
  • a similar protocol involving multiple injections of gp160, p17, p24 (a Gag protein), Vif, Nef and/or V3 peptide has also protected chimps against a challenge of HIV1-infected cells (Fultz et al., 1992).
  • chimps have been passively protected by the infusion of HIV1 V3-specific antibodies (Emini et al., 1992).
  • HIV1 or SIV envelope glycoprotein Most of these vaccination protocols have focused on eliciting an immune response against the HIV1 or SIV envelope glycoprotein, or more specifically, against the V3 epitope of the envelope glycoprotein.
  • different strains of HIV1 exhibit extensive genetic and antigenic variability, especially in the envelope glycoprotein. Therefore, an effective HIV1 vaccine may need to elicit an immune response against more than one HIV1 antigen, or one epitope of one HIV1 antigen.
  • T-cell epitopes are relatively conserved.
  • CTL cytotoxic T-lymphocytes
  • LAI strain vaccinia virus recombinant expressing HIV1 gp160
  • LAI purified HIV1 gp160
  • a vaccine that elicits an immune response against relatively conserved T-cell epitopes may not only be more efficacious against a homologous challenge, but also more efficacious against a heterologous challenge.
  • HIV1-seronegative individuals have been vaccinated with an ALVAC recombinant (vCP125) expressing HIV1 gp160, in a prime-boost protocol similar to the regimen used to vaccinate macaques against SIV.
  • ALVAC-based protocols demonstrated the ability of vCP125 to elicit HIV1 envelope-specific CD8 + CTLs and to enhance envelope-specific humoral responses observed following a subunit booster (Pialoux et al., 1995). These results justify the rationale for a recombinant ALVAC-based HIV1 vaccine.
  • HIV1 human immunodeficiency virus type 1
  • V3 variable region
  • the amino acid sequence of the V3 loop varies considerably between different HIV1 isolates. Therefore, a moderate level of sequence variation does not appear to alter the structure or immunogenicity of this region of the envelope glycoprotein.
  • this region of the envelope glycoprotein may be useful as an immunogenic platform for presenting normally non-immunogenic linear HIV1 epitopes or heterologous epitopes to the immune system.
  • Sera from HIV1-seropositive individuals can neutralize lab-adapted strains of HIV1. These sera can also neutralize primary HIV1 isolates (although 100 ⁇ higher titers are required). Conversely, sera from individuals vaccinated with HIV1 gp120 can neutralize lab-adapted strains of HIV1 (although 10 ⁇ higher titers relative to sera from seropositive individuals are required), but can not neutralize (at assayable levels) primary isolates (Hanson, 1994). A significant portion of the neutralizing activity found in sera from seropositive and gp120-vaccinated individuals appears to be specific to the V3 loop (Spear et al., 1994; Berman et al., 1994).
  • V3 loop is hypervariable and since antibodies against this region may not neutralize primary isolates or heterologous strains of HIV1, it may be necessary to develop vaccines that elicit an immune response against epitopes other than the V3 loop, epitopes that can neutralize a broad spectrum of HIV1 strains, including primary isolates.
  • the epitope recognized by this monoclonal antibody has been mapped between amino acids 662 and 667 of HIV1 gp41 and has the amino acid sequence, ELDKWA (Buchacher et al, 1994).
  • ELDKWA Buchacher et al, 1994.
  • this epitope does not appear to be very immunogenic in its normal configuration. Only approximately 50% of HIV1-seropositive individuals have a detectable antibody response to the region of gp41 containing this epitope (Broliden et al., 1992).
  • an immunodeficiency virus recombinant poxvirus and of an immunogenic composition which induces an immunological response against immunodeficiency virus infections when administered to host, particularly a composition having enhanced safety such as NYVAC or ALVAC based recombinants containing coding for any or all of HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL epitopes, pol(IIIB)CTL epitopes; for instance, HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nefCTL1, nefCTL2, pol1(PolCTL1), pol2(PolCTL2), pol3(PolCTL3), ELDKWA or LDKW epitopes (SEQ ID NOS: 147 and 148), especially in an immunogenic configuration, or any combination thereof, for example all of them in combination,
  • the present invention relates to a modified recombinant virus having inactivated virus-encoded genetic functions so that the recombinant virus has attenuated virulence and enhanced safety.
  • the functions can be non-essential, or associated with virulence.
  • the virus is advantageously a poxvirus, particularly a vaccinia virus or an avipox virus, such as fowlpox virus and canarypox virus.
  • the modified recombinant virus can include, within a non-essential region of the virus genome, a heterologous DNA sequence which encodes an antigen or epitope derived from immunodeficiency virus and/or CTL epitope such as, e.g., HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, ELDKWA, LDKW epitopes or any combination thereof, preferably all of them in combination.
  • a heterologous DNA sequence which encodes an antigen or epitope derived from immunodeficiency virus and/or CTL epitope such as, e.g., HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, ELDKWA, LDKW epitopes or any combination thereof, preferably all of
  • the present invention relates to an antigenic, immunological or vaccine composition or a therapeutic composition for inducing an antigenic or immunological response in a host animal inoculated with the composition, said vaccine including a carrier and a modified recombinant virus having inactivated nonessential virus-encoded genetic functions so that the recombinant virus has attenuated virulence and enhanced safety.
  • the virus used in the composition according to the present invention is advantageously a poxvirus, particularly a vaccinia virus or an avipox virus, such as fowlpox virus and canarypox virus.
  • the modified recombinant virus can include, within a non-essential region of the virus genome, a heterologous DNA sequence which encodes an antigenic protein, e.g., derived from immunodeficiency virus and/or CTL such as, HIV1gag(+pro) (IIIB), gp120 (MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, ELDKWA, LDKW epitopes or any combination thereof, preferably all of them in combination.
  • a heterologous DNA sequence which encodes an antigenic protein e.g., derived from immunodeficiency virus and/or CTL
  • an antigenic protein e.g., derived from immunodeficiency virus and/or CTL
  • CTL such as, HIV1gag(+pro) (IIIB), gp120 (MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, ELD
  • the present invention relates to an immunogenic composition containing a modified recombinant virus having inactivated nonessential virus-encoded genetic functions so that the recombinant virus has attenuated virulence and enhanced safety.
  • the modified recombinant virus includes, within a non-essential region of the virus genome, a heterologous DNA sequence which encodes an antigenic protein (e.g., derived from an immunodeficiency virus and/or CTL such as, HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, ELDKWA, LDKW epitopes or any combination thereof, preferably all of them in combination) wherein the composition, when administered to a host, is capable of inducing an immunological response specific to the antigen.
  • an antigenic protein e.g., derived from an immunodeficiency virus and/or CTL such as, HIV1g
  • the present invention relates to a method for expressing a gene product in a cell (e.g. peripheral blood mononuclear cells (PBMCs) or lymph node mononuclear cells (LNMC) in vitro by introducing into the cell a modified recombinant virus having attenuated virulence and coenhanced safety.
  • a cell e.g. peripheral blood mononuclear cells (PBMCs) or lymph node mononuclear cells (LNMC)
  • PBMCs peripheral blood mononuclear cells
  • LNMC lymph node mononuclear cells
  • the modified recombinant virus can include, within a nonessential region of the virus genome, a heterologous DNA sequence which encodes an antigenic protein, e.g.
  • the cells can then be reinfused directly into the individual or used to amplify specific CD8 + CTL reactivities for reinfusion (Ex vivo therapy).
  • an immunodeficiency virus such as HIV/gag (+pro) (IIIB), gp120(MN) (+transmembrane), nef (BRU)CTL, pol (IIIB)CTL, ELDKWA, LDKW epitopes or any combination thereof, preferably all of them in combination.
  • the cells can then be reinfused directly into the individual or used to amplify specific CD8 + CTL reactivities for reinfusion (Ex vivo therapy).
  • the present invention relates to a method for expressing a gene product in a cell cultured in vitro by introducing into the cell a modified recombinant virus having attenuated virulence and enhanced safety.
  • the modified recombinant virus can include, within a non-essential region of the virus genome, a heterologous DNA sequence which encodes an antigenic protein, e.g., derived from a immunodeficiency virus such as HIV1gag (+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, ELDKWA, LDKW epitopes or any combination thereof, preferably all of them in combination.
  • a immunodeficiency virus such as HIV1gag (+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, ELDKWA, LDKW epitop
  • the product can then be administered to individuals or animals to stimulate an immune response.
  • the antibodies raised can be useful in individuals for the prevention or treatment of immunodeficiency virus and, the antibodies from animals can be used in diagnostic kits, assays or tests to determine the presence or absence in a sample such as sera of immunodeficiency virus or CTL antigens (and therefore the absence or presence of the virus of an immune response to the virus or antibodies).
  • the present invention relates to a modified recombinant virus having nonessential virus-encoded genetic functions inactivated therein so that the virus has attenuated virulence, and wherein the modified recombinant virus further contains DNA from a heterologous source in a nonessential region of the virus genome.
  • the DNA can code for an immunodeficiency virus and/or CTL antigen such as HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, ELDKWA, LDKW epitopes or any combination thereof, preferably all of them in combination.
  • the genetic functions are inactivated by deleting an open reading frame encoding a virulence factor or by utilizing naturally host restricted viruses.
  • the virus used according to the present invention is advantageously a poxvirus, particularly a vaccinia virus or an avipox virus, such as fowlpox virus and canarypox virus.
  • the open reading frame is selected from the group consisting of J2R, B13R+B14R, A26L, A56R, C7L-K1L, and I4L (by the terminology reported in Goebel et al., 1990a,b); and, the combination thereof.
  • the open reading frame comprises a thymidine kinase gene, a hemorrhagic region, an A type inclusion body region, a hemagglutinin gene, a host range gene region or a large subunit, ribonucleotide reductase; or, the combination thereof.
  • the modified Copenhagen strain of vaccinia virus is identified as NYVAC (Tartaglia et al., 1992).
  • the COPAK strain can also be used in the practice of the invention.
  • the exogenous DNA codes for HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), two (2) nef(BRU)CTL and three (3) pol(IIIB)CTL epitopes; or, the exogenous DNA codes for the ELDKWA or LDKW epitopes, and, is inserted so as to be expressed in a region of gp120 or gp160 (i.e., the exogenous DNA codes for a ELDKWA or LDKW modified gp120 or gp160, for instance ELDKWA or LDKW or repeats of either or both in the V3 loop) such that the epitope is expressed in an immunogenic configuration.
  • the two (2) nef(BRU)CTL and three (3) pol(IIIB)CTL epitopes are CTL1, CTL2, poll, pol2, and pol3.
  • the exogenous DNA codes for HIV1 gp120+TM in which the V3 loop has been modified to contain at least one, and preferably two ELDKWA epitopes.
  • the invention comprehends HIV immunogens and modified gp160 or gp120.
  • the invention includes an HIV immunogen preferably selected from the group consisting of: HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef (BRU)CTL, pol(IIIB)CTL, and ELDKWA or LDKW epitopes.
  • the HIV immunogen of the invention can be part of gp160 or gp120.
  • the HIV immunogens ELKDKWA or LDKWA for example, can be a part of a region of go120 or a region of gp160; for instance, part of gp120V3.
  • the invention comprehends a gp120 or gp160 modified so as to contain an epitope not naturally occurring in gp160.
  • the epitope can be a B-cell epitope.
  • the epitope more specifically, can be at least one of HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, and ELDKWA or LDKW epitopes.
  • the gp120 can be modified in the V3 loop.
  • the immunogen and modified gp120 or gp160 can be synthesized by any suitable vector, including a poxvirus, such as a recombinant of the invention; or, by any suitable chemical synthesis method such as the Merrifield Synthesis Method.
  • the invention in yet a further aspect relates to the product of expression of the inventive recombinant poxvirus and uses therefor, as well as to uses for the inventive immunogens and modified gp120 and sp160, such as to form antigenic, immunological or vaccine compositions for treatment, prevention, diagnosis or testing.
  • the invention in still a further embodiment relates to the uses of DNA from the recombinants as probes for detecting the presence or absence of HIV DNA in a sample or for DNA immunization using an appropriate expression plasmid.
  • FIG. 1 schematically shows a method for the construction of plasmid pSD460 for deletion of thymidine kinase gene and generation of recombinant vaccinia virus vP410;
  • FIG. 2 schematically shows a method for the construction of plasmid pSD486 for deletion of hemorrhagic region and generation of recombinant vaccinia virus vP553;
  • FIG. 3 schematically shows a method for the construction of plasmid pMP494 ⁇ for deletion of ATI region and generation of recombinant vaccinia virus vP618;
  • FIG. 4 schematically shows a method for the construction of plasmid pSD467 for deletion of hemagglutinin gene and generation of recombinant vaccinia virus vP723;
  • FIG. 5 schematically shows a method for the construction of plasmid pMPCK1 ⁇ for deletion of gene cluster [C7L-K1L] and generation of recombinant vaccinia virus vP804;
  • FIG. 6 schematically shows a method for the construction of plasmid pSD548 for deletion of large subunit, ribonucleotide reductase and generation of recombinant vaccinia virus vP866 (NYVAC);
  • FIG. 7 schematically shows a method for the construction of plasmid pRW842 for insertion of rabies glycoprotein G gene into the TK deletion locus and generation of recombinant vaccinia virus vP879;
  • FIG. 8 shows the DNA sequence (SEQ ID NO:66) of a canarypox PvuII fragment containing the C5 ORF.
  • FIGS. 9A and 9B schematically show a method for the construction of recombinant canarypox virus vCP65 (ALVAC-RG);
  • FIG. 10 shows schematically the ORFs deleted to generate NYVAC
  • FIG. 11 shows the nucleotide sequence (SEQ ID NO:67) of a fragment of TROVAC DNA containing an F8 ORF;
  • FIG. 12 shows the DNA sequence (SEQ ID NO:68) of a 2356 base pair fragment of TROVAC DNA containing the F7 ORF;
  • FIGS. 13A to 13D show graphs of rabies neutralizing antibody titers (RFFIT, IU/ml), booster effect of HDC and vCP65 (10 5.5 TCID 50 ) in volunteers previously immunized with either the same or the alternate vaccine (vaccines given at days 0, 28 and 180, antibody titers measured at days 0, 7, 28, 35, 56, 173, 187 and 208);
  • FIG. 14A to 14C shows the nucleotide sequence of the H6-promoted HIV1 gp120 (+transmembrane) gene and the I3L-promoted HIV1gag(+pro) gene contained in pHIV32 (SEQ ID NOS: 78 and 79);
  • FIG. 15A to 15F shows the nucleotide sequence of the C3 locus in pVQH6CP3L (SEQ ID NOS: 80 and 81);
  • FIG. 16 shows the nucleotide sequence of the I3L-promoted nef CTL2 epitope and H6-promoted nef CTL1 epitope contained in p2-60-HIV.3 (SEQ ID NOS: 93-96);
  • FIG. 17A to 17C shows the nucleotide sequence of the C6 locus in pC6L (SEQ ID NOS: 97 and 98);
  • FIG. 18A to 18B shows the nucleotide sequence of the I3L-promoted pol2 epitope, H6-promoted poll epitope and 42K-promoted pol3 epitope contained in pC5POLT5A (SEQ ID NOS: 111-115);
  • FIG. 19A to 19C shows the nucleotide sequence of the C5 locus in pNC5L-SP5 (SEQ ID NOS: 116 and 117);
  • FIG. 20 shows the rabbit antibody responses to the HIV envelope glycoprotein following immunization with ALVAC, vCP205, or with peptide CLTB-36;
  • FIG. 21 shows the rabbit antibody responses to the HIV MN V3 loop following immunization with ALVAC, vCP205, or with peptide CLTB-36;
  • FIG. 22 shows the guinea pig antibody responses to the HIV envelope glycoprotein following immunization with ALVAC, vCP205, or with peptide CLTB-36;
  • FIG. 23 shows the guinea pig antibody responses to the HIV MN V3 loop following immunization with ALVAC, vCP205, or with peptide CLTB-36;
  • FIG. 24 shows in vitro stimulation of HIV-1-specific CTLs from PBMCs of an HIV-seropositive individual—Patient 1;
  • FIG. 25 is as in FIG. 24 but with Patient 2;
  • FIG. 26 a - c shows the nucleotide sequence of the H6-promoted HIV1 gp120+TM (with ELDKWA epitopes) gene (SEQ ID NOS: 135 and 136) contained in pHIV59 and vCP1307 and the protein expressed (SEQ ID NO: 137);
  • FIG. 27 shows FACS analysis of vCP1307-infected cells (FACS analysis was performed on HeLa cells infected with ALVAC, vP1286 or vCP1307 with sera from HIV1-seropositve humans (upper panel) or a human monoclonal antibody specific for the ELDKWA epitope, IAM41-2F5 (lower panel));
  • FIG. 28 a - c shows the nucleotide sequence of the H6-promoted HIV1 gp120+TM (with ELDKWA epitopes) gene (SEQ ID NOS: 138 and 139) contained in pHIV60 and vP1313 and the protein expressed (SEQ ID NO: 140);
  • FIG. 29 shows FACS analysis of vP1313-infected cells (FACS analysis was performed on HeLa cells infected with NYVAC, vP1286 or vP1313 with sera from HIV1-seropositve humans (upper panel) or a human monoclonal antibody specific for the ELDKWA epitope, IAM41-2F5 (lower panel)).
  • FIG. 30 a - c shows the nucleotide sequence of the H6-promoted HIV1 gp120+TM (with ELDKWA epitopes) gene (SEQ ID NOS: 141 to 142) contained in pHIV61 and vP1319 and the protein expressed (SEQ ID NO: 143);
  • FIG. 31 shows the FACS analysis of vP1319-infected cells (FACS analysis was performed on HeLa cells infected with WR, vP1286 or vP1319 with sera from HIV1-seropositve humans (upper panel), a human monoclonal antibody specific for the ELDKWA epitope, IAM41-2F5 (middle panel) or a mouse monoclonal antibody specific for the V3 loop, 50.1 (lower panel));
  • FIGS. 32 , 33 a , 33 b , 33 c , 34 , 35 , 36 , 37 a , 37 b , 37 c , 38 a , 38 b , 38 c show comparative body weights ( FIG. 32 ), blood counts ( FIG. 33 a - c ), creatinine ( FIG. 34 ), SGOT (35), SGPT ( FIG. 36 ), ELISA (Anti-gp160 MN/BR, -v3MN, -p24, FIGS. 37 a - c , 38 a - c ) of monkeys inoculated with vCP205 and placebo ( FIG. 32 ).
  • FIG. 33 b same layout and keying as FIG. 33 a , with upper panels indicating erythrocytes and lower panels indicating mean corpuscle volume and mean indicated by smaller darkened circle.
  • FIG. 33 c same layout as FIG. 33 b with upper panels indicating hematocrite and lower panels indicating hemoglobin.
  • FIG. 35 same keying as FIG. 34 , except IU/l vs. days.
  • FIG. 36 same keying as FIG. 35 .
  • FIGS. 37 a - c and 38 a - c ELISA in placebo administered monkeys ( FIGS. 37 a - c ) and in vCP205 administered monkeys ( FIGS. 38 a - c ), titer (log) vs.
  • FIGS. 37 a and 38 a anti-gp160 MN/BRU
  • FIGS. 37 b and 38 b anti-V3MN
  • FIGS. 37 c and 38 C anti-p24
  • monkeys 1 and 5 open circle
  • monkeys 2 and 6 darkened circle
  • monkeys 3 and 7 open inverted triangle
  • monkeys 4 and 8 darkened inverted triangle);
  • FIG. 39 shows anti-HIV1 (MN) neutralizing antibodies in monkeys inoculated with vCP205 (keying same as FIG. 38 a - c ); and,
  • FIGS. 40 , 41 a , 41 b , 41 c , 42 , 43 a , 43 b , 43 c , 43 d , 44 a , 44 b , 45 a , 45 b , 46 a , 46 b , 47 a , and 47 b show leucocyte counts ( FIG. 40 ), blood counts (erythrocytes FIG. 41 a , hematocrite FIG. 41 b , reticulocytes FIG. 41 c ), prothrombin ( FIG. 42 ), biochemical results (total cholesterol, total proteins, glucose FIG. 43 a ; sodium, potassium FIG. 43 b ; creatinine, bilirubin FIG.
  • FIG. 43 c SGOTransaminase, SGPTransaminase, alkaline phosphatase FIG. 43 d ), gp160 MN/BRU ELISA (control FIG. 44 a , test animals FIG. 44 b ), V3 MN ELISA (control FIG. 46 a , test animals FIG. 46 b ), and nef ELISA (control FIG. 47 a , test animals FIG. 47 b ) in monkeys inoculated with vCP300 and a placebo ( FIG. 40 : layout same as FIG. 33 a ; keying same as FIG.
  • FIG. 41 a layout same as FIG. 33 b , keying same as FIG. 33 a , except mean is dotted circle (left) and open circle (right).
  • FIG. 41 b layout same as FIG. 33 c , keying same as FIG. 41 a .
  • FIGS. 44 a , 44 b gp160 MN/BRU ELISA, control and vCP300, respectively; keying same as FIGS. 37 a and 38 a , respectively.
  • FIGS. 45 a , 45 b V3 MN ELISA, control and vCP300, respectively; keying same as FIGS. 37 b and 38 b , respectively.
  • FIGS. 46 a , 46 b p34 ELISA, control and vCP300, respectively; keying same as FIGS. 37 c and 38 c , respectively.
  • FIG. 47 a , 47 b nef ELISA, control and vCP300, respectively; keying as in FIGS. 44 a - 46 b ).
  • deletion loci were also engineered as recipient loci for the insertion of foreign genes.
  • NYVAC is a genetically engineered vaccinia virus strain that was generated by the specific deletion of eighteen open reading frames encoding gene products associated with virulence and host range. NYVAC is highly attenuated by a number of criteria including i) decreased virulence after intracerebral inoculation in newborn mice, ii) inocuity in genetically (nu + /nu + ) or chemically (cyclophosphamide) immunocompromised mice, iii) failure to cause disseminated infection in immunocompromised mice, iv) lack of significant induration and ulceration on rabbit skin, v) rapid clearance from the site of inoculation, and vi) greatly reduced replication competency on a number of tissue culture cell lines including those of human origin. Nevertheless, NYVAC based vectors induce excellent responses to extrinsic immunogens and provided protective immunity.
  • TROVAC refers to an attenuated fowlpox that was a plaque-cloned isolate derived from the FP-1 vaccine strain of fowlpoxvirus which is licensed for vaccination of 1 day old chicks.
  • ALVAC is an attenuated canarypox virus-based vector that was a plaque-cloned derivative of the licensed canarypox vaccine, Kanapox (Tartaglia et al., 1992).
  • Kanapox canarypox
  • ALVAC has some general properties which are the same as some general properties of Kanapox.
  • ALVAC-based recombinant viruses expressing extrinsic immunogens have also been demonstrated efficacious as vaccine vectors (Tartaglia et al., 1993 a,b).
  • This avipox vector is restricted to avian species for productive replication.
  • canarypox virus replication is aborted early in the viral replication cycle prior to viral DNA synthesis.
  • authentic expression and processing is observed in vitro in mammalian cells and inoculation into numerous mammalian species induces antibody and cellular immune responses to the extrinsic immunogen and provides protection against challenge with the cognate pathogen (Taylor et al., 1992; Taylor et al., 1991).
  • NYVAC, ALVAC and TROVAC have also been recognized as unique among all poxviruses in that the National Institutes of Health (“NIH”) (U.S. Public Health Service), Recombinant DNA Advisory Committee, which issues guidelines for the physical containment of genetic material such as viruses and vectors, i.e., guidelines for safety procedures for the use of such viruses and vectors which are based upon the pathogenicity of the particular virus or vector, granted a reduction in physical containment level: from BSL2 to BSL1. No other poxvirus has a BSL1 physical containment level. Even the Copenhagen strain of vaccinia virus—the common smallpox vaccine—has a higher physical containment level; namely, BSL2. Accordingly, the art has recognized that NYVAC, ALVAC and TROVAC have a lower pathogenicity than any other poxvirus.
  • NASH National Institutes of Health
  • TROVAC the art has recognized that NYVAC, ALVAC and TROVAC have a lower pathogenicity than any other pox
  • NYVAC- and ALVAC-based recombinant viruses have been shown to stimulate in vitro specific CD8 + CTLs from human PBMCs (Tartaglia et al., 1993a). Mice immunized with NYVAC or ALVAC recombinants expressing various forms of the HIV-1 envelope glycoprotein generated both primary and memory HIV specific CTL responses which could be recalled by a second inoculation (Tartaglia et al., 1993a; Cox et al., 1993).
  • ALVAC-env and NYVAC-env recombinants stimulated strong HIV-specific CTL responses from peripheral blood mononuclear cells (PBMC) of HIV-1 infected individuals (Tartaglia et al., 1993a; Cox et al., 1993). Acutely infected autologous PBMC were used as stimulator cells for the remaining PBMC. After 10 days incubation in the absence of exogenous IL-2, the cells were evaluated for CTL activities. NYVAC-env and ALVAC-env stimulated high levels of anti-HIV activities in mice.
  • PBMC peripheral blood mononuclear cells
  • vCP300 (ALVAC-MN120TMGNP), that expresses numerous HIV1 antigens and HIV1 T-cell epitopes.
  • vCP300 expresses the HIV1 (IIIB) gag (and protease) proteins. (Expression of the protease protein allows the gag polyprotein to be correctly processed.)
  • vCP300 also expresses a form of the HIV1 (MN) envelope glycoprotein in which gp120 is fused to the transmembrane anchor sequence derived from gp41.
  • vP300 also expresses two (2) HIV1 (BRU) nef CTL epitopes and three (3) HIV1 (IIIB) pol CTL epitopes.
  • vCP300 does not, however, express a functional reverse transcriptase activity. vCP300 also does not express a functional nef gene product; a protein associated with pathogenicity in the SIV-macaque model system and HIV1 virulence (Miller et al, 1994; Spina et al, 1994). Therefore, vCP300 expresses immunologically important antigens and/or epitopes from gag, env, pol and nef, but does not express the potentially detrimental enzymatic and/or pathogenic activities associated with pol and nef.
  • vCP300 expresses a form of HIV1 envelope glycoprotein in which the vast majority of the gp41 sequence is deleted. Since most of the immunologically important epitopes associated with the HIV1 envelope glycoprotein are found on gp120, rather than gp41, it is assumed that the immunogenicity of the envelope glycoprotein expressed by this recombinant is not adversely affected. In fact, in a side-by-side analysis, an HIV1 gp120 subunit vaccine was able to protect chimpanzees against an HIV1 challenge, whereas an HIV1 gp160 subunit vaccine was not (Berman et al., 1990). It is not known why the efficacy of these two vaccines is different.
  • antibodies against an epitope gp41 can enhance HIV1 infection in vitro (Robinson et al., 1990). Furthermore, it is known that antibodies to a putative immunosuppressive region of gp41 are associated with the absence of AIDS in HIV1-seropositive individuals, suggesting a potential role in pathogenicity for this region (Klasse et al., 1988). In addition, it is known that antibodies to the C-terminal region of gp41 can cross-react with HLA class II antigens (Golding et al., 1988) and inhibit antigen-specific lymphoproliferative responses (Golding et al., 1989).
  • the envelope glycoprotein expressed by vCP300 does not contain any gp41 sequence, except for the 28 amino acids associated with the transmembrane region, the potentially detrimental effects associated with gp41 are avoided. Furthermore, the envelope glycoprotein expressed by vCP300 does not contain the immunodominant epitope on gp41 that is recognized by antisera from every HIV1-seropositive individual from every stage of an HIV1 infection (Shafferman et al., 1989). Therefore, diagnostic tests based upon reactivity against this epitope can be used to distinguish between vaccinated and infected individuals.
  • vCP300-vaccinated individuals from HIV1-infected individuals with a gp41 antibody assay is important because the most commonly used diagnostic kit (which assays for the presence of HIV1 p24 antibodies) would be useless, since vCP300-vaccinated individuals would be expected to have a high level of p24 antibodies.
  • HIV-1 infected individuals would be expected to make anti-gp41 antibodies but those vaccinated with vCP205 or vCP300 would not since gp41 is absent from vCP205 or vCP300.
  • Rabbits and guinea pigs have been inoculated with an ALVAC recombinant (vCP205; ALVAC-MN120TMG) expressing the same cell surface-associated form of HIV1 gp120 (120TM) and Gag/pro as expressed by vCP300. Rabbits and guinea pigs have also been inoculated with vCP205 and boosted with an HIV1 T-B peptide. Both ALVAC-based protocols were able to elicit HIV1 gp160- and V3 loop-specific antibodies, thereby indicating that an ALVAC recombinant expressing the cell surface form of HIV1 gp120 induces an HIV1-specific immune response.
  • ALVAC-based protocols were able to elicit HIV1 gp160- and V3 loop-specific antibodies, thereby indicating that an ALVAC recombinant expressing the cell surface form of HIV1 gp120 induces an HIV1-specific immune response.
  • vCP300 expresses the HIV1 Gag proteins, a cell surface-associated form of the HIV1 gp120 envelope glycoprotein, two (2) regions from HIV1 nef containing CTL epitopes and three (3) regions from HIV1 pol containing CTL epitopes.
  • the expression of an HIV1 envelope glycoprotein that does not contain gp41 allows vaccinated individuals to be differentiated from HIV1-infected individuals via an assay for gp41 antibodies and eliminates potentially detrimental responses associated with various gp41 epitopes.
  • HIV1 gp160 Since a previous ALVAC recombinant expressing HIV1 gp160 has been shown to elicit HIV1-specific humoral and cellular immune responses in humans (Pialoux et al., 1995), the addition of Gag and the Pol and Nef epitopes (and the deletion of the potentially detrimental gp41 epitopes) heightens and broadens the immune response elicited by vP300, relative to vCP125, and, may provide an efficacious HIV1 vaccine, or immunological or antigenic composition.
  • recombinants of the invention present it to the immune system in a more immunogenic setting, such as within the V3 loop of gp120 or within other regions of gp120 and/or as part of an intact gp160 envelope.
  • ALVAC recombinant (vCP1307), NYVAC recombinant (vP1313) and COPAK recombinant (vP1319) express a form of the HIV1 gp120+TM gene product in which the V3 loop has been modified to contain two copies of the ELDKWA epitope.
  • the ELDKWA epitopes of this gp120+TM (with ELDKWA epitopes) gene product are expressed on the surface of vCP1307-, vP1313- and vP1319-infected cells.
  • the V3 loop of HIV1 gp120+TM (or gp160) can be used as an immunological platform for any linear epitope, not just linear HIV1 epitopes.
  • the gp120+TM (with epitopes of interest) protein generated by these recombinants can also be isolated from poxvirus-infected cells and used to inoculate individuals in a subunit vaccine configuration (composition, or an antigenic or immunological composition).
  • the proteins generated by the recombinants and antibodies elicited therefrom can also be used in assays to detect the presence or absence of HIV. Accordingly, the invention comprehends HIV immunogens and modified gp120 and gp160.
  • envelope-based immunogens HIV immunogens or unmodified gp120 or gp160 (can be derived from any eukaryotic or prokaryotic expression vector and used as subunit preparations or can be administered through DNA immunization using an appropriate expression plasmid. Techniques for DNA immunization are known in the art.
  • DNA immunization With respect to techniques for DNA immunization, mention is particularly made of Nabel and Felgner, “Direct gene transfer for immunotherapy and immunization”, Tibtech, May 1993, 11; 211-215, and Webster et al, “protection of ferrets against influenza challenge with a DNA vaccine to the haemagglutinin”, vaccine, 1994, 12(16): 1495-1498, incorporated herein by reference. Also, the DNA from the recombinants vP1313, vP1319 and vCP1307 can be used to probe for the presence of HIV DNA in a sample of interest using known hybridization techniques, or, to generate PCR primers using known techniques.
  • the administration procedure for recombinant virus, immunogen, modified gp120 or gp160, DNA or expression product compositions of the invention can be via a parenteral route (intradermal, intramuscular or subcutaneous). Such an administration enables a systemic immune response.
  • compositions containing the poxvirus recombinants, expression products, immunogens, DNA, modified gp120 or gp160 of the invention can be prepared in accordance with standard techniques well known to those skilled in the pharmaceutical art.
  • Such compositions can be administered in dosages and by techniques well known to those skilled in the medical arts taking into consideration such factors as the age, sex, weight, and condition of the particular patient, and the route of administration.
  • the compositions can be administered alone, or can be co-administered or sequentially administered with compositions of the invention or with other immunological, antigenic or vaccine or therapeutic compositions in seropositive individuals.
  • compositions can be administered alone, or can be co-administered or sequentially administered with compositions of the invention or with other antigenic, immunological, vaccine or therapeutic compositions in seronegative individuals.
  • Such other compositions can include purified antigens from immunodeficiency virus or from the expression of such antigens by a recombinant poxvirus or other vector system or, such other compositions can include a recombinant poxvirus which expresses other immunodeficiency antigens or biological response modifiers (e.g. cytokines; co-stimulating molecules).
  • co-administration is performed by taking into consideration such known factors as the age, sex, weight, and condition of the particular patient, and, the route of administration.
  • compositions of the invention include liquid preparations for orifice, e.g., oral, nasal, anal, vaginal, etc., administration such as suspensions, syrups or elixirs; and, preparations for parenteral, subcutaneous, intradermal, intramuscular or intravenous administration (e.g., injectable administration) such as sterile suspensions or emulsions.
  • parenteral, subcutaneous, intradermal, intramuscular or intravenous administration e.g., injectable administration
  • sterile suspensions or emulsions e.g., injectable administration
  • the recombinant poxvirus, expression product, immunogen, DNA, or modified gp120 or gp160 may be in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose or the like.
  • the products of expression of the inventive recombinant poxviruses can be used directly to stimulate an immune response in either seronegative or seropositive individuals or in animals.
  • the expression products can be used in compositions of the invention instead or in addition to the inventive recombinant poxvirus in the aforementioned compositions.
  • the immunogens of the invention can be similarly used.
  • inventive recombinant poxvirus and the expression products therefrom and immunogens and modified gp120 or gp160 of the invention stimulate an immune or antibody response in humans and animals.
  • monoclonal antibodies can be prepared and, those monoclonal antibodies, can be employed in well known antibody binding assays, diagnostic kits or tests to determine the presence or absence of particular immunodeficiency virus antigen(s) and therefore the presence or absence of the virus, or to determine whether an immune response to the virus or antigen(s) has simply been stimulated.
  • Those monoclonal antibodies can also be employed in immunoadsorption chromatography to recover immunodeficiency virus or expression products of the inventive recombinant poxvirus.
  • Monoclonal antibodies are immunoglobulins produced by hybridoma cells.
  • a monoclonal antibody reacts with a single antigenic determinant and provides greater specificity than a conventional, serum-derived antibody. Furthermore, screening a large number of monoclonal antibodies makes it possible to select an individual antibody with desired specificity, avidity and isotype.
  • Hybridoma cell lines provide a constant, inexpensive source of chemically identical antibodies and preparations of such antibodies can be easily standardized. Methods for producing monoclonal antibodies are well known to those of ordinary skill in the art, e.g., Koprowski, H. et al., U.S. Pat. No. 4,196,265, issued Apr. 1, 1989, incorporated herein by reference.
  • monoclonal antibodies Uses of monoclonal antibodies are known. One such use is in diagnostic methods, e.g., David, G. and Greene, H. U.S. Pat. No. 4,376,110, issued Mar. 8, 1983; incorporated herein by reference. Monoclonal antibodies have also been used to recover materials by immunoadsorption chromatography, e.g., Milstein, C. 1980, Scientific American 243:66, 70, incorporated herein by reference.
  • inventive recombinant poxvirus or expression products therefrom or the inventive immunogens or modified gp120 or gp160 can be used to stimulate a response in cells such as lymphocytes or CTLs in vitro or ex vivo for subsequent reinfusion into a patient.
  • the reinfusion is to stimulate an immune response, e.g., an immunological or antigenic response such as active immunization.
  • the reinfusion is to stimulate or boost the immune system against immunodeficiency virus.
  • DNA from inventive recombinants can be used as probes to detect the presence of HIV DNA in a sample or, to generate PCR primers, or for DNA immunization using an appropriate expression plasmid, by methods known in the art. (See Nabel and Felger and Webster et al, Supra)
  • the inventive recombinant poxvirus has several utilities: In antigenic, immunological or vaccine compositions such as for administration to seronegative individuals. In therapeutic compositions in seropositive individuals in need of therapy to stimulate or boost the immune system against immunodeficiency virus. In vitro to produce antigens or the inventive immunogens or the inventive modified gp120 or gp160 which can be further used in antigenic, immunological or vaccine compositions or in therapeutic compositions.
  • antibodies either by direct administration or by administration of an expression product of the inventive recombinant poxvirus which can be further used: in diagnosis, tests or kits to ascertain the presence or absence of antigens in a sample such as sera, for instance, to ascertain the presence or absence of immunodeficiency virus or CTLs in a sample such as sera or, to determine whether an immune response has elicited to the virus or, to particular antigen(s); or, in immunoadsorption chromatography (the inventive immunogens and modified gp120 or gp160 can also be used to generate antibodies which can be also so further used).
  • DNA for use as hybridization probes or to prepare PCR primers or for DNA immunization.
  • inventive recombinant poxvirus, expression products therefrom, immunogens and modified gp120 or gp160 can be used to generate stimulated cells which can be further used (reinfused) to stimulate an immune response (antigenic, or immunological response; or active immunization) or, to boost or stimulate the immune system (for instance, of an immunocompromised or seropositive individual).
  • an immune response antigenic, or immunological response; or active immunization
  • Other utilities also exist for embodiments of the invention.
  • Plasmids were constructed, screened and grown by standard procedures (Maniatis et al., 1982; Perkus et al., 1985; Piccini et al., 1987). Restriction endonucleases were obtained from Bethesda Research Laboratories, Gaithersburg, Md., New England Biolabs, Beverly, Mass.; and Boehringer Mannheim Biochemicals, Indianapolis, Ind. Klenow fragment of E. coli polymerase was obtained from Boehringer Mannheim Biochemicals. BAL-31 exonuclease and phage T4 DNA ligase were obtained from New England Biolabs. The reagents were used as specified by the various suppliers.
  • Synthetic oligodeoxyribonucleotides were prepared on a Biosearch 8750 or Applied Biosystems 380B DNA synthesizer as previously described (Perkus et al., 1989). DNA sequencing was performed by the dideoxy-chain termination method (Sanger et al., 1977) using Sequenase (Tabor et al., 1987) as previously described (Guo et al., 1989).
  • DNA amplification by polymerase chain reaction (PCR) for sequence verification was performed using custom synthesized oligonucleotide primers and GeneAmp DNA amplification Reagent Kit (Perkin Elmer Cetus, Norwalk, Conn.) in an automated Perkin Elmer Cetus DNA Thermal Cycler. Excess DNA sequences were deleted from plasmids by restriction endonuclease digestion followed by limited digestion by BAL-31 exonuclease and mutagenesis (Mandecki, 1986) using synthetic oligonucleotides.
  • PCR polymerase chain reaction
  • the parental canarypox virus (Rentschler strain) is a vaccinal strain for canaries.
  • the vaccine strain was obtained from a wild type isolate and attenuated through more than 200 serial passages on chick embryo fibroblasts.
  • a master viral seed was subjected to four successive plaque purifications under agar and one plaque clone was amplified through five additional passages after which the stock virus was used as the parental virus in in vitro recombination tests.
  • the plaque purified canarypox isolate is designated ALVAC.
  • the strain of fowlpox virus (FPV) designated FP-1 has been described previously (Taylor et al., 1988a). It is an attenuated vaccine strain useful in vaccination of day old chickens.
  • the parental virus strain Duvette was obtained in France as a fowlpox scab from a chicken. The virus was attenuated by approximately 50 serial passages in chicken embryonated eggs followed by 25 passages on chicken embryo fibroblast cells. The virus was subjected to four successive plaque purifications. One plaque isolate was further amplified in primary CEF cells and a stock virus, designated as TROVAC, established.
  • NYVAC, ALVAC and TROVAC viral vectors and their derivatives were propagated as described previously (Piccini et al., 1987; Taylor et al., 1988a,b). Vero cells and chick embryo fibroblasts (CEF) were propagated as described previously (Taylor et al., 1988a,b).
  • plasmid pSD406 contains vaccinia HindIII J (pos. 83359-88377) cloned into pUC8.
  • pSD406 was cut with HindIII and PvuII, and the 1.7 kb fragment from the left side of HindIII J cloned into pUC8 cut with HindIII/SmaI, forming pSD447.
  • pSD447 contains the entire gene for J2R (pos. 83855-84385).
  • the initiation codon is contained within an NlaIII site and the termination codon is contained within an SspI site.
  • Direction of transcription is indicated by an arrow in FIG. 1 .
  • pSD447 was cut with SspI (partial) within vaccinia sequences and HindIII at the pUC/vaccinia junction, and a 2.9 kb vector fragment isolated.
  • This vector fragment was ligated with annealed synthetic oligonucleotides MPSYN45/MPSYN46 (SEQ ID NO:3/SEQ ID NO:4)
  • pSD460 was used as donor plasmid for recombination with wild type parental vaccinia virus Copenhagen strain VC-2.
  • 32 P labelled probe was synthesized by primer extension using MPSYN45 (SEQ ID NO:3) as template and the complementary 20mer oligonucleotide MPSYN47 (SEQ ID NO:5) (5′ TTAGTTAATTAGGCGGCCGC 3′) as primer.
  • Recombinant virus vP410 was identified by plaque hybridization.
  • Plasmid pSD486 for Deletion of Hemorrhagic Region (B13R+B14R)
  • plasmid pSD419 contains vaccinia SalI G (pos. 160, 744-173,351) cloned into pUC8.
  • pSD422 contains the contiguous vaccinia SalI fragment to the right, SalI J (pos. 173, 351-182,746) cloned into pUC8.
  • u, B13R-B14R pos. 172, 549-173,552
  • pSD419 was used as the source for the left flanking arm and pSD422 was used as the source of the right flanking arm.
  • the direction of transcription for the u region is indicated by an arrow in FIG. 2 .
  • sequences to the left of the NcoI site were removed by digestion of pSD419 with NcoI/SmaI followed by blunt ending with Klenow fragment of E. coli polymerase and ligation generating plasmid pSD476.
  • a vaccinia right flanking arm was obtained by digestion of pSD422 with HpaI at the termination codon of B14R and by digestion with NruI 0.3 kb to the right. This 0.3 kb fragment was isolated and ligated with a 3.4 kb HincII vector fragment isolated from pSD476, generating plasmid pSD477.
  • the location of the partial deletion of the vaccinia u region in pSD477 is indicated by a triangle.
  • the remaining B13R coding sequences in pSD477 were removed by digestion with ClaI/HpaI, and the resulting vector fragment was ligated with annealed synthetic oligonucleotides SD22mer/SD20mer (SEQ ID NO:6/SEQ ID NO:7)
  • pSD479 contains an initiation codon (underlined) followed by a BamHI site.
  • E. coli Beta-galactosidase in the B13-B14 (u) deletion locus under the control of the u promoter, a 3.2 kb BamHI fragment containing the Beta-galactosidase gene (Shapira et al., 1983) was inserted into the BamHI site of pSD479, generating pSD479BG.
  • pSD479BG was used as donor plasmid for recombination with vaccinia virus vP410.
  • Recombinant vaccinia virus vP533 was isolated as a blue plaque in the presence of chromogenic substrate X-gal.
  • vP533 the B13R-B14R region is deleted and is replaced by Beta-galactosidase.
  • plasmid pSD486 a derivative of pSD477 containing a polylinker region but no initiation codon at the u deletion junction, was utilized.
  • ClaI/HpaI vector fragment from pSD477 referred to above was ligated with annealed synthetic oligonucleotides SD42mer/SD40mer (SEQ ID NO:8/SEQ ID NO:9)
  • pSD486 was used as donor plasmid for recombination with recombinant vaccinia virus vP533, generating vP553, which was isolated as a clear plaque in the presence of X-gal.
  • pSD414 contains SalI B cloned into pUC8.
  • pSD414 was cut with XbaI within vaccinia sequences (pos. 137,079) and with HindIII at the pUC/vaccinia junction, then blunt ended with Klenow fragment of E. coli polymerase and ligated, resulting in plasmid pSD483.
  • pSD483 was cut with EcoRI (pos. 140,665 and at the pUC/vaccinia junction) and ligated, forming plasmid pSD484.
  • pSD484 was cut with NdeI (partial) slightly upstream from the A26L ORF (pos. 139,004) and with HpaI (pos. 137,889) slightly downstream from the A26L ORF.
  • NdeI partial
  • HpaI pos. 137,889
  • BglII and EcoRI sites in the polylinker region of pSD485 are not unique, unwanted BglII and EcoRI sites were removed from plasmid pSD483 (described above) by digestion with BglII (pos. 140,136) and with EcoRI at the pUC/vaccinia junction, followed by blunt ending with Klenow fragment of E. coli polymerase and ligation.
  • the resulting plasmid was designated pSD489.
  • plasmid pSD492 was deleted by mutagenesis (Mandecki, 1986) using synthetic oligonucleotide MPSYN177 (SEQ ID NO:14) (5′ AAAATGGGCGTGGATTGTTAACTTTATATAACTTATTTTTTGAATATAC 3′).
  • MPSYN177 SEQ ID NO:14
  • vaccinia DNA encompassing positions [137,889-138,937], including the entire A26L ORF is deleted.
  • vaccinia SalI G restriction fragment (pos. 160, 744-173,351) crosses the HindIII A/B junction (pos. 162,539).
  • pSD419 contains vaccinia SalI G cloned into pUC8.
  • the direction of transcription for the hemagglutinin (HA) gene is indicated by an arrow in FIG. 4 .
  • Vaccinia sequences derived from HindIII B were removed by digestion of pSD419 with HindIII within vaccinia sequences and at the pUC/vaccinia junction followed by ligation.
  • the resulting plasmid, pSD456, contains the HA gene, A56R, flanked by 0.4 kb of vaccinia sequences to the left and 0.4 kb of vaccinia sequences to the right.
  • A56R coding sequences were removed by cutting pSD456 with RsaI (partial; pos. 161,090) upstream from A56R coding sequences, and with EagI (pos. 162,054) near the end of the gene.
  • the 3.6 kb RsaI/EagI vector fragment from pSD456 was isolated and ligated with annealed synthetic oligonucleotides MPSYN59 (SEQ ID NO:15), MPSYN62 (SEQ ID NO:16), MPSYN60 (SEQ ID NO:17), and MPSYN61 (SEQ ID NO:18)
  • Beta-galactosidase sequences were deleted from vP708 using donor plasmid pSD467.
  • pSD467 is identical to pSD466, except that EcoRI, SmaI and BamHI sites were removed from the pUC/vaccinia junction by digestion of pSD466 with EcoRI/BamHI followed by blunt ending with Klenow fragment of E. coli polymerase and ligation.
  • Recombination between vP708 and pSD467 resulted in recombinant vaccinia deletion mutant, vP723, which was isolated as a clear plaque in the presence of X-gal.
  • pSD420 is SalI H cloned into pUC8.
  • pSD435 is KpnI F cloned into pUC18.
  • pSD435 was cut with SphI and religated, forming pSD451.
  • DNA sequences to the left of the SphI site (pos. 27,416) in HindIII M are removed (Perkus et al., 1990).
  • pSD409 is HindIII M cloned into pUC8.
  • E. coli Beta-galactosidase was first inserted into the vaccinia M2L deletion locus (Guo et al., 1990) as follows. To eliminate the BglII site in pSD409, the plasmid was cut with BglII in vaccinia sequences (pos. 28,212) and with BamHI at the pUC/vaccinia junction, then ligated to form plasmid pMP409B. pMP409B was cut at the unique SphI site (pos. 27,416). M2L coding sequences were removed by mutagenesis (Guo et al., 1990; Mandecki, 1986) using synthetic oligonucleotide
  • MPSYN82 (SEQ ID NO: 19) Bgl II 5′ TTTCTGTATATTTGCACCAATTTAGATCTT-ACTCAAAATATGTAAC AATA 3′
  • the resulting plasmid, pMP409D contains a unique BglII site inserted into the M2L deletion locus as indicated above.
  • a 3.2 kb BamHI (partial)/BglII cassette containing the E. coli Beta-galactosidase gene (Shapira et al., 1983) under the control of the 11 kDa promoter (Bertholet et al., 1985) was inserted into pMP409D cut with BglII.
  • pMP409DBG The resulting plasmid, pMP409DBG (Guo et al., 1990), was used as donor plasmid for recombination with rescuing vaccinia virus vP723.
  • a plasmid deleted for vaccinia genes [C7L-K1L] was assembled in pUC8 cut with SmaI, HindIII and blunt ended with Klenow fragment of E. coli polymerase.
  • the left flanking arm consisting of vaccinia HindIII C sequences was obtained by digestion of pSD420 with XbaI (pos. 18,628) followed by blunt ending with Klenow fragment of E. coli polymerase and digestion with BglII (pos. 19,706).
  • the right flanking arm consisting of vaccinia HindIII K sequences was obtained by digestion of pSD451 with BglII (pos. 29,062) and EcoRV (pos. 29,778).
  • the resulting plasmid, pMP581CK is deleted for vaccinia sequences between the BglII site (pos. 19,706) in HindIII C and the BglII site (pos. 29,062) in HindIII K.
  • the site of the deletion of vaccinia sequences in plasmid pMP581CK is indicated by a triangle in FIG. 5 .
  • plasmid pMP581CK was cut at the NcoI sites within vaccinia sequences (pos. 18,811; 19,655), treated with Bal-31 exonuclease and subjected to mutagenesis (Mandecki, 1986) using synthetic oligonucleotide MPSYN233 (SEQ ID NO:20) 5′-TGTCATTTAACACTATACTCATATTAATAAAAATAATATTTATT-3′.
  • the resulting plasmid, pMPCSK18 is deleted for vaccinia sequences positions 18,805-29,108, encompassing 12 vaccinia open reading frames [C7L-K1L].
  • plasmid pSD405 contains vaccinia HindIII I (pos. 63, 875-70,367) cloned in pUC8.
  • pSD405 was digested with EcoRV within vaccinia sequences (pos. 67,933) and with SmaI at the pUC/vaccinia junction, and ligated, forming plasmid pSD518.
  • pSD518 was used as the source of all the vaccinia restriction fragments used in the construction of pSD548.
  • the vaccinia I4L gene extends from position 67,371-65,059. Direction of transcription for I4L is indicated by an arrow in FIG. 6 .
  • pSD518 was digested with BamHI (pos. 65,381) and HpaI (pos. 67,001) and blunt ended using Klenow fragment of E. coli polymerase. This 4.8 kb vector fragment was ligated with a 3.2 kb SmaI cassette containing the E.
  • coli Beta-galactosidase gene (Shapira et al., 1983) under the control of the vaccinia 11 kDa promoter (Bertholet et al., 1985; Perkus et al., 1990), resulting in plasmid pSD524 KBG.
  • pSD524 KBG was used as donor plasmid for recombination with vaccinia virus vP804.
  • Recombinant vaccinia virus, vP855, containing Beta-galactosidase in a partial deletion of the I4L gene was isolated as a blue plaque in the presence of X-gal.
  • deletion plasmid pSD548 was constructed.
  • the left and right vaccinia flanking arms were assembled separately in pUC8 as detailed below and presented schematically in FIG. 6 .
  • pUC8 was cut with BamHI/EcoRI and ligated with annealed synthetic oligonucleotides 518A1/518A2
  • pUC8 was cut with BamHI/EcoRI and ligated with annealed synthetic oligonucleotides 518B1/518B2
  • pSD518 was cut with RsaI within vaccinia sequences (pos. 67,436) and EcoRI at the vaccinia/pUC junction, and a 0.6 kb fragment isolated. The two fragments were ligated together, forming pSD538, which contains the complete vaccinia flanking arm to the right of I4L coding sequences.
  • the right vaccinia flanking arm was isolated as a 0.6 kb EcoRI/BglII fragment from pSD538 and ligated into pSD537 vector plasmid cut with EcoRI/BglII.
  • the I4L ORF pos. 65, 047-67,386
  • a polylinker region which is flanked by 0.6 kb vaccinia DNA to the left and 0.6 kb vaccinia DNA to the right, all in a pUC background.
  • the site of deletion within vaccinia sequences is indicated by a triangle in FIG. 6 .
  • the vaccinia I4L deletion cassette was moved from pSD539 into pRC11, a pUC derivative from which all Beta-galactosidase sequences have been removed and replaced with a polylinker region (Colinas et al., 1990).
  • pSD539 was cut with EcoRI/PstI and the 1.2 kb fragment isolated. This fragment was ligated into pRC11 cut with EcoRI/PstI (2.35 kb), forming pSD548.
  • DNA from recombinant vaccinia virus vP866 was analyzed by restriction digests followed by electrophoresis on an agarose gel. The restriction patterns were as expected. Polymerase chain reactions (PCR) (Engelke et al., 1988) using vP866 as template and primers flanking the six deletion loci detailed above produced DNA fragments of the expected sizes. Sequence analysis of the PCR generated fragments around the areas of the deletion junctions confirmed that the junctions were as expected.
  • NYVAC was deposited under the terms of the Budapest Treaty on Mar. 6, 1997 with the American Type Culture Collection (ATCC), P.O. Box 1549, Manassas, Va. 20108 USA under ATCC accession number VR-2559.
  • telomere sequence under the control of the vaccinia H6 promoter (Taylor et al., 1988a,b) was inserted into TK deletion plasmid pSD513.
  • pSD513 is identical to plasmid pSD460 ( FIG. 1 ) except for the presence of a polylinker region.
  • the polylinker region was inserted by cutting pSD460 with SmaI and ligating the plasmid vector with annealed synthetic oligonucleotides VQ1A/VQ1B (SEQ ID NO:25/SEQ ID NO:26)
  • pSD513 was cut with SmaI and ligated with a SmaI ended 1.8 kb cassette containing the gene encoding the rabies glycoprotein G gene under the control of the vaccinia H6 promoter (Taylor et al., 1988a,b). The resulting plasmid was designated pRW842.
  • pRW842 was used as donor plasmid for recombination with NYVAC rescuing virus (vP866).
  • Recombinant vaccinia virus vP879 was identified by plaque hybridization using 32 P-labelled DNA probe to rabies glycoprotein G coding sequences.
  • the modified recombinant viruses of the present invention provide advantages as recombinant vaccine vectors.
  • the attenuated virulence of the vector advantageously reduces the opportunity for the possibility of a runaway infection due to vaccination in the vaccinated individual and also diminishes transmission from vaccinated to unvaccinated individuals or contamination of the environment.
  • the modified recombinant viruses are also advantageously used in a method for expressing a gene product in a cell cultured in vitro by introducing into the cell the modified recombinant virus having foreign DNA which codes for and expresses gene products in the cell.
  • TROVAC a fowlpox virus vector and, of a fowlpox Newcastle Disease Virus recombinant designated TROVAC-NDV and its safety and efficacy.
  • TROVAC-NDV expresses authentically processed NDV glycoproteins in avian cells infected with the recombinant virus and inoculation of day old chicks protects against subsequent virulent NDV challenge.
  • the Texas strain of NDV is a velogenic strain. Preparation of cDNA clones of the F and HN genes has been previously described (Taylor et al., 1990; Edbauer et al., 1990). The strain of FPV designated FP-1 has been described previously (Taylor et al., 1988a). It is a vaccine strain useful in vaccination of day old chickens.
  • the parental virus strain Duvette was obtained in France as a fowlpox scab from a chicken. The virus was attenuated by approximately 50 serial passages in chicken embryonated eggs followed by 25 passages on chicken embryo fibroblast cells. The virus was subjected to four successive plaque purifications.
  • TROVAC a stock virus, designated as TROVAC, established.
  • the stock virus used in the in vitro recombination test to produce TROVAC-NDV had been subjected to twelve passages in primary CEF cells from the plaque isolate.
  • TROVAC was deposited under the terms of the Budapest Treaty on Feb. 6, 1997 with the American Type Culture Collection (ATCC), P.O. Box 1549, Manassas, Va. 20108 USA under ATCC accession number VR-2553.
  • a HindIII-EcoRV fragment containing the H6 promoter sequence was then inserted into pCE13 to form pCE38.
  • a perfect 5′ end was generated by digesting pCE38 with KpnI and NruI and inserting the annealed and kinased oligonucleotides CE75 (SEQ ID NO:27) and CE76 (SEQ ID NO:28) to generate pCE47.
  • CE75 CGATATCCGTTAAGTTTGTATCGTAATGGGCTCCAGATCTTCTACCAGGA TCCCGGTAC
  • CE76 CGGGATCCTGGTAGAAGATCTGGAGCCCATTACGATACAAACTTAACGGA TATCG.
  • CE42 AATTCGAGCTCCCCGGG
  • CE43 CCCGGGGAGCTCG
  • a HindIII-PstI fragment of pCE47 was inserted into the HindIII and PstI sites of pCE32 to form pCE49.
  • the H6 promoted NDV-F sequences were then transferred to the de-ORFed F8 locus (described below) by cloning a HindIII-NruI fragment from pCE49 into the HindIII and SmaI sites of pJCA002 (described below) to form pCE54.
  • Transcription stop signals were inserted into pCE54 by digesting pCE54 with SacI, partially digesting with BamHI and inserting the annealed and kinased oligonucleotides CE166 (SEQ ID NO:31) and CE167 (SEQ ID NO:32) to generate pCE58.
  • CE166 CTTTTTATAAAAAGTTAACTACGTAG
  • CE167 GATCCTACGTAGTTAACTTTTTATAAAAAGAGCT
  • PCR polymerase chain reaction
  • CE182 CTTAACTCAGCTGACTATCC
  • CE183 TACGTAGTTAACTTTTTATAAAAATCATATTTTTGTAGTGGCTC
  • Plasmid pRW846 is essentially equivalent to plasmid pJCA002 (described below) but containing the H6 promoter and transcription and translation stop signals. Digestion of pRW846 with HindIII and HpaI eliminates the H6 promoter but leaves the stop signals intact.
  • Construction of Cassette for NDV-HN Construction of plasmid pRW802 was previously described in Edbauer et al., 1990. This plasmid contains the NDV-HN sequences linked to the 3′ end of the vaccinia virus H6 promoter in a pUC9 vector. A HindIII-EcoRV fragment encompassing the 5′ end of the vaccinia virus H6 promoter was inserted into the HindIII and EcoRV sites of pRW802 to form pRW830.
  • NDV-HN A perfect 3′ end for NDV-HN was obtained by inserting the annealed and kinased oligonucleotides CE162 (SEQ ID NO:35) and CE163 (SEQ ID NO:36) into the EcoRI site of pRW830 to form pCE59, the final cassette for NDV-HN.
  • CE162 AATTCAGGATCGTTCCTTTACTAGTTGAGATTCTCAAGGATGATGGGATT TAATTTTTATAAGCTTG
  • CE163 AATTCAAGCTTATAAAAATTAAATCCCATCATCCTTGAGAATCTCAACTA GTAAAGGAACGATCCTG
  • Plasmid pRW731-15 contains a 10 kb PvuII-PvuII fragment cloned from genomic DNA. The nucleotide sequence was determined on both strands for a 3660 bp PvuII-EcoRV fragment and is shown in FIG. 11 (SEQ ID NO:67). The limits of an open reading frame designated here as F8 were determined. Plasmid pRW761 is a sub-clone of pRW731-15 containing a 2430 bp EcoRV-EcoRV fragment. The F8 ORF was entirely contained between an XbaI site and an SspI site in pRW761.
  • Plasmid pRW761 was completely digested with XbaI and partially digested with SspI. A 3700 bp XbaI-SspI band was isolated from the gel and ligated with the annealed double-stranded oligonucleotides JCA017 (SEQ ID NO:37) and JCA018 (SEQ ID NO:38).
  • JCA017 5′ CTAGACACTTTATGTTTTTTAATATCCGGTCTTAAAAGCTTCCCGGG GATCCTTATACGGGGAATAAT JCA018: 5′ ATTATTCCCCGTATAAGGATCCCCCGGGAAGCTTTTAAGACCGGATA TTAAAAAACATAAAGTGT
  • pJCA002 The plasmid resulting from this ligation was designated pJCA002.
  • Double Insertion Vector for NDV F and HN The H6 promoted NDV-HN sequence was inserted into the H6 promoted NDV-F cassette by cloning a HindIII fragment from pCE59 that had been filled in with Klenow fragment of E. coli DNA polymerase into the HpaI site of pCE71 to form pCE80. Plasmid pCE80 was completely digested with NdeI and partially digested with BglII to generate an NdeI-BglII 4760 bp fragment containing the NDV F and HN genes both driven by the H6 promoter and linked to F8 flanking arms.
  • Plasmid pJCA021 was obtained by inserting a 4900 bp PvuII-HindIII fragment from pRW731-15 into the SmaI and HindIII sites of pBSSK+. Plasmid pJCA021 was then digested with NdeI and BglII and ligated to the 4760 bp NdeI-BglII fragment of pCE80 to form pJCA024. Plasmid pJCA024 therefore contains the NDV-F and HN genes inserted in opposite orientation with 3′ ends adjacent between FPV flanking arms. Both genes are linked to the vaccinia virus H6 promoter. The right flanking arm adjacent to the NDV-F sequence consists of 2350 bp of FPV sequence. The left flanking arm adjacent to the NDV-HN sequence consists of 1700 bp of FPV sequence.
  • Plasmid pJCA024 was transfected into TROVAC infected primary CEF cells by using the calcium phosphate precipitation method previously described (Panicali et al., 1982; Piccini et al., 1987). Positive plaques were selected on the basis of hybridization to specific NDV-F and HN radiolabelled probes and subjected to five sequential rounds of plaque purification until a pure population was achieved. One representative plaque was then amplified and the resulting TROVAC recombinant was designated TROVAC-NDV (vFP96).
  • Immunofluorescence Indirect immunofluorescence was performed as described (Taylor et al., 1990) using a polyclonal anti-NDV serum and, as mono-specific reagents, sera produced in rabbits against vaccinia virus recombinants expressing NDV-F or NDV-HN.
  • Immunoprecipitation was performed as described (Taylor et al., 1990) using a polyclonal anti-NDV serum obtained from SPAFAS Inc., Storrs, Conn.
  • the stock virus was screened by in situ plaque hybridization to confirm that the F8 ORF was deleted.
  • the correct insertion of the NDV genes into the TROVAC genome and the deletion of the F8 ORF was also confirmed by Southern blot hybridization.
  • the F glycoprotein is anchored in the membrane via a hydrophobic transmembrane region near the carboxyl terminus and requires post-translational cleavage of a precursor, F 0 , into two disulfide linked polypeptides F 1 and F 2 .
  • Cleavage of F 0 is important in determining the pathogenicity of a given NDV strain (Homma and Ohuchi, 1973; Nagai et al., 1976; Nagai et al., 1980), and the sequence of amino acids at the cleavage site is therefore critical in determining viral virulence.
  • F and HN genes in TROVAC-NDV was analyzed to confirm that the gene products were authentically processed and presented.
  • Indirect-immunofluorescence using a polyclonal anti-NDV chicken serum confirmed that immunoreactive proteins were presented on the infected cell surface.
  • mono-specific rabbit sera were produced against vaccinia recombinants expressing either the F or HN glycoproteins. Indirect immunofluorescence using these sera confirmed the surface presentation of both proteins.
  • Immunoprecipitation experiments were performed by using ( 35 S) methionine labeled lysates of CEF cells infected with parental and recombinant viruses.
  • the expected values of apparent molecular weights of the glycosylated forms of F 1 and F 2 are 54.7 and 10.3 kDa respectively (Chambers et al., 1986).
  • fusion specific products of the appropriate size were detected from the NDV-F single recombinant vFP29 (Taylor et al., 1990) and the TROVAC-NDV double recombinant vFP96.
  • the HN glycoprotein of appropriate size was also detected from the NDV-HN single recombinant VFP-47 (Edbauer et al., 1990) and TROVAC-NDV. No NDV specific products were detected from uninfected and parental TROVAC infected CEF cells.
  • the F and HN glycoproteins are appropriately presented on the infected cell surface where they are recognized by NDV immune serum. Immunoprecipitation analysis indicated that the F 0 protein is authentically cleaved to the F 1 and F2 components required in virulent strains. Similarly, the HN glycoprotein was authentically processed in CEF cells infected with recombinant TROVAC-NDV.
  • This example describes the development of ALVAC, a canarypox virus vector and, of a canarypox-rabies recombinant designated as ALVAC-RG (vCP65) and its safety and efficacy.
  • the parental canarypox virus (Rentschler strain) is a vaccinal strain for canaries.
  • the vaccine strain was obtained from a wild type isolate and attenuated through more than 200 serial passages on chick embryo fibroblasts.
  • a master viral seed was subjected to four successive plaque purifications under agar and one plaque clone was amplified through five additional passages after which the stock virus was used as the parental virus in in vitro recombination tests.
  • the plaque purified canarypox isolate is designated ALVAC.
  • ALVAC was deposited under the terms of the Budapest Treaty with the American Type Culture Collection (ATCC), 12301 Parklawn Drive, Rockville, Md., 20852, USA: ALVAC under ATCC accession number VR-2547 on Nov. 14, 1996.
  • This replacement sequence contains HindIII, SmaI and EcoRI insertion sites followed by translation stops and a transcription termination signal recognized by vaccinia virus RNA polymerase (Yuen et al., 1987). Deletion of the C5 ORF was performed as described below. Plasmid pRW764.5 was partially cut with RsaI and the linear product was isolated. The RsaI linear fragment was recut with BglII and the pRW764.5 fragment now with a RsaI to BglII deletion from position 156 to position 462 was isolated and used as a vector for the following synthetic oligonucleotides:
  • RW145 (SEQ ID NO: 40): ACTCTCAAAAGCTTCCCGGGAATTCTAGCTAGCTAGTTTTTATAAA
  • RW146 (SEQ ID NO: 41): GATCTTTATAAAAACTAGCTAGCTAGAATTCCCGGGAAGCTTTTGAGAGT Oligonucleotides RW145 and RW146 were annealed and inserted into the pRW 764.5 RsaI and BglII vector described above. The resulting plasmid is designated pRW831.
  • Oligonucleotides A through E which overlap the translation initiation codon of the H6 promoter with the ATG of rabies G, were cloned into pUC9 as pRW737. Oligonucleotides A through E contain the H6 promoter, starting at NruI, through the HindIII site of rabies G followed by BglII. Sequences of oligonucleotides A through E ((SEQ ID NO:42)-(SEQ ID NO:46)) are:
  • A (SEQ ID NO: 42): CTGAAATTATTTCATTATCGCGATATCCGTTAAGTTTGTATCGTAATGGT TCCTCAGGCTCCTGTTTGT B (SEQ ID NO: 43): CATTACGATACAAACTTAACGGATATCGCGATAATGAAATAATTTCAG C (SEQ ID NO: 44): ACCCCTTCTGGTTTTTCCGTTGTGTTTTGGGAAATTCCCTATTTACACGA TCCCAGACAAGCTTAGATCTCAG D (SEQ ID NO: 45): CTGAGATCTAAGCTTGTCTGGGATCGTGTAAATAGGGAATTTCCCAAAAC A E (SEQ ID NO: 46): CAACGGAAAAACCAGAAGGGGTACAAACAGGAGAGCCTGAGGAAC The diagram of annealed oligonucleotides A through E is as follows:
  • Oligonucleotides A through E were kinased, annealed (95° C. for 5 minutes, then cooled to room temperature), and inserted between the PvuII sites of pUC9.
  • the resulting plasmid, pRW737 was cut with HindIII and BglII and used as a vector for the 1.6 kbp HindIII-BglII fragment of ptg155PRO (Kieny et al., 1984) generating pRW739.
  • the ptg155PRO HindIII site is 86 bp downstream of the rabies G translation initiation codon.
  • BglII is downstream of the rabies G translation stop codon in ptg155PRO.
  • pRW739 was partially cut with NruI, completely cut with BglII, and a 1.7 kbp NruI-BglII fragment, containing the 3′ end of the H6 promoter previously described (Taylor et al., 1988a,b; Guo et al., 1989; Perkus et al., 1989) through the entire rabies G gene, was inserted between the NruI and BamHI sites of pRW824. The resulting plasmid is designated pRW832. Insertion into pRW824 added the H6 promoter 5′ of NruI.
  • pRW824 sequence of BamHI followed by SmaI is (SEQ ID NO:47): GGATCCCCGGG.
  • pRW824 is a plasmid that contains a nonpertinent gene linked precisely to the vaccinia virus H6 promoter. Digestion with NruI and BamHI completely excised this nonpertinent gene.
  • Plasmid pRW838 was transfected into ALVAC infected primary CEF cells by using the calcium phosphate precipitation method previously described (Panicali et al., 1982; Piccini et al., 1987). Positive plaques were selected on the basis of hybridization to a specific rabies G probe and subjected to 6 sequential rounds of plaque purification until a pure population was achieved. One representative plaque was then amplified and the resulting ALVAC recombinant was designated ALVAC-RG (vCP65) (see also FIGS. 9A and 9B ). The correct insertion of the rabies G gene into the ALVAC genome without subsequent mutation was confirmed by sequence analysis.
  • Immunofluorescence During the final stages of assembly of mature rabies virus particles, the glycoprotein component is transported from the golgi apparatus to the plasma membrane where it accumulates with the carboxy terminus extending into the cytoplasm and the bulk of the protein on the external surface of the cell membrane.
  • immunofluorescence was performed on primary CEF cells infected with ALVAC or ALVAC-RG. Immunofluorescence was performed as previously described (Taylor et al., 1990) using a rabies G monoclonal antibody. Strong surface fluorescence was detected on CEF cells infected with ALVAC-RG but not with the parental ALVAC.
  • sample t7 of each cell substrate was inoculated undiluted onto three dishes of the same cell substrate (to provide samples t0, t7 and t7A) and onto one dish of primary CEF cells. Samples to, t7 and t7A were treated as for passage one. The additional inoculation on CEF cells was included to provide an amplification step for more sensitive detection of virus which might be present in the non-avian cells.
  • Virus yield in each sample was then determined by plaque titration on CEF monolayers under agarose. Summarized results of the experiment are shown in Tables 1 and 2.
  • mice Inoculation of Mice.
  • Groups of mice were inoculated with 50 to 100 ⁇ l of a range of dilutions of different batches of vCP65. Mice were inoculated in the footpad. On day 14, mice were challenged by intracranial inoculation of from 15 to 43 mouse LD 50 of the virulent CVS strain of rabies virus. Survival of mice was monitored and a protective dose 50% (PD 50 ) calculated at 28 days post-inoculation.
  • PD 50 protective dose 50%
  • Chicken embryo fibroblast cells produced from 11 day old white leghorn embryos were included as a positive control. All inoculations were performed on preformed monolayers of 2 ⁇ 10 6 cells as discussed below.
  • Results Estimation of Viral Yield. The results of titration for yield at 72 hours after inoculation at. 0.1 pfu per cell are shown in Table 5. The results indicate that while a productive infection can be attained in the avian cells, no increase in virus yield can be detected by this method in the four non-avian cell systems.
  • DNA from the cell lysates was fractionated by electrophoresis, transferred to nitrocellulose and probed for the presence of viral specific DNA.
  • ALVAC-RG infected CEF cells at 72 hours post-infection exhibited a strong band in the region of approximately 350 kbp representing ALVAC-specific viral DNA accumulation. No such band is detectable when the culture is incubated in the presence of the DNA synthesis inhibitor, cytosine arabinoside.
  • Equivalent samples produced in Vero cells showed a very faint band at approximately 350 kbp in the ALVAC-RG infected Vero cells at time zero. This level represented residual virus. The intensity of the band was amplified at 72 hours post-infection indicating that some level of viral specific DNA replication had occurred in Vero cells which had not resulted in an increase in viral progeny.
  • results of this experiment indicated that in the human cell lines analyzed, although the ALVAC-RG recombinant was able to initiate an infection and express a foreign gene product under the transcriptional control of the H6 early/late vaccinia virus promoter, the replication did not proceed through DNA replication, nor was there any detectable viral progeny produced. In the Vero cells, although some level of ALVAC-RG specific DNA accumulation was observed, no viral progeny was detected by these methods. These results would indicate that in the human cell lines analyzed the block to viral replication occurs prior to the onset of DNA replication, while in Vero cells, the block occurs following the onset of viral DNA replication.
  • mice were challenged 14 days later by the intracranial route with 300 ⁇ l of the CVS strain of rabies virus containing from 15 to 43 mouse LD 50 as determined by lethality titration in a control group of mice. Potency, expressed as the PD 50 (Protective dose 50%), was calculated at 14 days post-challenge. The results of the experiment are shown in Table 6. The results indicated that ALVAC-RG was consistently able to protect mice against rabies virus challenge with a PD 50 value ranging from 3.33 to 4.56 with a mean value of 3.73 (STD 0.48).
  • mice were inoculated intracranially with 50 ⁇ l of virus containing 6.0 log 10 TCID 50 of ALVAC-RG or with an equivalent volume of an uninfected cell suspension. Mice were sacrificed on days 1, 3 and 6 post-inoculation and their brains removed, fixed and sectioned. Histopathological examination showed no evidence for neurovirulence of ALVAC-RG in mice.
  • the immunological response of HIV-2 seropositive macaques to inoculation with ALVAC-RG was assessed. Animals were inoculated as described above and the presence of anti-rabies serum neutralizing antibody assessed in an RFFI test. The results, shown in Table 9, indicated that HIV-2 positive animals inoculated by the subcutaneous route developed anti-rabies antibody by 11 days after one inoculation. An anamnestic response was detected after a booster inoculation given approximately three months after the first inoculation. No response was detected in animals receiving the recombinant by the oral route. In addition, a series of six animals were inoculated with decreasing doses of ALVAC-RG given by either the intra-muscular or subcutaneous routes. Five of the six animals inoculated responded by 14 days post-vaccination with no significant difference in antibody titer.
  • N.D a This sample was harvested at zero time and represents the residual input virus. The titer is expressed as log 10 pfu per ml. b This sample was harvested at 7 days post-infection. c This sample was inoculated in the presence of 40 ⁇ g/ml of Cytosine arabinoside and harvested at 7 days post-infection. d Not detectable.
  • ALVAC Pass 2 a 7.0 b 6.0 5.2 3 7.5 4.1 4.9 4 7.5 N.D. c N.D. 5 7.1 N.D. N.D. b) ALVAC-RG Pass 2 a 7.2 5.5 5.5 3 7.2 5.0 5.1 4 7.2 N.D. N.D. 5 7.2 N.D. N.D. a Pass 2 represents the amplification in CEF cells of the 7 day sample from Pass 1.
  • ALVAC-RG (vCP65) was Generated as Described in Example 9 and FIGS. 9A and 9B .
  • ALVAC-RG (vCP65) was grown in primary CEF derived from specified pathogen free eggs. Cells were infected at a multiplicity of 0.1 and incubated at 37° C. for three days.
  • the vaccine virus suspension was obtained by ultrasonic disruption in serum free medium of the infected cells; cell debris were then removed by centrifugation and filtration.
  • the resulting clarified suspension was supplemented with lyophilization stabilizer (mixture of amino-acids), dispensed in single dose vials and freeze dried.
  • Three batches of decreasing titer were prepared by ten-fold serial dilutions of the virus suspension in a mixture of serum free medium and lyophilization stabilizer, prior to lyophilization.
  • ALVAC-RG vCP65
  • canaries chickens, ducks, geese, laboratory rodents (suckling and adult mice), hamsters, guinea-pigs, rabbits, cats and dogs, squirrel monkeys, rhesus macaques and chimpanzees
  • hamsters guinea-pigs
  • rabbits rabbits
  • cats and dogs squirrel monkeys
  • rhesus macaques and chimpanzees were inoculated with doses ranging from 10 5 to 10 8 pfu.
  • routes were used, most commonly subcutaneous, intramuscular and intradermal but also oral (monkeys and mice) and intracerebral (mice).
  • ALVAC-RG (vCP65) caused a “take” lesion at the site of scarification with no indication of disease or death. Intradermal inoculation of rabbits resulted in a typical poxvirus inoculation reaction which did not spread and healed in seven to ten days. There was no adverse side effects due to canarypox in any of the animal tests. Immunogenicity was documented by the development of anti-rabies antibodies following inoculation of ALVAC-RG (vCP65) in rodents, dogs, cats, and primates, as measured by Rapid Fluorescent Focus Inhibition Test (RFFIT). Protection was also demonstrated by rabies virus challenge experiments in mice, dogs, and cats immunized with ALVAC-RG (vCP65).
  • RFFIT Rapid Fluorescent Focus Inhibition Test
  • the trial was designated as a dose escalation study.
  • Three batches of experimental ALVAC-RG (vCP65) vaccine were used sequentially in three groups of volunteers (Groups A, B and C) with two week intervals between each step.
  • the concentration of the three batches was 10 3.5 , 10 4.5 , 10 5.5 Tissue Culture Infectious Dose (TCID 50 ) per dose, respectively.
  • the nature of the injected vaccine was not known by the participants at the time of the first injection but was known by the investigator.
  • the volunteers of Group B allocated to the medium dose of experimental vaccine were injected 1 h previously with the lower dose and those allocated to the higher dose (Group C) received successively the lower and the medium dose at hourly intervals.
  • ALVAC-RG vCP65
  • Group C the recipients of the highest dosage of ALVAC-RG (vCP65) (Group C) and HDC vaccine were offered a third dose of vaccine; they were then randomized to receive either the same vaccine as previously or the alternate vaccine.
  • four groups were formed corresponding to the following immunization scheme: 1. HDC, HDC-HDC; 2. HDC, HDC-ALVAC-RG (vCP65); 3. ALVAC-RG (vCP65), ALVAC-RG (vCP65)-HDC; 4. ALVAC-RG (vCP65), ALVAC-RG (vCP65), ALVAC-RG (vCP65).
  • Antibody assays were performed seven days prior to the first injection and at days 7, 28, 35, 56, 173, 187 and 208 of the study.
  • the levels of neutralizing antibodies to rabies were determined using the Rapid Fluorescent Focus Inhibition test (RFFIT) (Smith et al., 1973).
  • Canarypox antibodies were measured by direct ELISA.
  • the antigen a suspension of purified canarypox virus disrupted with 0.1% Triton X100, was coated in microplates. Fixed dilutions of the sera were reacted for two hours at room temperature and reacting antibodies were revealed with a peroxidase labelled anti-human IgG goat serum. The results are expressed as the optical density read at 490 nm.
  • Tenderness was the most common symptoms and was always mild. Other local symptoms included redness and induration which were also mild and transient. All symptoms usually subsided within 24 hours and never lasted more than 72 hours.
  • protective titers were achieved in 0/3 of Group A, 2/3 of Group B and 9/9 of Group C recipients of ALVAC-RG (vCP65) vaccine and persisted in all 10 HDC recipients.
  • the rabies antibody titers had substantially decreased in all subjects but remained above the minimum protective titer of 0.5 IU/ml in 5/10 HCD recipients and in 5/9 ALVAC-RG (vCP65) recipients; the geometric mean titers were 0.51 and 0.45 IU/ml in groups HCD and C, respectively.
  • Booster Injection The vaccine was similarly well tolerated six months later, at the time of the booster injection: fever was noted in 2/9 HDC booster recipients and in 1/10 ALVAC-RG (vCP65) booster recipients. Local reactions were present in 5/9 recipients of HDC booster and in 6/10 recipients of the ALVAC-RG (vCP65) booster.
  • FIGS. 13A-13D show graphs of rabies neutralizing antibody titers (Rapid Fluorescent Focus Inhibition Test or RFFIT, IU/ml): Booster effect of HDC and vCP65 (10 5.5 TCID 50 ) in volunteers previously immunized with either the same or the alternate vaccine. Vaccines were given at days 0, 28 and 180. Antibody titers were measured at days 0, 7, 28, 35, 56, 173, and 187 and 208.
  • RFFIT Rapid Fluorescent Focus Inhibition Test
  • the booster dose given resulted in a further increase in rabies antibody titers in every subject whatever the immunization scheme.
  • the ALVAC-RG (vCP65) booster globally elicited lower immune responses than the HDC booster and the ALVAC-RG (vCP65), ALVAC-RG (vCP65)-ALVAC-RG (vCP65) group had significantly lower titers than the three other groups.
  • the ALVAC-RG (vCP65) booster injection resulted in an increase in canarypox antibody titers in 3/5 subjects who had previously received the HDC vaccine and in all five subjects previously immunized with ALVAC-RG (vCP65).
  • Rabies neutralizing antibodies were assayed with the Rapid Fluorescent Focus Inhibition Test (RFFIT) which is known to correlate well with the sero neutralization test in mice. Of 9 recipients of 10 5.5 TCID 50 , five had low level responses after the first dose. Protective titers of rabies antibodies were obtained after the second injection in all recipients of the highest dose tested and even in 2 of the 3 recipients of the medium dose. In this study, both vaccines were given subcutaneously as usually recommended for live vaccines, but not for the inactivated HDC vaccine.
  • RFFIT Rapid Fluorescent Focus Inhibition Test
  • this Example clearly demonstrates that a non-replicating poxvirus can serve as an immunizing vector in humans, with all of the advantages that replicating agents confer on the immune response, but without the safety problem created by a fully permissive virus.
  • mice Male outbred Swiss Webster mice were purchased from Taconic Farms (Germantown, N.Y.) and maintained on mouse chow and water ad libitum until use at 3 weeks of age (“normal” mice). Newborn outbred Swiss Webster mice were of both sexes and were obtained following timed pregnancies performed by Taconic Farms. All newborn mice used were delivered within a two day period.
  • ALVAC was derived by plaque purification of a canarypox virus population and was prepared in primary chick embryo fibroblast cells (CEF). Following purification by centrifugation over sucrose density gradients, ALVAC was enumerated for plaque forming units in CEF cells.
  • the WR(L) variant of vaccinia virus was derived by selection of large plaque phenotypes of WR (Panicali et al., 1981).
  • the Wyeth New York State Board of Health vaccine strain of vaccinia virus was obtained from Pharmaceuticals Calf Lymph Type vaccine Dryvax, control number 302001B.
  • Copenhagen strain vaccinia virus VC-2 was obtained from Institut Merieux, France.
  • Vaccinia virus strain NYVAC was derived from Copenhagen VC-2. All vaccinia virus strains except the Wyeth strain were cultivated in Vero African green monkey kidney cells, purified by sucrose gradient density centrifugation and enumerated for plaque forming units on Vero cells. The Wyeth strain was grown in CEF cells and enumerated for plaque forming units in CEF cells.
  • mice were inoculated intracranially (ic) with 0.05 ml of one of several dilutions of virus prepared by 10-fold serially diluting the stock preparations in sterile phosphate-buffered saline. In some instances, undiluted stock virus preparation was used for inoculation.
  • mice Groups of 10 newborn mice, 1 to 2 days old, were inoculated ic similarly to the normal mice except that an injection volume of 0.03 ml was used.
  • mice All mice were observed daily for mortality for a period of 14 days (newborn mice) or 21 days (normal mice) after inoculation. Mice found dead the morning following inoculation were excluded due to potential death by trauma.
  • the lethal dose required to produce mortality for 50% of the experimental population was determined by the proportional method of Reed and Muench.
  • Preformed monolayers of avian or non-avian cells were inoculated with 10 pfu per cell of parental NYVAC (vP866) or NYVAC-RG (vP879) virus.
  • the inoculation was performed in EMEM free of methionine and supplemented with 2% dialyzed fetal bovine serum. After a one hour incubation, the inoculum was removed and the medium replaced with EMEM (methionine free) containing 20 ⁇ Ci/ml of 35 S-methionine.
  • Protein A Sepharose CL-48 obtained from Pharmacia LKB Biotechnology Inc., Piscataway, N.J., was used as a support matrix. Immunoprecipitates were fractionated on 10% polyacrylamide gels according to the method of Dreyfuss et. al. (1984). Gels were fixed, treated for fluorography with 1M Na-salicylate for one hour, and exposed to Kodak XAR-2 film to visualize the immunoprecipitated protein species.
  • New Zealand White rabbits were obtained from Hare-Marland (Hewitt, N.J.).
  • Three week old male Swiss Webster outbred mice, timed pregnant female Swiss Webster outbred mice, and four week old Swiss Webster nude (nu + nu + ) mice were obtained from Taconic Farms, Inc. (Germantown, N.Y.). All animals were maintained according to NIH guidelines. All animal protocols were approved by the institutional IACUC. When deemed necessary, mice which were obviously terminally ill were euthanized.
  • Virus Recovery from Inoculation Sites A single rabbit was inoculated intradermally at multiple sites of 0/1 ml of PBS containing 10 6 , 10 7 , or 10 8 pfu of each test virus or with PBS alone. After 11 days, the rabbit was euthanized and skin biopsy specimens taken from each of the inoculation sites were aseptically prepared by mechanical disruption and indirect sonication for virus recovery. Infectious virus was assayed by plaque titration on CEF monolayers.
  • mice Virulence in Mice. Groups of ten mice, or five in the nude mice experiment, were inoculated ip with one of several dilutions of virus in 0.5 ml of sterile PBS. Reference is also made to Example 11.
  • LD 50 The lethal dose required to produce 50% mortality (LD 50 ) was determined by the proportional method of Reed and Muench (Reed and Muench 1938).
  • FIG. 10 schematically depicts the ORFs deleted to generate NYVAC. At the top of FIG. 10 is depicted the HindIII restriction map of the vaccinia virus genome (VC-2 plaque isolate, COPENHAGEN strain).
  • NYVAC The replication potential of NYVAC in a number of human derived cells are shown in Table 16. Both VC-2 and NYVAC are capable of productive replication in CEF cells, although NYVAC with slightly reduced yields. VC-2 is also capable of productive replication in the six human derived cell lines tested with comparable yields except in the EBV transformed lymphoblastoid cell line JT-1 (human lymphoblastoid cell line transformed with Epstein-Barr virus, see Rickinson et al., 1984). In contrast, NYVAC is highly attenuated in its ability to productively replicate in any of the human derived cell lines tested.
  • MRC-5 and DETROIT 532 Consistent with the low levels of virus yields obtained in the human-derived cell lines, MRC-5 and DETROIT 532, detectable but reduced levels of NYVAC-specific DNA accumulation were noted.
  • NYVAC-specific viral DNA accumulation was not observed in any of the other human-derived cells.
  • Sites inoculated with NYVAC or control PBS displayed no induration or ulceration.
  • skin samples from the sites of inoculation were excised, mechanically disrupted, and virus was titrated on CEF cells. The results are shown in Table 18. In no case was more virus recovered at this timepoint than was administered.
  • Recovery of vaccinia strain, WR was approximately 10 6 pfu of virus at each site irrespective of amount of virus administered.
  • Recovery of vaccinia strains WYETH and VC-2 was 10 3 to 10 4 pfu regardless of amount administered. No infectious virus was recovered from sites inoculated with NYVAC.
  • mice inoculated with WR (10 3 to 10 4 pfu), WYETH (5 ⁇ 10 7 or 5 ⁇ 10 8 pfu) or VC-2 (10 4 to 10 9 pfu) displayed disseminated lesions typical of poxviruses first on the toes, then on the tail, followed by severe orchitis in some animals.
  • WR 10 3 to 10 4 pfu
  • WYETH 5 ⁇ 10 7 or 5 ⁇ 10 8 pfu
  • VC-2 (10 4 to 10 9 pfu) displayed disseminated lesions typical of poxviruses first on the toes, then on the tail, followed by severe orchitis in some animals.
  • WR or WYETH the appearance of disseminated lesions generally led to eventual death, whereas most mice infected with VC-2 eventually recovered.
  • Calculated LD 50 values are given in Table 19.
  • mice inoculated with VC-2 began to display lesions on their toes (red papules) and 1 to 2 days later on the tail. These lesions occurred between 11 and 13 days post-inoculation (pi) in mice given the highest doses (10 9 , 10 8 , 10 7 and 10 6 pfu), on day 16 pi in mice given 10 5 pfu and on day 21 pi in mice given 10 4 pfu. No lesions were observed in mice inoculated with 10 3 and 10 2 pfu during the 100 day observation period. Orchitis was noticed on day 23 pi in mice given 10 9 and 10 8 pfu, and approximately 7 days later in the other groups (10 7 to 10 4 pfu).
  • Orchitis was especially intense in the 10 9 and 10 8 pfu groups and, although receding, was observed until the end of the 100 day observation period. Some pox-like lesions were noticed on the skin of a few mice, occurring around 30-35 days pi. Most pox lesions healed normally between 60-90 days pi. Only one mouse died in the group inoculated with 10 9 pfu (Day 34 pi) and one mouse died in the group inoculated with 10 8 pfu (Day 94 pi). No other deaths were observed in the VC-2 inoculated mice.
  • mice inoculated with 10 4 pfu of the WR strain of vaccinia started to display pox lesions on Day 17 pi. These lesions appeared identical to the lesions displayed by the VC-2 injected mice (swollen toes, tail). Mice inoculated with 10 3 pfu of the WR strain did not develop lesions until 34 days pi. Orchitis was noticed only in the mice inoculated with the highest dose of WR (10 4 pfu). During the latter stages of the observation period, lesions appeared around the mouth and the mice stopped eating. All mice inoculated with 10 4 pfu of WR died or were euthanized when deemed necessary between 21 days and 31 days pi.
  • mice injected with 10 3 pfu of WR died or were euthanized when deemed necessary between 35 days and 57 days pi. No deaths were observed in mice inoculated with lower doses of WR (1 to 100 pfu).
  • CY-treated mice provided a more sensitive model for assaying poxvirus virulence than did nude mice.
  • LD 50 values for the WR, WYETH, and VC-2 vaccinia virus strains were significantly lower in this model system than in the nude mouse model.
  • CY-treated mice injected with NYVAC or ALVAC did not develop lesions. However, unlike nude mice, some deaths were observed in CY-treated mice challenged with NYVAC or ALVAC, regardless of the dose. These random incidences are suspect as to the cause of death.
  • mice injected with all doses of WYETH displayed pox lesions on their tail and/or on their toes between 7 and 15 days pi. In addition, the tails and toes were swollen. Evolution of lesions on the tail was typical of pox lesions with formation of a papule, ulceration and finally formation of a scab.
  • Mice inoculated with all doses of VC-2 (1.65 ⁇ 10 5 to 1.65 ⁇ 10 9 ) also developed pox lesions on their tails and/or their toes analogous to those of WYETH injected mice. These lesions were observed between 7-12 days post inoculation. No lesions were observed on mice injected with lower doses of WR virus, although deaths occurred in these groups.
  • Table 20 demonstrates that the PD 50 values obtained with the highly attenuated NYVAC vector are identical to those obtained using a COPENHAGEN-based recombinant containing the rabies glycoprotein gene in the tk locus (Kieny et al., 1984) and similar to PD 50 values obtained with ALVAC-RG, a canarypox based vector restricted to replication to avian species.
  • NYVAC deleted of known virulence genes and having restricted in vitro growth characteristics, was analyzed in animal model systems to assess its attenuation characteristics. These studies were performed in comparison with the neurovirulent vaccinia virus laboratory strain, WR, two vaccinia virus vaccine strains, WYETH (New York City Board of Health) and COPENHAGEN (VC-2), as well as with a canarypox virus strain, ALVAC (See also Example 11).
  • viruses provided a spectrum of relative pathogenic potentials in the mouse challenge model and the rabbit skin model, with WR being the most virulent strain, WYETH and COPENHAGEN (VC-2) providing previously utilized attenuated vaccine strains with documented characteristics, and ALVAC providing an example of a poxvirus whose replication is restricted to avian species.
  • Results from these in vivo analyses clearly demonstrate the highly attenuated properties of NYVAC relative to the vaccinia virus strains, WR, WYETH and COPENHAGEN (VC-2) (Tables 14-20).
  • the LD 50 values for NYVAC were comparable to those observed with the avian host restricted avipoxvirus, ALVAC.
  • Example 11 demonstrate the highly attenuated nature of NYVAC relative to WR, and the previously utilized vaccinia virus vaccine strains, WYETH and COPENHAGEN.
  • the pathogenic profile of NYVAC, in the animal model systems tested was similar to that of ALVAC, a poxvirus known to productively replicate only in avian species.
  • NYVAC-based vaccine candidates have been shown to be efficacious.
  • NYVAC recombinants expressing foreign gene products from a number of pathogens have elicited immunological responses towards the foreign gene products in several animal species, including primates.
  • a NYVAC-based recombinant expressing the rabies glycoprotein was able to protect mice against a lethal rabies challenge.
  • the potency of the NYVAC-based rabies glycoprotein recombinant was comparable to the PD 50 value for a COPENHAGEN-based recombinant containing the rabies glycoprotein in the tk locus (Table 20).
  • NYVAC-based recombinants have also been shown to elicit measles virus neutralizing antibodies in rabbits and protection against pseudorabies virus and Japanese encephalitis virus challenge in swine.
  • the highly attenuated NYVAC strain confers safety advantages with human and veterinary applications (Tartaglia et al., 1992).
  • the use of NYVAC as a general laboratory expression vector system may greatly reduce the biological hazards associated with using vaccinia virus.
  • Example 11 show NYVAC to be highly attenuated: a) no detectable induration or ulceration at site of inoculation (rabbit skin); b) rapid clearance of infectious virus from intradermal site of inoculation (rabbit skin); c) absence of testicular inflammation (nude mice); d) greatly reduced virulence (intracranial challenge, both three-week old and newborn mice); e) greatly reduced pathogenicity and failure to disseminate in immunodeficient subjects (nude and cyclophosphamide treated mice); and f) dramatically reduced ability to replicate on a variety of human tissue culture cells. Yet, in spite of being highly attenuated, NYVAC, as a vector, retains the ability to induce strong immune responses to extrinsic antigens.
  • mice LD 50 a Poxvirus Cyclophosphamide Strain Nude mice treated mice WR 422 42 VC-2 >10 9 ⁇ 1.65 ⁇ 10 5 WYETH 1.58 ⁇ 10 7 1.83 ⁇ 10 6 NY VAC >5.50 ⁇ 10 8 7.23 ⁇ 10 8 ALVAC >10 9 ⁇ 5.00 ⁇ 10 8b a Calculated 50% lethal dose (pfu) for nude or cyclophosphamide treated mice by the indicated vaccinia viruses and for ALVAC by intraperitoneal route. b 5 out of 10 mice died at the highest dose of 5 ⁇ 10 8 pfu.
  • mice of each group were challenged by intracranial inoculation of 30 ⁇ l of a live CVS strain rabies virus corresponding to 15 lethal dose 50% (LD 50 ) per mouse.
  • LD 50 lethal dose 50%
  • mice of each group were challenged by intracranial inoculation of 30 ⁇ l of a live CVS strain rabies virus corresponding to 15 lethal dose 50% (LD 50 ) per mouse.
  • surviving mice were counted and a protective dose 50% (PD 50 ) was calculated.
  • This Example describes the development of fowlpox virus recombinants expressing the hemagglutinin genes of three serotypes of avian influenza virus.
  • Plasmids containing cDNA clones of the H4, H5 and H7 hemagglutinin genes were obtained from Dr. Robert Webster, St. Jude Children's Research Hospital, Memphis, Tenn.
  • the strain of FPV designated FP-1 has been described previously (Taylor et al., 1988a, b). It is a vaccine strain useful in vaccination of day old chickens.
  • the parental virus strain Duvette was obtained in France as a fowlpox scab from a chicken. The virus was attenuated by approximately 50 serial passages in chicken embryonated eggs followed by 25 passages on chick embryo fibroblast (CEF) cells.
  • CEF chick embryo fibroblast
  • This virus was obtained in September 1980 by Rhone Merieux, Lyon, France, and a master viral seed established. The virus was received by Virogenetics in September 1989, where it was subjected to four successive plaque purifications.
  • One plaque isolate was further amplified in primary CEF cells and a stock virus, designated as TROVAC, was established.
  • the stock virus used in the in vitro recombination test to produce TROVAC-AIH5 (vFP89) and TROVAC-AIH4 (vFP92) had been further amplified though 8 passages in primary CEF cells.
  • the stock virus used to produce TROVAC-AIH7 (vFP100) had been further amplified through 12 passages in primary CEF cells.
  • Plasmid pRW731.15 contains a 10 kbp PvuII-PvuII fragment cloned from TROVAC genomic DNA. The nucleotide sequence was determined on both strands for a 3659 bp PvuII-EcoRV fragment. This sequence is shown in FIG. 11 (SEQ ID NO:67). The limits of an open reading frame designated in this laboratory as F8 were determined within this sequence. The open reading frame is initiated at position 495 and terminates at position 1887. A deletion was made from position 779 to position 1926, as described below.
  • Plasmid pRW761 is a sub-clone of pRW731.15 containing a 2430 bp EcoRV-EcoRV fragment. Plasmid pRW761 was completely digested with XbaI and partially digested with SspI. A 3700 bp XbaI-SspI band was isolated and ligated with the annealed double-stranded oligonucleotides JCA017 (SEQ ID NO:37) and JCA018 (SEQ ID NO:38).
  • JCA017 (SEQ ID NO: 37) 5′ CTAGACACTTTATGTTTTTTAATATCCGGTCTTAAAAGCTTCCCGGG GATCCTTATACGGGGAATAAT 3′ JCA018 (SEQ ID NO: 38) 5′ ATTATTCCCCGTATAAGGATCCCCCGGGAAGCTTTTAAGACCGGATA TTAAAAAACATAAAGTGT 3′
  • Plasmid pJCA004 contains a non-pertinent gene linked to the vaccinia virus H6 promoter in plasmid pJCA002.
  • the sequence of the vaccinia virus H6 promoter has been previously described (Taylor et al., 1988a, b; Guo et al. 1989; Perkus et al., 1989).
  • Plasmid pJCA004 was digested with EcoRV and BamHI which deletes the non-pertinent gene and a portion of the 3′ end of the H6 promoter.
  • Annealed oligonucleotides RW178 (SEQ ID NO:48) and RW179 (SEQ ID NO:49) were cut with EcoRV and BamHI and inserted between the EcoRV and BamHI sites of JCA004 to form pRW846.
  • RW178 (SEQ ID NO: 48): 5′ TCATTATCGCGATATCCGTGTTAACTAGCTAGCTAATTTTTATTCCC GGGATCCTTATCA 3′
  • RW179 (SEQ ID NO: 49): 5′ GTATAAGGATCCCGGGAATAAAAATTAGCTAGCTAGTTAACACGGAT ATCGCGATAATGA 3′
  • Plasmid pRW846 therefore contains the H6 promoter 5′ of EcoRV in the de-ORFed F8 locus.
  • HincII site 3′ of the H6 promoter in pRW846 is followed by translation stop codons, a transcriptional stop sequence recognized by vaccinia virus early promoters (Yuen et al., 1987) and a SmaI site.
  • the insertion site was a unique HincII site within these sequences.
  • the nucleotide sequence shown in FIG. 12 (SEQ ID NO:68) was determined for a 2356 bp region encompassing the unique HincII site. Analysis of this sequence revealed that the unique HincII site ( FIG. 12 , underlined) was situated within an ORF encoding a polypeptide of 90 amino acids.
  • the ORF begins with an ATG at position 1531 and terminates at position 898 (positions marked by arrows in FIG. 12 ).
  • the arms for the de-ORFed insertion plasmid were derived by PCR using pRW731.13 as template.
  • a 596 bp arm (designated as HB) corresponding to the region upstream from the ORF was amplified with oligonucleotides F73PH2 (SEQ ID NO:50) (5′-GACAATCTAAGTCCTATATTAGAC-3′) and F73PB (SEQ ID NO:51) (5′-GGATTTTTAGGTAGACAC-3′).
  • a 270 bp arm (designated as EH) corresponding to the region downstream from the ORF was amplified using oligonucleotides F75PE (SEQ ID NO:52) (5′-TCATCGTCTTCATCATCG-3′) and F73PH1 (SEQ ID NO:53) (5′-GTCTTAAACTTATTGTAAGGGTATACCTG-3′).
  • Fragment EH was digested with EcoRV to generate a 126 bp fragment.
  • the EcoRV site is at the 3′-end and the 5′-end was formed, by PCR, to contain the 3′ end of a HincII site.
  • This fragment was inserted into pBS-SK (Stratagene, La Jolla, Calif.) digested with HincII to form plasmid pF7D1.
  • the sequence was confirmed by dideoxynucleotide sequence analysis.
  • the plasmid pF7D1 was linearized with ApaI, blunt-ended using T4 DNA polymerase, and ligated to the 596 bp HB fragment.
  • the resultant plasmid was designated as pF7D2. The entire sequence and orientation were confirmed by nucleotide sequence analysis.
  • the plasmid pF7D2 was digested with EcoRV and BglII to generate a 600 bp fragment. This fragment was inserted into pBS-SK that was digested with ApaI, blunt-ended with T4 DNA polymerase, and subsequently digested with BamHI. The resultant plasmid was designated as pF7D3. This plasmid contains an HB arm of 404 bp and a EH arm of 126 bp.
  • the plasmid pF7D3 was linearized with XhoI and blunt-ended with the Klenow fragment of the E. coli DNA polymerase in the presence of 2 mM dNTPs.
  • This linearized plasmid was ligated with annealed oligonucleotides F7MCSB (SEQ ID NO:54) (5′-AACGATTAGTTAGTTACTAAAAGCTTGCTGCAGCCCGGGTTTTTTATTAGTTTAGTT AGTC-3′) and F7MCSA (SEQ ID NO:55) (5′-GACTAACTAACTAATAAAAAAAA CCCGGGCTGCAGCAAGCTTTTTGTAACTAACTAATCGTT-3′). This was performed to insert a multiple cloning region containing the restriction sites for HindIII, PstI and SmaI between the EH and HB arms.
  • the resultant plasmid was designated as pF7DO.
  • Insertion Plasmid for the H4 Hemagglutinin at the F8 Locus A cDNA copy encoding the avian influenza H4 derived from A/Ty/Min/833/80 was obtained from Dr. R. Webster in plasmid pTM4H833. The plasmid was digested with HindIII and NruI and blunt-ended using the Klenow fragment of DNA polymerase in the presence of dNTPs. The blunt-ended 2.5 kbp HindIII-NruI fragment containing the H4 coding region was inserted into the HincII site of pIBI25 (International Biotechnologies, Inc., New Haven, Conn.).
  • Plasmid pRW828 was partially cut with BanII, the linear product isolated and recut with HindIII. Plasmid pRW828 now with a 100 bp HindIII-BanII deletion was used as a vector for the synthetic oligonucleotides RW152 (SEQ ID NO:56) and RW153 (SEQ ID NO:57). These oligonucleotides represent the 3′ portion of the H6 promoter from the EcoRV site and align the ATG of the promoter with the ATG of the H4 cDNA.
  • RW152 (SEQ ID NO: 56): 5′ GCACGGAACAAAGCTTATCGCGATATCCGTTAAGTTTGTATCGTAAT GCTATCAATCACGATTCTGTTCCTGCTCATAGCAGAGGGCTCATCTCAGA AT 3′
  • RW153 (SEQ ID NO: 57): 5′ ATTCTGAGATGAGCCCTCTGCTATGAGCAGGAACAGAATCGTGATTG ATAGCATTACGATACAAACTTAACGGATATCGCGATAAGCTTTGTTCCGT GC 3′
  • Plasmid pRW848 therefore contains the H4 coding sequence linked to the vaccinia virus H6 promoter in the de-ORFed F8 locus of fowlpox virus.
  • RW10 (SEQ ID NO: 58): 5′ GAAAAATTTAAAGTCGACCTGTTTTGTTGAGTTGTTTGCGTGGTAAC CAATGCAAATCTGGTCACT 3′
  • RW11 (SEQ ID NO: 59): 5′ TCTAGCAAGACTGACTATTGCAAAAAGAAGCACTATTTCCTCCATTA CGATACAAACTTAACGGAT 3′
  • RW12 (SEQ ID NO: 60): 5′ ATCCGTTAAGTTTGTATCGTAATGGAGGAAATAGTGCTTCTTTTTGC AATAGTCAGTCTTGCTAGAAGTGACCAGATTTGCATTGGT 3′
  • RW13 (SEQ ID NO:61): 5′ TACCACGCAAACAACTCAACAAAACAGGTCGACTTTAAATTTTTCTG CA 3′
  • the oligonucleotides were annealed at 95° C. for three minutes followed by slow cooling at room temperature. This results in the following double strand structure with the indicated ends.
  • Plasmid pRW742B contains the vaccinia virus H6 promoter linked to a non-pertinent gene inserted at the HincII site of pRW731.15 described previously. Digestion with PstI and EcoRV eliminates the non-pertinent gene and the 3′-end of the H6 promoter. Plasmid pRW744 now contains the 3′ portion of the H6 promoter overlapping the ATG of avian influenza H5.
  • the plasmid also contains the H5 sequence through the 5′ SalI site and the 3′ sequence from the H5 stop codon (containing a DraI site). Use of the DraI site removes the H5 3′ non-coding end.
  • the oligonucleotides add a transcription termination signal recognized by early vaccinia virus RNA polymerase (Yuen et al., 1987). To complete the H6 promoted H5 construct, the H5 coding region was isolated as a 1.6 kpb SalI-DraI fragment from pTH29.
  • Plasmid pRW744 was partially digested with DraI, the linear fragment isolated, recut with SalI and the plasmid now with eight bases deleted between SalI and DraI was used as a vector for the 1.6 kpb pTH29 SalI and DraI fragment.
  • the resulting plasmid pRW759 was cut with EcoRV and DraI.
  • the 1.7 kbp PRW759 EcoRV-DraI fragment containing the 3′ H6 promoter and the H5 gene was inserted between the EcoRV and HincII sites of pRW846 (previously described).
  • the resulting plasmid pRW849 contains the H6 promoted avian influenza virus H5 gene in the de-ORFed F8 locus.
  • Plasmid pCVH71 containing the H7 hemagglutinin from A/CK/VIC/1/85 was received from Dr. R. Webster.
  • An EcoRI-BamHI fragment containing the H7 gene was blunt-ended with the Klenow fragment of DNA polymerase and inserted into the HincII site of pIBI25 as PRW827.
  • Synthetic oligonucleotides RW165 (SEQ ID NO:62) and RW166 (SEQ ID NO:63) were annealed, cut with HincII and StyI and inserted between the EcoRV and StyI sites of pRW827 to generate pRW845.
  • RW165 (SEQ ID NO: 62): 5′ GTACAGGTCGACAAGCTTCCCGGGTATCGCGATATCCGTTAAGTTTG TATCGTAATGAATACTCAAATTCTAATACTCACTCTTGTGGCAGCCATTC ACACAAATGCAGACAAAATCTGCCTTGGACATCAT 3′
  • RW166 (SEQ ID NO: 63): 5′ ATGATGTCCAAGGCAGATTTTGTCTGCATTTGTGTGAATGGCTGCCA CAAGAGTGAGTATTAGAATTTGAGTATTCATTACGATACAAACTTAACGG ATATCGCGATACCCGGGAAGCTTGTCGACCTGTAC 3′
  • Oligonucleotides RW165 (SEQ ID NO:62) and RW166 (SEQ ID NO:63) link the 3′ portion of the H6 promoter to the H7 gene.
  • the 3′ non-coding end of the H7 gene was removed by isolating the linear product of an ApaLI digestion of pRW845, recutting it with EcoRI, isolating the largest fragment and annealing with synthetic oligonucleotides RW227 (SEQ ID NO:64) and RW228 (SEQ ID NO:65).
  • the resulting plasmid was pRW854.
  • RW227 (SEQ ID NO: 64): 5′ ATAACATGCGGTGCACCATTTGTATATAAGTTAACGAATTCCAAGTC AAGC 3′
  • RW228 (SEQ ID NO: 65): 5′ GCTTGACTTGGAATTCGTTAACTTATATACAAATGGTGCACCGCATG TTAT 3′
  • the stop codon of H7 in PRW854 is followed by an HpaI site.
  • the intermediate H6 promoted H7 construct in the de-ORFed F7 locus was generated by moving the pRW854 EcoRV-HpaI fragment into pRW858 which had been cut with EcoRV and blunt-ended at its PstI site.
  • Plasmid pRW858 (described below) contains the H6 promoter in an F7 de-ORFed insertion plasmid.
  • the plasmid pRW858 was constructed by insertion of an 850 bp SmaI/HpaI fragment, containing the H6 promoter linked to a non-pertinent gene, into the SmaI site of pF7DO described previously.
  • the non-pertinent sequences were excised by digestion of pRW858 with EcoRV (site 24 bp upstream of the 3′-end of the H6 promoter) and PstI.
  • the 3.5 kb resultant fragment was isolated and blunt-ended using the Klenow fragment of the E. coli DNA polymerase in the presence of 2 mM dNTPs.
  • This blunt-ended fragment was ligated to a 1700 bp EcoRV/HpaI fragment derived from pRW854 (described previously).
  • This EcoRV/HpaI fragment contains the entire AIV HA (H7) gene juxtaposed 3′ to the 3′-most 24 bp of the VV H6 promoter.
  • the resultant plasmid was designated pRW861.
  • the 126 bp EH arm (defined previously) was lengthened in pRW861 to increase the recombination frequency with genomic TROVAC DNA.
  • a 575 bp AccI/SnaBI fragment was derived from pRW 731.13 (defined previously). The fragment was isolated and inserted between the AccI and NaeI sites of pRW861.
  • the resultant plasmid containing an EH arm of 725 bp and a HB arm of 404 bp flanking the AIV H7 gene, was designated as pRW869.
  • Plasmid pRW869 therefore consists of the H7 coding sequence linked at its 5′ end to the vaccinia virus H6 promoter.
  • the left flanking arm consists of 404 bp of TROVAC sequence and the right flanking arm of 725 bp of TROVAC sequence which directs insertion to the de-ORFed F7 locus.
  • Insertion plasmids containing the avian influenza virus HA coding sequences were individually transfected into TROVAC infected primary CEF cells by using the calcium phosphate precipitation method previously described (Panicali et al., 1982; Piccini et al., 1987). Positive plaques were selected on the basis of hybridization to HA specific radiolabelled probes and subjected to sequential rounds of plaque purification until a pure population was achieved. One representative plaque was then amplified to produce a stock virus.
  • Plasmid pRW849 was used in an in vitro recombination test to produce recombinant TROVAC-AIH5 (vFP89) expressing the H5 hemagglutinin.
  • Plasmid pRW848 was used to produce recombinant TROVAC-AIH4 (vFP92) expressing the H4 hemagglutinin.
  • Plasmid pRW869 was used to produce recombinant TROVAC-AIH7 (vFP100) expressing the H7 hemagglutinin.
  • H5 hemagglutinin in TROVAC-AIH5 H4 hemagglutinin in TROVAC-AIH4 and H7 hemagglutinin in TROVAC-AIH7 was confirmed by indirect immunofluorescence. Expression of the H5 hemagglutinin was detected using a pool of monoclonal antibodies specific for the H5HA. Expression of the H4HA was analyzed using a goat monospecific anti-H4 serum. Expression of the H7HA was analyzed using a H7 specific monoclonal antibody preparation.
  • a plasmid, pHXB2D, containing HIV1 (IIIB) cDNA sequence was obtained from Robert Gallo (NCI, NIH).
  • the sequence encoding the 5′-end of the gag gene was cloned between vaccinia virus tk flanking arms. This was accomplished by cloning the 1,625 bp BglII fragment of pHXB2D, containing the 5′-end of the gag gene, into the 4,075 bp BglII fragment of pSD542VCVQ.
  • the plasmid generated by this manipulation is called pHIVG2.
  • the 3′-end of the gag gene was then cloned into pHIVG2. This was accomplished by cloning a 280 bp ApaI-BamHI PCR fragment, containing the 3′-end of the gag gene, into the 5,620 bp ApaI-BamHI fragment of pHIVG2. (This PCR fragment was generated from the plasmid, pHXB2D, with the oligonucleotide primers, HIVP5 (SEQ ID NO:69; 5′-TGTGGCAAAGAAGGGC-3′) and HIVP6 (SEQ ID NO:70; 5′-TTGGATCCTTATTGTGACGAGGGGTC-3′).) The plasmid generated by this manipulation is called pHIVG3.
  • the I3L promoter was then cloned upstream of the gag gene. This was accomplished by cloning the oligonucleotides, HIVL17 (SEQ ID NO:71; 5′-GATCTTGAGATAAAGTGAAAATATATATCATTATATTACAAAGTACAATTATTTA GGTTTAATCATGGGTGCGAGAGCGTCAGTATTAAGCGGGGGAGAATTAGAT-3′) and HIVL18 (SEQ ID NO:72; 5′-CGATCTAATTCTCCCCCGCTTAATACTGACGCTCT CGCACCCATGATTAAACCTAAATAATTGTACTTTGTAATATAATGATATATATTTTCACTTT ATCTCAA-3′), encoding the vaccinia virus I3L promoter and the 5′-end of the gag gene, into the 5,540 bp partial BglII-ClaI fragment of pHIVG3.
  • the plasmid generated by this manipulation is called pHIVG4.
  • the portion of the gag gene encoding p24, p2, p7 and p6 was then eliminated. This was accomplished by cloning the oligonucleotides, HIVL19 (SEQ ID NO:73; 5′-CTGACACAGG ACACAGCAATCAGGTCAGCCAAAATTACTAATTTTTATCTCGAGGTCGACAGGACCCG-3′) and HIVL20 (SEQ ID NO:74; 5′-GATCCGGGTCCTGTCGACCTCGAGATAAAAAAA TTAGTAATTTTGGCTGACCTGATTGCTGTGTCCTGTGTCAG-3′), into the 4,450 bp partial PvuII-BamHI fragment of pHIVG4.
  • the plasmid generated by this manipulation is called pHIVG5.
  • Extraneous 3′-noncoding sequence was then eliminated. This was accomplished by cloning a 360 bp AflII-BamHI PCR fragment, containing the 3′-end of the pol gene, into the 8,030 bp AflII-BamHI fragment of pHIVG6.
  • This PCR fragment was generated from the plasmid, pHXB2D, with the oligonucleotide primers, HIVP7 (SEQ ID NO:75; 5′-AAG AAAATTATAGGAC-3′) and HIVP8 (SEQ ID NO:76; 5′-TTGGATCCC TAATCCTCATCCTGT-3′).
  • the plasmid generated by this manipulation is called pHIVG7.
  • the I3L-promoted gag and pol genes were then cloned between canary pox C3 flanking arms. This was accomplished by cloning the 4,360 bp partial BglII-BamHI fragment of pHIVG7, containing the I3L-promoted gag and pol genes, into the BamHI site of pVQH6CP3L.
  • the plasmid generated by this manipulation is called pHIVGE14.
  • the H6-promoted HIV1gp120(MN) (+transmembrane) “gene” was then cloned into pHIVGE14. This was accomplished by cloning the 1,700 bp NruI-SmaI fragment of pC5HIVMN120T, containing the gp120(+transmembrane) “gene”, into the 11,400 bp NruI-SmaI fragment of pHIVGE14.
  • the plasmid generated by this manipulation is called pHIVGE14T.
  • pHIV32 SEQ ID NOS: 78 and 79
  • FIGS. 14A-14C shows the nucleotide sequence of the H6-promoted HIV1gp120(+transmembrane) gene and the I3L-promoted HIV1gag(+pro) gene contained in pHIV32:
  • FIGS. 15A-F show the DNA sequence of the ALVAC C3 flanking arm (SEQ ID NOS: 80 and 81) in FIGS. 15A-F .
  • FIGS. 15A to 15F show the nucleotide sequence of the C3 locus in pVQH6CP3L:
  • pHIV32 was used in vitro recombination with ALVAC as the rescuing virus to yield vCP205.
  • vCP205 (ALVAC-MN120TMG) was deposited on Mar. 6, 1997 under the terms of the Budapest Treaty with the American Type Culture Collection (ATCC), P.O. Box 1549, Manassas, Va. 20108 USA under ATCC accession number VR-2557.
  • This 216 bp PCR fragment was then used as a template in a second PCR reaction with the oligonucleotide primers, VQPCRI3 and CTLPCR (SEQ ID NO: 84; 5′-GAATTCCTCGAGGATCCTCTAGATTAACAATTTTTAAAATATTCAGGATGTAATTCTCT AGCTACGTGATGAAATGC-3′), to generate the PCR fragment, containing the I3L-promoted CTL2 epitope, that was digested with HindIII and XhoI and cloned into pBSH6).
  • the plasmid generated by this manipulation is called p2-60-HIV.1.
  • the H6-promoted CTL1 epitope was then cloned into p2-60-HIV.1. This was accomplished by cloning a 290 bp NruI-EcoRI fragment, containing the H6-promoted CTL1 epitope, into the 3,300 bp NruI-EcoRI fragment of p2-60-HIV.1. (The 290 bp NruI-EcoRI fragment was generated by the following procedure.
  • NCC174A SEQ ID NO: 87; 5′-ACTTACAAAGCAGCTGTAGATCTTTCTCACTTTTTAAAAGAAAAAGGAGGTTTAGAAGG GCTAATTCATTCTCAACGAAGACAAGATATTCTTGATTTGTGG-3′
  • NCC174B SEQ ID NO: 88; 5′-CCACAAATCAAGAATATCTTGTCTTCGTTGAGAATGAATTAGCCCTTCTAAACCTCCTT TTTCTTAAAAAGTGAGAAAGATCTACAGCTGCTTTGTAAGT-3′
  • H6PCR1 and NCCPCR2 SEQ ID NO: 89; 5′-CTGCCAATCAGGAAAATATCCTTGTGTATGATAAATCCACAAATCAAGAATATC-3′.
  • NCC291A SEQ ID NO: 90; 5′-GGATATTTTCCTGATTGGCAGAATTACACACCAGGACCAGGAGTCAGATACCCATTAAC CTTTGGTTGGTGCTACAAGC-3′
  • NCC291B SEQ ID NO: 91; 5′-GCTTGTAGCACCAACCAAAGGTTAATGGGTATCTGACTCCTGGTCCTGGTGTGTAATTC TGCCAATCAGGAAAATATCC-3′
  • H6PCR1 and NCCPCR3 SEQ ID NO: 92; 5′-ACTACTGAATTCTCGAGAAAAATTATGGTACTAGCTTGTAGCACCAACC-3′
  • FIG. 16 shows the nucleotide sequence of the I3L-promoted nef CTL2 epitope and H6-promoted nef CTL1 epitope contained in p2-60-HIV.3:
  • NEF CTL epitopes FEATURES From To/Span Description frag 1 51 C6 Left Arm pept 175 98 (C) nef CTL2 frag 275 176 (C) I3L promoter frag 337 460 H6 promoter pept 461 709 1 nef CTL1 frag 751 801 C6 Right Arm
  • FIGS. 17A-C show the DNA sequence of the ALVAC C6 flanking arm (SEQ ID NOS: 97 and 98) in FIGS. 17A-C .
  • FIG. 17A to 17C show the nucleotide sequence of the C6 locus in pC6L:
  • p2-60HIV.3 was used in in vitro recombination experiments with vCP205 as the rescuing virus to yield vCP264.
  • the insertion plasmid, pC5POLT5A, containing the three (3) pol CTL epitopes was generated by cloning a 948 bp XhoI-BamHI fragment, containing the H6-promoted poll epitope, the I3L-promoted pol2 epitope and the 42K-promoted pol3 epitope, into the 2,940 bp XhoI-BamHI fragment of PBSK + .
  • the 948 bp XhoI-BamHI fragment was generated by the following procedure.
  • a 340 bp PCR fragment, containing the I3L and H6 promoters (in a head-to-head configuration) was generated from the plasmid, p2-60-HIV.2, with the oligonucleotide primers, P2IVH (SEQ ID NO: 105; 5′-GTCATGCTACTTTTGAATATTGCCATGATTAAACCTAAATAATTGTACTTTG-3,) and IVHP1 (SEQ ID NO: 106; 5′-TTTAATTTTACTGGTACAGTCTCAATCATTACGATACAAACTTAACGGATATCGCG-3′).
  • a 511 bp PCR fragment, containing the H6 promoter and I3L-promoted pol2 epitope was generated by using the 224 bp PCR fragment, containing the pol2 epitope, and the 340 bp PCR fragment, containing the I3L and H6 promoters, as templates in a PCR reaction with the oligonucleotide primers, P2B and IVHP1.
  • a 506 bp PCR fragment, containing the poll epitope and the 42K-promoted pol3 epitope was generated by using the 183 bp PCR fragment, containing the poll epitope, and the 347 bp PCR fragment, containing the 42K-promoted pol3 epitope, as templates in a PCR reaction with the oligonucleotide primers, P1A and P3B.
  • a 977 bp PCR fragment, containing the H6-promoted poll epitope, the I3L-promoted pol2 epitope and the 42K-promoted pol3 epitope was generated by using the 511 bp PCR fragment, containing the H6 promoter and I3L-promoted pol2 epitope, and the 506 bp PCR fragment, containing the poll epitope and 42K-promoted pol3 epitope, as templates in a PCR reaction with the oligonucleotide primers, P2B and P3B.
  • the 977 bp PCR fragment was then digested with XhoI and BamHI and cloned into the 2,940 bp XhoI-BamHI fragment of pBSK + .)
  • the plasmid generated by this manipulation is called pBSPOLT5.
  • Nucleotide sequence analysis of pBSPOLT5 indicated that there was an error in the pol2 epitope.
  • the 948 bp XhoI-BamHI fragment containing the H6-promoted poll epitope, the I3L-promoted pol2 epitope and the 42K-promoted pol3 epitope, was used as a template in a PCR reaction with the oligonucleotide primers, 13PCR1 (SEQ ID NO: 109; 5′-ATCATCGGATCCAAGCTTACATCATGCAGTGG-3′) and FIXPOL2 (SEQ ID NO: 110; 5′-ATCATCCTCGAGCTATTCAATTAGGTTGTAAGTCCCCACCTCAAC-3′).
  • the resulting PCR fragment containing the corrected I3L-promoted pol2 epitope, was digested with HindIII and XhoI and cloned into the 3,650 bp HindIII-XhoI fragment of pBSPOLT5.
  • the plasmid generated by this manipulation is called pBSPOLT5A.
  • the H6-promoted poll epitope, I3L-promoted pol2 epitope and 42K-promoted pol3 epitope was then cloned between canary pox C5 flanking arms. This was accomplished by cloning the 897 bp BamHI-XhoI fragment of pBSPOLT5A, containing the H6-promoted poll epitope, the I3L-promoted pol2 epitope and the 42K-promoted pol3 epitope, into the 4,675 bp BamHI-XhoI fragment of pNC5L-SP5. The plasmid generated by this manipulation is called pC5POLT5A.
  • FIGS. 18A-B The DNA sequence of pC5POLT5A (SEQ ID NOS: 111-115) is shown in FIGS. 18A-B .
  • FIGS. 18A to 18B shows the nucleotide sequence of the I3L-promoted pol2 epitope, H6-promoted poll epitope and 42K-promoted pol3 epitope contained in pC5POLT5a:
  • POL CTL epitopes FEATURES From To/Span Description frag 1 50 C5 Left Arm pept 272 92 (C) POL 2 frag 372 273 (C) I3L promoter frag 377 500 H6 promoter pept 501 647 1 POL1 frag 676 782 _42K promoter pept 783 962 1 POL 3 frag 986 1035 C5 Right Arm
  • FIGS. 19A-C show the DNA sequence of the ALVAC C5 flanking arm (SEQ ID NOS: 116 and 117) in FIGS. 19A-C .
  • FIGS. 19A to 19C show the nucleotide sequence of the C5 locus in pNC5L-SP5:
  • pC5POLT5A was used in in vitro recombination experiments with vCP264 as the rescuing virus to yield vCP300.
  • ALVAC, vCP205, vCP264 and vCP300 DNA were digested with HindIII, PstI or XhoI and the resultant fragments fractionated on an agarose gel. When the sizes of the resulting fragments were compared, it was determined that, as expected, the gag(+pro) and gp120(+transmembrane) genes were inserted into the C3 locus, the nef epitopes were inserted into the C6 locus and the pol epitopes were inserted into the C5 locus.
  • vCP300 expresses authentic HIV1gag and gp120(+transmembrane) gene products.
  • HeLa cell monolayers were either mock infected or infected at an m.o.i. of 10 pfu/cell with ALVAC or vCP300. Following an hour adsorption period, the inoculum was aspirated and the cells were overlayed with 2 mls of modified Eagle's medium (minus methionine) containing 2% fetal bovine serum and [ 35 S]-methionine (20 ⁇ Ci/ml).
  • Lysates precleared with normal human sera and protein A-sepharose, were then incubated overnight at 4° C. with the HIV1-seropositive human sera bound to protein A-sepharose. After the overnight incubation period, the samples were washed 4 ⁇ with 1 ⁇ buffer A and 2 ⁇ with a LiCl 2 /urea buffer. Precipitated proteins were dissociated from the immune complexes by the addition of 2 ⁇ Laemmli's buffer (125 mM Tris (pH6.8), 4% SDS, 20% glycerol, 10% 2-mercaptoethanol) and boiling for 5 min.
  • Laemmli's buffer 125 mM Tris (pH6.8), 4% SDS, 20% glycerol, 10% 2-mercaptoethanol
  • Proteins were fractionated on a 10% Dreyfuss gel system (Dreyfuss et al., 1984), fixed and treated with 1M Na-salicylate for fluorography. This analysis indicated that HIV1gag and gp120(+transmembrane) gene products were precipitated from vCP300-infected cells, but were not precipitated from mock infected or ALVAC-infected cells.
  • nef and pol epitopes in vCP300-infected cells has not been confirmed because no epitope specific serological reagents are yet available. Nucleotide sequence analysis, however, has confirmed that the nef and pol sequences cloned into vCP300 are correct. PCR fragments, containing the nef and pol expression cassettes, were generated from vCP300 DNA. Nucleotide sequence analysis of these fragments indicated that the nef and pol sequences are correct.
  • vCP205 expresses the same cell surface-associated form of HIV1 gp120 as expressed by vCP300. The immunogenicity of this gene product, as expressed by vCP205, has been assayed in small laboratory animals.
  • Groups of two rabbits or guinea pigs were inoculated intramuscularly (im) with 10 8 pfu of ALVAC, vCP205, or with 0.1 mg of peptide CLTB-36 (GPKEPFRDYVDRFYKNKRKRIHIGPGRAFYTTKN) (SEQ ID NOS: 118) adjuvanted with 0.05 mg of QS-21 according to the schedule below (Table 21).
  • Each rabbit and guinea pig was bled prior to the first inoculation and at 2-week intervals following the first inoculation through week 14. Serum was prepared from each blood sample and stored at ⁇ 70° C. until use. Each serum was tested for antibody responses to recombinant HIV MN/BRU hybrid gp160 or to 25-mer synthetic HIV MN gp120 V3 loop (American Bio-Technologies, Inc. Cambridge, Mass., product # 686010) by kinetics enzyme-linked immunosorbant assay (KELISA).
  • Rabbits immunized with vCP205 (Group 2) produced the highest levels of anti-gp160 antibodies ( FIG. 20 ). Rabbits were immunized according to the schedule in Table 21 (arrows in FIG. 20 ) and bled at 2 week intervals. Each serum was diluted 1:100 in dilution buffer and tested for reactivity with purified recombinant HIV MN/BRU gp160 using a kinetics ELISA. Both rabbits in this group began producing gp160 reactive antibodies after a single inoculation. Boosting with subsequent inoculations produced only minor increases in antibody levels.
  • Rabbits immunized only with peptide CLTB-36 would not be expected to generate broadly reactive gp160-specific antibodies since the peptide contains only a small portion of the envelope glycoprotein, the V3 loop. Thus, sera were tested for reactivity to a peptide containing 25 amino acids of the HIV MN V3 loop ( FIG. 21 ). Rabbits were immunized according to the schedule in Table 21 (arrows in FIG. 22 ) and bled at 2 week intervals.
  • Each serum was diluted 1:100 in dilution buffer and tested for reactivity with a 25-mer synthetic peptide representing the HIV MN gp120 V3 loop (CNKRKRIHIGPGRAFYTTKNIIGTIC; (SEQ ID NO: 119) American Bio-Technologies, Inc. Cambridge, Mass., product # 686010) using a kinetics ELISA.
  • the highest V3 antibody responses were found in the sera of rabbits inoculated three times with vCP205.
  • Two inoculations with vCP205 followed by peptide CLTB-36 in QS-21 produced anti-V3 antibody responses, but not as high as Group 2 rabbits.
  • only one rabbit responded to three inoculations with peptide CLTB-36 in QS-21.
  • FIG. 23 Similar results were seen using a HIV MN V3 25-mer peptide as the KELISA antigen ( FIG. 23 ).
  • Guinea pigs were immunized according to the schedule in Table 21 (arrows in FIG. 23 ) and bled at 2 week intervals. Each serum was diluted 1:100 in dilution buffer and tested for reactivity with a 25-mer synthetic peptide representing the HIV MN gp120 V3 loop (CNKRKRIHIGPGRAFYTTKNIIGTIC (SEQ ID NO: 120) American Bio-Technologies, Inc. Cambridge, Mass., product # 686010) using a kinetics ELISA.
  • a single inoculation of peptide CLTB-36 in QS-21 elicited V3 antibody responses which were boosted by second and third inoculations.
  • Two inoculations with vCP205 were necessary to induce V3 antibody responses which was boosted to higher levels by the third inoculation of vCP205 or CLTB-36 in QS-21.
  • vCP300 Expression and immunogenicity of the Nef and Pol CTL epitopes expressed by vCP300 is demonstrated by the following in vitro assays.
  • Fresh PBMC samples were derived from HIV-seropositive individuals. Twenty-percent of these cells were inoculated with vCP300 at an m.o.i. of 10. Two hours post-infection the cells were washed and mixed with autologous, uninoculated PBMCs at a ratio of uninoculated/inoculated of 10:1. (Seeding density equaled 1.5 ⁇ 10 6 cells/ml). On day 0, exogenous IL-7 was added at a final concentration of 1000 U/ml.
  • the combined results demonstrate the ability of vCP300-infected PBMCs to stimulate HIV-1, Env-, Gag-, Pol-, and Nef-specific cytolytic activity. Further, abrogation of the cytolytic activities by anti-CD8 monoclonal antibodies demonstrates that the nature of the cell mediating the cytolytic activities are classical CD8 + CTLs.
  • vCP205 the inoculation of rabbits and guinea pigs with the HIV ALVAC recombinant canarypox virus, vCP205, elicited antibodies to the HIV envelope glycoprotein and a region of the HIV envelope glycoprotein associated with neutralization of HIV, the gp120 V3 loop region.
  • the expression and immunogenicity of the vCP300 expressed Env, Gag, Pol and Nef encoded products is demonstrated by the in vitro stimulation of CD8 + CTLs from seropositive individuals.
  • vCP205 and vCP300 and precursors to these recombinants and expression products and DNA from these recombinants are useful, as described above.
  • vCP1307 an ALVAC recombinant expressing HIV1 gp120+TM with 2 ELDKWA epitopes from HIV1 gp41 inserted into the gp120 V3 loop region, was generated by the following procedure.
  • the sequence encoding part of the ELDKWA elements and V3 loop was cloned into pBSK+ (Stratagene, LaJolla, Calif.). This was accomplished by cloning a 225 bp EcoRI-SacI-digested PCR fragment, containing part of the ELDKWA-V3 loop sequence, into the 2,900 bp EcoRI-SacI fragment of pBSK+.
  • PCR fragment was generated from the plasmid, pBSHIVMN120T, with the primers, HIVP72 (SEQ ID NO: 121; 5′-TTATTACCATTCCAAGTACTATT-3′) and HIVP74 (SEQ ID NO: 122) 5′-TCTGTACAAATTAATTGTACAAGACCCAACTACGAGCTCGACAAATGGGCCCATATAGGACC AGGGAGAGAATTGGATAAGTGGGCGAATATAATAGGAACTATAAGAC-3′).
  • the plasmid generated by this manipulation is called pHIV55.
  • pBSHIVMN120T a plasmid containing the H6-promoted HIV1 gp120+TM gene
  • PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIVMN6 (SEQ ID NO: 123; 5′-GGGTTATTAATGATCTGTAG-3′) and HIV3B2 (SEQ ID NO: 124; 5′-GAATTACAGTAGAAGAATTCCCCTCCACAATTAAAAC-3′).
  • HIVMN6 SEQ ID NO: 123; 5′-GGGTTATTAATGATCTGTAG-3′
  • HIV3B2 SEQ ID NO: 124; 5′-GAATTACAGTAGAAGAATTCCCCTCCACAATTAAAAC-3′.
  • the T 5 NT-modified 5′-end of the env gene was then cloned upstream to the rest of the env gene. This was accomplished by cloning the 1,025 bp KpnI-EcoRI fragment of pBSMIDMN, containing the T 5 NT-modified 5′-end of the env gene, into the 4,300 bp KpnI-EcoRI fragment of pBS3MN.
  • pBS3MN was generated by cloning a 430 bp EcoRI-SacI-digested PCR fragment, containing a central portion of the env gene, and a 1,050 bp SacI-XbaI-digested PCR fragment, containing the 3′-end of the env gene, into the 2,900 bp EcoRI-XbaI fragment of pBSK+.
  • the 430 bp PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIV3B1 (SEQ ID NO: 125; 5′-GTTTTAATTGTGGAGGGGAATTCTTCTACTGTAATTC-3′) and HIVMN4 (SEQ ID NO: 126; 5′-ATCATCGAGCTCCTATCGCTGCTC-3′).
  • the 1,050 bp PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIVMN5 (SEQ ID NO: 127; 5′-ATCATCGAGCTCTGTTCCTTGGGTTCTTAG-3′) and HIVMN3P (SEQ ID NO: 128; 5′-ATCATCTCTAGAATAAAAATTATAGCAAAGCCCTTTCCAAGCC-3′).)
  • HIVMN5 SEQ ID NO: 127; 5′-ATCATCGAGCTCTGTTCCTTGGGTTCTTAG-3′
  • HIVMN3P SEQ ID NO: 128; 5′-ATCATCTCTAGAATAAAAATTATAGCAAAGCCCTTTCCAAGCC-3′.
  • the H6 promoter (Perkus et al., 1989) was then cloned upstream to the env gene. This was accomplished by cloning the 320 bp KpnI fragment of pH6IIIBE, containing the H6 promoter linked to the 5′-end of the HIV1 (IIIB) env gene, and the 2,450 bp KpnI-XbaI fragment of pBSMID3MN, containing the bulk of the HIV1 (MN) env gene, into the 2,900 bp KpnI-XbaI fragment of pBSK+.
  • the plasmid generated by this manipulation is called pH6HMNE.
  • the sequence encoding gp41 was then replaced with the sequence encoding the HIV1 env transmembrane (TM) region. This was accomplished by cloning a 480 bp EcoRI-XbaI-digested PCR fragment, containing the 3′-end of the gp120 gene and the HIV1 env transmembrane region, into the 4,200 bp EcoRI-XbaI fragment of pH6HMNE.
  • HIVTM1 SEQ ID NO: 129; 5′-TTATTCATAATGATAGTAGGAGGCTTGGTAGGTTTAAGAATAGTTTTTGCTGTACTCTCTGT AGTGAATAGAGTTAGGCAGGGATAA-3′
  • HIVTM2 SEQ ID NO: 130; 5′-TTATCCCTGCCTAACTCTATTCACTACAGAGAGTACAGCAAAAACTATTCTTAAACCTACCA AGCCTCCTACTATCATTATGAATAA-3′
  • HIV3B1 SEQ ID NO: 125
  • HIVTM3 SEQ ID NO: 131; 5′-ATCATCTCTAGAATAAAAATTATCCCTGCCTAACTCTATTCAC-3′.
  • PCR-MN11 was generated from the plasmid, pH6HMNE, with the oligonucleotides, HIV3B1 (SEQ ID NO: 125) and HIVMN18 (SEQ ID NO: 132; 5′-GCCTCCTACTATCATTATGAATAATCTTTTTTCTCTCTG-3′).)
  • the plasmid generated by this manipulation is called pBSHIVMN120T.
  • Another part of the sequence encoding the ELDKWA epitopes and V3 loop was then cloned into PBSK+. This was accomplished by cloning a 300 bp HindIII-SacI-digested PCR fragment, containing part of the ELDKWA-V3 loop sequence, into the 2,900 bp HindIII-SacI fragment of PBSK+.
  • PCR fragment was generated from the plasmid, pBSHIVMN120T, with the primers, HIVP69 (SEQ ID NO: 133; 5′-TGATAGTACCAGCTATAGGTTGAT-3′) and HIVP75 (SEQ ID NO: 134; 5′-TTTGTCGAGCTCGTAGTTGGGTCTTGTACAATT-3′).
  • the plasmid generated by this manipulation is called pHIV56.
  • the ELDKWA-V3 loop sequences from pHIV55 and pHIV56 were then cloned into the H6-promoted gp120+TM gene. This was accomplished by cloning the 225 bp EcoRI-SacI fragment of pHIV55 and the 300 bp HindIII-SacI fragment of pHIV56, containing the ELDKWA-V3 loop sequences, into the 4,300 bp EcoRI-HindIII fragment of pBSHIVMN120T. The plasmid generated by this manipulation is called pHIV57.
  • the H6-promoted gp120+TM construct containing the ELDKWA epitopes was then cloned between C5 flanking arms. This was accomplished by cloning the 1,700 bp NruI-XbaI fragment of pHIV57, containing the H6-promoted gp120+TM (with ELDKWA epitopes) gene, into the 4,700 bp NruI-XbaI fragment of pSIVGC15. (pSIVGC15 contains the H6-promoted SIV env gene cloned between C5 flanking arms.) The plasmid generated by this manipulation is called pHIV59.
  • pHIV59 The DNA sequence of the H6-promoted gp120+TM (with ELDKWA epitopes) gene in pHIV59 is shown in FIG. 26 . pHIV59 was used in in vitro recombination experiments with ALVAC as the rescuing virus to yield vCP1307.
  • FACS analysis was performed to determine whether HIV1 gp120+TM (with ELDKWA epitopes) was expressed on the surface of vCP1307-infected cells.
  • 5 ⁇ 10 6 HeLa-S3 cells in S-MEM (Sigma M-8028 Joklik suspension media) were infected at an m.o.i. of 5 pfu/cell with ALVAC, vP1286 (a WR recombinant expressing HIV1 gp120+TM) or vCP1307. Following a 60 minute adsorption period at 37° C., the cells were washed with 10 mls of S-MEM and centrifuged at 1,000 RPM for 5 minutes.
  • a gene product containing the ELDKWA epitope was expressed at low levels on the surface of vCP1307-infected cells, but was not expressed on the surface of ALVAC-infected or vP1286-infected cells ( FIG. 27 , lower panel).
  • a gene product reactive with the HIV1-seropositive sera was expressed on the surface of vP1286-infected cells and vCP1307-infected cells, but was not expressed on the surface of ALVAC-infected cells ( FIG. 27 , upper panel).
  • vCP1307 expresses a form of gp120+TM which contains an immunogenic ELDKWA epitope.
  • HeLa cell monolayers were infected at an m.o.i. of 10 pfu/cell with ALVAC (the parental virus), vP1286 (a WR recombinant expressing HIV1 gp120+TM) or vCP1307. Following an hour adsorption period, the inoculum was removed and the cells were overlayed with 2 mls of modified Eagle's medium (minus cysteine and methionine) containing 2% dialyzed fetal bovine serum and [ 35 S]-TRANS label (30 ⁇ Ci/ml).
  • modified Eagle's medium minus cysteine and methionine
  • Proteins were fractionated on an SDS-polyacrylamide gel, fixed and treated with 1 M Na-salicylate for fluorography. Proteins of the appropriate size were precipitated with the monoclonal antibody to the ELDKWA epitope from vCP1307-infected cells, but were not precipitated from ALVAC-infected cells or vP1286-infected cells. Furthermore, proteins of the appropriate size were precipitated with the human HIV1-seropositive sera from vP1286-infected cells and vCP1307-infected cells, but were not precipitated from ALVAC-infected cells. These results indicate that vCP1307 expresses a form of gp120+TM which contains an antigenic ELDKWA epitope.
  • vP1313 a NYVAC Recombinant Expressing a Form of HIV1 gp120+TM with 2 ELDKWA Epitopes Inserted into the gp120 V3 Loop
  • vP1313, a NYVAC recombinant expressing HIV1 gp120+TM with 2 ELDKWA epitopes from HIV1 gp41 inserted into the gp120 V3 loop was generated by the following procedure.
  • the sequence encoding part of the ELDKWA epitopes and V3 loop was cloned into pBSK+. This was accomplished by cloning a 225 bp EcoRI-SacI-digested PCR fragment, containing part of the ELDKWA-V3 loop sequence, into the 2,900 bp EcoRI-SacI fragment of pBSK+.
  • PCR fragment was generated from the plasmid, pBSHIVMN120T, with the primers, HIVP72 (SEQ ID NO: 144; 5′-TTATTACCATTCCAAGTACTATT-3′) and HIVP74 (SEQ ID NO: 145; 5′-TCTGTACAAATTAATTGTACAAGACCCAACTACGAGCTCGACAAATGGGCCCATATAGGACC AGGGAGAGAATTGGATAAGTGGGCGAATATAATAGGAACTATAAGAC-3′).
  • the plasmid generated by this manipulation is called pHIV55.
  • pBSHIVMN120T a plasmid containing the H6-promoted HIV1 gp120+TM gene
  • PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIVMN6 (SEQ ID NO: 146; 5′-GGGTTATTAATGATCTGTAG-3′) and HIV3B2 (SEQ ID NO: 124; 5′-GAATTACAGTAGAAGAATTCCCCTCCACAATTAAAAC-3′).
  • HIVMN6 SEQ ID NO: 146; 5′-GGGTTATTAATGATCTGTAG-3′
  • HIV3B2 SEQ ID NO: 124; 5′-GAATTACAGTAGAAGAATTCCCCTCCACAATTAAAAC-3′.
  • the T 5 NT-modified 5%-end of the env gene was then cloned upstream to the rest of the env gene. This was accomplished by cloning the 1,025 bp KpnI-EcoRI fragment of pBSMIDMN, containing the T 5 NT-modified 5′-end of the env gene, into the 4,300 bp KpnI-EcoRI fragment of pBS3MN.
  • pBS3MN was generated by cloning a 430 bp EcoRI-SacI-digested PCR fragment, containing a central portion of the env gene, and a 1,050 bp SacI-XbaI-digested PCR fragment, containing the 3′-end of the env gene, into the 2,900 bp EcoRI-XbaI fragment of pBSK+.
  • the 430 bp PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIV3B1 (SEQ ID NO: 125; 5′-GTTTTAATTGTGGAGGGGAATTCTTCTACTGTAATTC-3′) and HIVMN4 (SEQ ID NO: 126; 5′-ATCATCGAGCTCCTATCGCTGCTC-3′).
  • the 1,050 bp PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIVMN5 (SEQ ID NO: 127; 5′-ATCATCGAGCTCTGTTCCTTGGGTTCTTAG-3′) and HIVMN3P (SEQ ID NO: 128; 5′-ATCATCTCTAGAATAAAAATTATAGCAAAGCCCTTTCCAAGCC-3′).)
  • HIVMN5 SEQ ID NO: 127; 5′-ATCATCGAGCTCTGTTCCTTGGGTTCTTAG-3′
  • HIVMN3P SEQ ID NO: 128; 5′-ATCATCTCTAGAATAAAAATTATAGCAAAGCCCTTTCCAAGCC-3′.
  • the H6 promoter was then cloned upstream to the env gene. This was accomplished by cloning the 320 bp KpnI fragment of pH6IIIBE, containing the H6 promoter linked to the 5′-end of the HIV1 (IIIB) env gene, and the 2,450 bp KpnI-XbaI fragment of pBSMID3MN, containing the bulk of the HIV1 (MN) env gene, into the 2,900 bp KpnI-XbaI fragment of pBSK+.
  • the plasmid generated by this manipulation is called pH6HMNE.
  • the sequence encoding gp41 was then replaced with the sequence encoding the HIV1 env transmembrane (TM) region. This was accomplished by cloning a 480 bp EcoRI-XbaI-digested PCR fragment, containing the 3′-end of the gp120 gene and the HIV1 env transmembrane region, into the 4,200 bp EcoRI-XbaI fragment of pH6HMNE.
  • HIVTM1 SEQ ID NO: 129; 5′-TTATTCATAATGATAGTAGGAGGCTTGGTAGGTTTAAGAATAGTTTTTGCTGTACTCTCTGT AGTGAATAGAGTTAGGCAGGGATAA-3′
  • HIVTM2 SEQ ID NO: 130; 5′-TTATCCCTGCCTAACTCTATTCACTACAGAGAGTACAGCAAAAACTATTCTTAAACCTACCA AGCCTCCTACTATCATTATGAATAA-3′
  • HIV3B1 SEQ ID NO: 125
  • HIVTM3 SEQ ID NO: 131; 5′-ATCATCTCTAGAATAAAAATTATCCCTGCCTAACTCTATTCAC-3′.
  • PCR-MN11 was generated from the plasmid, pH6HMNE, with the oligonucleotides, HIV3B1 (SEQ ID NO: 125) and HIVMN18 (SEQ ID NO: 132; 5′-GCCTCCTACTATCATTATGAATAATCTTTTTTCTCTCTG-3′).)
  • the plasmid generated by this manipulation is called pBSHIVMN120T.
  • Another part of the sequence encoding the ELDKWA epitopes and V3 loop was then cloned into pBSK+. This was accomplished by cloning a 300 bp HindIII-SacI-digested PCR fragment, containing part of the ELDKWA-V3 loop sequence, into the 2,900 bp HindIII-SacI fragment of pBSK+.
  • PCR fragment was generated from the plasmid, pBSHIVMN120T, with the primers, HIVP69 (SEQ ID NO: 133; 5′-TGATAGTACCAGCTATAGGTTGAT-3′) and HIVP75 (SEQ ID NO: 134; 5′-TTTGTCGAGCTCGTAGTTGGGTCTTGTACAATT-3′).
  • the plasmid generated by this manipulation is called pHIV56.
  • the ELDKWA-V3 loop sequences from pHIV55 and pHIV56 were then cloned into the H6-promoted gp120+TM gene. This was accomplished by cloning the 225 bp EcoRI-SacI fragment of pHIV55 and the 300 bp HindIII-SacI fragment of pHIV56, containing the ELDKWA-V3 loop sequences, into the 4,300 bp EcoRI-HindIII fragment of pBSHIVMN120T. The plasmid generated by this manipulation is called pHIV57.
  • the H6-promoted gp120+TM construct containing the ELDKWA epitopes was then cloned between C5 flanking arms. This was accomplished by cloning the 1,700 bp NruI-XbaI fragment of pHIV57, containing the H6-promoted gp120+TM (with ELDKWA epitopes) gene, into the 4,700 bp NruI-XbaI fragment of pSIVGC15. (pSIVGC15 contains the H6-promoted SIV env gene cloned between C5 flanking arms) The plasmid generated by this manipulation is called pHIV59.
  • the H6-promoted gp120+TM (with ELDKWA epitopes) gene was then cloned between I4L flanking arms. This was accomplished by cloning the 1,850 bp BamHI-SmaI fragment of pHIV59, containing the H6-promoted gp120+TM (with ELDKWA epitopes) gene, into the 3,600 bp BamHI-SmaI fragment of pSD550VC. The plasmid generated by this manipulation is called pHIV60.
  • the DNA sequence of the H6-promoted gp120+TM (with ELDKWA epitopes) gene in pHIV60 is shown in FIG. 28 .
  • pHIV60 was used in in vitro recombination experiments with NYVAC as the rescuing virus to yield vP1313.
  • FACS analysis was performed to determine whether HIV1 gp120+TM (with ELDKWA epitopes) was expressed on the surface of vP1313-infected cells.
  • 5 ⁇ 10 6 HeLa-S3 cells in S-MEM (Sigma M-8028 Joklik suspension media) were infected at an m.o.i. of 5 pfu/cell with NYVAC, vP1286 (a WR recombinant expressing HIV1 gp120+TM) or vP1313. Following a 60 minute adsorption period at 37° C., the cells were washed with 10 mls of S-MEM and centrifuged at 1,000 RPM for 5 minutes.
  • a gene product containing the ELDKWA epitope was expressed on the surface of vP1313-infected cells, but was not expressed on the surface of NYVAC-infected or vP1286-infected cells ( FIG. 29 , lower panel).
  • a gene product reactive with the HIV1-seropositive sera was expressed on the surface of vP1286-infected cells and vP1313-infected cells, but was not expressed on the surface of NYVAC-infected cells ( FIG. 29 , upper panel).
  • vP1313 expresses a form of gp120+TM which contains an immunogenic ELDKWA epitope.
  • HeLa cell monolayers were infected at an m.o.i. of 10 pfu/cell with NYVAC (the parental virus), vP1286 (a WR recombinant expressing HIV1 gp120+TM) or vP1313.
  • NYVAC the parental virus
  • vP1286 a WR recombinant expressing HIV1 gp120+TM
  • vP1313 the inoculum was removed and the cells were overlayed with 2 mls of modified Eagle's medium (minus cysteine and methionine) containing 2% dialyzed fetal bovine serum and [ 35 S]-TRANS label (30 ⁇ Ci/ml).
  • Proteins were fractionated on an SDS-polyacrylamide gel, fixed and treated with 1 M Na-salicylate for fluorography. Proteins of the appropriate size were precipitated with the monoclonal antibody to the ELDKWA epitope from vP1313-infected cells, but were not precipitated from NYVAC-infected cells or vP1286-infected cells. Furthermore, proteins of the appropriate size were precipitated with the human HIV1-seropositive sera from vP1286-infected cells and vP1313-infected cells, but were not precipitated from NYVAC-infected cells. These results indicate that vP1313 expresses a form of gp120+TM which contains an immunogenic ELDKWA epitope.
  • vP1319 a COPAK recombinant expressing HIV1 gp120+TM with 2 ELDKWA epitopes from HIV1 gp41 inserted into the gp120 V3 loop, was generated by the following procedure.
  • the sequence encoding part of the ELDKWA epitopes and V3 loop was cloned into pBSK+. This was accomplished by cloning a 225 bp EcoRI-SacI-digested PCR fragment, containing part of the ELDKWA-V3 loop sequence, into the 2,900 bp EcoRI-SacI fragment of pBSK+.
  • pBSHIVMN120T a plasmid containing the H6-promoted HIV1 gp120+TM gene, was generated by the following procedure.
  • PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIVMN6 (SEQ ID NO: 123; 5′-GGGTTATTAATGATCTGTAG-3′) and HIV3B2 (SEQ ID NO: 124; 5′-GAATTACAGTAGAAGAATTCCCCTCCACAATTAAAAC-3′).
  • HIVMN6 SEQ ID NO: 123; 5′-GGGTTATTAATGATCTGTAG-3′
  • HIV3B2 SEQ ID NO: 124; 5′-GAATTACAGTAGAAGAATTCCCCTCCACAATTAAAAC-3′.
  • the T 5 NT-modified 5′-end of the env gene was then cloned upstream to the rest of the env gene. This was accomplished by cloning the 1,025 bp KpnI-EcoRI fragment of pBSMIDMN, containing the T 5 NT-modified 5′-end of the env gene, into the 4,300 bp KpnI-EcoRI fragment of pBS3MN.
  • pBS3MN was generated by cloning a 430 bp EcoRI-SacI-digested PCR fragment, containing a central portion of the env gene, and a 1,050 bp SacI-XbaI-digested PCR fragment, containing the 3′-end of the env gene, into the 2,900 bp EcoRI-XbaI fragment of pBSK+.
  • the 430 bp PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIV3B1 (SEQ ID NO: 125; 5′-GTTTTAATTGTGGAGGGGAATTCTTCTACTGTAATTC-3′) and HIVMN4 (SEQ ID NO: 126; 5′-ATCATCGAGCTCCTATCGCTGCTC-3′).
  • the 1,050 bp PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIVMN5 (SEQ ID NO: 127; 5′-ATCATCGAGCTCTGTTCCTTGGGTTCTTAG-3′) and HIVMN3P (SEQ ID NO: 128; 5′-ATCATCTCTAGAATAAAAATTATAGCAAAGCCCTTTCCAAGCC-3′).)
  • HIVMN5 SEQ ID NO: 127; 5′-ATCATCGAGCTCTGTTCCTTGGGTTCTTAG-3′
  • HIVMN3P SEQ ID NO: 128; 5′-ATCATCTCTAGAATAAAAATTATAGCAAAGCCCTTTCCAAGCC-3′.
  • the H6 promoter was then cloned upstream to the env gene. This was accomplished by cloning the 320 bp KpnI fragment of pH6IIIBE, containing the H6 promoter linked to the 5′-end of the HIV1 (IIIB) env gene, and the 2,450 bp KpnI-XbaI fragment of pBSMID3MN, containing the bulk of the HIV1 (MN) env gene, into the 2,900 bp KpnI-XbaI fragment of pBSK+.
  • the plasmid generated by this manipulation is called pH6HMNE.
  • the sequence encoding gp41 was then replaced with the sequence encoding the HIV1 env transmembrane (TM) region. This was accomplished by cloning a 480 bp EcoRI-XbaI-digested PCR fragment, containing the 3′-end of the gp120 gene and the HIV1 env transmembrane region, into the 4,200 bp EcoRI-XbaI fragment of pH6HMNE.
  • HIVTM1 SEQ ID NO: 129; 5′-TTATTCATAATGATAGTAGGAGGCTTGGTAGGTTTAAGAATAGTTTTTGCTGTACTCTCTGT AGTGAATAGAGTTAGGCAGGGATAA-3′
  • HIVTM2 SEQ ID NO: 130; 5′-TTATCCCTGCCTAACTCTATTCACTACAGAGAGTACAGCAAAAACTATTCTTAAACCTACCA AGCCTCCTACTATCATTATGAATAA-3′
  • HIV3B1 SEQ ID NO: 125
  • HIVTM3 SEQ ID NO: 131; 5′-ATCATCTCTAGAATAAAAATTATCCCTGCCTAACTCTATTCAC-3′.
  • PCR-MN11 was generated from the plasmid, pH6HMNE, with the oligonucleotides, HIV3B1 (SEQ ID NO: 125) and HIVMN18 (SEQ ID NO: 132; 5′-GCCTCCTACTATCATTATGAATAATCTTTTTTCTCTCTG-3′).)
  • the plasmid generated by this manipulation is called pBSHIVMN120T.
  • Another part of the sequence encoding the ELDKWA epitopes and V3 loop was then cloned into pBSK+. This was accomplished by cloning a 300 bp HindIII-SacI-digested PCR fragment, containing part of the ELDKWA-V3 loop sequence, into the 2,900 bp HindIII-SacI fragment of pBSK+.
  • PCR fragment was generated from the plasmid, pBSHIVMN120T, with the primers, HIVP69 (SEQ ID NO: 133; 5′-TGATAGTACCAGCTATAGGTTGAT-3′) and HIVP75 (SEQ ID NO: 134; 5′-TTTGTCGAGCTCGTAGTTGGGTCTTGTACAATT-3′).
  • the plasmid generated by this manipulation is called pHIV56.
  • the ELDKWA-V3 loop sequences from pHIV55 and pHIV56 were then cloned into the H6-promoted gp120+TM gene. This was accomplished by cloning the 225 bp EcoRI-SacI fragment of pHIV55 and the 300 bp HindIII-SacI fragment of pHIV56, containing the ELDKWA-V3 loop sequences, into the 4,300 bp EcoRI-HindIII fragment of pBSHIVMN120T. The plasmid generated by this manipulation is called pHIV57.
  • the H6-promoted gp120+TM construct containing the ELDKWA epitopes was then cloned between C5 flanking arms. This was accomplished by cloning the 1,700 bp NruI-XbaI fragment of pHIV57, containing the H6-promoted gp120+TM (with ELDKWA epitopes) gene, into the 4,700 bp NruI-XbaI fragment of pSIVGC15. (pSIVGC15 contains the H6-promoted SIV env gene cloned between C5 flanking arms.) The plasmid generated by this manipulation is called pHIV59.
  • the H6-promoted gp120+TM (with ELDKWA epitopes) gene was then cloned between COPAK flanking arms. This was accomplished by cloning the 1,850 bp BamHI-SmaI fragment of pHIV59, containing the H6-promoted gp120+TM (with ELDKWA epitopes) gene, into the 4,600 bp BamHI-SmaI fragment of pSD553VC. The plasmid generated by this manipulation is called pHIV61.
  • the DNA sequence of the H6-promoted gp120+TM (with ELDKWA epitopes) gene in pHIV61 is shown in FIG. 30 .
  • pHIV61 was used in in vitro recombination experiments with COPAK as the rescuing virus to yield vP1319.
  • FACS analysis was performed to determine whether HIV1 gp120+TM (with ELDKWA epitopes) was expressed on the surface of vP1319-infected cells.
  • 5 ⁇ 10 6 HeLa-S3 cells in S-MEM (Sigma M-8028 Joklik suspension media) were infected at an m.o.i. of 5 pfu/cell with WR, vP1286 (a WR recombinant expressing HIV1 gp120+TM) or vP1319. Following a 60 minute adsorption period at 37° C., the cells were washed with 10 mls of S-MEM and centrifuged at 1,000 RPM for 5 minutes.
  • the supernatant was decanted and the pellet was resuspended in a 1:100 dilution of goat anti-human FITC or goat anti-mouse FITC (obtained from Boehringer Mannheim).
  • the samples were incubated at 4° C. for 30 minutes, washed twice with PBS-CMF (with 0.2% NaN 3 +0.2% BSA) and analyzed on a Facscan flow cytometer.
  • a gene product containing the ELDKWA epitope was expressed on the surface of vP1319-infected cells, but was not expressed on the surface of WR-infected cells or vP1286-infected cells ( FIG. 31 , middle panel).
  • a gene product containing the V3 loop was expressed on the surface of vP1286-infected cells, but was not expressed on the surface of WR-infected cells or vP1319-infected cells ( FIG. 31 , lower panel).
  • a gene product reactive with the HIV1-seropositive sera was expressed on the surface of vP1286-infected cells and vP1319-infected cells, but was not expressed on the surface of WR-infected cells ( FIG. 31 , upper panel).
  • vP1319 expresses a form of gp120+TM which contains an immunogenic ELDKWA epitope.
  • HeLa cell monolayers were infected at an m.o.i. of 10 pfu/cell with NYVAC (the parental virus), vP1286 (a WR recombinant expressing HIV1 gp120+TM) or vP1319.
  • NYVAC the parental virus
  • vP1286 a WR recombinant expressing HIV1 gp120+TM
  • vP1319 Following an hour adsorption period, the inoculum was removed and the cells were overlayed with 2 mls of modified Eagle's medium (minus cysteine and methionine) containing 2% dialyzed fetal bovine serum and [ 35 S]-TRANS label (30 ⁇ Ci/ml).
  • Proteins were fractionated on an SDS-polyacrylamide gel, fixed and treated with 1 M Na-salicylate for fluorography. Proteins of the appropriate size were precipitated with the monoclonal antibody to the ELDKWA epitope from vP1319-infected cells, but were not precipitated from NYVAC-infected cells or vP1286-infected cells. Furthermore, proteins of the appropriate size were precipitated with the human HIV1-seropositive sera from vP1286-infected cells and vP1319-infected cells, but were not precipitated from NYVAC-infected cells. These results indicate that vP1319 expresses a form of gp120+TM which contains an immunogenic ELDKWA epitope.
  • vCP1307, vP1313 and vP1319 each express the ELDKWA epitope in an immunogenic configuration
  • these recombinants have numerous utilities, as do the expression products, antibodies elicited thereby, and DNA from these recombinants, as discussed above.
  • Macaca fascicularis adult, wild caught
  • Blood samples were collected in EDTA blood collection Vacutainer® tubes (Becton-Dickinson, Meyland, France) for hematological analyses, in lithium-heparin microvette CB 100 tubes (Sarstedt, Nümbrecht, Germany) for biochemical analysis and in tubes with serum separator SST Vacutainer® tubes (Becton-Dickinson, Meylan, France) for serological analyses (MON:TSA.034.00). Samplings were done on days 0, 3, 7, 14, 28, 31, 35, 42, 56, 59, 63, 70, 84, 87, 91, 98, 112, 115, 119, 126 and 140. Anesthesia (Ketamine, 20 mg/kg, intramuscular) was used for clinical examinations and blood sampling.
  • the reactions were stopped with 50 ⁇ l of 4N H 2 SO 4 .
  • the optical density was measured at 490-650 nm with an automatic plate reader (Vmax, Molecular Devices).
  • Vmax automatic plate reader
  • Titer log ⁇ OD 490 - 650 ⁇ 10 1 ⁇ / ⁇ dilution ⁇ ⁇ ( OD ⁇ ⁇ value ⁇ ⁇ range ⁇ : ⁇ ⁇ 0.2 ⁇ ⁇ to ⁇ ⁇ 1 )
  • Neutralizing antibody assay determines the dilution of serum that prevents the development of syncytia in 50% of microwells infected with 10 TCID 50 of HIV MN.
  • the MN strain was obtained from F. Barre-Sinoussi and propagated in CEM clone 166 cells.
  • Sera were decomplemented and twofold serial dilutions in RPMI beginning 1/10 were prepared. Equal volumes of serum dilution and HIV suspension (500 ul each) were mixed and incubated for 2 h at 37° C. The HIV suspension had been adjusted to contain 10 2 to 10 2.5 TCID 50 per ml.
  • indicator CEMss cells Prior to use, indicator CEMss cells were plated in microwells coated with poly-L-lysine, and incubated for 1 h at 37° C. Culture medium was removed and replaced with the virus/serum mixtures (100 ⁇ l/well, 6 wells per dilution). After 1 h incubation at 37° C. culture medium was added to each well and the plates were incubated at 37° C. All incubations were in a CO 2 5% incubator.
  • the anti-HIV immune response induced by vCP205 was assessed by ELISA tests using purified gp160 MN/BRU (from recombinant vaccinia), V3MN synthetic peptide and p24 (from E. coli , LAI isolate). All the animals developed antibodies against gp160 and V3, and 2/4 against p24. The positive anti-HIV immune response usually appeared after 2, or maximum, 3 injections. Subsequent vCP205 inoculations mainly maintained (sometimes slightly increased) the antibody levels and improved homogeneity of the response between macaques. Highest antibody titers were usually observed two weeks after each inoculation, followed by a decrease until the next booster. Neutralizing antibodies against HIV/MN were detectable in all immunized monkeys.
  • Serological analyses (considering the ELISA titers of the negative control group of macaques sera, the negative detection threshold of the serological response was considered to be, in log 10 : 1.56 ⁇ 0.24, 1.92 ⁇ 0.12 and 2.18 ⁇ 0.34, for gp160, V3 and p24 respectively): gp160 and V3 specific response ( FIGS. 37 a - 37 b , 38 a - 38 b ): the kinetics of antibody of gp160 was similar to that to V3. The magnitude of the latter was slightly weaker (mean titer at week 20 of 4.37 versus 8.84).
  • FIGS. 37 c , 38 c a response was observed for 2 macaques (macaques 5 and 7) out of 4 after respectively 2 and 3 injections of vCP205. This is in contrast with a guinea-pig test in which no anti-p24 antibodies were detected in any inoculated animal groups. As with anti-gp160 and anti-V3 antibodies, titers fluctuated up and down between injections and individual differences progressively disappeared. Unlike that of gp160 and V3, the anti-p24 antibody profile did not reach a plateau.
  • Neutralizing antibody as shown in FIG. 39 , all four monkeys with vCP205 developed detectable levels of neutralizing antibody against HIV (MN). One of them tested positive after one injection, two after the second injection and the last one required five administrations. It is noteworthy that the latter animal also showed the slowest kinetics of ELISA antibody. The levels of neutralizing activity are relatively modest (1/10 to 1/30 in arithmetical expression) and, likewise ELISA measurements, went up and down in the intervals between injections.
  • the immunization regimen induced high levels of binding antibody to gp160 MN/BRU and V3 MN peptide, and low but definite neutralizing antibody. Serological results showed higher antibody levels than those observed in macaques inoculated with ALVAC-HIV (vCP125) and one booster (instead of two) was sufficient to obtain a good anamnestic type response.
  • ALVAC-HIV vCP125
  • one booster instead of two
  • Hematological analyses included: blood counts and differential leucocyte counts, hemoglobin, thrombocytes, prothrombin, reticulocytes and sedimentation rate.
  • the optical density was measured at 490-650 nm with an automatic plate reader (Vmax, Molecular Devices). The blanks were subtracted and the values of the duplicates averaged.
  • the antibody titers were calculated for the OD value range of 0.2 to 1.2, from the regression curve of a standard anti-gp160 and anti-p24 hyperimmune serum of guinea-pig which was present on each ELISA plate. The titer of the standard serum had been previously determined according to the formula:
  • anti-nef antibodies were determined by including in the test a reference monoclonal mouse antibody (anti-nef HIV1 ALI, MATG0020, Transgene) as an internal positive control.
  • the immune response induced by vCP300 was assessed by analyzing in ELISA the anti-HIV-1 gp160, V3, p24 and nef sera antibodies.
  • the highest antibody titers were usually observed two weeks after each intramuscular injection, followed by a decrease until the next boost.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Virology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Public Health (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Veterinary Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • AIDS & HIV (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

Attenuated recombinant viruses containing DNA encoding an immunodeficiency virus and/or CTL antigen, as well as methods and compositions employing the viruses, expression products therefrom, and antibodies generated from the viruses or expression products, are disclosed and claimed. The recombinant viruses can be NYVAC or ALVAC recombinant viruses. The DNA can code for at least one of: HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef (BRU)CTL, pol(IIIB)CTL, ELDKWA or LDKW epitopes, preferably HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), two (2) nef(BRU)CTL and three (3) pol(IIIB)CTL epitopes; or two ELDKWA in gp120 V3 or another region or in gp160. The two (2) nef(BRU)CTL and three (3) pol(IIIB)CTL epitopes are preferably CTL1, CTL2, pol1, pol2 and pol3. The recombinant viruses and gene products therefrom and antibodies generated by the viruses and gene products have several preventive, therapeutic and diagnostic uses. DNA from the recombinant viruses are useful as probes or, for generating PCR primers or for immunization. Also disclosed and claimed are HIV immunogens and modified gp160 and gp120.

Description

    RELATED APPLICATIONS
  • This application is a continuation of application Ser. No. 10/441,788, filed May 20, 2003, which in turn is a divisional of application Ser. No. 09/136,159, filed Aug. 14, 1998, now U.S. Pat. No. 6,596,279, which in turn is a divisional of application Ser. No. 08/417,210, filed Apr. 5, 1995, now U.S. Pat. No. 5,863,542, which in turn is a continuation-in-part of application Ser. No. 08/223,842, filed Apr. 6, 1994, abandoned, which in turn is a continuation-in-part of application Ser. No. 07/897,382, filed Jun. 11, 1992, abandoned, which in turn is a continuation-in-part of application Ser. No. 07/715,921, filed Jun. 14, 1991, abandoned. This application is also a continuation-in-part of application Ser. No. 08/105,483, filed Aug. 12, 1993, now U.S. Pat. No. 5,494,807 which in turn is a continuation of application Ser. No. 07/847,951, filed Mar. 6, 1992, abandoned, which in turn is a continuation-in-part of application Ser. No. 07/713,967, filed Jun. 11, 1991, abandoned, which in turn is a continuation in part of application Ser. No. 07/666,056, filed Mar. 7, 1991, abandoned. Mention is also made of co-pending application Ser. No. 08/184,009, filed Jan. 19, 1994, now U.S. Pat. No. 5,833,975, as a continuation-in-part of application Ser. No. 08/007,115, filed Jan. 21, 1993, abandoned. Each of the aforementioned and above-referenced applications is hereby incorporated herein by reference.
  • FIELD OF THE INVENTION
  • The present invention relates to a modified poxvirus and to methods of making and using the same. More in particular, the invention relates to improved vectors for the insertion and expression of foreign genes for use as safe immunization vehicles to elicit an immune response against immunodeficiency virus. Thus, the invention relates to a recombinant poxvirus, which virus expresses gene products of immunodeficiency virus and to immunogenic compositions which induce an immunological response against immunodeficiency virus infections when administered to a host, or in vitro (e.g. ex vivo modalities) as well as to the products of expression of the poxvirus which by themselves are useful for eliciting an immune response e.g., raising antibodies, which antibodies are useful against immunodeficiency virus infection, in either seropositive or seronegative individuals, or are useful if isolated from an animal or human for preparing a diagnostic kit, test or assay for the detection of the virus or infected cells.
  • Several publications are referenced in this application. Full citation to these references is found at the end of the specification immediately preceding the claims or where the publication is mentioned; and each of these publications is hereby incorporated herein by reference.
  • BACKGROUND OF THE INVENTION
  • Vaccinia virus and more recently other poxviruses have been used for the insertion and expression of foreign genes. The basic technique of inserting foreign genes into live infectious poxvirus involves recombination between pox DNA sequences flanking a foreign genetic element in a donor plasmid and homologous sequences present in the rescuing poxvirus (Piccini et al., 1987).
  • Specifically, the recombinant poxviruses are constructed in two steps known in the art and analogous to the methods for creating synthetic recombinants of poxviruses such as the vaccinia virus and avipox virus described in U.S. Pat. Nos. 4,769,330, 4,772,848, 4,603,112, 5,100,587, and 5,179,993, the disclosures of which are incorporated herein by reference.
  • First, the DNA gene sequence to be inserted into the virus, particularly an open reading frame from a non-pox source, is placed into an E. coli plasmid construct into which DNA homologous to a section of DNA of the poxvirus has been inserted. Separately, the DNA gene sequence to be inserted is ligated to a promoter. The promoter-gene linkage is positioned in the plasmid construct so that the promoter-gene linkage is flanked on both ends by DNA homologous to a DNA sequence flanking a region of pox DNA containing a nonessential locus. The resulting plasmid construct is then amplified by growth within E. coli bacteria (Clewell, 1972) and isolated (Clewell et al., 1969; Maniatis et al., 1982).
  • Second, the isolated plasmid containing the DNA gene sequence to be inserted is transfected into a cell culture, e.g. chick embryo fibroblasts, along with the poxvirus. Recombination between homologous pox DNA in the plasmid and the viral genome respectively gives a poxvirus modified by the presence, in a nonessential region of its genome, of foreign DNA sequences. The term “foreign” DNA designates exogenous DNA, particularly DNA from a non-pox source, that codes for gene products not ordinarily produced by the genome into which the exogenous DNA is placed.
  • Genetic recombination is in general the exchange of homologous sections of DNA between two strands of DNA. In certain viruses RNA may replace DNA. Homologous sections of nucleic acid are sections of nucleic acid (DNA or RNA) which have the same sequence of nucleotide bases.
  • Genetic recombination may take place naturally during the replication or manufacture of new viral genomes within the infected host cell. Thus, genetic recombination between viral genes may occur during the viral replication cycle that takes place in a host cell which is co-infected with two or more different viruses or other genetic constructs. A section of DNA from a first genome is used interchangeably in constructing the section of the genome of a second co-infecting virus in which the DNA is homologous with that of the first viral genome.
  • However, recombination can also take place between sections of DNA in different genomes that are not perfectly homologous. If one such section is from a first genome homologous with a section of another genome except for the presence within the first section of, for example, a genetic marker or a gene coding for an antigenic determinant inserted into a portion of the homologous DNA, recombination can still take place and the products of that recombination are then detectable by the presence of that genetic marker or gene in the recombinant viral genome. Additional strategies have recently been reported for generating recombinant vaccinia virus.
  • Successful expression of the inserted DNA genetic sequence by the modified infectious virus requires two conditions. First, the insertion must be into a nonessential region of the virus in order that the modified virus remain viable. The second condition for expression of inserted DNA is the presence of a promoter in the proper relationship to the inserted DNA. The promoter must be placed so that it is located upstream from the DNA sequence to be expressed.
  • Vaccinia virus has been used successfully to immunize against smallpox, culminating in the worldwide eradication of smallpox in 1980. In the course of its history, many strains of vaccinia have arisen. These different strains demonstrate varying immunogenicity and are implicated to varying degrees with potential complications, the most serious of which are post-vaccinial encephalitis and generalized vaccinia (Behbehani, 1983).
  • With the eradication of smallpox, a new role for vaccinia became important, that of a genetically engineered vector for the expression of foreign genes. Genes encoding a vast number of heterologous antigens have been expressed in vaccinia, often resulting in protective immunity against challenge by the corresponding pathogen (reviewed in Tartaglia et al., 1990a).
  • The genetic background of the vaccinia vector has been shown to affect the protective efficacy of the expressed foreign immunogen. For example, expression of Epstein Barr Virus (EBV) gp340 in the Wyeth vaccine strain of vaccinia virus did not protect cottontop tamarins against EBV virus induced lymphoma, while expression of the same gene in the WR laboratory strain of vaccinia virus was protective (Morgan et al., 1988).
  • A fine balance between the efficacy and the safety of a vaccinia virus-based recombinant vaccine candidate is extremely important. The recombinant virus must present the immunogen(s) in a manner that elicits a protective immune response in the vaccinated animal but lacks any significant pathogenic properties. Therefore attenuation of the vector strain would be a highly desirable advance over the current state of technology.
  • A number of vaccinia genes have been identified which are non-essential for growth of the virus in tissue culture and whose deletion or inactivation reduces virulence in a variety of animal systems.
  • The gene encoding the vaccinia virus thymidine kinase (TK) has been mapped (Hruby et al., 1982) and sequenced (Hruby et al., 1983; Weir et al., 1983). Inactivation or complete deletion of the thymidine kinase gene does not prevent growth of vaccinia virus in a wide variety of cells in tissue culture. TK− vaccinia virus is also capable of replication in vivo at the site of inoculation in a variety of hosts by a variety of routes.
  • It has been shown for herpes simplex virus type 2 that intravaginal inoculation of guinea pigs with TK− virus resulted in significantly lower virus titers in the spinal cord than did inoculation with TK+ virus (Stanberry et al., 1985). It has been demonstrated that herpesvirus encoded TK activity in vitro was not important for virus growth in actively metabolizing cells, but was required for virus growth in quiescent cells (Jamieson et al., 1974).
  • Attenuation of TK− vaccinia has been shown in mice inoculated by the intracerebral and intraperitoneal routes (Buller et al., 1985). Attenuation was observed both for the WR neurovirulent laboratory strain and for the Wyeth vaccine strain. In mice inoculated by the intradermal route, TK− recombinant vaccinia generated equivalent anti-vaccinia neutralizing antibodies as compared with the parental TK+ vaccinia virus, indicating that in this test system the loss of TK function does not significantly decrease immunogenicity of the vaccinia virus vector. Following intranasal inoculation of mice with TK− and TK+ recombinant vaccinia virus (WR strain), significantly less dissemination of virus to other locations, including the brain, has been found (Taylor et al., 1991a).
  • Another enzyme involved with nucleotide metabolism is ribonucleotide reductase. Loss of virally encoded ribonucleotide reductase activity in herpes simplex virus (HSV) by deletion of the gene encoding the large subunit was shown to have no effect on viral growth and DNA synthesis in dividing cells in vitro, but severely compromised the ability of the virus to grow on serum starved cells (Goldstein et al., 1988). Using a mouse model for acute HSV infection of the eye and reactivatable latent infection in the trigeminal ganglia, reduced virulence was demonstrated for HSV deleted of the large subunit of ribonucleotide reductase, compared to the virulence exhibited by wild type HSV (Jacobson et al., 1989).
  • Both the small (Slabaugh et al., 1988) and large (Schmidtt et al., 1988) subunits of ribonucleotide reductase have been identified in vaccinia virus. Insertional inactivation of the large subunit of ribonucleotide reductase in the WR strain of vaccinia virus leads to attenuation of the virus as measured by intracranial inoculation of mice (Child et al., 1990).
  • The vaccinia virus hemagglutinin gene (HA) has been mapped and sequenced (Shida, 1986). The HA gene of vaccinia virus is nonessential for growth in tissue culture (Ichihashi et al., 1971). Inactivation of the HA gene of vaccinia virus results in reduced neurovirulence in rabbits inoculated by the intracranial route and smaller lesions in rabbits at the site of intradermal inoculation (Shida et al., 1988). The HA locus was used for the insertion of foreign genes in the WR strain (Shida et al., 1987), derivatives of the Lister strain (Shida et al., 1988) and the Copenhagen strain (Guo et al., 1989) of vaccinia virus. Recombinant HA vaccinia virus expressing foreign genes have been shown to be immunogenic (Guo et al., 1989; Itamura et al., 1990; Shida et al., 1988; Shida et al., 1987) and protective against challenge by the relevant pathogen (Guo et al., 1989; Shida et al., 1987).
  • Cowpox virus (Brighton red strain) produces red (hemorrhagic) pocks on the chorioallantoic membrane of chicken eggs. Spontaneous deletions within the cowpox genome generate mutants which produce white pocks (Pickup et al., 1984). The hemorrhagic function (u) maps to a 38 kDa protein encoded by an early gene (Pickup et al., 1986). This gene, which has homology to serine protease inhibitors, has been shown to inhibit the host inflammatory response to cowpox virus (Palumbo et al., 1989) and is an inhibitor of blood coagulation.
  • The u gene is present in WR strain of vaccinia virus (Kotwal et al., 1989b). Mice inoculated with a WR vaccinia virus recombinant in which the u region has been inactivated by insertion of a foreign gene produce higher antibody levels to the foreign gene product compared to mice inoculated with a similar recombinant vaccinia virus in which the u gene is intact (Zhou et al., 1990). The u region is present in a defective nonfunctional form in Copenhagen strain of vaccinia virus (open reading frames B13 and B14 by the terminology reported in Goebel et al., 1990a,b).
  • Cowpox virus is localized in infected cells in cytoplasmic A type inclusion bodies (ATI) (Kato et al., 1959). The function of ATI is thought to be the protection of cowpox virus virions during dissemination from animal to animal (Bergoin et al., 1971). The ATI region of the cowpox genome encodes a 160 kDa protein which forms the matrix of the ATI bodies (Funahashi et al., 1988; Patel et al., 1987). Vaccinia virus, though containing a homologous region in its genome, generally does not produce ATI. In WR strain of vaccinia, the ATI region of the genome is translated as a 94 kDa protein (Patel et al., 1988). In Copenhagen strain of vaccinia virus, most of the DNA sequences corresponding to the ATI region are deleted, with the remaining 3′ end of the region fused with sequences upstream from the ATI region to form open reading frame (ORF) A26L (Goebel et al., 1990a,b).
  • A variety of spontaneous (Altenburger et al., 1989; Drillien et al., 1981; Lai et al., 1989; Moss et al., 1981; Paez et al., 1985; Panicali et al., 1981) and engineered (Perkus et al., 1991; Perkus et al., 1989; Perkus et al., 1986) deletions have been reported near the left end of the vaccinia virus genome. A WR strain of vaccinia virus with a 10 kb spontaneous deletion (Moss et al., 1981; Panicali et al., 1981) was shown to be attenuated by intracranial inoculation in mice (Buller et al., 1985). This deletion was later shown to include 17 potential ORFs (Kotwal et al., 1988b). Specific genes within the deleted region include the virokine N1L and a 35 kDa protein (C3L, by the terminology reported in Goebel et al., 1990a,b). Insertional inactivation of N1L reduces virulence by intracranial inoculation for both normal and nude mice (Kotwal et al., 1989a). The 35 kDa protein is secreted like N1L into the medium of vaccinia virus infected cells. The protein contains homology to the family of complement control proteins, particularly the complement 4B binding protein (C4 bp) (Kotwal et al., 1988a). Like the cellular C4 bp, the vaccinia 35 kDa protein binds the fourth component of complement and inhibits the classical complement cascade (Kotwal et al., 1990). Thus the vaccinia 35 kDa protein appears to be involved in aiding the virus in evading host defense mechanisms.
  • The left end of the vaccinia genome includes two genes which have been identified as host range genes, K1L (Gillard et al., 1986) and C7L (Perkus et al., 1990). Deletion of both of these genes reduces the ability of vaccinia virus to grow on a variety of human cell lines (Perkus et al., 1990).
  • Two additional vaccine vector systems involve the use of naturally host-restricted poxviruses, avipoxviruses. Both fowlpoxvirus (FPV) and canarypoxvirus (CPV) have been engineered to express foreign gene products. Fowlpox virus (FPV) is the prototypic virus of the Avipox genus of the Poxvirus family. The virus causes an economically important disease of poultry which has been well controlled since the 1920's by the use of live attenuated vaccines. Replication of the avipox viruses is limited to avian species (Matthews, 1982) and there are no reports in the literature of avipoxvirus causing a productive infection in any non-avian species including man. This host restriction provides an inherent safety barrier to transmission of the virus to other species and makes use of avipoxvirus based vaccine vectors in veterinary and human applications an attractive proposition.
  • FPV has been used advantageously as a vector expressing antigens from poultry pathogens. The hemagglutinin protein of a virulent avian influenza virus was expressed in an FPV recombinant (Taylor et al., 1988a). After inoculation of the recombinant into chickens and turkeys, an immune response was induced which was protective against either a homologous or a heterologous virulent influenza virus challenge (Taylor et al., 1988a). FPV recombinants expressing the surface glycoproteins of Newcastle Disease Virus have also been developed (Taylor et al., 1990; Edbauer et al., 1990).
  • Despite the host-restriction for replication of FPV and CPV to avian systems, recombinants derived from these viruses were found to express extrinsic proteins in cells of nonavian origin. Further, such recombinant viruses were shown to elicit immunological responses directed towards the foreign gene product and where appropriate were shown to afford protection from challenge against the corresponding pathogen (Tartaglia et al., 1993a,b; Taylor et al., 1992; 1991b; 1988b).
  • In 1983, human immunodeficiency virus type 1 (HIV1) was identified as the causative agent of AIDS. Twelve years later, despite a massive, worldwide effort, an effective HIV1 vaccine is still not available. Recently, however, several reports have suggested that an efficacious HIV1 vaccine may be attainable. For example, macaques have been protected against a simian immunodeficiency virus (SIV) challenge by a vaccination protocol involving a primary immunization with a vaccinia virus recombinant expressing the SIV gp160 glycoprotein and a booster immunization with purified SIV gp160 glycoprotein (Hu et al., 1992). In addition, chimpanzees have been protected against an HIV1 challenge with an HIV1 gp120 subunit vaccine (Berman et al, 1990). Chimps have also been protected against an HIV1 challenge by a vaccination protocol involving multiple injections of either inactivated HIV1, gp160 and/or V3 peptide or gp160, p17 (a Gag protein) and/or V3 peptide (Girard et al., 1991). A similar protocol involving multiple injections of gp160, p17, p24 (a Gag protein), Vif, Nef and/or V3 peptide has also protected chimps against a challenge of HIV1-infected cells (Fultz et al., 1992). Furthermore, chimps have been passively protected by the infusion of HIV1 V3-specific antibodies (Emini et al., 1992).
  • Most of these vaccination protocols have focused on eliciting an immune response against the HIV1 or SIV envelope glycoprotein, or more specifically, against the V3 epitope of the envelope glycoprotein. Unfortunately, different strains of HIV1 exhibit extensive genetic and antigenic variability, especially in the envelope glycoprotein. Therefore, an effective HIV1 vaccine may need to elicit an immune response against more than one HIV1 antigen, or one epitope of one HIV1 antigen.
  • Contrary to the extensive sequence variability observed in B-cell epitopes, T-cell epitopes are relatively conserved. For example, cytotoxic T-lymphocytes (CTL) clones, isolated from an HIV1-seronegative individual vaccinated with a vaccinia virus recombinant expressing HIV1 gp160 (LAI strain) and boosted with purified HIV1 gp160 (LAI), lyse target cells expressing the HIV1 MN or RF envelope glycoprotein as efficiently as cells expressing the HIV1 LAI envelope glycoprotein (Hammond et al., 1992). Therefore, a vaccine that elicits an immune response against relatively conserved T-cell epitopes may not only be more efficacious against a homologous challenge, but also more efficacious against a heterologous challenge.
  • HIV1-seronegative individuals have been vaccinated with an ALVAC recombinant (vCP125) expressing HIV1 gp160, in a prime-boost protocol similar to the regimen used to vaccinate macaques against SIV. These ALVAC-based protocols demonstrated the ability of vCP125 to elicit HIV1 envelope-specific CD8+ CTLs and to enhance envelope-specific humoral responses observed following a subunit booster (Pialoux et al., 1995). These results justify the rationale for a recombinant ALVAC-based HIV1 vaccine.
  • Individuals infected with human immunodeficiency virus type 1 (HIV1) initially generate a relatively dynamic and extensive antiviral immune response, including HIV1-specific neutralizing antibodies and HIV1-specific CTLs. Despite these responses, however, the vast majority of HIV1-infected people eventually succumb to HIV1-associated diseases. Since the immune response generated by most HIV1-infected people is not protective, generation of an effective immune response may necessitate that the immune response be modulated or redirected against HIV1 epitopes that are not normally or efficiently seen by HIV1-infected individuals.
  • Approximately 40% of the HIV1-specific antibody in HIV1-seropositive individuals capable of binding HIV1-infected cells is specific to the third variable region (V3) of the HIV1 envelope glycoprotein (Spear et al, 1994). These results indicate that the V3 loop is 1) highly immunogenic and 2) exposed on the surface of infected cells. The amino acid sequence of the V3 loop varies considerably between different HIV1 isolates. Therefore, a moderate level of sequence variation does not appear to alter the structure or immunogenicity of this region of the envelope glycoprotein. Since the V3 loop is highly immunogenic and its structure and immunogenicity is not severely affected by sequence variation, this region of the envelope glycoprotein may be useful as an immunogenic platform for presenting normally non-immunogenic linear HIV1 epitopes or heterologous epitopes to the immune system.
  • Sera from HIV1-seropositive individuals can neutralize lab-adapted strains of HIV1. These sera can also neutralize primary HIV1 isolates (although 100× higher titers are required). Conversely, sera from individuals vaccinated with HIV1 gp120 can neutralize lab-adapted strains of HIV1 (although 10× higher titers relative to sera from seropositive individuals are required), but can not neutralize (at assayable levels) primary isolates (Hanson, 1994). A significant portion of the neutralizing activity found in sera from seropositive and gp120-vaccinated individuals appears to be specific to the V3 loop (Spear et al., 1994; Berman et al., 1994). Since the V3 loop is hypervariable and since antibodies against this region may not neutralize primary isolates or heterologous strains of HIV1, it may be necessary to develop vaccines that elicit an immune response against epitopes other than the V3 loop, epitopes that can neutralize a broad spectrum of HIV1 strains, including primary isolates.
  • A monoclonal antibody capable of neutralizing primary HIV1 isolates, as well as a broad spectrum of lab-adapted HIV1 strains, has been isolated (Conley et al., 1994; Katinger et al., 1992). The epitope recognized by this monoclonal antibody has been mapped between amino acids 662 and 667 of HIV1 gp41 and has the amino acid sequence, ELDKWA (Buchacher et al, 1994). Approximately 80% of the HIV1 strains from which sequence information has been derived, including strains from the various HIV1 clades, express the core binding sequence of this epitope, LDKW (Conley et al., 1994). Therefore, unlike the V3 loop, this epitope appears to be relatively well conserved. Unfortunately, this epitope does not appear to be very immunogenic in its normal configuration. Only approximately 50% of HIV1-seropositive individuals have a detectable antibody response to the region of gp41 containing this epitope (Broliden et al., 1992).
  • It can thus be appreciated that provision of an immunodeficiency virus recombinant poxvirus, and of an immunogenic composition which induces an immunological response against immunodeficiency virus infections when administered to host, particularly a composition having enhanced safety such as NYVAC or ALVAC based recombinants containing coding for any or all of HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL epitopes, pol(IIIB)CTL epitopes; for instance, HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nefCTL1, nefCTL2, pol1(PolCTL1), pol2(PolCTL2), pol3(PolCTL3), ELDKWA or LDKW epitopes (SEQ ID NOS: 147 and 148), especially in an immunogenic configuration, or any combination thereof, for example all of them in combination, would be a highly desirable advance over the current state of technology.
  • OBJECTS AND SUMMARY OF THE INVENTION
  • It is therefore an object of this invention to provide modified recombinant viruses, which viruses have enhanced safety, and to provide a method of making such recombinant viruses.
  • It is an additional object of this invention to provide a recombinant poxvirus antigenic, vaccine or immunological composition having an increased level of safety compared to known recombinant poxvirus vaccines.
  • It is a further object of this invention to provide a modified vector for expressing a gene product in a host, wherein the vector is modified so that it has attenuated virulence in the host.
  • It is another object of this invention to provide a method for expressing a gene product in a cell cultured in vitro using a modified recombinant virus or modified vector having an increased level of safety.
  • These and other objects and advantages of the present invention will become more readily apparent after consideration of the following.
  • In one aspect, the present invention relates to a modified recombinant virus having inactivated virus-encoded genetic functions so that the recombinant virus has attenuated virulence and enhanced safety. The functions can be non-essential, or associated with virulence. The virus is advantageously a poxvirus, particularly a vaccinia virus or an avipox virus, such as fowlpox virus and canarypox virus. The modified recombinant virus can include, within a non-essential region of the virus genome, a heterologous DNA sequence which encodes an antigen or epitope derived from immunodeficiency virus and/or CTL epitope such as, e.g., HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, ELDKWA, LDKW epitopes or any combination thereof, preferably all of them in combination.
  • In another aspect, the present invention relates to an antigenic, immunological or vaccine composition or a therapeutic composition for inducing an antigenic or immunological response in a host animal inoculated with the composition, said vaccine including a carrier and a modified recombinant virus having inactivated nonessential virus-encoded genetic functions so that the recombinant virus has attenuated virulence and enhanced safety. The virus used in the composition according to the present invention is advantageously a poxvirus, particularly a vaccinia virus or an avipox virus, such as fowlpox virus and canarypox virus. The modified recombinant virus can include, within a non-essential region of the virus genome, a heterologous DNA sequence which encodes an antigenic protein, e.g., derived from immunodeficiency virus and/or CTL such as, HIV1gag(+pro) (IIIB), gp120 (MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, ELDKWA, LDKW epitopes or any combination thereof, preferably all of them in combination.
  • In yet another aspect, the present invention relates to an immunogenic composition containing a modified recombinant virus having inactivated nonessential virus-encoded genetic functions so that the recombinant virus has attenuated virulence and enhanced safety. The modified recombinant virus includes, within a non-essential region of the virus genome, a heterologous DNA sequence which encodes an antigenic protein (e.g., derived from an immunodeficiency virus and/or CTL such as, HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, ELDKWA, LDKW epitopes or any combination thereof, preferably all of them in combination) wherein the composition, when administered to a host, is capable of inducing an immunological response specific to the antigen.
  • In a further aspect, the present invention relates to a method for expressing a gene product in a cell (e.g. peripheral blood mononuclear cells (PBMCs) or lymph node mononuclear cells (LNMC) in vitro by introducing into the cell a modified recombinant virus having attenuated virulence and coenhanced safety. The modified recombinant virus can include, within a nonessential region of the virus genome, a heterologous DNA sequence which encodes an antigenic protein, e.g. derived from an immunodeficiency virus such as HIV/gag (+pro) (IIIB), gp120(MN) (+transmembrane), nef (BRU)CTL, pol (IIIB)CTL, ELDKWA, LDKW epitopes or any combination thereof, preferably all of them in combination. The cells can then be reinfused directly into the individual or used to amplify specific CD8+ CTL reactivities for reinfusion (Ex vivo therapy).
  • In a further aspect, the present invention relates to a method for expressing a gene product in a cell cultured in vitro by introducing into the cell a modified recombinant virus having attenuated virulence and enhanced safety. The modified recombinant virus can include, within a non-essential region of the virus genome, a heterologous DNA sequence which encodes an antigenic protein, e.g., derived from a immunodeficiency virus such as HIV1gag (+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, ELDKWA, LDKW epitopes or any combination thereof, preferably all of them in combination. The product can then be administered to individuals or animals to stimulate an immune response. The antibodies raised can be useful in individuals for the prevention or treatment of immunodeficiency virus and, the antibodies from animals can be used in diagnostic kits, assays or tests to determine the presence or absence in a sample such as sera of immunodeficiency virus or CTL antigens (and therefore the absence or presence of the virus of an immune response to the virus or antibodies).
  • In a still further aspect, the present invention relates to a modified recombinant virus having nonessential virus-encoded genetic functions inactivated therein so that the virus has attenuated virulence, and wherein the modified recombinant virus further contains DNA from a heterologous source in a nonessential region of the virus genome. The DNA can code for an immunodeficiency virus and/or CTL antigen such as HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, ELDKWA, LDKW epitopes or any combination thereof, preferably all of them in combination. In particular, the genetic functions are inactivated by deleting an open reading frame encoding a virulence factor or by utilizing naturally host restricted viruses. The virus used according to the present invention is advantageously a poxvirus, particularly a vaccinia virus or an avipox virus, such as fowlpox virus and canarypox virus. Advantageously, the open reading frame is selected from the group consisting of J2R, B13R+B14R, A26L, A56R, C7L-K1L, and I4L (by the terminology reported in Goebel et al., 1990a,b); and, the combination thereof. In this respect, the open reading frame comprises a thymidine kinase gene, a hemorrhagic region, an A type inclusion body region, a hemagglutinin gene, a host range gene region or a large subunit, ribonucleotide reductase; or, the combination thereof. The modified Copenhagen strain of vaccinia virus is identified as NYVAC (Tartaglia et al., 1992). However, the COPAK strain can also be used in the practice of the invention.
  • Most preferably, in recombinant viruses of the invention, the exogenous DNA codes for HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), two (2) nef(BRU)CTL and three (3) pol(IIIB)CTL epitopes; or, the exogenous DNA codes for the ELDKWA or LDKW epitopes, and, is inserted so as to be expressed in a region of gp120 or gp160 (i.e., the exogenous DNA codes for a ELDKWA or LDKW modified gp120 or gp160, for instance ELDKWA or LDKW or repeats of either or both in the V3 loop) such that the epitope is expressed in an immunogenic configuration. In this most preferred embodiment it is even more preferred that the two (2) nef(BRU)CTL and three (3) pol(IIIB)CTL epitopes are CTL1, CTL2, poll, pol2, and pol3. In another most preferred embodiment the exogenous DNA codes for HIV1 gp120+TM in which the V3 loop has been modified to contain at least one, and preferably two ELDKWA epitopes.
  • In further embodiments, the invention comprehends HIV immunogens and modified gp160 or gp120. Thus, the invention includes an HIV immunogen preferably selected from the group consisting of: HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef (BRU)CTL, pol(IIIB)CTL, and ELDKWA or LDKW epitopes. The HIV immunogen of the invention can be part of gp160 or gp120. Thus the HIV immunogens ELKDKWA or LDKWA, for example, can be a part of a region of go120 or a region of gp160; for instance, part of gp120V3. Accordingly, the invention comprehends a gp120 or gp160 modified so as to contain an epitope not naturally occurring in gp160. The epitope can be a B-cell epitope. The epitope, more specifically, can be at least one of HIV1gag(+pro) (IIIB), gp120(MN) (+transmembrane), nef(BRU)CTL, pol(IIIB)CTL, and ELDKWA or LDKW epitopes. The gp120 can be modified in the V3 loop. The immunogen and modified gp120 or gp160 can be synthesized by any suitable vector, including a poxvirus, such as a recombinant of the invention; or, by any suitable chemical synthesis method such as the Merrifield Synthesis Method.
  • The invention in yet a further aspect relates to the product of expression of the inventive recombinant poxvirus and uses therefor, as well as to uses for the inventive immunogens and modified gp120 and sp160, such as to form antigenic, immunological or vaccine compositions for treatment, prevention, diagnosis or testing. The invention in still a further embodiment relates to the uses of DNA from the recombinants as probes for detecting the presence or absence of HIV DNA in a sample or for DNA immunization using an appropriate expression plasmid.
  • These and other embodiments are disclosed or are obvious from and encompassed by the following detailed description.
  • BRIEF DESCRIPTION OF THE DRAWINGS
  • The following detailed description, given by way of example, but not intended to limit the invention solely to the specific embodiments described, may best be understood in conjunction with the accompanying drawings, in which:
  • FIG. 1 schematically shows a method for the construction of plasmid pSD460 for deletion of thymidine kinase gene and generation of recombinant vaccinia virus vP410;
  • FIG. 2 schematically shows a method for the construction of plasmid pSD486 for deletion of hemorrhagic region and generation of recombinant vaccinia virus vP553;
  • FIG. 3 schematically shows a method for the construction of plasmid pMP494Δ for deletion of ATI region and generation of recombinant vaccinia virus vP618;
  • FIG. 4 schematically shows a method for the construction of plasmid pSD467 for deletion of hemagglutinin gene and generation of recombinant vaccinia virus vP723;
  • FIG. 5 schematically shows a method for the construction of plasmid pMPCK1Δ for deletion of gene cluster [C7L-K1L] and generation of recombinant vaccinia virus vP804;
  • FIG. 6 schematically shows a method for the construction of plasmid pSD548 for deletion of large subunit, ribonucleotide reductase and generation of recombinant vaccinia virus vP866 (NYVAC);
  • FIG. 7 schematically shows a method for the construction of plasmid pRW842 for insertion of rabies glycoprotein G gene into the TK deletion locus and generation of recombinant vaccinia virus vP879;
  • FIG. 8 shows the DNA sequence (SEQ ID NO:66) of a canarypox PvuII fragment containing the C5 ORF.
  • FIGS. 9A and 9B schematically show a method for the construction of recombinant canarypox virus vCP65 (ALVAC-RG);
  • FIG. 10 shows schematically the ORFs deleted to generate NYVAC;
  • FIG. 11 shows the nucleotide sequence (SEQ ID NO:67) of a fragment of TROVAC DNA containing an F8 ORF;
  • FIG. 12 shows the DNA sequence (SEQ ID NO:68) of a 2356 base pair fragment of TROVAC DNA containing the F7 ORF;
  • FIGS. 13A to 13D show graphs of rabies neutralizing antibody titers (RFFIT, IU/ml), booster effect of HDC and vCP65 (105.5 TCID50) in volunteers previously immunized with either the same or the alternate vaccine (vaccines given at days 0, 28 and 180, antibody titers measured at days 0, 7, 28, 35, 56, 173, 187 and 208);
  • FIG. 14A to 14C shows the nucleotide sequence of the H6-promoted HIV1 gp120 (+transmembrane) gene and the I3L-promoted HIV1gag(+pro) gene contained in pHIV32 (SEQ ID NOS: 78 and 79);
  • FIG. 15A to 15F shows the nucleotide sequence of the C3 locus in pVQH6CP3L (SEQ ID NOS: 80 and 81);
  • FIG. 16 shows the nucleotide sequence of the I3L-promoted nef CTL2 epitope and H6-promoted nef CTL1 epitope contained in p2-60-HIV.3 (SEQ ID NOS: 93-96);
  • FIG. 17A to 17C shows the nucleotide sequence of the C6 locus in pC6L (SEQ ID NOS: 97 and 98);
  • FIG. 18A to 18B shows the nucleotide sequence of the I3L-promoted pol2 epitope, H6-promoted poll epitope and 42K-promoted pol3 epitope contained in pC5POLT5A (SEQ ID NOS: 111-115);
  • FIG. 19A to 19C shows the nucleotide sequence of the C5 locus in pNC5L-SP5 (SEQ ID NOS: 116 and 117);
  • FIG. 20 shows the rabbit antibody responses to the HIV envelope glycoprotein following immunization with ALVAC, vCP205, or with peptide CLTB-36;
  • FIG. 21 shows the rabbit antibody responses to the HIV MN V3 loop following immunization with ALVAC, vCP205, or with peptide CLTB-36;
  • FIG. 22 shows the guinea pig antibody responses to the HIV envelope glycoprotein following immunization with ALVAC, vCP205, or with peptide CLTB-36;
  • FIG. 23 shows the guinea pig antibody responses to the HIV MN V3 loop following immunization with ALVAC, vCP205, or with peptide CLTB-36;
  • FIG. 24 shows in vitro stimulation of HIV-1-specific CTLs from PBMCs of an HIV-seropositive individual—Patient 1;
  • FIG. 25 is as in FIG. 24 but with Patient 2;
  • FIG. 26 a-c, shows the nucleotide sequence of the H6-promoted HIV1 gp120+TM (with ELDKWA epitopes) gene (SEQ ID NOS: 135 and 136) contained in pHIV59 and vCP1307 and the protein expressed (SEQ ID NO: 137);
  • FIG. 27 shows FACS analysis of vCP1307-infected cells (FACS analysis was performed on HeLa cells infected with ALVAC, vP1286 or vCP1307 with sera from HIV1-seropositve humans (upper panel) or a human monoclonal antibody specific for the ELDKWA epitope, IAM41-2F5 (lower panel));
  • FIG. 28 a-c shows the nucleotide sequence of the H6-promoted HIV1 gp120+TM (with ELDKWA epitopes) gene (SEQ ID NOS: 138 and 139) contained in pHIV60 and vP1313 and the protein expressed (SEQ ID NO: 140);
  • FIG. 29 shows FACS analysis of vP1313-infected cells (FACS analysis was performed on HeLa cells infected with NYVAC, vP1286 or vP1313 with sera from HIV1-seropositve humans (upper panel) or a human monoclonal antibody specific for the ELDKWA epitope, IAM41-2F5 (lower panel)).
  • FIG. 30 a-c shows the nucleotide sequence of the H6-promoted HIV1 gp120+TM (with ELDKWA epitopes) gene (SEQ ID NOS: 141 to 142) contained in pHIV61 and vP1319 and the protein expressed (SEQ ID NO: 143);
  • FIG. 31 shows the FACS analysis of vP1319-infected cells (FACS analysis was performed on HeLa cells infected with WR, vP1286 or vP1319 with sera from HIV1-seropositve humans (upper panel), a human monoclonal antibody specific for the ELDKWA epitope, IAM41-2F5 (middle panel) or a mouse monoclonal antibody specific for the V3 loop, 50.1 (lower panel));
  • FIGS. 32, 33 a, 33 b, 33 c, 34, 35, 36, 37 a, 37 b, 37 c, 38 a, 38 b, 38 c show comparative body weights (FIG. 32), blood counts (FIG. 33 a-c), creatinine (FIG. 34), SGOT (35), SGPT (FIG. 36), ELISA (Anti-gp160 MN/BR, -v3MN, -p24, FIGS. 37 a-c, 38 a-c) of monkeys inoculated with vCP205 and placebo (FIG. 32). upper panel=monkeys 1-4, placebo; lower panel=monkeys 5-8 vCP205; monkeys: 1=open square, 2=open diamond, 3=open triangle, 4=open circle, 5=darkened square, 6=darkened diamond, 7=darkened triangle, 8—darkened circle; plots of Kg (wt) vs. weeks (inoculations indicated with arrow). FIG. 33 a: leucoytes: left top and bottom panels=monkeys 1-4, placebo; right top and bottom panels=monkeys 5-8, vCP205; top panels individual WBC counts, key same as FIG. 32 except small darkened circle is mean (m); lower panels differential cell counts, darkened square=granulo, open square=lympho, darkened diamond=mono. FIG. 33 b: same layout and keying as FIG. 33 a, with upper panels indicating erythrocytes and lower panels indicating mean corpuscle volume and mean indicated by smaller darkened circle. FIG. 33 c: same layout as FIG. 33 b with upper panels indicating hematocrite and lower panels indicating hemoglobin. FIG. 34: upper bar graphs=monkeys 1-4, placebo; lower bar graph=monkeys 5-8, vCP205; mg/l vs. days, arrow indicates inoculation; monkeys 1 and 5=dark bars, monkeys 2 and 6=double stippling bars (slanted lines in opposite directions), monkeys 3 and 7=dotted bars, monkeys 4 and 8=single stippling bar (slant lines in one direction), mean is darkened circles. FIG. 35: same keying as FIG. 34, except IU/l vs. days. FIG. 36: same keying as FIG. 35. FIGS. 37 a-c and 38 a-c: ELISA in placebo administered monkeys (FIGS. 37 a-c) and in vCP205 administered monkeys (FIGS. 38 a-c), titer (log) vs. weeks, arrow indicates injection; FIGS. 37 a and 38 a=anti-gp160 MN/BRU, FIGS. 37 b and 38 b=anti-V3MN, FIGS. 37 c and 38C=anti-p24; monkeys 1 and 5=open circle; monkeys 2 and 6=darkened circle; monkeys 3 and 7=open inverted triangle; monkeys 4 and 8=darkened inverted triangle);
  • FIG. 39 shows anti-HIV1 (MN) neutralizing antibodies in monkeys inoculated with vCP205 (keying same as FIG. 38 a-c); and,
  • FIGS. 40, 41 a, 41 b, 41 c, 42, 43 a, 43 b, 43 c, 43 d, 44 a, 44 b, 45 a, 45 b, 46 a, 46 b, 47 a, and 47 b show leucocyte counts (FIG. 40), blood counts (erythrocytes FIG. 41 a, hematocrite FIG. 41 b, reticulocytes FIG. 41 c), prothrombin (FIG. 42), biochemical results (total cholesterol, total proteins, glucose FIG. 43 a; sodium, potassium FIG. 43 b; creatinine, bilirubin FIG. 43 c; SGOTransaminase, SGPTransaminase, alkaline phosphatase FIG. 43 d), gp160 MN/BRU ELISA (control FIG. 44 a, test animals FIG. 44 b), V3 MN ELISA (control FIG. 46 a, test animals FIG. 46 b), and nef ELISA (control FIG. 47 a, test animals FIG. 47 b) in monkeys inoculated with vCP300 and a placebo (FIG. 40: layout same as FIG. 33 a; keying same as FIG. 33 a, except in upper panels, mean is dotted circle (left) and open circle (right) and in lower panels decimal instead of percentage and darkened square=neutro, open diamond=eosino, and darkened triangle=baso. FIG. 41 a: layout same as FIG. 33 b, keying same as FIG. 33 a, except mean is dotted circle (left) and open circle (right). FIG. 41 b: layout same as FIG. 33 c, keying same as FIG. 41 a. FIG. 41 c: layout and keying same as FIG. 41 b, upper panels=reticulocytes, lower panels=thrombocytes. FIG. 42: upper panel=placebo, lower panel=vCP300, keying same as FIG. 41 c. FIG. 43 a: top=cholesterol, middle=proteins, lower=glucose; open circle=placebo, darkened circle=vCP300. FIG. 34 b: top=sodium, lower=potassium; keying same as FIG. 43 a. FIG. 43 c: top=creatinine, lower=bilirulain; keying same as FIG. 43 a. FIG. 43 d: top=SGOT, middle=SGPT, lower=alkaline phosphatases; keying same as FIG. 43 a. FIGS. 44 a, 44 b: gp160 MN/BRU ELISA, control and vCP300, respectively; keying same as FIGS. 37 a and 38 a, respectively. FIGS. 45 a, 45 b: V3 MN ELISA, control and vCP300, respectively; keying same as FIGS. 37 b and 38 b, respectively. FIGS. 46 a, 46 b: p34 ELISA, control and vCP300, respectively; keying same as FIGS. 37 c and 38 c, respectively. FIG. 47 a, 47 b, nef ELISA, control and vCP300, respectively; keying as in FIGS. 44 a-46 b).
  • DETAILED DESCRIPTION OF THE INVENTION
  • To develop a new vaccinia vaccine strain, NYVAC (vP866), the Copenhagen vaccine strain of vaccinia virus was modified by the deletion of six nonessential regions of the genome encoding known or potential virulence factors. The sequential deletions are detailed below. All designations of vaccinia restriction fragments, open reading frames and nucleotide positions are based on the terminology reported in Goebel et al., 1990a,b.
  • The deletion loci were also engineered as recipient loci for the insertion of foreign genes.
  • The regions deleted in NYVAC are listed below. Also listed are the abbreviations and open reading frame designations for the deleted regions (Goebel et al., 1990a,b) and the designation of the vaccinia recombinant (vP) containing all deletions through the deletion specified:
      • (1) thymidine kinase gene (TK; J2R) vP410;
      • (2) hemorrhagic region (u; B13R+B14R) vP553;
      • (3) A type inclusion body region (ATI; A26L) vP618;
      • (4) hemagglutinin gene (HA; A56R) vP723;
      • (5) host range gene region (C7L-K1L) vP804; and
      • (6) large subunit, ribonucleotide reductase (I4L) vP866 (NYVAC).
  • NYVAC is a genetically engineered vaccinia virus strain that was generated by the specific deletion of eighteen open reading frames encoding gene products associated with virulence and host range. NYVAC is highly attenuated by a number of criteria including i) decreased virulence after intracerebral inoculation in newborn mice, ii) inocuity in genetically (nu+/nu+) or chemically (cyclophosphamide) immunocompromised mice, iii) failure to cause disseminated infection in immunocompromised mice, iv) lack of significant induration and ulceration on rabbit skin, v) rapid clearance from the site of inoculation, and vi) greatly reduced replication competency on a number of tissue culture cell lines including those of human origin. Nevertheless, NYVAC based vectors induce excellent responses to extrinsic immunogens and provided protective immunity.
  • TROVAC refers to an attenuated fowlpox that was a plaque-cloned isolate derived from the FP-1 vaccine strain of fowlpoxvirus which is licensed for vaccination of 1 day old chicks. ALVAC is an attenuated canarypox virus-based vector that was a plaque-cloned derivative of the licensed canarypox vaccine, Kanapox (Tartaglia et al., 1992). ALVAC has some general properties which are the same as some general properties of Kanapox. ALVAC-based recombinant viruses expressing extrinsic immunogens have also been demonstrated efficacious as vaccine vectors (Tartaglia et al., 1993 a,b). This avipox vector is restricted to avian species for productive replication. On human cell cultures, canarypox virus replication is aborted early in the viral replication cycle prior to viral DNA synthesis. Nevertheless, when engineered to express extrinsic immunogens, authentic expression and processing is observed in vitro in mammalian cells and inoculation into numerous mammalian species induces antibody and cellular immune responses to the extrinsic immunogen and provides protection against challenge with the cognate pathogen (Taylor et al., 1992; Taylor et al., 1991). Recent Phase I clinical trials in both Europe and the United States of a canarypox/rabies glycoprotein recombinant (ALVAC-RG) demonstrated that the experimental vaccine was well tolerated and induced protective levels of rabiesvirus neutralizing antibody titers (Cadoz et al., 1992; Fries et al., 1992). Additionally, peripheral blood mononuclear cells (PBMCs) derived from the ALVAC-RG vaccinates demonstrated significant levels of lymphocyte proliferation when stimulated with purified rabies virus (Fries et al., 1992).
  • NYVAC, ALVAC and TROVAC have also been recognized as unique among all poxviruses in that the National Institutes of Health (“NIH”) (U.S. Public Health Service), Recombinant DNA Advisory Committee, which issues guidelines for the physical containment of genetic material such as viruses and vectors, i.e., guidelines for safety procedures for the use of such viruses and vectors which are based upon the pathogenicity of the particular virus or vector, granted a reduction in physical containment level: from BSL2 to BSL1. No other poxvirus has a BSL1 physical containment level. Even the Copenhagen strain of vaccinia virus—the common smallpox vaccine—has a higher physical containment level; namely, BSL2. Accordingly, the art has recognized that NYVAC, ALVAC and TROVAC have a lower pathogenicity than any other poxvirus.
  • Both NYVAC- and ALVAC-based recombinant viruses have been shown to stimulate in vitro specific CD8+ CTLs from human PBMCs (Tartaglia et al., 1993a). Mice immunized with NYVAC or ALVAC recombinants expressing various forms of the HIV-1 envelope glycoprotein generated both primary and memory HIV specific CTL responses which could be recalled by a second inoculation (Tartaglia et al., 1993a; Cox et al., 1993). ALVAC-env and NYVAC-env recombinants (expressing the HIV-1 envelope glycoprotein) stimulated strong HIV-specific CTL responses from peripheral blood mononuclear cells (PBMC) of HIV-1 infected individuals (Tartaglia et al., 1993a; Cox et al., 1993). Acutely infected autologous PBMC were used as stimulator cells for the remaining PBMC. After 10 days incubation in the absence of exogenous IL-2, the cells were evaluated for CTL activities. NYVAC-env and ALVAC-env stimulated high levels of anti-HIV activities in mice.
  • Applicants have generated an ALVAC recombinant, vCP300 (ALVAC-MN120TMGNP), that expresses numerous HIV1 antigens and HIV1 T-cell epitopes. vCP300 expresses the HIV1 (IIIB) gag (and protease) proteins. (Expression of the protease protein allows the gag polyprotein to be correctly processed.) vCP300 also expresses a form of the HIV1 (MN) envelope glycoprotein in which gp120 is fused to the transmembrane anchor sequence derived from gp41. vP300 also expresses two (2) HIV1 (BRU) nef CTL epitopes and three (3) HIV1 (IIIB) pol CTL epitopes. vCP300 does not, however, express a functional reverse transcriptase activity. vCP300 also does not express a functional nef gene product; a protein associated with pathogenicity in the SIV-macaque model system and HIV1 virulence (Miller et al, 1994; Spina et al, 1994). Therefore, vCP300 expresses immunologically important antigens and/or epitopes from gag, env, pol and nef, but does not express the potentially detrimental enzymatic and/or pathogenic activities associated with pol and nef.
  • As previously mentioned, vCP300 expresses a form of HIV1 envelope glycoprotein in which the vast majority of the gp41 sequence is deleted. Since most of the immunologically important epitopes associated with the HIV1 envelope glycoprotein are found on gp120, rather than gp41, it is assumed that the immunogenicity of the envelope glycoprotein expressed by this recombinant is not adversely affected. In fact, in a side-by-side analysis, an HIV1 gp120 subunit vaccine was able to protect chimpanzees against an HIV1 challenge, whereas an HIV1 gp160 subunit vaccine was not (Berman et al., 1990). It is not known why the efficacy of these two vaccines is different. However, it is known that antibodies against an epitope gp41 can enhance HIV1 infection in vitro (Robinson et al., 1990). Furthermore, it is known that antibodies to a putative immunosuppressive region of gp41 are associated with the absence of AIDS in HIV1-seropositive individuals, suggesting a potential role in pathogenicity for this region (Klasse et al., 1988). In addition, it is known that antibodies to the C-terminal region of gp41 can cross-react with HLA class II antigens (Golding et al., 1988) and inhibit antigen-specific lymphoproliferative responses (Golding et al., 1989). Since the envelope glycoprotein expressed by vCP300 does not contain any gp41 sequence, except for the 28 amino acids associated with the transmembrane region, the potentially detrimental effects associated with gp41 are avoided. Furthermore, the envelope glycoprotein expressed by vCP300 does not contain the immunodominant epitope on gp41 that is recognized by antisera from every HIV1-seropositive individual from every stage of an HIV1 infection (Shafferman et al., 1989). Therefore, diagnostic tests based upon reactivity against this epitope can be used to distinguish between vaccinated and infected individuals. The ability to differentiate vCP300-vaccinated individuals from HIV1-infected individuals with a gp41 antibody assay is important because the most commonly used diagnostic kit (which assays for the presence of HIV1 p24 antibodies) would be useless, since vCP300-vaccinated individuals would be expected to have a high level of p24 antibodies. Alternatively, HIV-1 infected individuals would be expected to make anti-gp41 antibodies but those vaccinated with vCP205 or vCP300 would not since gp41 is absent from vCP205 or vCP300.
  • Rabbits and guinea pigs have been inoculated with an ALVAC recombinant (vCP205; ALVAC-MN120TMG) expressing the same cell surface-associated form of HIV1 gp120 (120™) and Gag/pro as expressed by vCP300. Rabbits and guinea pigs have also been inoculated with vCP205 and boosted with an HIV1 T-B peptide. Both ALVAC-based protocols were able to elicit HIV1 gp160- and V3 loop-specific antibodies, thereby indicating that an ALVAC recombinant expressing the cell surface form of HIV1 gp120 induces an HIV1-specific immune response.
  • vCP300 expresses the HIV1 Gag proteins, a cell surface-associated form of the HIV1 gp120 envelope glycoprotein, two (2) regions from HIV1 nef containing CTL epitopes and three (3) regions from HIV1 pol containing CTL epitopes. The expression of an HIV1 envelope glycoprotein that does not contain gp41 allows vaccinated individuals to be differentiated from HIV1-infected individuals via an assay for gp41 antibodies and eliminates potentially detrimental responses associated with various gp41 epitopes. Since a previous ALVAC recombinant expressing HIV1 gp160 has been shown to elicit HIV1-specific humoral and cellular immune responses in humans (Pialoux et al., 1995), the addition of Gag and the Pol and Nef epitopes (and the deletion of the potentially detrimental gp41 epitopes) heightens and broadens the immune response elicited by vP300, relative to vCP125, and, may provide an efficacious HIV1 vaccine, or immunological or antigenic composition.
  • In Macaca fascicularis (monkeys; macaques) immunized with vCP205 or vCP300, an antibody response (anti-HIV) was observed, thereby further demonstrating the utility and efficacy of these recombinants.
  • Since the ELDKWA or LDKW epitope does not appear to be very immunogenic in its normal configuration, to increase its immunogenicity, recombinants of the invention present it to the immune system in a more immunogenic setting, such as within the V3 loop of gp120 or within other regions of gp120 and/or as part of an intact gp160 envelope.
  • ALVAC recombinant (vCP1307), NYVAC recombinant (vP1313) and COPAK recombinant (vP1319) express a form of the HIV1 gp120+TM gene product in which the V3 loop has been modified to contain two copies of the ELDKWA epitope. The ELDKWA epitopes of this gp120+TM (with ELDKWA epitopes) gene product are expressed on the surface of vCP1307-, vP1313- and vP1319-infected cells.
  • The V3 loop of HIV1 gp120+TM (or gp160) can be used as an immunological platform for any linear epitope, not just linear HIV1 epitopes. The gp120+TM (with epitopes of interest) protein generated by these recombinants can also be isolated from poxvirus-infected cells and used to inoculate individuals in a subunit vaccine configuration (composition, or an antigenic or immunological composition). The proteins generated by the recombinants and antibodies elicited therefrom can also be used in assays to detect the presence or absence of HIV. Accordingly, the invention comprehends HIV immunogens and modified gp120 and gp160. Further, such envelope-based immunogens (HIV immunogens or unmodified gp120 or gp160 (can be derived from any eukaryotic or prokaryotic expression vector and used as subunit preparations or can be administered through DNA immunization using an appropriate expression plasmid. Techniques for DNA immunization are known in the art. With respect to techniques for DNA immunization, mention is particularly made of Nabel and Felgner, “Direct gene transfer for immunotherapy and immunization”, Tibtech, May 1993, 11; 211-215, and Webster et al, “protection of ferrets against influenza challenge with a DNA vaccine to the haemagglutinin”, vaccine, 1994, 12(16): 1495-1498, incorporated herein by reference. Also, the DNA from the recombinants vP1313, vP1319 and vCP1307 can be used to probe for the presence of HIV DNA in a sample of interest using known hybridization techniques, or, to generate PCR primers using known techniques.
  • Clearly based on the attenuation profiles of the NYVAC, ALVAC, and TROVAC vectors and their demonstrated ability to elicit both humoral and cellular immunological responses to extrinsic immunogens (Tartaglia et al., 1993a,b; Taylor et al., 1992; Konishi et al., 1992) such recombinant viruses offer a distinct advantage over previously described vaccinia-based recombinant viruses.
  • The administration procedure for recombinant virus, immunogen, modified gp120 or gp160, DNA or expression product compositions of the invention such as immunological, antigenic or vaccine compositions or therapeutic compositions can be via a parenteral route (intradermal, intramuscular or subcutaneous). Such an administration enables a systemic immune response.
  • More generally, the inventive antigenic, immunological or vaccine compositions or therapeutic compositions (compositions containing the poxvirus recombinants, expression products, immunogens, DNA, modified gp120 or gp160 of the invention) can be prepared in accordance with standard techniques well known to those skilled in the pharmaceutical art. Such compositions can be administered in dosages and by techniques well known to those skilled in the medical arts taking into consideration such factors as the age, sex, weight, and condition of the particular patient, and the route of administration. The compositions can be administered alone, or can be co-administered or sequentially administered with compositions of the invention or with other immunological, antigenic or vaccine or therapeutic compositions in seropositive individuals. The compositions can be administered alone, or can be co-administered or sequentially administered with compositions of the invention or with other antigenic, immunological, vaccine or therapeutic compositions in seronegative individuals. Such other compositions can include purified antigens from immunodeficiency virus or from the expression of such antigens by a recombinant poxvirus or other vector system or, such other compositions can include a recombinant poxvirus which expresses other immunodeficiency antigens or biological response modifiers (e.g. cytokines; co-stimulating molecules). Again, co-administration is performed by taking into consideration such known factors as the age, sex, weight, and condition of the particular patient, and, the route of administration.
  • Examples of compositions of the invention include liquid preparations for orifice, e.g., oral, nasal, anal, vaginal, etc., administration such as suspensions, syrups or elixirs; and, preparations for parenteral, subcutaneous, intradermal, intramuscular or intravenous administration (e.g., injectable administration) such as sterile suspensions or emulsions. In such compositions the recombinant poxvirus, expression product, immunogen, DNA, or modified gp120 or gp160 may be in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose or the like.
  • Further, the products of expression of the inventive recombinant poxviruses can be used directly to stimulate an immune response in either seronegative or seropositive individuals or in animals. Thus, the expression products can be used in compositions of the invention instead or in addition to the inventive recombinant poxvirus in the aforementioned compositions. The immunogens of the invention can be similarly used.
  • Additionally, the inventive recombinant poxvirus and the expression products therefrom and immunogens and modified gp120 or gp160 of the invention stimulate an immune or antibody response in humans and animals. From those antibodies or by techniques well-known in the art, monoclonal antibodies can be prepared and, those monoclonal antibodies, can be employed in well known antibody binding assays, diagnostic kits or tests to determine the presence or absence of particular immunodeficiency virus antigen(s) and therefore the presence or absence of the virus, or to determine whether an immune response to the virus or antigen(s) has simply been stimulated. Those monoclonal antibodies can also be employed in immunoadsorption chromatography to recover immunodeficiency virus or expression products of the inventive recombinant poxvirus.
  • Monoclonal antibodies are immunoglobulins produced by hybridoma cells. A monoclonal antibody reacts with a single antigenic determinant and provides greater specificity than a conventional, serum-derived antibody. Furthermore, screening a large number of monoclonal antibodies makes it possible to select an individual antibody with desired specificity, avidity and isotype. Hybridoma cell lines provide a constant, inexpensive source of chemically identical antibodies and preparations of such antibodies can be easily standardized. Methods for producing monoclonal antibodies are well known to those of ordinary skill in the art, e.g., Koprowski, H. et al., U.S. Pat. No. 4,196,265, issued Apr. 1, 1989, incorporated herein by reference.
  • Uses of monoclonal antibodies are known. One such use is in diagnostic methods, e.g., David, G. and Greene, H. U.S. Pat. No. 4,376,110, issued Mar. 8, 1983; incorporated herein by reference. Monoclonal antibodies have also been used to recover materials by immunoadsorption chromatography, e.g., Milstein, C. 1980, Scientific American 243:66, 70, incorporated herein by reference.
  • Furthermore, the inventive recombinant poxvirus or expression products therefrom or the inventive immunogens or modified gp120 or gp160 can be used to stimulate a response in cells such as lymphocytes or CTLs in vitro or ex vivo for subsequent reinfusion into a patient. If the patient is seronegative, the reinfusion is to stimulate an immune response, e.g., an immunological or antigenic response such as active immunization. In a seropositive individual, the reinfusion is to stimulate or boost the immune system against immunodeficiency virus.
  • Additionally, the DNA from inventive recombinants can be used as probes to detect the presence of HIV DNA in a sample or, to generate PCR primers, or for DNA immunization using an appropriate expression plasmid, by methods known in the art. (See Nabel and Felger and Webster et al, Supra)
  • Accordingly, the inventive recombinant poxvirus has several utilities: In antigenic, immunological or vaccine compositions such as for administration to seronegative individuals. In therapeutic compositions in seropositive individuals in need of therapy to stimulate or boost the immune system against immunodeficiency virus. In vitro to produce antigens or the inventive immunogens or the inventive modified gp120 or gp160 which can be further used in antigenic, immunological or vaccine compositions or in therapeutic compositions. To generate antibodies (either by direct administration or by administration of an expression product of the inventive recombinant poxvirus) which can be further used: in diagnosis, tests or kits to ascertain the presence or absence of antigens in a sample such as sera, for instance, to ascertain the presence or absence of immunodeficiency virus or CTLs in a sample such as sera or, to determine whether an immune response has elicited to the virus or, to particular antigen(s); or, in immunoadsorption chromatography (the inventive immunogens and modified gp120 or gp160 can also be used to generate antibodies which can be also so further used). To generate DNA for use as hybridization probes or to prepare PCR primers or for DNA immunization. And, the inventive recombinant poxvirus, expression products therefrom, immunogens and modified gp120 or gp160 can be used to generate stimulated cells which can be further used (reinfused) to stimulate an immune response (antigenic, or immunological response; or active immunization) or, to boost or stimulate the immune system (for instance, of an immunocompromised or seropositive individual). Other utilities also exist for embodiments of the invention.
  • A better understanding of the present invention and of its many advantages will be had from the following examples, given by way of illustration.
  • EXAMPLES
  • DNA Cloning and Synthesis. Plasmids were constructed, screened and grown by standard procedures (Maniatis et al., 1982; Perkus et al., 1985; Piccini et al., 1987). Restriction endonucleases were obtained from Bethesda Research Laboratories, Gaithersburg, Md., New England Biolabs, Beverly, Mass.; and Boehringer Mannheim Biochemicals, Indianapolis, Ind. Klenow fragment of E. coli polymerase was obtained from Boehringer Mannheim Biochemicals. BAL-31 exonuclease and phage T4 DNA ligase were obtained from New England Biolabs. The reagents were used as specified by the various suppliers.
  • Synthetic oligodeoxyribonucleotides were prepared on a Biosearch 8750 or Applied Biosystems 380B DNA synthesizer as previously described (Perkus et al., 1989). DNA sequencing was performed by the dideoxy-chain termination method (Sanger et al., 1977) using Sequenase (Tabor et al., 1987) as previously described (Guo et al., 1989). DNA amplification by polymerase chain reaction (PCR) for sequence verification (Engelke et al., 1988) was performed using custom synthesized oligonucleotide primers and GeneAmp DNA amplification Reagent Kit (Perkin Elmer Cetus, Norwalk, Conn.) in an automated Perkin Elmer Cetus DNA Thermal Cycler. Excess DNA sequences were deleted from plasmids by restriction endonuclease digestion followed by limited digestion by BAL-31 exonuclease and mutagenesis (Mandecki, 1986) using synthetic oligonucleotides.
  • Cells, Virus, and Transfection. The origins and conditions of cultivation of the Copenhagen strain of vaccinia virus has been previously described (Guo et al., 1989). Generation of recombinant virus by recombination, in situ hybridization of nitrocellulose filters and screening for B-galactosidase activity are as previously described (Piccini et al., 1987).
  • The origins and conditions of cultivation of the Copenhagen strain of vaccinia virus and NYVAC has been previously described (Guo et al., 1989; Tartaglia et al., 1992). Generation of recombinant virus by recombination, in situ hybridization of nitrocellulose filters and screening for B-galactosidase activity are as previously described (Panicali et al., 1982; Perkus et al., 1989).
  • The parental canarypox virus (Rentschler strain) is a vaccinal strain for canaries. The vaccine strain was obtained from a wild type isolate and attenuated through more than 200 serial passages on chick embryo fibroblasts. A master viral seed was subjected to four successive plaque purifications under agar and one plaque clone was amplified through five additional passages after which the stock virus was used as the parental virus in in vitro recombination tests. The plaque purified canarypox isolate is designated ALVAC.
  • The strain of fowlpox virus (FPV) designated FP-1 has been described previously (Taylor et al., 1988a). It is an attenuated vaccine strain useful in vaccination of day old chickens. The parental virus strain Duvette was obtained in France as a fowlpox scab from a chicken. The virus was attenuated by approximately 50 serial passages in chicken embryonated eggs followed by 25 passages on chicken embryo fibroblast cells. The virus was subjected to four successive plaque purifications. One plaque isolate was further amplified in primary CEF cells and a stock virus, designated as TROVAC, established.
  • NYVAC, ALVAC and TROVAC viral vectors and their derivatives were propagated as described previously (Piccini et al., 1987; Taylor et al., 1988a,b). Vero cells and chick embryo fibroblasts (CEF) were propagated as described previously (Taylor et al., 1988a,b).
  • Example 1 Construction of Plasmid pSD460 for Deletion of Thymidine Kinase Gene (J2R)
  • Referring now to FIG. 1, plasmid pSD406 contains vaccinia HindIII J (pos. 83359-88377) cloned into pUC8. pSD406 was cut with HindIII and PvuII, and the 1.7 kb fragment from the left side of HindIII J cloned into pUC8 cut with HindIII/SmaI, forming pSD447. pSD447 contains the entire gene for J2R (pos. 83855-84385). The initiation codon is contained within an NlaIII site and the termination codon is contained within an SspI site. Direction of transcription is indicated by an arrow in FIG. 1.
  • To obtain a left flanking arm, a 0.8 kb HindIII/EcoRI fragment was isolated from pSD447, then digested with NlaIII and a 0.5 kb HindIII/NlaIII fragment isolated. Annealed synthetic oligonucleotides MPSYN43/MPSYN44 (SEQ ID NO:1/SEQ ID NO:2)
  •                       SmaI
    MPSYN43
    5′     TAATTAACTAGCTACCCGGG     3′
    MPSYN44 3′ GTACATTAATTGATCGATGGGCCCTTAA 5′
      NlaIII                  EcoRI

    were ligated with the 0.5 kb HindIII/NlaIII fragment into pUC18 vector plasmid cut with HindIII/EcoRI, generating plasmid pSD449.
  • To obtain a restriction fragment containing a vaccinia right flanking arm and pUC vector sequences, pSD447 was cut with SspI (partial) within vaccinia sequences and HindIII at the pUC/vaccinia junction, and a 2.9 kb vector fragment isolated. This vector fragment was ligated with annealed synthetic oligonucleotides MPSYN45/MPSYN46 (SEQ ID NO:3/SEQ ID NO:4)
  •    HindIII  SmaI
    MPSYN45
    5′  AGCTTCCCGGGTAAGTAATACGTCAAGGAGAAAACGAA
    MPSYN46
    3′      AGGGCCCATTCATTATGCAGTTCCTCTTTTGCTT
                    NotI           SspI
     ACGATCTGTAGTTAGCGGCCGCCTAATTAACTAAT
      3′ MPSYN45
     TGCTAGACATCAATCGCCGGCGGATTAATTGATTA
      5′ MPSYN46

    generating pSD459.
  • To combine the left and right flanking arms into one plasmid, a 0.5 kb HindIII/SmaI fragment was isolated from pSD449 and ligated with pSD459 vector plasmid cut with HindIII/SmaI, generating plasmid pSD460. pSD460 was used as donor plasmid for recombination with wild type parental vaccinia virus Copenhagen strain VC-2. 32P labelled probe was synthesized by primer extension using MPSYN45 (SEQ ID NO:3) as template and the complementary 20mer oligonucleotide MPSYN47 (SEQ ID NO:5) (5′ TTAGTTAATTAGGCGGCCGC 3′) as primer. Recombinant virus vP410 was identified by plaque hybridization.
  • Example 2 Construction of Plasmid pSD486 for Deletion of Hemorrhagic Region (B13R+B14R)
  • Referring now to FIG. 2, plasmid pSD419 contains vaccinia SalI G (pos. 160, 744-173,351) cloned into pUC8. pSD422 contains the contiguous vaccinia SalI fragment to the right, SalI J (pos. 173, 351-182,746) cloned into pUC8. To construct a plasmid deleted for the hemorrhagic region, u, B13R-B14R (pos. 172, 549-173,552), pSD419 was used as the source for the left flanking arm and pSD422 was used as the source of the right flanking arm. The direction of transcription for the u region is indicated by an arrow in FIG. 2.
  • To remove unwanted sequences from pSD419, sequences to the left of the NcoI site (pos. 172,253) were removed by digestion of pSD419 with NcoI/SmaI followed by blunt ending with Klenow fragment of E. coli polymerase and ligation generating plasmid pSD476. A vaccinia right flanking arm was obtained by digestion of pSD422 with HpaI at the termination codon of B14R and by digestion with NruI 0.3 kb to the right. This 0.3 kb fragment was isolated and ligated with a 3.4 kb HincII vector fragment isolated from pSD476, generating plasmid pSD477. The location of the partial deletion of the vaccinia u region in pSD477 is indicated by a triangle. The remaining B13R coding sequences in pSD477 were removed by digestion with ClaI/HpaI, and the resulting vector fragment was ligated with annealed synthetic oligonucleotides SD22mer/SD20mer (SEQ ID NO:6/SEQ ID NO:7)
  •     ClaI          Bam HI HpaI
    SD22mer
    5′  CGATTACTATGAAGGATCCGTT  3′
    SD20mer 3′    TAATGATACTTCCTAGGCAA  5′

    generating pSD479. pSD479 contains an initiation codon (underlined) followed by a BamHI site. To place E. coli Beta-galactosidase in the B13-B14 (u) deletion locus under the control of the u promoter, a 3.2 kb BamHI fragment containing the Beta-galactosidase gene (Shapira et al., 1983) was inserted into the BamHI site of pSD479, generating pSD479BG. pSD479BG was used as donor plasmid for recombination with vaccinia virus vP410. Recombinant vaccinia virus vP533 was isolated as a blue plaque in the presence of chromogenic substrate X-gal. In vP533 the B13R-B14R region is deleted and is replaced by Beta-galactosidase.
  • To remove Beta-galactosidase sequences from vP533, plasmid pSD486, a derivative of pSD477 containing a polylinker region but no initiation codon at the u deletion junction, was utilized. First the ClaI/HpaI vector fragment from pSD477 referred to above was ligated with annealed synthetic oligonucleotides SD42mer/SD40mer (SEQ ID NO:8/SEQ ID NO:9)
  •    ClaI          SacI         Xho I        HpaI
    SD42mer
    5′ CGATTACTAGATCTGAGCTCCCCGGGCTCGAGGGATCCGTT  3′
    SD40mer 3′   TAATGATCTAGACTCGAGGGGCCCGAGCTCCCTAGGCAA  5′
               BglII       SmaI        BamHI

    generating plasmid pSD478. Next the EcoRI site at the pUC/vaccinia junction was destroyed by digestion of pSD478 with EcoRI followed by blunt ending with Klenow fragment of E. coli polymerase and ligation, generating plasmid pSD478E−. pSD478E− was digested with BamHI and HpaI and ligated with annealed synthetic oligonucleotides HEM5/HEM6 (SEQ ID NO:10/SEQ ID NO:11)
  •   BamHI  Eco RI   HpaI
    HEM5
    5′  GATCCGAATTCTAGCT 3′
    HEM6 3′      GCTTAAGATCGA 5′

    generating plasmid pSD486. pSD486 was used as donor plasmid for recombination with recombinant vaccinia virus vP533, generating vP553, which was isolated as a clear plaque in the presence of X-gal.
  • Example 3 Construction of Plasmid pMP494Δ for Deletion of ATI Region (A26L)
  • Referring now to FIG. 3, pSD414 contains SalI B cloned into pUC8. To remove unwanted DNA sequences to the left of the A26L region, pSD414 was cut with XbaI within vaccinia sequences (pos. 137,079) and with HindIII at the pUC/vaccinia junction, then blunt ended with Klenow fragment of E. coli polymerase and ligated, resulting in plasmid pSD483. To remove unwanted vaccinia DNA sequences to the right of the A26L region, pSD483 was cut with EcoRI (pos. 140,665 and at the pUC/vaccinia junction) and ligated, forming plasmid pSD484. To remove the A26L coding region, pSD484 was cut with NdeI (partial) slightly upstream from the A26L ORF (pos. 139,004) and with HpaI (pos. 137,889) slightly downstream from the A26L ORF. The 5.2 kb vector fragment was isolated and ligated with annealed synthetic oligonucleotides ATI3/ATI4 (SEQ ID NO:12/SEQ ID NO:13)
  •    Nde I
    ATI3
    5′ TATGAGTAACTTAACTCTTTTGTTAATTAAAAGTATATTCAA
    ATI4
    3′   ACTCATTGAATTGAGAAAACAATTAATTTTCATATAAGTT
                     BglII  Eco RI HpaI
    AAAATAAGTTATATAAATAGATCTGAATTCGTT
      3′ ATI3
    TTTTATTCAATATATTTATCTAGACTTAAGCAA
      5′ ATI4

    reconstructing the region upstream from A26L and replacing the A26L ORF with a short polylinker region containing the restriction sites BglII, EcoRI and HpaI, as indicated above. The resulting plasmid was designated pSD485. Since the BglII and EcoRI sites in the polylinker region of pSD485 are not unique, unwanted BglII and EcoRI sites were removed from plasmid pSD483 (described above) by digestion with BglII (pos. 140,136) and with EcoRI at the pUC/vaccinia junction, followed by blunt ending with Klenow fragment of E. coli polymerase and ligation. The resulting plasmid was designated pSD489. The 1.8 kb ClaI (pos. 137,198)/EcORV (pos. 139,048) fragment from pSD489 containing the A26L ORF was replaced with the corresponding 0.7 kb polylinker-containing ClaI/EcoRV fragment from pSD485, generating pSD492. The BglII and EcoRI sites in the polylinker region of pSD492 are unique.
  • A 3.3 kb BglII cassette containing the E. coli Beta-galactosidase gene (Shapira et al., 1983) under the control of the vaccinia 11 kDa promoter (Bertholet et al., 1985; Perkus et al., 1990) was inserted into the BglII site of pSD492, forming pSD493KBG. Plasmid pSD493KBG was used in recombination with rescuing virus vP553. Recombinant vaccinia virus, vP581, containing Beta-galactosidase in the A26L deletion region, was isolated as a blue plaque in the presence of X-gal.
  • To generate a plasmid for the removal of Beta-galactosidase sequences from vaccinia recombinant virus vP581, the polylinker region of plasmid pSD492 was deleted by mutagenesis (Mandecki, 1986) using synthetic oligonucleotide MPSYN177 (SEQ ID NO:14) (5′ AAAATGGGCGTGGATTGTTAACTTTATATAACTTATTTTTTGAATATAC 3′). In the resulting plasmid, pMP494Δ, vaccinia DNA encompassing positions [137,889-138,937], including the entire A26L ORF is deleted. Recombination between the pMP494L and the Beta-galactosidase containing vaccinia recombinant, vP581, resulted in vaccinia deletion mutant vP618, which was isolated as a clear plaque in the presence of X-gal.
  • Example 4 Construction of Plasmid pSD467 for Deletion of Hemagglutinin Gene (A56R)
  • Referring now to FIG. 4, vaccinia SalI G restriction fragment (pos. 160, 744-173,351) crosses the HindIII A/B junction (pos. 162,539). pSD419 contains vaccinia SalI G cloned into pUC8. The direction of transcription for the hemagglutinin (HA) gene is indicated by an arrow in FIG. 4. Vaccinia sequences derived from HindIII B were removed by digestion of pSD419 with HindIII within vaccinia sequences and at the pUC/vaccinia junction followed by ligation. The resulting plasmid, pSD456, contains the HA gene, A56R, flanked by 0.4 kb of vaccinia sequences to the left and 0.4 kb of vaccinia sequences to the right. A56R coding sequences were removed by cutting pSD456 with RsaI (partial; pos. 161,090) upstream from A56R coding sequences, and with EagI (pos. 162,054) near the end of the gene. The 3.6 kb RsaI/EagI vector fragment from pSD456 was isolated and ligated with annealed synthetic oligonucleotides MPSYN59 (SEQ ID NO:15), MPSYN62 (SEQ ID NO:16), MPSYN60 (SEQ ID NO:17), and MPSYN61 (SEQ ID NO:18)
  •    Rsa I
    MPSYN59
    5′ ACACGAATGATTTTCTAAAGTATTTGGAAAGTTTTATAGGT-
    MPSYN62 3′ TGTGCTTACTAAAAGATTTCATAAACCTTTCAAAATATCCA-
    MPSYN59   AGTTGATAGAACAAAATACATAATTT 3′
    MPSYN62   TCAACTATCT 5′
    MPSYN60 5′                 TGTAAAAATAAATCACTTTTTATA-
    MPSYN61 3′ TGTTTTATGTATTAAAACATTTTTATTTAGTGAAAAATAT-
       BglII SmaI  PstI   Eag I
    MPSYN60 CTAAGATCTCCCGGGCTGCAGC
          3′
    MPSYN61 GATTCTAGAGGGCCCGACGTCGCCGG   5′

    reconstructing the DNA sequences upstream from the A56R ORF and replacing the A56R ORF with a polylinker region as indicated above. The resulting plasmid is pSD466. The vaccinia deletion in pSD466 encompasses positions [161,185-162,053]. The site of the deletion in pSD466 is indicated by a triangle in FIG. 4.
  • A 3.2 kb BglII/BamHI (partial) cassette containing the E. coli Beta-galactosidase gene (Shapira et al., 1983) under the control of the vaccinia 11 kDa promoter (Bertholet et al., 1985; Guo et al., 1989) was inserted into the BglII site of pSD466, forming pSD466 KBG. Plasmid pSD466 KBG was used in recombination with rescuing virus vP618. Recombinant vaccinia virus, vP708, containing Beta-galactosidase in the A56R deletion, was isolated as a blue plaque in the presence of X-gal.
  • Beta-galactosidase sequences were deleted from vP708 using donor plasmid pSD467. pSD467 is identical to pSD466, except that EcoRI, SmaI and BamHI sites were removed from the pUC/vaccinia junction by digestion of pSD466 with EcoRI/BamHI followed by blunt ending with Klenow fragment of E. coli polymerase and ligation. Recombination between vP708 and pSD467 resulted in recombinant vaccinia deletion mutant, vP723, which was isolated as a clear plaque in the presence of X-gal.
  • Example 5 Construction of Plasmid pMPCSK1Δ for Deletion of Open Reading Frames [C7L-K1L]
  • Referring now to FIG. 5, the following vaccinia clones were utilized in the construction of pMPCSK1Δ. pSD420 is SalI H cloned into pUC8. pSD435 is KpnI F cloned into pUC18. pSD435 was cut with SphI and religated, forming pSD451. In pSD451, DNA sequences to the left of the SphI site (pos. 27,416) in HindIII M are removed (Perkus et al., 1990). pSD409 is HindIII M cloned into pUC8.
  • To provide a substrate for the deletion of the [C7L-K1L] gene cluster from vaccinia, E. coli Beta-galactosidase was first inserted into the vaccinia M2L deletion locus (Guo et al., 1990) as follows. To eliminate the BglII site in pSD409, the plasmid was cut with BglII in vaccinia sequences (pos. 28,212) and with BamHI at the pUC/vaccinia junction, then ligated to form plasmid pMP409B. pMP409B was cut at the unique SphI site (pos. 27,416). M2L coding sequences were removed by mutagenesis (Guo et al., 1990; Mandecki, 1986) using synthetic oligonucleotide
  • MPSYN82
    (SEQ ID NO: 19)
                               Bgl II
    5′ TTTCTGTATATTTGCACCAATTTAGATCTT-ACTCAAAATATGTAAC
    AATA
    3′

    The resulting plasmid, pMP409D, contains a unique BglII site inserted into the M2L deletion locus as indicated above. A 3.2 kb BamHI (partial)/BglII cassette containing the E. coli Beta-galactosidase gene (Shapira et al., 1983) under the control of the 11 kDa promoter (Bertholet et al., 1985) was inserted into pMP409D cut with BglII. The resulting plasmid, pMP409DBG (Guo et al., 1990), was used as donor plasmid for recombination with rescuing vaccinia virus vP723. Recombinant vaccinia virus, vP784, containing Beta-galactosidase inserted into the M2L deletion locus, was isolated as a blue plaque in the presence of X-gal.
  • A plasmid deleted for vaccinia genes [C7L-K1L] was assembled in pUC8 cut with SmaI, HindIII and blunt ended with Klenow fragment of E. coli polymerase. The left flanking arm consisting of vaccinia HindIII C sequences was obtained by digestion of pSD420 with XbaI (pos. 18,628) followed by blunt ending with Klenow fragment of E. coli polymerase and digestion with BglII (pos. 19,706). The right flanking arm consisting of vaccinia HindIII K sequences was obtained by digestion of pSD451 with BglII (pos. 29,062) and EcoRV (pos. 29,778). The resulting plasmid, pMP581CK is deleted for vaccinia sequences between the BglII site (pos. 19,706) in HindIII C and the BglII site (pos. 29,062) in HindIII K. The site of the deletion of vaccinia sequences in plasmid pMP581CK is indicated by a triangle in FIG. 5.
  • To remove excess DNA at the vaccinia deletion junction, plasmid pMP581CK, was cut at the NcoI sites within vaccinia sequences (pos. 18,811; 19,655), treated with Bal-31 exonuclease and subjected to mutagenesis (Mandecki, 1986) using synthetic oligonucleotide MPSYN233 (SEQ ID NO:20) 5′-TGTCATTTAACACTATACTCATATTAATAAAAATAATATTTATT-3′. The resulting plasmid, pMPCSK18, is deleted for vaccinia sequences positions 18,805-29,108, encompassing 12 vaccinia open reading frames [C7L-K1L]. Recombination between pMPCSK1Δ and the Beta-galactosidase containing vaccinia recombinant, vP784, resulted in vaccinia deletion mutant, vP804, which was isolated as a clear plaque in the presence of X-gal.
  • Example 6 Construction of Plasmid pSD548 for Deletion of Large Subunit, Ribonucleotide Reductase (I4L)
  • Referring now to FIG. 6, plasmid pSD405 contains vaccinia HindIII I (pos. 63, 875-70,367) cloned in pUC8. pSD405 was digested with EcoRV within vaccinia sequences (pos. 67,933) and with SmaI at the pUC/vaccinia junction, and ligated, forming plasmid pSD518. pSD518 was used as the source of all the vaccinia restriction fragments used in the construction of pSD548.
  • The vaccinia I4L gene extends from position 67,371-65,059. Direction of transcription for I4L is indicated by an arrow in FIG. 6. To obtain a vector plasmid fragment deleted for a portion of the I4L coding sequences, pSD518 was digested with BamHI (pos. 65,381) and HpaI (pos. 67,001) and blunt ended using Klenow fragment of E. coli polymerase. This 4.8 kb vector fragment was ligated with a 3.2 kb SmaI cassette containing the E. coli Beta-galactosidase gene (Shapira et al., 1983) under the control of the vaccinia 11 kDa promoter (Bertholet et al., 1985; Perkus et al., 1990), resulting in plasmid pSD524 KBG. pSD524 KBG was used as donor plasmid for recombination with vaccinia virus vP804. Recombinant vaccinia virus, vP855, containing Beta-galactosidase in a partial deletion of the I4L gene, was isolated as a blue plaque in the presence of X-gal.
  • To delete Beta-galactosidase and the remainder of the I4L ORF from vP855, deletion plasmid pSD548 was constructed. The left and right vaccinia flanking arms were assembled separately in pUC8 as detailed below and presented schematically in FIG. 6.
  • To construct a vector plasmid to accept the left vaccinia flanking arm, pUC8 was cut with BamHI/EcoRI and ligated with annealed synthetic oligonucleotides 518A1/518A2
  • (SEQ ID NO: 21/SEQ ID NO: 22)
        Bam HI   RsaI
    518A1
    5′ GATCCTGAGTACTTTGTAATATAATGATATATATTTTCACT
    518A2
    3′     GACTCATGAAACATTATATTACTATATATAAAAGTGA
                          Bgl II    EcoRI
    TTATCTCATTTGAGAATAAAAAGATCTTAGG
         3′ 
    AATAGAGTAAACTCTTATTTTTCTAGAATCCTTAA 5′ 
    518A1
    518A2

    forming plasmid pSD531. pSD531 was cut with RsaI (partial) and BamHI and a 2.7 kb vector fragment isolated. pSD518 was cut with BglII (pos. 64,459)/RsaI (pos. 64,994) and a 0.5 kb fragment isolated. The two fragments were ligated together, forming pSD537, which contains the complete vaccinia flanking arm left of the I4L coding sequences.
  • To construct a vector plasmid to accept the right vaccinia flanking arm, pUC8 was cut with BamHI/EcoRI and ligated with annealed synthetic oligonucleotides 518B1/518B2
  • (SEQ ID NO: 23/SEQ ID NO: 24)
      BamHI  Bgl II SmaI
    518B1
    5′ GATCCAGATCTCCCGGGAAAAAAATTATTTAACTTTTCAT
    518B2
    3′     GTCTAGAGGCCCCTTTTTTTAATAAATTGAAAAGTA
                             RsaI   EcoRI
    TAATAG-GGATTTGACGTATGTAGCGTACTAGG     3′
    ATTATC-CCTAAACTGCATACTACGCATGATCCTTAA 5′
    518B1
    518B2

    forming plasmid pSD532. pSD532 was cut with RsaI (partial)/EcoRI and a 2.7 kb vector fragment isolated. pSD518 was cut with RsaI within vaccinia sequences (pos. 67,436) and EcoRI at the vaccinia/pUC junction, and a 0.6 kb fragment isolated. The two fragments were ligated together, forming pSD538, which contains the complete vaccinia flanking arm to the right of I4L coding sequences.
  • The right vaccinia flanking arm was isolated as a 0.6 kb EcoRI/BglII fragment from pSD538 and ligated into pSD537 vector plasmid cut with EcoRI/BglII. In the resulting plasmid, pSD539, the I4L ORF (pos. 65, 047-67,386) is replaced by a polylinker region, which is flanked by 0.6 kb vaccinia DNA to the left and 0.6 kb vaccinia DNA to the right, all in a pUC background. The site of deletion within vaccinia sequences is indicated by a triangle in FIG. 6. To avoid possible recombination of Beta-galactosidase sequences in the pUC-derived portion of pSD539 with Beta-galactosidase sequences in recombinant vaccinia virus vP855, the vaccinia I4L deletion cassette was moved from pSD539 into pRC11, a pUC derivative from which all Beta-galactosidase sequences have been removed and replaced with a polylinker region (Colinas et al., 1990). pSD539 was cut with EcoRI/PstI and the 1.2 kb fragment isolated. This fragment was ligated into pRC11 cut with EcoRI/PstI (2.35 kb), forming pSD548. Recombination between pSD548 and the Beta-galactosidase containing vaccinia recombinant, vP855, resulted in vaccinia deletion mutant vP866, which was isolated as a clear plaque in the presence of X-gal.
  • DNA from recombinant vaccinia virus vP866 was analyzed by restriction digests followed by electrophoresis on an agarose gel. The restriction patterns were as expected. Polymerase chain reactions (PCR) (Engelke et al., 1988) using vP866 as template and primers flanking the six deletion loci detailed above produced DNA fragments of the expected sizes. Sequence analysis of the PCR generated fragments around the areas of the deletion junctions confirmed that the junctions were as expected. Recombinant vaccinia virus vP866, containing the six engineered deletions as described above, was designated vaccinia vaccine strain “NYVAC.”
  • NYVAC was deposited under the terms of the Budapest Treaty on Mar. 6, 1997 with the American Type Culture Collection (ATCC), P.O. Box 1549, Manassas, Va. 20108 USA under ATCC accession number VR-2559.
  • Example 7 Insertion of a Rabies Glycoprotein G Gene into NYVAC
  • The gene encoding rabies glycoprotein G under the control of the vaccinia H6 promoter (Taylor et al., 1988a,b) was inserted into TK deletion plasmid pSD513. pSD513 is identical to plasmid pSD460 (FIG. 1) except for the presence of a polylinker region.
  • Referring now to FIG. 7, the polylinker region was inserted by cutting pSD460 with SmaI and ligating the plasmid vector with annealed synthetic oligonucleotides VQ1A/VQ1B (SEQ ID NO:25/SEQ ID NO:26)
  •   SmaI BglII XhoI  PstI   NarI   BamHI
    VQ1A
    5′  GGGAGATCTCTCGAGCTGCAGGGCGCCGGATCCTTTTTCT 3′
    VQ1B 3′  CCCTCTAGAGAGCTCGACGTCCCGCGGCCTAGGAAAAAGA 5′

    to form vector plasmid pSD513. pSD513 was cut with SmaI and ligated with a SmaI ended 1.8 kb cassette containing the gene encoding the rabies glycoprotein G gene under the control of the vaccinia H6 promoter (Taylor et al., 1988a,b). The resulting plasmid was designated pRW842. pRW842 was used as donor plasmid for recombination with NYVAC rescuing virus (vP866). Recombinant vaccinia virus vP879 was identified by plaque hybridization using 32P-labelled DNA probe to rabies glycoprotein G coding sequences.
  • The modified recombinant viruses of the present invention provide advantages as recombinant vaccine vectors. The attenuated virulence of the vector advantageously reduces the opportunity for the possibility of a runaway infection due to vaccination in the vaccinated individual and also diminishes transmission from vaccinated to unvaccinated individuals or contamination of the environment.
  • The modified recombinant viruses are also advantageously used in a method for expressing a gene product in a cell cultured in vitro by introducing into the cell the modified recombinant virus having foreign DNA which codes for and expresses gene products in the cell.
  • Example 8 Construction of TROVAC-NDV Expressing the Fusion and Hemagglutinin-Neuraminidase Glycoproteins of Newcastle Disease Virus
  • This example describes the development of TROVAC, a fowlpox virus vector and, of a fowlpox Newcastle Disease Virus recombinant designated TROVAC-NDV and its safety and efficacy. A fowlpox virus (FPV) vector expressing both F and HN genes of the virulent NDV strain Texas was constructed. The recombinant produced was designated TROVAC-NDV. TROVAC-NDV expresses authentically processed NDV glycoproteins in avian cells infected with the recombinant virus and inoculation of day old chicks protects against subsequent virulent NDV challenge.
  • Cells and Viruses. The Texas strain of NDV is a velogenic strain. Preparation of cDNA clones of the F and HN genes has been previously described (Taylor et al., 1990; Edbauer et al., 1990). The strain of FPV designated FP-1 has been described previously (Taylor et al., 1988a). It is a vaccine strain useful in vaccination of day old chickens. The parental virus strain Duvette was obtained in France as a fowlpox scab from a chicken. The virus was attenuated by approximately 50 serial passages in chicken embryonated eggs followed by 25 passages on chicken embryo fibroblast cells. The virus was subjected to four successive plaque purifications. One plaque isolate was further amplified in primary CEF cells and a stock virus, designated as TROVAC, established. The stock virus used in the in vitro recombination test to produce TROVAC-NDV had been subjected to twelve passages in primary CEF cells from the plaque isolate.
  • TROVAC was deposited under the terms of the Budapest Treaty on Feb. 6, 1997 with the American Type Culture Collection (ATCC), P.O. Box 1549, Manassas, Va. 20108 USA under ATCC accession number VR-2553.
  • Construction of a Cassette for NDV-F. A 1.8 kbp BamHI fragment containing all but 22 nucleotides from the 5′ end of the F protein coding sequence was excised from pNDV81 (Taylor et al., 1990) and inserted at the BamHI site of pUC18 to form pCE13. The vaccinia virus H6 promoter previously described (Taylor et al., 1988a,b; Guo et al., 1989; Perkus et al., 1989) was inserted into pCE13 by digesting pCE13 with SalI, filling in the sticky ends with Klenow fragment of E. coli DNA polymerase and digesting with HindIII. A HindIII-EcoRV fragment containing the H6 promoter sequence was then inserted into pCE13 to form pCE38. A perfect 5′ end was generated by digesting pCE38 with KpnI and NruI and inserting the annealed and kinased oligonucleotides CE75 (SEQ ID NO:27) and CE76 (SEQ ID NO:28) to generate pCE47.
  • CE75:
    CGATATCCGTTAAGTTTGTATCGTAATGGGCTCCAGATCTTCTACCAGGA
    TCCCGGTAC
    CE76:
    CGGGATCCTGGTAGAAGATCTGGAGCCCATTACGATACAAACTTAACGGA
    TATCG.

    In order to remove non-coding sequence from the 3′ end of the NDV-F a SmaI to PstI fragment from pCE13 was inserted into the SmaI and PstI sites of pUC18 to form pCE23. The non-coding sequences were removed by sequential digestion of pCE23 with SacI, BamHI, Exonuclease III, SI nuclease and EcoRI. The annealed and kinased oligonucleotides CE42 (SEQ ID NO:29) and CE43 (SEQ ID NO:30) were then inserted to form pCE29.
  • CE42: AATTCGAGCTCCCCGGG
    CE43: CCCGGGGAGCTCG

    The 3′ end of the NDV-F sequence was then inserted into plasmid pCE20 already containing the 5′ end of NDV-F by cloning a PstI-SacI fragment from pCE29 into the PstI and SacI sites of pCE20 to form pCE32. Generation of pCE20 has previously been described in Taylor et al., 1990.
  • In order to align the H6 promoter and NDV-F 5′ sequences contained in pCE47 with the 3′ NDV-F sequences contained in pCE32, a HindIII-PstI fragment of pCE47 was inserted into the HindIII and PstI sites of pCE32 to form pCE49. The H6 promoted NDV-F sequences were then transferred to the de-ORFed F8 locus (described below) by cloning a HindIII-NruI fragment from pCE49 into the HindIII and SmaI sites of pJCA002 (described below) to form pCE54. Transcription stop signals were inserted into pCE54 by digesting pCE54 with SacI, partially digesting with BamHI and inserting the annealed and kinased oligonucleotides CE166 (SEQ ID NO:31) and CE167 (SEQ ID NO:32) to generate pCE58.
  • CE166: CTTTTTATAAAAAGTTAACTACGTAG
    CE167: GATCCTACGTAGTTAACTTTTTATAAAAAGAGCT

    A perfect 3′ end for NDV-F was obtained by using the polymerase chain reaction (PCR) with pCE54 as template and oligonucleotides CE182 (SEQ ID NO:33) and CE183 (SEQ ID NO:34) as primers.
  • CE182: CTTAACTCAGCTGACTATCC
    CE183: TACGTAGTTAACTTTTTATAAAAATCATATTTTTGTAGTGGCTC
  • The PCR fragment was digested with PvuII and HpaI and cloned into pCE58 that had been digested with HpaI and partially digested with PvuII. The resulting plasmid was designated pCE64. Translation stop signals were inserted by cloning a HindIII-HpaI fragment which contains the complete H6 promoter and F coding sequence from pCE64 into the HindIII and HpaI sites of pRW846 to generate pCE71, the final cassette for NDV-F. Plasmid pRW846 is essentially equivalent to plasmid pJCA002 (described below) but containing the H6 promoter and transcription and translation stop signals. Digestion of pRW846 with HindIII and HpaI eliminates the H6 promoter but leaves the stop signals intact.
  • Construction of Cassette for NDV-HN. Construction of plasmid pRW802 was previously described in Edbauer et al., 1990. This plasmid contains the NDV-HN sequences linked to the 3′ end of the vaccinia virus H6 promoter in a pUC9 vector. A HindIII-EcoRV fragment encompassing the 5′ end of the vaccinia virus H6 promoter was inserted into the HindIII and EcoRV sites of pRW802 to form pRW830. A perfect 3′ end for NDV-HN was obtained by inserting the annealed and kinased oligonucleotides CE162 (SEQ ID NO:35) and CE163 (SEQ ID NO:36) into the EcoRI site of pRW830 to form pCE59, the final cassette for NDV-HN.
  • CE162:
    AATTCAGGATCGTTCCTTTACTAGTTGAGATTCTCAAGGATGATGGGATT
    TAATTTTTATAAGCTTG
    CE163:
    AATTCAAGCTTATAAAAATTAAATCCCATCATCCTTGAGAATCTCAACTA
    GTAAAGGAACGATCCTG
  • Construction of FPV Insertion Vector. Plasmid pRW731-15 contains a 10 kb PvuII-PvuII fragment cloned from genomic DNA. The nucleotide sequence was determined on both strands for a 3660 bp PvuII-EcoRV fragment and is shown in FIG. 11 (SEQ ID NO:67). The limits of an open reading frame designated here as F8 were determined. Plasmid pRW761 is a sub-clone of pRW731-15 containing a 2430 bp EcoRV-EcoRV fragment. The F8 ORF was entirely contained between an XbaI site and an SspI site in pRW761. In order to create an insertion plasmid which on recombination with TROVAC genomic DNA would eliminate the F8 ORF, the following steps were followed. Plasmid pRW761 was completely digested with XbaI and partially digested with SspI. A 3700 bp XbaI-SspI band was isolated from the gel and ligated with the annealed double-stranded oligonucleotides JCA017 (SEQ ID NO:37) and JCA018 (SEQ ID NO:38).
  • JCA017:
    5′ CTAGACACTTTATGTTTTTTAATATCCGGTCTTAAAAGCTTCCCGGG
    GATCCTTATACGGGGAATAAT
    JCA018:
    5′ ATTATTCCCCGTATAAGGATCCCCCGGGAAGCTTTTAAGACCGGATA
    TTAAAAAACATAAAGTGT

    The plasmid resulting from this ligation was designated pJCA002.
  • Construction of Double Insertion Vector for NDV F and HN. The H6 promoted NDV-HN sequence was inserted into the H6 promoted NDV-F cassette by cloning a HindIII fragment from pCE59 that had been filled in with Klenow fragment of E. coli DNA polymerase into the HpaI site of pCE71 to form pCE80. Plasmid pCE80 was completely digested with NdeI and partially digested with BglII to generate an NdeI-BglII 4760 bp fragment containing the NDV F and HN genes both driven by the H6 promoter and linked to F8 flanking arms. Plasmid pJCA021 was obtained by inserting a 4900 bp PvuII-HindIII fragment from pRW731-15 into the SmaI and HindIII sites of pBSSK+. Plasmid pJCA021 was then digested with NdeI and BglII and ligated to the 4760 bp NdeI-BglII fragment of pCE80 to form pJCA024. Plasmid pJCA024 therefore contains the NDV-F and HN genes inserted in opposite orientation with 3′ ends adjacent between FPV flanking arms. Both genes are linked to the vaccinia virus H6 promoter. The right flanking arm adjacent to the NDV-F sequence consists of 2350 bp of FPV sequence. The left flanking arm adjacent to the NDV-HN sequence consists of 1700 bp of FPV sequence.
  • Development of TROVAC-NDV. Plasmid pJCA024 was transfected into TROVAC infected primary CEF cells by using the calcium phosphate precipitation method previously described (Panicali et al., 1982; Piccini et al., 1987). Positive plaques were selected on the basis of hybridization to specific NDV-F and HN radiolabelled probes and subjected to five sequential rounds of plaque purification until a pure population was achieved. One representative plaque was then amplified and the resulting TROVAC recombinant was designated TROVAC-NDV (vFP96).
  • Immunofluorescence. Indirect immunofluorescence was performed as described (Taylor et al., 1990) using a polyclonal anti-NDV serum and, as mono-specific reagents, sera produced in rabbits against vaccinia virus recombinants expressing NDV-F or NDV-HN.
  • Immunoprecipitation. Immunoprecipitation reactions were performed as described (Taylor et al., 1990) using a polyclonal anti-NDV serum obtained from SPAFAS Inc., Storrs, Conn.
  • The stock virus was screened by in situ plaque hybridization to confirm that the F8 ORF was deleted. The correct insertion of the NDV genes into the TROVAC genome and the deletion of the F8 ORF was also confirmed by Southern blot hybridization.
  • In NDV-infected cells, the F glycoprotein is anchored in the membrane via a hydrophobic transmembrane region near the carboxyl terminus and requires post-translational cleavage of a precursor, F0, into two disulfide linked polypeptides F1 and F2. Cleavage of F0 is important in determining the pathogenicity of a given NDV strain (Homma and Ohuchi, 1973; Nagai et al., 1976; Nagai et al., 1980), and the sequence of amino acids at the cleavage site is therefore critical in determining viral virulence. It has been determined that amino acids at the cleavage site in the NDV-F sequence inserted into FPV to form recombinant vFP29 had the sequence Arg-Arg-Gln-Arg-Arg (SEQ ID NO: 149) (Taylor et al., 1990) which conforms to the sequence found to be a requirement for virulent NDV strains (Chambers et al., 1986; Espion et al., 1987; Le et al., 1988; McGinnes and Morrison, 1986; Toyoda et al., 1987). The HN glycoprotein synthesized in cells infected with virulent strains of NDV is an uncleaved glycoprotein of 74 kDa. Extremely avirulent strains such as Ulster and Queensland encode an HN precursor (HNo) which requires cleavage for activation (Garten et al., 1980).
  • The expression of F and HN genes in TROVAC-NDV was analyzed to confirm that the gene products were authentically processed and presented. Indirect-immunofluorescence using a polyclonal anti-NDV chicken serum confirmed that immunoreactive proteins were presented on the infected cell surface. To determine that both proteins were presented on the plasma membrane, mono-specific rabbit sera were produced against vaccinia recombinants expressing either the F or HN glycoproteins. Indirect immunofluorescence using these sera confirmed the surface presentation of both proteins.
  • Immunoprecipitation experiments were performed by using (35S) methionine labeled lysates of CEF cells infected with parental and recombinant viruses. The expected values of apparent molecular weights of the glycosylated forms of F1 and F2 are 54.7 and 10.3 kDa respectively (Chambers et al., 1986). In the immunoprecipitation experiments using a polyclonal anti-NDV serum, fusion specific products of the appropriate size were detected from the NDV-F single recombinant vFP29 (Taylor et al., 1990) and the TROVAC-NDV double recombinant vFP96. The HN glycoprotein of appropriate size was also detected from the NDV-HN single recombinant VFP-47 (Edbauer et al., 1990) and TROVAC-NDV. No NDV specific products were detected from uninfected and parental TROVAC infected CEF cells.
  • In CEF cells, the F and HN glycoproteins are appropriately presented on the infected cell surface where they are recognized by NDV immune serum. Immunoprecipitation analysis indicated that the F0 protein is authentically cleaved to the F1 and F2 components required in virulent strains. Similarly, the HN glycoprotein was authentically processed in CEF cells infected with recombinant TROVAC-NDV.
  • Previous reports (Taylor et al., 1990; Edbauer et al., 1990; Boursnell et al., 1990a,b,c; Ogawa et al., 1990) would indicate that expression of either HN or F alone is sufficient to elicit protective immunity against NDV challenge. Work on other paramyxoviruses has indicated, however, that antibody to both proteins may be required for full protective immunity. It has been demonstrated that SV5 virus could spread in tissue culture in the presence of antibody to the HN glycoprotein but not to the F glycoprotein (Merz et al., 1980). In addition, it has been suggested that vaccine failures with killed measles virus vaccines were due to inactivation of the fusion component (Norrby et al., 1975). Since both NDV glycoproteins have been shown to be responsible for eliciting virus neutralizing antibody (Avery et al., 1979) and both glycoproteins, when expressed individually in a fowlpox vector are able to induce a protective immune response, it can be appreciated that the most efficacious NDV vaccine should express both glycoproteins.
  • Example 9 Construction of ALVAC Recombinants Expressing Rabies Virus Glycoprotein G
  • This example describes the development of ALVAC, a canarypox virus vector and, of a canarypox-rabies recombinant designated as ALVAC-RG (vCP65) and its safety and efficacy.
  • Cells and Viruses. The parental canarypox virus (Rentschler strain) is a vaccinal strain for canaries. The vaccine strain was obtained from a wild type isolate and attenuated through more than 200 serial passages on chick embryo fibroblasts. A master viral seed was subjected to four successive plaque purifications under agar and one plaque clone was amplified through five additional passages after which the stock virus was used as the parental virus in in vitro recombination tests. The plaque purified canarypox isolate is designated ALVAC.
  • ALVAC was deposited under the terms of the Budapest Treaty with the American Type Culture Collection (ATCC), 12301 Parklawn Drive, Rockville, Md., 20852, USA: ALVAC under ATCC accession number VR-2547 on Nov. 14, 1996.
  • Construction of a Canarypox Insertion Vector. An 880 bp canarypox PvuII fragment was cloned between the PvuII sites of pUC9 to form pRW764.5. The sequence of this fragment is shown in FIG. 8 (SEQ ID NO:66) between positions 1372 and 2251. The limits of an open reading frame designated as C5 were defined. It was determined that the open reading frame was initiated at position 166 within the fragment and terminated at position 487. The C5 deletion was made without interruption of open reading frames. Bases from position 167 through position 455 were replaced with the sequence (SEQ ID NO:39) GCTTCCCGGGAATTCTAGCTAGCTAGTTT. This replacement sequence contains HindIII, SmaI and EcoRI insertion sites followed by translation stops and a transcription termination signal recognized by vaccinia virus RNA polymerase (Yuen et al., 1987). Deletion of the C5 ORF was performed as described below. Plasmid pRW764.5 was partially cut with RsaI and the linear product was isolated. The RsaI linear fragment was recut with BglII and the pRW764.5 fragment now with a RsaI to BglII deletion from position 156 to position 462 was isolated and used as a vector for the following synthetic oligonucleotides:
  • RW145 (SEQ ID NO: 40):
    ACTCTCAAAAGCTTCCCGGGAATTCTAGCTAGCTAGTTTTTATAAA
    RW146 (SEQ ID NO: 41):
    GATCTTTATAAAAACTAGCTAGCTAGAATTCCCGGGAAGCTTTTGAGAGT

    Oligonucleotides RW145 and RW146 were annealed and inserted into the pRW 764.5 RsaI and BglII vector described above. The resulting plasmid is designated pRW831.
  • Construction of Insertion Vector Containing the Rabies G Gene. Construction of pRW838 is illustrated below. Oligonucleotides A through E, which overlap the translation initiation codon of the H6 promoter with the ATG of rabies G, were cloned into pUC9 as pRW737. Oligonucleotides A through E contain the H6 promoter, starting at NruI, through the HindIII site of rabies G followed by BglII. Sequences of oligonucleotides A through E ((SEQ ID NO:42)-(SEQ ID NO:46)) are:
  • A (SEQ ID NO: 42):
    CTGAAATTATTTCATTATCGCGATATCCGTTAAGTTTGTATCGTAATGGT
    TCCTCAGGCTCTCCTGTTTGT
    B (SEQ ID NO: 43):
    CATTACGATACAAACTTAACGGATATCGCGATAATGAAATAATTTCAG
    C (SEQ ID NO: 44):
    ACCCCTTCTGGTTTTTCCGTTGTGTTTTGGGAAATTCCCTATTTACACGA
    TCCCAGACAAGCTTAGATCTCAG
    D (SEQ ID NO: 45):
    CTGAGATCTAAGCTTGTCTGGGATCGTGTAAATAGGGAATTTCCCAAAAC
    A
    E (SEQ ID NO: 46):
    CAACGGAAAAACCAGAAGGGGTACAAACAGGAGAGCCTGAGGAAC

    The diagram of annealed oligonucleotides A through E is as follows:
  • Figure US20080188640A1-20080807-C00001
  • Oligonucleotides A through E were kinased, annealed (95° C. for 5 minutes, then cooled to room temperature), and inserted between the PvuII sites of pUC9. The resulting plasmid, pRW737, was cut with HindIII and BglII and used as a vector for the 1.6 kbp HindIII-BglII fragment of ptg155PRO (Kieny et al., 1984) generating pRW739. The ptg155PRO HindIII site is 86 bp downstream of the rabies G translation initiation codon. BglII is downstream of the rabies G translation stop codon in ptg155PRO. pRW739 was partially cut with NruI, completely cut with BglII, and a 1.7 kbp NruI-BglII fragment, containing the 3′ end of the H6 promoter previously described (Taylor et al., 1988a,b; Guo et al., 1989; Perkus et al., 1989) through the entire rabies G gene, was inserted between the NruI and BamHI sites of pRW824. The resulting plasmid is designated pRW832. Insertion into pRW824 added the H6 promoter 5′ of NruI. The pRW824 sequence of BamHI followed by SmaI is (SEQ ID NO:47): GGATCCCCGGG. pRW824 is a plasmid that contains a nonpertinent gene linked precisely to the vaccinia virus H6 promoter. Digestion with NruI and BamHI completely excised this nonpertinent gene. The 1.8 kbp pRW832 SmaI fragment, containing H6 promoted rabies G, was inserted into the SmaI of pRW831, to form plasmid pRW838.
  • Development of ALVAC-RG. Plasmid pRW838 was transfected into ALVAC infected primary CEF cells by using the calcium phosphate precipitation method previously described (Panicali et al., 1982; Piccini et al., 1987). Positive plaques were selected on the basis of hybridization to a specific rabies G probe and subjected to 6 sequential rounds of plaque purification until a pure population was achieved. One representative plaque was then amplified and the resulting ALVAC recombinant was designated ALVAC-RG (vCP65) (see also FIGS. 9A and 9B). The correct insertion of the rabies G gene into the ALVAC genome without subsequent mutation was confirmed by sequence analysis.
  • Immunofluorescence. During the final stages of assembly of mature rabies virus particles, the glycoprotein component is transported from the golgi apparatus to the plasma membrane where it accumulates with the carboxy terminus extending into the cytoplasm and the bulk of the protein on the external surface of the cell membrane. In order to confirm that the rabies glycoprotein expressed in ALVAC-RG was correctly presented, immunofluorescence was performed on primary CEF cells infected with ALVAC or ALVAC-RG. Immunofluorescence was performed as previously described (Taylor et al., 1990) using a rabies G monoclonal antibody. Strong surface fluorescence was detected on CEF cells infected with ALVAC-RG but not with the parental ALVAC.
  • Immunoprecipitation. Preformed monolayers of primary CEF, Vero (a line of African Green monkey kidney cells ATCC # CCL81) and MRC-5 cells (a fibroblast-like cell line derived from normal human fetal lung tissue ATCC # CCL171) were inoculated at 10 pfu per cell with parental virus ALVAC and recombinant virus ALVAC-RG in the presence of radiolabelled 35S-methionine and treated as previously described (Taylor et al., 1990). Immunoprecipitation reactions were performed using a rabies G specific monoclonal antibody. Efficient expression of a rabies specific glycoprotein with a molecular weight of approximately 67 kDa was detected with the recombinant ALVAC-RG. No rabies specific products were detected in uninfected cells or cells infected with the parental ALVAC virus.
  • Sequential Passaging Experiment. In studies with ALVAC virus in a range of non-avian species no proliferative infection or overt disease was observed (Taylor et al., 1991b). However, in order to establish that neither the parental nor recombinant virus could be adapted to grow in non-avian cells, a sequential passaging experiment was performed.
  • The two viruses, ALVAC and ALVAC-RG, were inoculated in 10 sequential blind passages in three cell substrates:
      • (1) Primary chick embryo fibroblast (CEF) cells produced from 11 day old white leghorn embryos;
      • (2) Vero cells—a continuous line of African Green monkey kidney cells (ATCC # CCL81); and
      • (3) MRC-5 cells—a diploid cell line derived from human fetal lung tissue (ATCC # CCL171).
        The initial inoculation was performed at an m.o.i. of 0.1 pfu per cell using three 60 mm dishes of each cell substrate containing 2×106 cells per dish. One dish was inoculated in the presence of 40 μg/ml of Cytosine arabinoside (Ara C), an inhibitor of DNA replication. After an absorption period of 1 hour at 37° C., the inoculum was removed and the monolayer washed to remove unabsorbed virus. At this time the medium was replaced with 5 ml of EMEM+2% NBCS on two dishes (samples t0 and t7) and 5 ml of EMEM+2% NBCS containing 40 μg/ml Ara C on the third (sample t7A). Sample t0 was frozen at −70° C. to provide an indication of the residual input virus. Samples t7 and t7A were incubated at 37° C. for 7 days, after which time the contents were harvested and the cells disrupted by indirect sonication.
  • One ml of sample t7 of each cell substrate was inoculated undiluted onto three dishes of the same cell substrate (to provide samples t0, t7 and t7A) and onto one dish of primary CEF cells. Samples to, t7 and t7A were treated as for passage one. The additional inoculation on CEF cells was included to provide an amplification step for more sensitive detection of virus which might be present in the non-avian cells.
  • This procedure was repeated for 10 (CEF and MRC-5) or 8 (Vero) sequential blind passages. Samples were then frozen and thawed three times and assayed by titration on primary CEF monolayers.
  • Virus yield in each sample was then determined by plaque titration on CEF monolayers under agarose. Summarized results of the experiment are shown in Tables 1 and 2.
  • The results indicate that both the parental ALVAC and the recombinant ALVAC-RG are capable of sustained replication on CEF monolayers with no loss of titer. In Vero cells, levels of virus fell below the level of detection after 2 passages for ALVAC and 1 passage for ALVAC-RG. In MRC-5 cells, a similar result was evident, and no virus was detected after 1 passage. Although the results for only four passages are shown in Tables 1 and 2 the series was continued for 8 (Vero) and 10 (MRC-5) passages with no detectable adaptation of either virus to growth in the non-avian cells.
  • In passage 1 relatively high levels of virus were present in the t7 sample in MRC-5 and Vero cells. However this level of virus was equivalent to that seen in the t0 sample and the t7A sample incubated in the presence of Cytosine arabinoside in which no viral replication can occur. This demonstrated that the levels of virus seen at 7 days in non-avian cells represented residual virus and not newly replicated virus.
  • In order to make the assay more sensitive, a portion of the 7 day harvest from each cell substrate was inoculated onto a permissive CEF monolayer and harvested at cytopathic effect (CPE) or at 7 days if no CPE was evident. The results of this experiment are shown in Table 3. Even after amplification through a permissive cell substrate, virus was only detected in MRC-5 and Vero cells for two additional passages. These results indicated that under the conditions used, there was no adaptation of either virus to growth in Vero or MRC-5 cells.
  • Inoculation of Macaques. Four HIV seropositive macaques were initially inoculated with ALVAC-RG as described in Table 4. After 100 days these animals were re-inoculated to determine a booster effect, and an additional seven animals were inoculated with a range of doses. Blood was drawn at appropriate intervals and sera analyzed, after heat inactivation at 56° C. for 30 minutes, for the presence of anti-rabies antibody using the Rapid Fluorescent Focus Inhibition Assay (Smith et al., 1973).
  • Inoculation of Chimpanzees. Two adult male chimpanzees (50 to 65 kg weight range) were inoculated intramuscularly or subcutaneously with 1×107 pfu of vCP65. Animals were monitored for reactions and bled at regular intervals for analysis for the presence of anti-rabies antibody with the RFFI test (Smith et al., 1973). Animals were re-inoculated with an equivalent dose 13 weeks after the initial inoculation.
  • Inoculation of Mice. Groups of mice were inoculated with 50 to 100 μl of a range of dilutions of different batches of vCP65. Mice were inoculated in the footpad. On day 14, mice were challenged by intracranial inoculation of from 15 to 43 mouse LD50 of the virulent CVS strain of rabies virus. Survival of mice was monitored and a protective dose 50% (PD50) calculated at 28 days post-inoculation.
  • Inoculation of Dogs and Cats. Ten beagle dogs, 5 months old, and 10 cats, 4 months old, were inoculated subcutaneously with either 6.7 or 7.7 log10 TCID50 of ALVAC-RG. Four dogs and four cats were not inoculated. Animals were bled at 14 and 28 days post-inoculation and anti-rabies antibody assessed in an RFFI test. The animals receiving 6.7 log10 TCID50 of ALVAC-RG were challenged at 29 days post-vaccination with 3.7 log10 mouse LD50 (dogs) or 4.3 log10 mouse LD50 (cats) of the NYGS rabies virus challenge strain.
  • Inoculation of Squirrel Monkeys. Three groups of four squirrel monkeys (Saimiri sciureus) were inoculated with one of three viruses (a) ALVAC, the parental canarypox virus, (b) ALVAC-RG, the recombinant expressing the rabies G glycoprotein or (c) vCP37, a canarypox recombinant expressing the envelope glycoprotein of feline leukemia virus. Inoculations were performed under ketamine anaesthesia. Each animal received at the same time: (1) 20 μl instilled on the surface of the right eye without scarification; (2) 100 μl as several droplets in the mouth; (3) 100 μl in each of two intradermal injection sites in the shaven skin of the external face of the right arm; and (4) 100 μl in the anterior muscle of the right thigh.
  • Four monkeys were inoculated with each virus, two with a total of 5.0 log10 pfu and two with a total of 7.0 log10 pfu. Animals were bled at regular intervals and sera analyzed for the presence of antirabies antibody using an RFFI test (Smith et al., 1973). Animals were monitored daily for reactions to vaccination. Six months after the initial inoculation the four monkeys receiving ALVAC-RG, two monkeys initially receiving vCP37, and two monkeys initially receiving ALVAC, as well as one naive monkey were inoculated with 6.5 log10 pfu of ALVAC-RG subcutaneously. Sera were monitored for the presence of rabies neutralizing antibody in an RFFI test (Smith et al., 1973).
  • Inoculation of Human Cell Lines with ALVAC-RG. In order to determine whether efficient expression of a foreign gene could be obtained in non-avian cells in which the virus does not productively replicate, five cell types, one avian and four non-avian, were analyzed for virus yield, expression of the foreign rabies G gene and viral specific DNA accumulation. The cells inoculated were:
      • (a) Vero, African Green monkey kidney cells, ATCC # CCL81;
      • (b) MRC-5, human embryonic lung, ATCC # CCL 171;
      • (c) WISH human amnion, ATCC # CCL 25;
      • (d) Detroit-532, human foreskin, Downs's syndrome, ATCC # CCL 54; and
      • (e) Primary CEF cells.
  • Chicken embryo fibroblast cells produced from 11 day old white leghorn embryos were included as a positive control. All inoculations were performed on preformed monolayers of 2×106 cells as discussed below.
  • A. Methods for DNA Analysis.
      • Three dishes of each cell line were inoculated at 5 pfu/cell of the virus under test, allowing one extra dish of each cell line un-inoculated. One dish was incubated in the presence of 40 μg/ml of cytosine arabinoside (Ara C). After an adsorption period of 60 minutes at 37° C., the inoculum was removed and the monolayer washed twice to remove unadsorbed virus. Medium (with or without Ara C) was then replaced. Cells from one dish (without Ara C) were harvested as a time zero sample. The remaining dishes were incubated at 37° C. for 72 hours, at which time the cells were harvested and used to analyze DNA accumulation. Each sample of 2×106 cells was resuspended in 0.5 ml phosphate buffered saline (PBS) containing 40 mM EDTA and incubated for 5 minutes at 37° C. An equal volume of 1.5% agarose prewarmed at 42° C. and containing 120 mM EDTA was added to the cell suspension and gently mixed. The suspension was transferred to an agarose plug mold and allowed to harden for at least 15 min. The agarose plugs were then removed and incubated for 12-16 hours at 50° C. in a volume of lysis buffer (1% sarkosyl, 100 μg/ml proteinase K, 10 mM Tris HCl pH 7.5, 200 mM EDTA) that completely covers the plug. The lysis buffer was then replaced with 5.0 ml sterile 0.5×TBE (44.5 mM Tris-borate, 44.5 mM boric acid, 0.5 mM EDTA) and equilibrated at 4° C. for 6 hours with 3 changes of TBE buffer. The viral DNA within the plug was fractionated from cellular RNA and DNA using a pulse field electrophoresis system. Electrophoresis was performed for 20 hours at 180 V with a ramp of 50-90 sec at 15° C. in 0.5×TBE. The DNA was run with lambda DNA molecular weight standards. After electrophoresis the viral DNA band was visualized by staining with ethidium bromide. The DNA was then transferred to a nitrocellulose membrane and probed with a radiolabelled probe prepared from purified ALVAC genomic DNA.
    B. Estimation of Virus Yield.
      • Dishes were inoculated exactly as described above, with the exception that input multiplicity was 0.1 pfu/cell. At 72 hours post infection, cells were lysed by three successive cycles of freezing and thawing. Virus yield was assessed by plaque titration on CEF monolayers.
    C. Analysis of Expression of Rabies G Gene.
      • Dishes were inoculated with recombinant or parental virus at a multiplicity of 10 pfu/cell, allowing an additional dish as an uninfected virus control. After a one hour absorption period, the medium was removed and replaced with methionine free medium. After a 30 minute period, this medium was replaced with methionine-free medium containing 25 uCi/ml of 35S-Methionine. Infected cells were labelled overnight (approximately 16 hours), then lysed by the addition of buffer A lysis buffer. Immunoprecipitation was performed as previously described (Taylor et al., 1990) using a rabies G specific monoclonal antibody.
  • Results: Estimation of Viral Yield. The results of titration for yield at 72 hours after inoculation at. 0.1 pfu per cell are shown in Table 5. The results indicate that while a productive infection can be attained in the avian cells, no increase in virus yield can be detected by this method in the four non-avian cell systems.
  • Analysis of Viral DNA Accumulation. In order to determine whether the block to productive viral replication in the non-avian cells occurred before or after DNA replication, DNA from the cell lysates was fractionated by electrophoresis, transferred to nitrocellulose and probed for the presence of viral specific DNA. DNA from uninfected CEF cells, ALVAC-RG infected CEF cells at time zero, ALVAC-RG infected CEF cells at 72 hours post-infection and ALVAC-RG infected CEF cells at 72 hours post-infection in the presence of 40 pg/ml of cytosine arabinoside all showed some background activity, probably due to contaminating CEF cellular DNA in the radiolabelled ALVAC DNA probe preparation. However, ALVAC-RG infected CEF cells at 72 hours post-infection exhibited a strong band in the region of approximately 350 kbp representing ALVAC-specific viral DNA accumulation. No such band is detectable when the culture is incubated in the presence of the DNA synthesis inhibitor, cytosine arabinoside. Equivalent samples produced in Vero cells showed a very faint band at approximately 350 kbp in the ALVAC-RG infected Vero cells at time zero. This level represented residual virus. The intensity of the band was amplified at 72 hours post-infection indicating that some level of viral specific DNA replication had occurred in Vero cells which had not resulted in an increase in viral progeny. Equivalent samples produced in MRC-5 cells indicated that no viral specific DNA accumulation was detected under these conditions in this cell line. This experiment was then extended to include additional human cell lines, specifically WISH and Detroit-532 cells. ALVAC infected CEF cells served as a positive control. No viral specific DNA accumulation was detected in either WISH or Detroit cells inoculated with ALVAC-RG. It should be noted that the limits of detection of this method have not been fully ascertained and viral DNA accumulation may be occurring, but at a level below the sensitivity of the method. Other experiments in which viral DNA replication was measured by 3H-thymidine incorporation support the results obtained with Vero and MRC-5 cells.
  • Analysis of Rabies Gene Expression. To determine if any viral gene expression, particularly that of the inserted foreign gene, was occurring in the human cell lines even in the absence of viral DNA replication, immunoprecipitation experiments were performed on 35S-methionine labelled lysates of avian and non-avian cells infected with ALVAC and ALVAC-RG. The results of immunoprecipitation using a rabies G specific monoclonal antibody illustrated specific immunoprecipitation of a 67 kDa glycoprotein in CEF, Vero and MRC-5, WISH and Detroit cells infected with ALVAC-RG. No such specific rabies gene products were detected in any of the uninfected and parentally infected cell lysates.
  • The results of this experiment indicated that in the human cell lines analyzed, although the ALVAC-RG recombinant was able to initiate an infection and express a foreign gene product under the transcriptional control of the H6 early/late vaccinia virus promoter, the replication did not proceed through DNA replication, nor was there any detectable viral progeny produced. In the Vero cells, although some level of ALVAC-RG specific DNA accumulation was observed, no viral progeny was detected by these methods. These results would indicate that in the human cell lines analyzed the block to viral replication occurs prior to the onset of DNA replication, while in Vero cells, the block occurs following the onset of viral DNA replication.
  • In order to determine whether the rabies glycoprotein expressed in ALVAC-RG was immunogenic, a number of animal species were tested by inoculation of the recombinant. The efficacy of current rabies vaccines is evaluated in a mouse model system. A similar test was therefore performed using ALVAC-RG. Nine different preparations of virus (including one vaccine batch (J) produced after 10 serial tissue culture passages of the seed virus) with infectious titers ranging from 6.7 to 8.4 log10 TCID50 per ml were serially diluted and 50 to 100 μl of dilutions inoculated into the footpad of four to six week old mice. Mice were challenged 14 days later by the intracranial route with 300 μl of the CVS strain of rabies virus containing from 15 to 43 mouse LD50 as determined by lethality titration in a control group of mice. Potency, expressed as the PD50 (Protective dose 50%), was calculated at 14 days post-challenge. The results of the experiment are shown in Table 6. The results indicated that ALVAC-RG was consistently able to protect mice against rabies virus challenge with a PD50 value ranging from 3.33 to 4.56 with a mean value of 3.73 (STD 0.48). As an extension of this study, male mice were inoculated intracranially with 50 μl of virus containing 6.0 log10 TCID50 of ALVAC-RG or with an equivalent volume of an uninfected cell suspension. Mice were sacrificed on days 1, 3 and 6 post-inoculation and their brains removed, fixed and sectioned. Histopathological examination showed no evidence for neurovirulence of ALVAC-RG in mice.
  • In order to evaluate the safety and efficacy of ALVAC-RG for dogs and cats, a group of 14, 5 month old beagles and 14, 4 month old cats were analyzed. Four animals in each species were not vaccinated. Five animals received 6.7 log10 TCID50 subcutaneously and five animals received 7.7 log10 TCID50 by the same route. Animals were bled for analysis for anti-rabies antibody. Animals receiving no inoculation or 6.7 log10 TCID50 of ALVAC-RG were challenged at 29 days post-vaccination with 3.7 log10 mouse LD50 (dogs, in the temporal muscle) or 4.3 log10 mouse LD50 (cats, in the neck) of the NYGS rabies virus challenge strain. The results of the experiment are shown in Table 7.
  • No adverse reactions to inoculation were seen in either cats or dogs with either dose of inoculum virus. Four of 5 dogs immunized with 6.7 log10 TCID50 had antibody titers on day 14 post-vaccination and all dogs had titers at 29 days. All dogs were protected from a challenge which killed three out of four controls. In cats, three of five cats receiving 6.7 log10 TCID50 had specific antibody titers on day 14 and all cats were positive on day 29 although the mean antibody titer was low at 2.9 IU. Three of five cats survived a challenge which killed all controls. All cats immunized with 7.7 log10 TCID50 had antibody titers on day 14 and at day 29 the Geometric Mean Titer was calculated as 8.1 International Units.
  • The immune response of squirrel monkeys (Saimiri sciureus) to inoculation with ALVAC, ALVAC-RG and an unrelated canarypox virus recombinant was examined. Groups of monkeys were inoculated as described above and sera analyzed for the presence of rabies specific antibody. Apart from minor typical skin reactions to inoculation by the intradermal route, no adverse reactivity was seen in any of the monkeys. Small amounts of residual virus were isolated from skin lesions after intradermal inoculation on days two and four post-inoculation only. All specimens were negative on day seven and later. There was no local reaction to intra-muscular injection. All four monkeys inoculated with ALVAC-RG developed anti-rabies serum neutralizing antibodies as measured in an RFFI test. Approximately six months after the initial inoculation all monkeys and one additional naive monkey were re-inoculated by the subcutaneous route on the external face of the left thigh with 6.5 log10 TCID50 of ALVAC-RG. Sera were analyzed for the presence of anti-rabies antibody. The results are shown in Table 8.
  • Four of the five monkeys naive to rabies developed a serological response by seven days post-inoculation with ALVAC-RG. All five monkeys had detectable antibody by 11 days post-inoculation. Of the four monkeys with previous exposure to the rabies glycoprotein, all showed a significant increase in serum neutralization titer between days 3 and 7 post-vaccination. The results indicate that vaccination of squirrel monkeys with ALVAC-RG does not produce adverse side-effects and a primary neutralizing antibody response can be induced. An anamnestic response is also induced on re-vaccination. Prior exposure to ALVAC or to a canarypox recombinant expressing an unrelated foreign gene does not interfere with induction of an anti-rabies immune response upon re-vaccination.
  • The immunological response of HIV-2 seropositive macaques to inoculation with ALVAC-RG was assessed. Animals were inoculated as described above and the presence of anti-rabies serum neutralizing antibody assessed in an RFFI test. The results, shown in Table 9, indicated that HIV-2 positive animals inoculated by the subcutaneous route developed anti-rabies antibody by 11 days after one inoculation. An anamnestic response was detected after a booster inoculation given approximately three months after the first inoculation. No response was detected in animals receiving the recombinant by the oral route. In addition, a series of six animals were inoculated with decreasing doses of ALVAC-RG given by either the intra-muscular or subcutaneous routes. Five of the six animals inoculated responded by 14 days post-vaccination with no significant difference in antibody titer.
  • Two chimpanzees with prior exposure to HIV were inoculated with 7.0 log10 pfu of ALVAC-RG by the subcutaneous or intra-muscular route. At 3 months post-inoculations both animals were re-vaccinated in an identical fashion. The results are shown in Table 10.
  • No adverse reactivity to inoculation was noted by either intramuscular or subcutaneous routes. Both chimpanzees responded to primary inoculation by 14 days and a strongly rising response was detected following re-vaccination.
  • TABLE 1
    Sequential Passage of ALVAC in Avian and non-Avian Cells.
    CEF Vero MRC5
    Pass
    1
    Sample toa 2.4 3.0 2.6
    t7b 7.0 1.4 0.4
    t7Ac 1.2 1.2 0.4
    Pass 2
    Sample to 5.0 0.4  N.D.d
    t7 7.3 0.4 N.D.
    t7A 3.9 N.D. N.D.
    Pass 3
    Sample to 5.4 0.4 N.D.
    t7 7.4 N.D. N.D.
    t7A 3.8 N.D. N.D.
    Pass 4
    Sample to 5.2 N.D. N.D.
    t7 7.1 N.D. N.D.
    t7A 3.9 N.D. N.D.
    aThis sample was harvested at zero time and represents the residual input virus. The titer is expressed as log10 pfu per ml.
    bThis sample was harvested at 7 days post-infection.
    cThis sample was inoculated in the presence of 40 μg/ml of Cytosine arabinoside and harvested at 7 days post infection.
    dNot detectable
  • TABLE 2
    Sequential Passage of ALVAC-RG in Avian and non-Avian Cells
    CEF Vero MRC-5
    Pass 1
    Sample t0a 3.0 2.9 2.9
    t7b 7.1 1.0 1.4
    t7Ac 1.8 1.4 1.2
    Pass 2
    Sample t0 5.1 0.4 0.4
    t7 7.1  N.D.d N.D.
    t7A 3.8 N.D. N.D.
    Pass 3
    Sample t0 5.1 0.4 N.D.
    t7 7.2 N.D. N.D.
    t7A 3.6 N.D. N.D.
    Pass 4
    Sample t0 5.1 N.D. N.D.
    t7 7.0 N.D. N.D.
    t7A 4.0 N.D. N.D
    aThis sample was harvested at zero time and represents the residual input virus. The titer is expressed as log10 pfu per ml.
    bThis sample was harvested at 7 days post-infection.
    cThis sample was inoculated in the presence of 40 μg/ml of Cytosine arabinoside and harvested at 7 days post-infection.
    dNot detectable.
  • TABLE 3
    Amplification of residual virus by passage in CEF cells
    CEF Vero MRC-5
    a) ALVAC
    Pass
    2a  7.0b 6.0 5.2
    3 7.5 4.1 4.9
    4 7.5  N.D.c N.D.
    5 7.1 N.D. N.D.
    b) ALVAC-RG
    Pass
    2a 7.2 5.5 5.5
    3 7.2 5.0 5.1
    4 7.2 N.D. N.D.
    5 7.2 N.D. N.D.
    a Pass 2 represents the amplification in CEF cells of the 7 day sample from Pass 1.
    bTiter expressed as log10 pfu per ml
    cNot Detectable
  • TABLE 4
    Schedule of inoculation of rhesus
    macaques with ALVAC-RG (vCP65)
    Animal Inoculation
    176L Primary: 1 × 108 pfu of vCP65 orally in TANG
    Secondary: 1 × 107 pfu of vCP65 plus 1 × 107
    pfu of vCP82a by SC route
    185 L Primary: 1 × 108 pfu of vCP65 orally in Tang
    Secondary: 1 × 107 pfu of vCP65 plus 1 × 107
    pfu of vCP82 by SC route
    177 L Primary: 5 × 107 pfu SC of vCP65 by SC route
    Secondary: 1 × 107 pfu of vCP65 plus 1 × 107
    pfu of vCP82 by SC route
    186L Primary: 5 × 107 pfu of vCP65 by SC route
    Secondary: 1 × 107 pfu of vCP65 plus 1 × 107
    pfu of vCP82 by SC route
    178L Primary: 1 × 107 pfu of vCP65 by SC route
    182L Primary: 1 × 107 pfu of VCP65 by IM route
    179L Primary: 1 × 106 pfu of vCP65 by SC route
    183L Primary: 1 × 106 pfu of vCP65 by IM route
    180L Primary: 1 × 106 pfu of vCP65 by SC route
    184L Primary: 1 × 105 pfu of vCP65 by IM route
    187L Primary
    1 × 107 pfu of vCP65 orally
    avCP82 is a canarypox virus recombinant expressing the measles virus fusion and hemagglutinin genes.
  • TABLE 5
    Analysis of yield in avian and non-avian
    cells inoculated with ALVAC-RG
    Sample Time
    Cell Type t0 t72 t72Ab
    Expt 1
    CEF  3.3a 7.4 1.7
    Vero 3.0 1.4 1.7
    MRC-5 3.4 2.0 1.7
    Expt 2
    CEF 2.9 7.5 <1.7
    WISH 3.3 2.2 2.0
    Detroit-532 2.8 1.7 <1.7
    aTiter expressed as log10 pfu per ml
    bCulture incubated in the presence of 40 μg/ml of Cytosine arabinoside
  • TABLE 6
    Potency of ALVAC-RG as tested in mice
    Test Challenge Dosea PD50 b
    Initial seed 43 4.56
    Primary seed 23 3.34
    Vaccine Batch H 23 4.52
    Vaccine Batch I 23 3.33
    Vaccine Batch K 15 3.64
    Vaccine Batch L 15 4.03
    Vaccine Batch M 15 3.32
    Vaccine Batch N 15 3.39
    Vaccine Batch J 23 3.42
    aExpressed as mouse LD50
    bExpressed as log10 TCID50
  • TABLE 7
    Efficacy of ALVAC-RG in dogs and cats
    Dogs Cats
    Dose Antibodya Survivalb Antibody Survival
    6.7 11.9 5/5 2.9 3/5
    7.7 10.1 N.T. 8.1 N.T.
    aAntibody at day 29 post inoculation expressed as the geometric mean titer in International Units.
    bExpressed as a ratio of survivors over animals challenged
  • TABLE 8
    Anti-rabies serological response of Squirrel monkeys
    inoculated with canarypox recombinants
    Monkey Previous Rabies serum-neutralizing antibodya
    # Exposure −196b 0 3 7 11 21 28
    22 ALVACc  NTg <1.2 <1.2 <1.2 2.1 2.3 2.2
    51 ALVACc NT <1.2 <1.2 1.7 2.2 2.2 2.2
    39 vCP37d NT <1.2 <1.2 1.7 2.1 2.2 N.T.g
    55 vCP37d NT <1.2 <1.2 1.7 2.2 2.1 N.T. 
    37 ALVAC-RGe 2.2 <1.2 <1.2 3.2 3.5 3.5 3.2
    53 ALVAC-RGe 2.2 <1.2 <1.2 3.6 3.6 3.6 3.4
    38 ALVAC-RGf 2.7 <1.7 <1.7 3.2 3.8 3.6 N.T. 
    54 ALVAC-RGf 3.2 <1.7 <1.5 3.6 4.2 4.0 3.6
    57 None NT <1.2 <1.2 1.7 2.7 2.7 2.3
    aAs determined by RFFI test on days indicated and expressed in International Units
    bDay −196 represents serum from day 28 after primary vaccination
    cAnimals received 5.0 log10 TCID50 of ALVAC
    dAnimals received 5.0 log10 TCID50 of vCP37
    eAnimals received 5.0 log10 TCID50 of ALVAC-RG
    fAnimals received 7.0 log10 TCID50 of ALVAC-RG
    gNot tested.
  • TABLE 9
    Inoculation of rhesus macaques with ALVAC-RGa
    Route of Primary Inoculation
    Days post- or/Tang SC SC SC IM SC IM SC IM OR
    Inoculation 176Lb 185L 177L 186L 178L 182L 179L 183L 180L 184L 187Lb
    −84  — — —
    −9 — — — — — —
     3 — — — —
     6 — — ± ±
    11 — —  16d 128
    19 — — 32 128 — —
    35 — — 32 512
    59 — — 64 256
    75 — — 64 128 — —
     99c — — 64 256 — — — — — —
     2 — — 32 256 — — — — — — —
     6 — — 512  512 — — — — — — —
    15 16 16 512  512 64 32 64 128 32 — —
    29 16 32 256  256 64 64 32 128 32 — —
    55 32 32 32 16 —
    57 16 128  128 16 16 —
    aSee Table 9 for schedule of inoculations.
    bAnimals 176L and 185L received 8.0 log10 pfu by the oral route in 5 ml Tang. Animal 187L received 7.0 log10 pfu by oral route not in Tang.
    cDay of re-vaccination for animals 176L, 185L, 177L and 186L by S.C. route, and primary vaccination for animals 178L, 182L, 179L, 183L, 180L, 184L and 187L.
    dTiters expressed as reciprocal of last dilution showing inhibition of fluorescence in an RFFI test.
  • TABLE 10
    Inoculation of chimpanzees with ALVAC-RG
    Weeks post- Animal 431 Animal 457
    Inoculation I.M. S.C.
    0  <8a <8
    1 <8 <8
    2  8 32
    4 16 32
    8 16 32
    12b/0  16 8
    13/1 128  128
    15/3 256  512
    20/8 64 128
     26/12 32 128
    aTiter expressed as reciprocal of last dilution showing inhibition of fluorescence in an RFFI test
    bDay of re-inoculation
  • Example 10 Immunization of Humans Using Canarypox Expressing Rabies Glycoprotein (ALVAC-RG; vCP65)
  • ALVAC-RG (vCP65) was Generated as Described in Example 9 and FIGS. 9A and 9B. For scaling-up and vaccine manufacturing ALVAC-RG (vCP65) was grown in primary CEF derived from specified pathogen free eggs. Cells were infected at a multiplicity of 0.1 and incubated at 37° C. for three days.
  • The vaccine virus suspension was obtained by ultrasonic disruption in serum free medium of the infected cells; cell debris were then removed by centrifugation and filtration. The resulting clarified suspension was supplemented with lyophilization stabilizer (mixture of amino-acids), dispensed in single dose vials and freeze dried. Three batches of decreasing titer were prepared by ten-fold serial dilutions of the virus suspension in a mixture of serum free medium and lyophilization stabilizer, prior to lyophilization.
  • Quality control tests were applied to the cell substrates, media and virus seeds and final product with emphasis on the search for adventitious agents and inocuity in laboratory rodents. No undesirable trait was found.
  • Preclinical data. Studies in vitro indicated that VERO or MRC-5 cells do not support the growth of ALVAC-RG (vCP65); a series of eight (VERO) and 10 (MRC) blind serial passages caused no detectable adaptation of the virus to grow in these non avian lines. Analyses of human cell lines (MRC-5, WISH, Detroit 532, HEL, HNK or EBV-transformed lymphoblastoid cells) infected or inoculated with ALVAC-RG (vCP65) showed no accumulation of virus specific DNA suggesting that in these cells the block in replication occurs prior to DNA synthesis. Significantly, however, the expression of the rabies virus glycoprotein gene in all cell lines tested indicating that the abortive step in the canarypox replication cycle occurs prior to viral DNA replication.
  • The safety and efficacy of ALVAC-RG (vCP65) were documented in a series of experiments in animals. A number of species including canaries, chickens, ducks, geese, laboratory rodents (suckling and adult mice), hamsters, guinea-pigs, rabbits, cats and dogs, squirrel monkeys, rhesus macaques and chimpanzees, were inoculated with doses ranging from 105 to 108 pfu. A variety of routes were used, most commonly subcutaneous, intramuscular and intradermal but also oral (monkeys and mice) and intracerebral (mice).
  • In canaries, ALVAC-RG (vCP65) caused a “take” lesion at the site of scarification with no indication of disease or death. Intradermal inoculation of rabbits resulted in a typical poxvirus inoculation reaction which did not spread and healed in seven to ten days. There was no adverse side effects due to canarypox in any of the animal tests. Immunogenicity was documented by the development of anti-rabies antibodies following inoculation of ALVAC-RG (vCP65) in rodents, dogs, cats, and primates, as measured by Rapid Fluorescent Focus Inhibition Test (RFFIT). Protection was also demonstrated by rabies virus challenge experiments in mice, dogs, and cats immunized with ALVAC-RG (vCP65).
  • Volunteers. Twenty-five healthy adults aged 20-45 with no previous history of rabies immunization were enrolled. Their health status was assessed by complete medical histories, physical examinations, hematological and blood chemistry analyses. Exclusion criteria included pregnancy, allergies, immune depression of any kind, chronic debilitating disease, cancer, injection of immunoglobins in the past three months, and seropositivity to human immunodeficiency virus (HIV) or to hepatitis B virus surface antigen.
  • Study design. Participants were randomly allocated to receive either standard Human Diploid Cell Rabies Vaccine (HDC) batch no E0751 (Pasteur Merieux Serums & Vaccine, Lyon, France) or the study vaccine ALVAC-RG (vCP65).
  • The trial was designated as a dose escalation study. Three batches of experimental ALVAC-RG (vCP65) vaccine were used sequentially in three groups of volunteers (Groups A, B and C) with two week intervals between each step. The concentration of the three batches was 103.5, 104.5, 105.5 Tissue Culture Infectious Dose (TCID50) per dose, respectively.
  • Each volunteer received two doses of the same vaccine subcutaneously in the deltoid region at an interval of four weeks. The nature of the injected vaccine was not known by the participants at the time of the first injection but was known by the investigator.
  • In order to minimize the risk of immediate hypersensitivity at the time of the second injection, the volunteers of Group B allocated to the medium dose of experimental vaccine were injected 1 h previously with the lower dose and those allocated to the higher dose (Group C) received successively the lower and the medium dose at hourly intervals.
  • Six months later, the recipients of the highest dosage of ALVAC-RG (vCP65) (Group C) and HDC vaccine were offered a third dose of vaccine; they were then randomized to receive either the same vaccine as previously or the alternate vaccine. As a result, four groups were formed corresponding to the following immunization scheme: 1. HDC, HDC-HDC; 2. HDC, HDC-ALVAC-RG (vCP65); 3. ALVAC-RG (vCP65), ALVAC-RG (vCP65)-HDC; 4. ALVAC-RG (vCP65), ALVAC-RG (vCP65), ALVAC-RG (vCP65).
  • Monitoring of Side Effects. All subjects were monitored for 1 h after injection and re-examined every day for the next five days. They were asked to record local and systemic reactions for the next three weeks and were questioned by telephone two times a week.
  • Laboratory Investigators. Blood specimens were obtained before enrollment and two, four and six days after each injection. Analysis included complete blood cell count, liver enzymes and creatine kinase assays.
  • Antibody assays. Antibody assays were performed seven days prior to the first injection and at days 7, 28, 35, 56, 173, 187 and 208 of the study.
  • The levels of neutralizing antibodies to rabies were determined using the Rapid Fluorescent Focus Inhibition test (RFFIT) (Smith et al., 1973). Canarypox antibodies were measured by direct ELISA. The antigen, a suspension of purified canarypox virus disrupted with 0.1% Triton X100, was coated in microplates. Fixed dilutions of the sera were reacted for two hours at room temperature and reacting antibodies were revealed with a peroxidase labelled anti-human IgG goat serum. The results are expressed as the optical density read at 490 nm.
  • Analysis. Twenty-five subjects were enrolled and completed the study. There were 10 males and 15 females and the mean age was 31.9 (21 to 48). All but three subjects had evidence of previous smallpox vaccination; the three remaining subjects had no typical scar and vaccination history. Three subjects received each of the lower doses of experimental vaccine (103.5 and 104.5 TCID50), nine subjects received 105.5 TCID50 and ten received the HDC vaccine.
  • Safety (Table 11). During the primary series of immunization, fever greater than 37.7° C. was noted within 24 hours after injection in one HDC recipient (37.8° C.) and in one vCP65 105.5 TCID50 recipient (38° C.). No other systemic reaction attributable to vaccination was observed in any participant.
  • Local reactions were noted in 9/10 recipients of HDC vaccine injected subcutaneously and in 0/3, 1/3 and 9/9 recipients of vCP65 103.5, 104.5, 105.5 TCID50, respectively.
  • Tenderness was the most common symptoms and was always mild. Other local symptoms included redness and induration which were also mild and transient. All symptoms usually subsided within 24 hours and never lasted more than 72 hours.
  • There was no significant change in blood cell counts, liver enzymes or creatine kinase values.
  • Immune Responses; Neutralizing Antibodies to Rabies (Table 12). Twenty eight days after the first injection all the HDC recipients had protective titers (≧0.5 IU/ml). By contrast none in groups A and B (103.5 and 104.5 TCID50) and only 2/9 in group C (105.5 TCID50) ALVAC-RG (vCP65) recipients reached this protective titer.
  • At day 56 (i.e. 28 days after the second injection) protective titers were achieved in 0/3 of Group A, 2/3 of Group B and 9/9 of Group C recipients of ALVAC-RG (vCP65) vaccine and persisted in all 10 HDC recipients.
  • At day 56 the geometric mean titers were 0.05, 0.47, 4.4 and 11.5 IU/ml in groups A, B, C and HDC respectively.
  • At day 180, the rabies antibody titers had substantially decreased in all subjects but remained above the minimum protective titer of 0.5 IU/ml in 5/10 HCD recipients and in 5/9 ALVAC-RG (vCP65) recipients; the geometric mean titers were 0.51 and 0.45 IU/ml in groups HCD and C, respectively.
  • Antibodies to the Canarypox virus (Table 13). The pre-immune titers observed varied widely with titers varying from 0.22 to 1.23 O.D. units despite the absence of any previous contact with canary birds in those subjects with the highest titers. When defined as a greater than two-fold increase between preimmunization and post second injection titers, a seroconversion was obtained in 1/3 subjects in group B and in 9/9 subjects in group C whereas no subject seroconverted in groups A or HDC.
  • Booster Injection. The vaccine was similarly well tolerated six months later, at the time of the booster injection: fever was noted in 2/9 HDC booster recipients and in 1/10 ALVAC-RG (vCP65) booster recipients. Local reactions were present in 5/9 recipients of HDC booster and in 6/10 recipients of the ALVAC-RG (vCP65) booster.
  • Observations. FIGS. 13A-13D show graphs of rabies neutralizing antibody titers (Rapid Fluorescent Focus Inhibition Test or RFFIT, IU/ml): Booster effect of HDC and vCP65 (105.5 TCID50) in volunteers previously immunized with either the same or the alternate vaccine. Vaccines were given at days 0, 28 and 180. Antibody titers were measured at days 0, 7, 28, 35, 56, 173, and 187 and 208.
  • As shown in FIGS. 13A to 13D, the booster dose given resulted in a further increase in rabies antibody titers in every subject whatever the immunization scheme. However, the ALVAC-RG (vCP65) booster globally elicited lower immune responses than the HDC booster and the ALVAC-RG (vCP65), ALVAC-RG (vCP65)-ALVAC-RG (vCP65) group had significantly lower titers than the three other groups. Similarly, the ALVAC-RG (vCP65) booster injection resulted in an increase in canarypox antibody titers in 3/5 subjects who had previously received the HDC vaccine and in all five subjects previously immunized with ALVAC-RG (vCP65).
  • In general, none of the local side effects from administration of vCP65 was indicative of a local replication of the virus. In particular, lesions of the skin such as those observed after injection of vaccine were absent. In spite of the apparent absence of replication of the virus, the injection resulted in the volunteers generating significant amounts of antibodies to both the canarypox vector and to the expressed rabies glycoprotein.
  • Rabies neutralizing antibodies were assayed with the Rapid Fluorescent Focus Inhibition Test (RFFIT) which is known to correlate well with the sero neutralization test in mice. Of 9 recipients of 105.5TCID50, five had low level responses after the first dose. Protective titers of rabies antibodies were obtained after the second injection in all recipients of the highest dose tested and even in 2 of the 3 recipients of the medium dose. In this study, both vaccines were given subcutaneously as usually recommended for live vaccines, but not for the inactivated HDC vaccine. This route of injection was selected as it best allowed a careful examination of the injection site, but this could explain the late appearance of antibodies in HDC recipients: indeed, none of the HDC recipients had an antibody increase at day 7, whereas, in most studies where HDC vaccine is give intramuscularly a significant proportion of subjects do (Klietmann et al., Int'l Green Cross—Geneva, 1981; Kuwert et al., Int'l Green Cross—Geneva, 1981). However, this invention is not necessarily limited to the subcutaneous route of administration.
  • The GMT (geometric mean titers) of rabies neutralizing antibodies was lower with the investigational vaccine than with the HDC control vaccine, but still well above the minimum titer required for protection. The clear dose effect response obtained with the three dosages used in this study suggest that a higher dosage might induce a stronger response. Certainly from this disclosure the skilled artisan can select an appropriate dosage for a given patient.
  • The ability to boost the antibody response is another important result of this Example; indeed, an increase in rabies antibody titers was obtained in every subject after the 6 month dose whatever the immunization scheme, showing that preexisting immunity elicited by either the canarypox vector or the rabies glycoprotein had no blocking effect on the booster with the recombinant vaccine candidate or the conventional HDC rabies vaccine. This contrasts findings of others with vaccinia recombinants in humans that immune response may be blocked by pre-existing immunity (Cooney et al.; Etinger et al.).
  • Thus, this Example clearly demonstrates that a non-replicating poxvirus can serve as an immunizing vector in humans, with all of the advantages that replicating agents confer on the immune response, but without the safety problem created by a fully permissive virus.
  • TABLE 11
    Reactions in the 5 days following vaccination
    vCP65 dosage H D C
    (TCID50) 103.5 104.5 105.5 control
    Injection 1st 2nd 1st 2nd 1st 2nd 1st 2nd
    No. vaccinees
    3 3 3 3 9 9 10 10
    temp >37.7° C. 0 0 0 0 0 1 1 0
    soreness 0 0 1 1 6 8 8 6
    redness 0 0 0 0 0 4 5 4
    induration 0 0 0 0 0 4 5 4
  • TABLE 12
    Rabies neutralizing antibodies (REFIT; IU/ml)
    Individual titers and geometric mean titers (GMT)
    Days
    No. TCID50/dose 0 7 28 35 56
    1 103.5 <0.1 <0.1 <0.1 <0.1 0.2
    3 103.5 <0.1 <0.1 <0.1 <0.1 <0.1
    4 103.5 <0.1 <0.1 <0.1 <0.1 <0.1
    G.M.T. <0.1 <0.1 <0.1 <0.1 <0.1
    6 104.5 <0.1 <0.1 <0.1 <0.1 <0.1
    7 104.5 <0.1 <0.1 <0.1 2.4 1.9
    10 104.5 <0.1 <0.1 <0.1 1.6 1.1
    G.M.T. <0.1 <0.1 0.1 0.58 0.47
    11 105.5 <0.1 <0.1 1.0 3.2 4.3
    13 105.5 <0.1 <0.1 0.3 6.0 8.8
    14 105.5 <0.1 <0.1 0.2 2.1 9.4
    17 105.5 <0.1 <0.1 <0.1 1.2 2.5
    18 105.5 <0.1 <0.1 0.7 8.3 12.5
    20 105.5 <0.1 <0.1 <0.1 0.3 3.7
    21 105.5 <0.1 <0.1 0.2 2.6 3.9
    23 105.5 <0.1 <0.1 <0.1 1.7 4.2
    25 105.5 <0.1 <0.1 <0.1 0.6 0.9
    G.M.T. <0.1 <0.1 0.16 1.9 4.4*
    2 HDC <0.1 <0.1 0.8 7.1 7.2
    5 HDC <0.1 <0.1 9.9 12.8 18.7
    8 HDC <0.1 <0.1 12.7 21.1 16.5
    9 HDC <0.1 <0.1 6.0 9.9 14.3
    12 HDC <0.1 <0.1 5.0 9.2 25.3
    15 HDC <0.1 <0.1 2.2 5.2 8.6
    16 HDC <0.1 <0.1 2.7 7.7 20.7
    19 HDC <0.1 <0.1 2.6 9.9 9.1
    22 HDC <0.1 <0.1 1.4 8.6 6.6
    24 HDC <0.1 <0.1 0.8 5.8 4.7
    G.M.T. <0.1 <0.1 2.96 9.0 11.5*
    *p = 0.007 student t test
  • TABLE 13
    Canarypox antibodies: ELISA Geometric Mean Titers*
    vCP65
    dosage Days
    TCID50/dose 0 7 28 35 56
    103.5 0.69 ND 0.76 ND 0.68
    104.5 0.49 0.45 0.56 0.63 0.87
    105.5 0.38 0.38 0.77 1.42 1.63
    HDC control 0.45 0.39 0.40 0.35 0.39
    *optical density at 1/25 dilution
  • Example 11 Comparison of the LD50 of ALVAC and NYVAC with Various Vaccinia Virus Strains
  • Mice. Male outbred Swiss Webster mice were purchased from Taconic Farms (Germantown, N.Y.) and maintained on mouse chow and water ad libitum until use at 3 weeks of age (“normal” mice). Newborn outbred Swiss Webster mice were of both sexes and were obtained following timed pregnancies performed by Taconic Farms. All newborn mice used were delivered within a two day period.
  • Viruses. ALVAC was derived by plaque purification of a canarypox virus population and was prepared in primary chick embryo fibroblast cells (CEF). Following purification by centrifugation over sucrose density gradients, ALVAC was enumerated for plaque forming units in CEF cells. The WR(L) variant of vaccinia virus was derived by selection of large plaque phenotypes of WR (Panicali et al., 1981). The Wyeth New York State Board of Health vaccine strain of vaccinia virus was obtained from Pharmaceuticals Calf Lymph Type vaccine Dryvax, control number 302001B. Copenhagen strain vaccinia virus VC-2 was obtained from Institut Merieux, France. Vaccinia virus strain NYVAC was derived from Copenhagen VC-2. All vaccinia virus strains except the Wyeth strain were cultivated in Vero African green monkey kidney cells, purified by sucrose gradient density centrifugation and enumerated for plaque forming units on Vero cells. The Wyeth strain was grown in CEF cells and enumerated for plaque forming units in CEF cells.
  • Inoculations. Groups of 10 normal mice were inoculated intracranially (ic) with 0.05 ml of one of several dilutions of virus prepared by 10-fold serially diluting the stock preparations in sterile phosphate-buffered saline. In some instances, undiluted stock virus preparation was used for inoculation.
  • Groups of 10 newborn mice, 1 to 2 days old, were inoculated ic similarly to the normal mice except that an injection volume of 0.03 ml was used.
  • All mice were observed daily for mortality for a period of 14 days (newborn mice) or 21 days (normal mice) after inoculation. Mice found dead the morning following inoculation were excluded due to potential death by trauma.
  • The lethal dose required to produce mortality for 50% of the experimental population (LD50) was determined by the proportional method of Reed and Muench.
  • Comparison of the LD50 of ALVAC and NYVAC with Various Vaccinia Virus Strains for Normal, Young Outbred Mice by the ic Route. In young, normal mice, the virulence of NYVAC and ALVAC were several orders of magnitude lower than the other vaccinia virus strains tested (Table 14). NYVAC and ALVAC were found to be over 3,000 times less virulent in normal mice than the Wyeth strain; over 12,500 times less virulent than the parental VC-2 strain; and over 63,000,000 times less virulent than the WR(L) variant. These results would suggest that NYVAC is highly attenuated compared to other vaccinia strains, and that ALVAC is generally nonvirulent for young mice when administered intracranially, although both may cause mortality in mice at extremely high doses (3.85×108 PFUs, ALVAC and 3×108 PFUs, NYVAC) by an undetermined mechanism by this route of inoculation.
  • Comparison of the LD50 of ALVAC and NYVAC with Various Vaccinia Virus Strains for Newborn Outbred Mice by the ic Route. The relative virulence of 5 poxvirus strains for normal, newborn mice was tested by titration in an intracranial (ic) challenge model system (Table 15). With mortality as the endpoint, LD50 values indicated that ALVAC is over 100,000 times less virulent than the Wyeth vaccine strain of vaccinia virus; over 200,000 times less virulent than the Copenhagen VC-2 strain of vaccinia virus; and over 25,000,000 times less virulent than the WR-L variant of vaccinia virus. Nonetheless, at the highest dose tested, 6.3×107 PFUs, 100% mortality resulted. Mortality rates of 33.3% were observed at 6.3×106 PFUs. The cause of death, while not actually determined, was not likely of toxicological or traumatic nature since the mean survival time (MST) of mice of the highest dosage group (approximately 6.3 LD50) was 6.7±1.5 days. When compared to WR(L) at a challenge dose of 5 LD50, wherein MST is 4.8±0.6 days, the MST of ALVAC challenged mice was significantly longer (P=0.001).
  • Relative to NYVAC, Wyeth was found to be over 15,000 times more virulent; VC-2, greater than 35,000 times more virulent; and WR(L), over 3,000,000 times more virulent. Similar to ALVAC, the two highest doses of NYVAC, 6×108 and 6×107 PFUs, caused 100% mortality. However, the MST of mice challenged with the highest dose, corresponding to 380 LD50, was only 2 days (9 deaths on day 2 and 1 on day 4). In contrast, all mice challenged with the highest dose of WR-L, equivalent to 500 LD50, survived to day 4.
  • TABLE 14
    Calculated 50% Lethal Dose for mice by various vaccinia virus
    strains and for canarypox virus (ALVAC) by the ic route.
    POXVIRUS CALCULATED
    STRAIN LD50 (PFUs)
    WR(L) 2.5
    VC-2 1.26 × 104
    WYETH 5.00 × 104
    NYVAC 1.58 × 108
    ALVAC 1.58 × 108
  • TABLE 15
    Calculated 50% Lethal Dose for newborn mice by various vaccinia
    virus strains and for canarypox virus (ALVAC) by the ic route.
    POXVIRUS CALCULATED
    STRAIN LD50 (PFUs)
    WR(L) 0.4
    VC-2 0.1
    WYETH 1.6
    NYVAC 1.58 × 106
    ALVAC 1.00 × 107
  • Example 12 Evaluation of NYVAC (vP866) and NYVAC-RG (vP879)
  • Immunoprecipitations. Preformed monolayers of avian or non-avian cells were inoculated with 10 pfu per cell of parental NYVAC (vP866) or NYVAC-RG (vP879) virus. The inoculation was performed in EMEM free of methionine and supplemented with 2% dialyzed fetal bovine serum. After a one hour incubation, the inoculum was removed and the medium replaced with EMEM (methionine free) containing 20 μCi/ml of 35S-methionine. After an overnight incubation of approximately 16 hours, cells were lysed by the addition of Buffer A (1% Nonidet P-40, 10 mM Tris pH7.4, 150 mM NaCl, 1 mM EDTA, 0.01% sodium azide, 500 units per ml of aprotinin, and 0.02% phenyl methyl sulfonyl fluoride). Immunoprecipitation was performed using a rabies glycoprotein specific monoclonal antibody designated 24-3F10 supplied by Dr. C. Trinarchi, Griffith Laboratories, New York State Department of Health, Albany, N.Y., and a rat anti-mouse conjugate obtained from Boehringer Mannheim Corporation (Cat. #605-500). Protein A Sepharose CL-48 obtained from Pharmacia LKB Biotechnology Inc., Piscataway, N.J., was used as a support matrix. Immunoprecipitates were fractionated on 10% polyacrylamide gels according to the method of Dreyfuss et. al. (1984). Gels were fixed, treated for fluorography with 1M Na-salicylate for one hour, and exposed to Kodak XAR-2 film to visualize the immunoprecipitated protein species.
  • Sources of Animals. New Zealand White rabbits were obtained from Hare-Marland (Hewitt, N.J.). Three week old male Swiss Webster outbred mice, timed pregnant female Swiss Webster outbred mice, and four week old Swiss Webster nude (nu+nu+) mice were obtained from Taconic Farms, Inc. (Germantown, N.Y.). All animals were maintained according to NIH guidelines. All animal protocols were approved by the institutional IACUC. When deemed necessary, mice which were obviously terminally ill were euthanized.
  • Evaluation of Lesions in Rabbits. Each of two rabbits was inoculated intradermally at multiple sites with 0.1 ml of PBS containing 104, 105, 106, 107, or 108 pfu of each test virus or with PBS alone. The rabbits were observed daily from day 4 until lesion resolution. Indurations and ulcerations were measured and recorded.
  • Virus Recovery from Inoculation Sites. A single rabbit was inoculated intradermally at multiple sites of 0/1 ml of PBS containing 106, 107, or 108 pfu of each test virus or with PBS alone. After 11 days, the rabbit was euthanized and skin biopsy specimens taken from each of the inoculation sites were aseptically prepared by mechanical disruption and indirect sonication for virus recovery. Infectious virus was assayed by plaque titration on CEF monolayers.
  • Virulence in Mice. Groups of ten mice, or five in the nude mice experiment, were inoculated ip with one of several dilutions of virus in 0.5 ml of sterile PBS. Reference is also made to Example 11.
  • Cyclophosphamide (CY) Treatment. Mice were injected by the ip route with 4 mg (0.02 ml) of CY (SIGMA) on day −2, followed by virus injection on day 0. On the following days post infection, mice were injected ip with CY: 4 mg on day 1; 2 mg on days 4, 7 and 11; 3 mg on days 14, 18, 21, 25 and 28. Immunosuppression was indirectly monitored by enumerating white blood cells with a Coulter Counter on day 11. The average white blood cell count was 13,500 cells per μl for untreated mice (n=4) and 4,220 cells per μl for CY-treated control mice (n=5).
  • Calculation of LD50. The lethal dose required to produce 50% mortality (LD50) was determined by the proportional method of Reed and Muench (Reed and Muench 1938).
  • Potency Testing of NYVAC-RG in Mice. Four to six week old mice were inoculated in the footpad with 50 to 100 μl of a range of dilutions (2.0-8.0 log10 tissue culture infective dose 50% (TCID50)) of either VV-RG (Kieny et al., 1984), ALVAC-RG (Taylor et al., 1991b), or the NYVAC-RG. Each group consisted of eight mice. At 14 days post-vaccination, the mice were challenged by intracranial inoculation with 15 LD50 of the rabies virus CVS strain (0.03 ml). On day 28, surviving mice were counted and protective does 50% (PD50) calculated.
  • Derivation of NYVAC (vP866). The NYVAC strain of vaccinia virus was generated from VC-2, a plaque cloned isolate of the COPENHAGEN vaccine strain. To generate NYVAC from VC-2, eighteen vaccinia ORFs, including a number of viral functions associated with virulence, were precisely deleted in a series of sequential manipulations as described earlier in this disclosure. These deletions were constructed in a manner designed to prevent the appearance of novel unwanted open reading frames. FIG. 10 schematically depicts the ORFs deleted to generate NYVAC. At the top of FIG. 10 is depicted the HindIII restriction map of the vaccinia virus genome (VC-2 plaque isolate, COPENHAGEN strain). Expanded are the six regions of VC-2 that were sequentially deleted in the generation of NYVAC. The deletions were described earlier in this disclosure (Examples 1 through 6). Below such deletion locus is listed the ORFs which were deleted from that locus, along with the functions or homologies and molecular weight of their gene products.
  • Replication Studies of NYVAC and ALVAC on Human Tissue Cell Lines. In order to determine the level of replication of NYVAC strain of vaccinia virus (vP866) in cells of human origin, six cell lines were inoculated at an input multiplicity of 0.1 pfu per cell under liquid culture and incubated for 72 hours. The COPENHAGEN parental clone (VC-2) was inoculated in parallel. Primary chick embryo fibroblast (CEF) cells (obtained from 10-11 day old embryonated eggs of SPF origin, Spafas, Inc., Storrs, Conn.) were included to represent a permissive cell substrate for all viruses. Cultures were analyzed on the basis of two criteria: the occurrence of productive viral replication and expression of an extrinsic antigen.
  • The replication potential of NYVAC in a number of human derived cells are shown in Table 16. Both VC-2 and NYVAC are capable of productive replication in CEF cells, although NYVAC with slightly reduced yields. VC-2 is also capable of productive replication in the six human derived cell lines tested with comparable yields except in the EBV transformed lymphoblastoid cell line JT-1 (human lymphoblastoid cell line transformed with Epstein-Barr virus, see Rickinson et al., 1984). In contrast, NYVAC is highly attenuated in its ability to productively replicate in any of the human derived cell lines tested. Small increases of infectious virus above residual virus levels were obtained from NYVAC-infected MRC-5 (ATCC #CCL171, human embryonic lung origin), DETROIT 532 (ATCC #CCL54, human foreskin, Downs Syndrome), HEL 299 (ATCC #CCL137, human embryonic lung cells) and HNK (human neonatal kidney cells, Whittiker Bioproducts, Inc. Walkersville, Md., Cat #70-151) cells. Replication on these cell lines was significantly reduced when compared to virus yields obtained from NYVAC-infected CEF cells or with parental VC-2 (Table 16). It should be noted that the yields at 24 hours in CEF cells for both NYVAC and VC-2 is equivalent to the 72-hour yield. Allowing the human cell line cultures to incubate an additional 48 hours (another two viral growth cycles) may, therefore, have amplified the relative virus yield obtained.
  • Consistent with the low levels of virus yields obtained in the human-derived cell lines, MRC-5 and DETROIT 532, detectable but reduced levels of NYVAC-specific DNA accumulation were noted. The level of DNA accumulation in the MRC-5 and DETROIT 532 NYVAC-infected cell lines relative to that observed in NYVAC-infected CEF cells paralleled the relative virus yields. NYVAC-specific viral DNA accumulation was not observed in any of the other human-derived cells.
  • An equivalent experiment was also performed using the avipox virus, ALVAC. The results of virus replication are also shown in Table 16. No progeny virus was detectable in any of the human cell lines consistent with the host range restriction of canarypox virus to avian species. Also consistent with a lack of productive replication of ALVAC in these human-derived cells is the observation that no ALVAC-specific DNA accumulation was detectable in any of the human-derived cell lines.
  • Expression of Rabies Glycoprotein by NYVAC-RG (vP879) in Human Cells. In order to determine whether efficient expression of a foreign gene could be obtained in the absence of significant levels of productive viral replication, the same cell lines were inoculated with the NYVAC recombinant expressing the rabies virus glycoprotein (vP879, Example 7) in the presence of 35S-methionine. Immunoprecipitation of the rabies glycoprotein was performed from the radiolabelled culture lysate using a monoclonal antibody specific for the rabies glycoprotein. Immunoprecipitation of a 67 kDa protein was detected consistent with a fully glycosylated form of the rabies glycoprotein. No serologically crossreactive product was detected in uninfected or parental NYVAC infected cell lysates. Equivalent results were obtained with all other human cells analyzed.
  • Inoculations on the Rabbit Skin. The induction and nature of skin lesions on rabbits following intradermal (id) inoculations has been previously used as a measure of pathogenicity of vaccinia virus strains (Buller et al., 1988; Child et al., 1990; Fenner, 1958, Flexner et al., 1987; Ghendon and Chemos 1964). Therefore, the nature of lesions associated with id inoculations with the vaccinia strains WR (ATCC #VR119 plaque purified on CV-1 cells, ATCC #CCL70, and a plaque isolate designated L variant, ATCC #VR2035 selected, as described in Panicali et al., 1981)), WYETH (ATCC #VR325 marketed as DRYVAC by Wyeth Laboratories, Marietta, Pa.), COPENHAGEN (VC-2), and NYVAC was evaluated by inoculation of two rabbits (A069 and A128). The two rabbits displayed different overall sensitivities to the viruses, with rabbit A128 displaying less severe reactions than rabbit A069. In rabbit A128, lesions were relatively small and resolved by 27 days post-inoculation. On rabbit A069, lesions were intense, especially for the WR inoculation sites, and resolved only after 49 days. Intensity of the lesions was also dependent on the location of the inoculation sites relative to the lymph drainage network. In particular, all sites located above the backspine displayed more intense lesions and required longer times to resolve the lesions located on the flanks. All lesions were measured daily from day 4 to the disappearance of the last lesion, and the means of maximum lesion size and days to resolution were calculated (Table 17). No local reactions were observed from sites injected with the control PBS. Ulcerative lesions were observed at sites injected with WR, VC-2 and WYETH vaccinia virus strains. Significantly, no induration or ulcerative lesions were observed at sites of inoculation with NYVAC.
  • Persistence of Infectious Virus at the Site of Inoculation. To assess the relative persistence of these viruses at the site of inoculation, a rabbit was inoculated intradermally at multiple sites with 0.1 ml PBS containing 106, 107 or 108 pfu of VC-2, WR, WYETH or NYVAC. For each virus, the 107 pfu dose was located above the backspine, flanked by the 106 and 108 doses. Sites of inoculation were observed daily for 11 days. WR elicited the most intense response, followed by VC-2 and WYETH (Table 18). Ulceration was first observed at day 9 for WR and WYETH and day 10 for VC-2. Sites inoculated with NYVAC or control PBS displayed no induration or ulceration. At day 11 after inoculation, skin samples from the sites of inoculation were excised, mechanically disrupted, and virus was titrated on CEF cells. The results are shown in Table 18. In no case was more virus recovered at this timepoint than was administered. Recovery of vaccinia strain, WR, was approximately 106 pfu of virus at each site irrespective of amount of virus administered. Recovery of vaccinia strains WYETH and VC-2 was 103 to 104 pfu regardless of amount administered. No infectious virus was recovered from sites inoculated with NYVAC.
  • Inoculation of Genetically or Chemically Immune Deficient Mice. Intraperitoneal inoculation of high doses of NYVAC (5×108 pfu) or ALVAC (109 pfu) into nude mice caused no deaths, no lesions, and no apparent disease through the 100 day observation period. In contrast, mice inoculated with WR (103 to 104 pfu), WYETH (5×107 or 5×108 pfu) or VC-2 (104 to 109 pfu) displayed disseminated lesions typical of poxviruses first on the toes, then on the tail, followed by severe orchitis in some animals. In mice infected with WR or WYETH, the appearance of disseminated lesions generally led to eventual death, whereas most mice infected with VC-2 eventually recovered. Calculated LD50 values are given in Table 19.
  • In particular, mice inoculated with VC-2 began to display lesions on their toes (red papules) and 1 to 2 days later on the tail. These lesions occurred between 11 and 13 days post-inoculation (pi) in mice given the highest doses (109, 108, 107 and 106 pfu), on day 16 pi in mice given 105 pfu and on day 21 pi in mice given 104 pfu. No lesions were observed in mice inoculated with 103 and 102 pfu during the 100 day observation period. Orchitis was noticed on day 23 pi in mice given 109 and 108 pfu, and approximately 7 days later in the other groups (107 to 104 pfu). Orchitis was especially intense in the 109 and 108 pfu groups and, although receding, was observed until the end of the 100 day observation period. Some pox-like lesions were noticed on the skin of a few mice, occurring around 30-35 days pi. Most pox lesions healed normally between 60-90 days pi. Only one mouse died in the group inoculated with 109 pfu (Day 34 pi) and one mouse died in the group inoculated with 108 pfu (Day 94 pi). No other deaths were observed in the VC-2 inoculated mice.
  • Mice inoculated with 104 pfu of the WR strain of vaccinia started to display pox lesions on Day 17 pi. These lesions appeared identical to the lesions displayed by the VC-2 injected mice (swollen toes, tail). Mice inoculated with 103 pfu of the WR strain did not develop lesions until 34 days pi. Orchitis was noticed only in the mice inoculated with the highest dose of WR (104pfu). During the latter stages of the observation period, lesions appeared around the mouth and the mice stopped eating. All mice inoculated with 104 pfu of WR died or were euthanized when deemed necessary between 21 days and 31 days pi. Four out of the 5 mice injected with 103 pfu of WR died or were euthanized when deemed necessary between 35 days and 57 days pi. No deaths were observed in mice inoculated with lower doses of WR (1 to 100 pfu).
  • Mice inoculated with the WYETH strain of vaccinia virus at higher doses 5×107 and 5×108 pfu) showed lesions on toes and tails, developed orchitis, and died. Mice injected with 5×106 pfu or less of WYETH showed no signs of disease or lesions.
  • As shown in Table 19, CY-treated mice provided a more sensitive model for assaying poxvirus virulence than did nude mice. LD50 values for the WR, WYETH, and VC-2 vaccinia virus strains were significantly lower in this model system than in the nude mouse model. Additionally, lesions developed in mice injected with WYETH, WR and VC-2 vaccinia viruses, as noted below, with higher doses of each virus resulting in more rapid formation of lesions. As was seen with nude mice, CY-treated mice injected with NYVAC or ALVAC did not develop lesions. However, unlike nude mice, some deaths were observed in CY-treated mice challenged with NYVAC or ALVAC, regardless of the dose. These random incidences are suspect as to the cause of death.
  • Mice injected with all doses of WYETH (9.5×104 to 9.5×109 pfu) displayed pox lesions on their tail and/or on their toes between 7 and 15 days pi. In addition, the tails and toes were swollen. Evolution of lesions on the tail was typical of pox lesions with formation of a papule, ulceration and finally formation of a scab. Mice inoculated with all doses of VC-2 (1.65×105 to 1.65×109) also developed pox lesions on their tails and/or their toes analogous to those of WYETH injected mice. These lesions were observed between 7-12 days post inoculation. No lesions were observed on mice injected with lower doses of WR virus, although deaths occurred in these groups.
  • Potency Testing of NYVAC-RG. In order to determine that attenuation of the COPENHAGEN strain of vaccinia virus had been effected without significantly altering the ability of the resulting NYVAC strain to be a useful vector, comparative potency tests were performed. In order to monitor the immunogenic potential of the vector during the sequential genetic manipulations performed to attenuate the virus, a rabiesvirus glycoprotein was used as a reporter extrinsic antigen. The protective efficacy of the vectors expressing the rabies glycoprotein gene was evaluated in the standard NIH mouse potency test for rabies (Seligmann, 1973). Table 20 demonstrates that the PD50 values obtained with the highly attenuated NYVAC vector are identical to those obtained using a COPENHAGEN-based recombinant containing the rabies glycoprotein gene in the tk locus (Kieny et al., 1984) and similar to PD50 values obtained with ALVAC-RG, a canarypox based vector restricted to replication to avian species.
  • Observations. NYVAC, deleted of known virulence genes and having restricted in vitro growth characteristics, was analyzed in animal model systems to assess its attenuation characteristics. These studies were performed in comparison with the neurovirulent vaccinia virus laboratory strain, WR, two vaccinia virus vaccine strains, WYETH (New York City Board of Health) and COPENHAGEN (VC-2), as well as with a canarypox virus strain, ALVAC (See also Example 11). Together, these viruses provided a spectrum of relative pathogenic potentials in the mouse challenge model and the rabbit skin model, with WR being the most virulent strain, WYETH and COPENHAGEN (VC-2) providing previously utilized attenuated vaccine strains with documented characteristics, and ALVAC providing an example of a poxvirus whose replication is restricted to avian species. Results from these in vivo analyses clearly demonstrate the highly attenuated properties of NYVAC relative to the vaccinia virus strains, WR, WYETH and COPENHAGEN (VC-2) (Tables 14-20). Significantly, the LD50 values for NYVAC were comparable to those observed with the avian host restricted avipoxvirus, ALVAC. Deaths due to NYVAC, as well as ALVAC, were observed only when extremely high doses of virus were administered via the intracranial route (Example 11, Tables 14, 15, 19). It has not yet been established whether these deaths were due to nonspecific consequences of inoculation of a high protein mass. Results from analyses in immunocompromised mouse models (nude and CY-treated) also demonstrate the relatively high attenuation characteristics of NYVAC, as compared to WR, WYETH and COPENHAGEN strains (Tables 17 and 18). Significantly, no evidence of disseminated vaccinia infection or vaccinial disease was observed in NYVAC-inoculated animals or ALVAC-inoculated animals over the observation period. The deletion of multiple virulence-associated genes in NYVAC shows a synergistic effect with respect to pathogenicity. Another measure of the inocuity of NYVAC was provided by the intradermal administration on rabbit skin (Tables 17 and 18). Considering the results with ALVAC, a virus unable to replicate in nonavian species, the ability to replicate at the site of inoculation is not the sole correlate with reactivity, since intradermal inoculation of ALVAC caused areas of induration in a dose dependent manner. Therefore, it is likely that factors other than the replicative capacity of the virus contribute to the formation of the lesions. Deletion of specific virulence-associated genes in NYVAC prevents lesion occurrence.
  • Together, the results in this Example and in foregoing Examples, including Example 11, demonstrate the highly attenuated nature of NYVAC relative to WR, and the previously utilized vaccinia virus vaccine strains, WYETH and COPENHAGEN. In fact, the pathogenic profile of NYVAC, in the animal model systems tested, was similar to that of ALVAC, a poxvirus known to productively replicate only in avian species. The apparently restricted capacity of NYVAC to productively replicate on cells derived from humans (Table 16) and other species, including the mouse, swine, dog and horse, provides a considerable barrier that limits or prevents potential transmission to unvaccinated contacts or to the general environment in addition to providing a vector with reduced probability of dissemination within the vaccinated individual.
  • Significantly, NYVAC-based vaccine candidates have been shown to be efficacious. NYVAC recombinants expressing foreign gene products from a number of pathogens have elicited immunological responses towards the foreign gene products in several animal species, including primates. In particular, a NYVAC-based recombinant expressing the rabies glycoprotein was able to protect mice against a lethal rabies challenge. The potency of the NYVAC-based rabies glycoprotein recombinant was comparable to the PD50 value for a COPENHAGEN-based recombinant containing the rabies glycoprotein in the tk locus (Table 20). NYVAC-based recombinants have also been shown to elicit measles virus neutralizing antibodies in rabbits and protection against pseudorabies virus and Japanese encephalitis virus challenge in swine. The highly attenuated NYVAC strain confers safety advantages with human and veterinary applications (Tartaglia et al., 1992). Furthermore, the use of NYVAC as a general laboratory expression vector system may greatly reduce the biological hazards associated with using vaccinia virus.
  • By the following criteria, the results of this Example and the Examples herein, including Example 11, show NYVAC to be highly attenuated: a) no detectable induration or ulceration at site of inoculation (rabbit skin); b) rapid clearance of infectious virus from intradermal site of inoculation (rabbit skin); c) absence of testicular inflammation (nude mice); d) greatly reduced virulence (intracranial challenge, both three-week old and newborn mice); e) greatly reduced pathogenicity and failure to disseminate in immunodeficient subjects (nude and cyclophosphamide treated mice); and f) dramatically reduced ability to replicate on a variety of human tissue culture cells. Yet, in spite of being highly attenuated, NYVAC, as a vector, retains the ability to induce strong immune responses to extrinsic antigens.
  • TABLE 16
    Replication of COPENHAGEN (VC-2), NYVAC and
    ALVAC in avian or human derived cell lines
    Hours post- Yielda
    Cells infection VC-2 NYVAC ALVAC % Yield
    CEF
     0 3.8b 3.7 4.5
    24 8.3 7.8 6.6
    48 8.6 7.9 7.7
    72 8.3 7.7 7.5 25
    72Ac <1.4 1.8 3.1
    MRC-5  0 3.8 3.8 4.7
    72 7.2 4.6 3.8 0.25
    72A 2.2 2.2 3.7
    WISH*  0 3.4 3.4 4.3
    72 7.6 2.2 3.1 0.0004
    72A —d 1.9 2.9
    DETROIT  0 3.8 3.7 4.4
    72 7.2 5.4 3.4 1.6
    72A 1.7 1.7 2.9
    HEL  0 3.8 3.5 4.3
    72 7.5 4.6 3.3 0.125
    72A 2.5 2.1 3.6
    JT-1  0 3.1 3.1 4.1
    72 6.5 3.1 4.2 0.039
    72A 2.4 2.1 4.4
    HNK  0 3.8 3.7 4.7
    72 7.6 4.5 3.6 0.079
    72A 3.1 2.7 3.7
    aYield of NYVAC at 72 hours post-infection expressed as a percentage of yield of VAC-2 after 72 hours on the same cell line.
    bTiter expressed as LOG50 pfu per ml.
    cSample was incubated in the presence of 40 g/ml of cytosine arabinoside.
    dNot determined.
    *ATCC #CCL25 Human amnionic cells.
  • TABLE 17
    Induration and ulceration at the site of intradermal
    inoculation of the rabbit skin
    VIRUS INDURATION ULCERATION
    STRAIN DOSEa Sizeb Daysc Size Days
    WR
    104 386 30 88 30
    105 622 35 149 32
    106 1057 34 271 34
    107 877 35 204 35
    108 581 25 88 26
    WYETH 104 32 5  —d —
    105 116 15 — —
    106 267 17 3 15
    107 202 17 3 24
    108 240 29 12 31
    VC-2 104 64 7 — —
    105 86 8 — —
    106 136 17 — —
    107 167 21 6 10
    108 155 32 6 8
    NYVAC 104 — — — —
    105 — — — —
    106 — — — —
    107 — — — —
    108 — — — —
    apfu of indicated vaccinia virus in 0.1 ml PBS inoculated intradermally into one site.
    bmean maximum size of lesions (mm2)
    cmean time after inoculation for complete healing of lesion.
    dno lesions discernable.
  • TABLE 18
    Persistence of poxviruses at the site of intradermal inoculation
    Total Virus
    Virus Inoculum Dose Recovered
    WR  8.0a 6.14
    7.0 6.26
    6.0 6.21
    WYETH 8.0 3.66
    7.0 4.10
    6.0 3.59
    VC-2 8.0 4.47
    7.0 4.74
    6.0 3.97
    NYVAC 8.0 0
    7.0 0
    6.0 0
    aexpressed as log10 pfu.
  • TABLE 19
    Virulence studies in immunocompromised mice
    LD50 a
    Poxvirus Cyclophosphamide
    Strain Nude mice treated mice
    WR 422  42
    VC-2 >109 <1.65 × 105 
    WYETH  1.58 × 107 1.83 × 106
    NY VAC >5.50 × 108 7.23 × 108
    ALVAC >109 ≧5.00 × 108b  
    aCalculated 50% lethal dose (pfu) for nude or cyclophosphamide treated mice by the indicated vaccinia viruses and for ALVAC by intraperitoneal route.
    b5 out of 10 mice died at the highest dose of 5 × 108 pfu.
  • TABLE 20
    Comparative efficacy of NYVAC-RG and ALVAC-RG in mice
    Recombinant PD50 a
    VV-RG 3.74
    ALVAC-RG 3.86
    NYVAC-RG 3.70
    aFour to six week old mice were inoculated in the footpad with 50-100 μl of a range of dilutions (2.0-8.0 log10 tissue culture infection dose 50% (TCID50) of either the VV-RG (Kieny et al., 1984), ALVAC-RG (vCP65) or NYVAC-RG (vP879). At day 14, mice of each group were challenged by intracranial inoculation of 30 μl of a live CVS strain rabies virus corresponding to 15 lethal dose 50% (LD50) per mouse. At day 28, surviving mice were counted and a protective dose 50% (PD50) was calculated.
  • Example 13 Construction of TROVAC Recombinants Expressing the Hemagglutinin Glycoproteins of Avian Influenza Viruses
  • This Example describes the development of fowlpox virus recombinants expressing the hemagglutinin genes of three serotypes of avian influenza virus.
  • Cells and Viruses. Plasmids containing cDNA clones of the H4, H5 and H7 hemagglutinin genes were obtained from Dr. Robert Webster, St. Jude Children's Research Hospital, Memphis, Tenn. The strain of FPV designated FP-1 has been described previously (Taylor et al., 1988a, b). It is a vaccine strain useful in vaccination of day old chickens. The parental virus strain Duvette was obtained in France as a fowlpox scab from a chicken. The virus was attenuated by approximately 50 serial passages in chicken embryonated eggs followed by 25 passages on chick embryo fibroblast (CEF) cells. This virus was obtained in September 1980 by Rhone Merieux, Lyon, France, and a master viral seed established. The virus was received by Virogenetics in September 1989, where it was subjected to four successive plaque purifications. One plaque isolate was further amplified in primary CEF cells and a stock virus, designated as TROVAC, was established. The stock virus used in the in vitro recombination test to produce TROVAC-AIH5 (vFP89) and TROVAC-AIH4 (vFP92) had been further amplified though 8 passages in primary CEF cells. The stock virus used to produce TROVAC-AIH7 (vFP100) had been further amplified through 12 passages in primary CEF cells.
  • Construction of Fowlpox Insertion Plasmid at F8 Locus. Plasmid pRW731.15 contains a 10 kbp PvuII-PvuII fragment cloned from TROVAC genomic DNA. The nucleotide sequence was determined on both strands for a 3659 bp PvuII-EcoRV fragment. This sequence is shown in FIG. 11 (SEQ ID NO:67). The limits of an open reading frame designated in this laboratory as F8 were determined within this sequence. The open reading frame is initiated at position 495 and terminates at position 1887. A deletion was made from position 779 to position 1926, as described below.
  • Plasmid pRW761 is a sub-clone of pRW731.15 containing a 2430 bp EcoRV-EcoRV fragment. Plasmid pRW761 was completely digested with XbaI and partially digested with SspI. A 3700 bp XbaI-SspI band was isolated and ligated with the annealed double-stranded oligonucleotides JCA017 (SEQ ID NO:37) and JCA018 (SEQ ID NO:38).
  • JCA017 (SEQ ID NO: 37)
    5′ CTAGACACTTTATGTTTTTTAATATCCGGTCTTAAAAGCTTCCCGGG
    GATCCTTATACGGGGAATAAT
    3′
    JCA018 (SEQ ID NO: 38)
    5′ ATTATTCCCCGTATAAGGATCCCCCGGGAAGCTTTTAAGACCGGATA
    TTAAAAAACATAAAGTGT
    3′
  • The plasmid resulting from this ligation was designated pJCA002. Plasmid pJCA004 contains a non-pertinent gene linked to the vaccinia virus H6 promoter in plasmid pJCA002. The sequence of the vaccinia virus H6 promoter has been previously described (Taylor et al., 1988a, b; Guo et al. 1989; Perkus et al., 1989). Plasmid pJCA004 was digested with EcoRV and BamHI which deletes the non-pertinent gene and a portion of the 3′ end of the H6 promoter. Annealed oligonucleotides RW178 (SEQ ID NO:48) and RW179 (SEQ ID NO:49) were cut with EcoRV and BamHI and inserted between the EcoRV and BamHI sites of JCA004 to form pRW846.
  • RW178 (SEQ ID NO: 48):
    5′ TCATTATCGCGATATCCGTGTTAACTAGCTAGCTAATTTTTATTCCC
    GGGATCCTTATCA
    3′
    RW179 (SEQ ID NO: 49):
    5′ GTATAAGGATCCCGGGAATAAAAATTAGCTAGCTAGTTAACACGGAT
    ATCGCGATAATGA
    3′

    Plasmid pRW846 therefore contains the H6 promoter 5′ of EcoRV in the de-ORFed F8 locus. The HincII site 3′ of the H6 promoter in pRW846 is followed by translation stop codons, a transcriptional stop sequence recognized by vaccinia virus early promoters (Yuen et al., 1987) and a SmaI site.
  • Construction of Fowlpox Insertion Plasmid at F7 Locus. The original F7 non-de-ORFed insertion plasmid, pRW731.13, contained a 5.5 kb FP genomic PvuII fragment in the PvuII site of pUC9. The insertion site was a unique HincII site within these sequences. The nucleotide sequence shown in FIG. 12 (SEQ ID NO:68) was determined for a 2356 bp region encompassing the unique HincII site. Analysis of this sequence revealed that the unique HincII site (FIG. 12, underlined) was situated within an ORF encoding a polypeptide of 90 amino acids. The ORF begins with an ATG at position 1531 and terminates at position 898 (positions marked by arrows in FIG. 12).
  • The arms for the de-ORFed insertion plasmid were derived by PCR using pRW731.13 as template. A 596 bp arm (designated as HB) corresponding to the region upstream from the ORF was amplified with oligonucleotides F73PH2 (SEQ ID NO:50) (5′-GACAATCTAAGTCCTATATTAGAC-3′) and F73PB (SEQ ID NO:51) (5′-GGATTTTTAGGTAGACAC-3′). A 270 bp arm (designated as EH) corresponding to the region downstream from the ORF was amplified using oligonucleotides F75PE (SEQ ID NO:52) (5′-TCATCGTCTTCATCATCG-3′) and F73PH1 (SEQ ID NO:53) (5′-GTCTTAAACTTATTGTAAGGGTATACCTG-3′).
  • Fragment EH was digested with EcoRV to generate a 126 bp fragment. The EcoRV site is at the 3′-end and the 5′-end was formed, by PCR, to contain the 3′ end of a HincII site. This fragment was inserted into pBS-SK (Stratagene, La Jolla, Calif.) digested with HincII to form plasmid pF7D1. The sequence was confirmed by dideoxynucleotide sequence analysis. The plasmid pF7D1 was linearized with ApaI, blunt-ended using T4 DNA polymerase, and ligated to the 596 bp HB fragment. The resultant plasmid was designated as pF7D2. The entire sequence and orientation were confirmed by nucleotide sequence analysis.
  • The plasmid pF7D2 was digested with EcoRV and BglII to generate a 600 bp fragment. This fragment was inserted into pBS-SK that was digested with ApaI, blunt-ended with T4 DNA polymerase, and subsequently digested with BamHI. The resultant plasmid was designated as pF7D3. This plasmid contains an HB arm of 404 bp and a EH arm of 126 bp.
  • The plasmid pF7D3 was linearized with XhoI and blunt-ended with the Klenow fragment of the E. coli DNA polymerase in the presence of 2 mM dNTPs. This linearized plasmid was ligated with annealed oligonucleotides F7MCSB (SEQ ID NO:54) (5′-AACGATTAGTTAGTTACTAAAAGCTTGCTGCAGCCCGGGTTTTTTATTAGTTTAGTT AGTC-3′) and F7MCSA (SEQ ID NO:55) (5′-GACTAACTAACTAATAAAAAA CCCGGGCTGCAGCAAGCTTTTTGTAACTAACTAATCGTT-3′). This was performed to insert a multiple cloning region containing the restriction sites for HindIII, PstI and SmaI between the EH and HB arms. The resultant plasmid was designated as pF7DO.
  • Construction of Insertion Plasmid for the H4 Hemagglutinin at the F8 Locus. A cDNA copy encoding the avian influenza H4 derived from A/Ty/Min/833/80 was obtained from Dr. R. Webster in plasmid pTM4H833. The plasmid was digested with HindIII and NruI and blunt-ended using the Klenow fragment of DNA polymerase in the presence of dNTPs. The blunt-ended 2.5 kbp HindIII-NruI fragment containing the H4 coding region was inserted into the HincII site of pIBI25 (International Biotechnologies, Inc., New Haven, Conn.). The resulting plasmid pRW828 was partially cut with BanII, the linear product isolated and recut with HindIII. Plasmid pRW828 now with a 100 bp HindIII-BanII deletion was used as a vector for the synthetic oligonucleotides RW152 (SEQ ID NO:56) and RW153 (SEQ ID NO:57). These oligonucleotides represent the 3′ portion of the H6 promoter from the EcoRV site and align the ATG of the promoter with the ATG of the H4 cDNA.
  • RW152 (SEQ ID NO: 56):
    5′ GCACGGAACAAAGCTTATCGCGATATCCGTTAAGTTTGTATCGTAAT
    GCTATCAATCACGATTCTGTTCCTGCTCATAGCAGAGGGCTCATCTCAGA
    AT
    3′
    RW153 (SEQ ID NO: 57):
    5′ ATTCTGAGATGAGCCCTCTGCTATGAGCAGGAACAGAATCGTGATTG
    ATAGCATTACGATACAAACTTAACGGATATCGCGATAAGCTTTGTTCCGT
    GC
    3′
  • The oligonucleotides were annealed, cut with BanII and HindIII and inserted into the HindIII-BanII deleted pRW828 vector described above. The resulting plasmid pRW844 was cut with EcoRV and DraI and the 1.7 kbp fragment containing the 3′ H6 promoted H4 coding sequence was inserted between the EcoRV and HincII sites of pRW846 (described previously) forming plasmid pRW848. Plasmid pRW848 therefore contains the H4 coding sequence linked to the vaccinia virus H6 promoter in the de-ORFed F8 locus of fowlpox virus.
  • Construction of Insertion Plasmid for H5 Hemagglutinin at the F8 Locus. A cDNA clone of avian influenza H5 derived from A/Turkey/Ireland/1378/83 was received in plasmid pTH29 from Dr. R. Webster. Synthetic oligonucleotides RW10 (SEQ ID NO:58) through RW13 (SEQ ID NO:61) were designed to overlap the translation initiation codon of the previously described vaccinia virus H6 promoter with the ATG of the H5 gene. The sequence continues through the 5′ SalI site of the H5 gene and begins again at the 3′ H5 DraI site containing the H5 stop codon.
  • RW10 (SEQ ID NO: 58):
    5′ GAAAAATTTAAAGTCGACCTGTTTTGTTGAGTTGTTTGCGTGGTAAC
    CAATGCAAATCTGGTCACT
    3′
    RW11 (SEQ ID NO: 59):
    5′ TCTAGCAAGACTGACTATTGCAAAAAGAAGCACTATTTCCTCCATTA
    CGATACAAACTTAACGGAT
    3′
    RW12 (SEQ ID NO: 60):
    5′ ATCCGTTAAGTTTGTATCGTAATGGAGGAAATAGTGCTTCTTTTTGC
    AATAGTCAGTCTTGCTAGAAGTGACCAGATTTGCATTGGT
    3′
    RW13 (SEQ ID NO:61):
    5′ TACCACGCAAACAACTCAACAAAACAGGTCGACTTTAAATTTTTCTG
    CA
    3′
  • The oligonucleotides were annealed at 95° C. for three minutes followed by slow cooling at room temperature. This results in the following double strand structure with the indicated ends.
  • Figure US20080188640A1-20080807-C00002
  • Cloning of oligonucleotides between the EcoRV and PstI sites of pRW742B resulted in pRW744. Plasmid pRW742B contains the vaccinia virus H6 promoter linked to a non-pertinent gene inserted at the HincII site of pRW731.15 described previously. Digestion with PstI and EcoRV eliminates the non-pertinent gene and the 3′-end of the H6 promoter. Plasmid pRW744 now contains the 3′ portion of the H6 promoter overlapping the ATG of avian influenza H5. The plasmid also contains the H5 sequence through the 5′ SalI site and the 3′ sequence from the H5 stop codon (containing a DraI site). Use of the DraI site removes the H5 3′ non-coding end. The oligonucleotides add a transcription termination signal recognized by early vaccinia virus RNA polymerase (Yuen et al., 1987). To complete the H6 promoted H5 construct, the H5 coding region was isolated as a 1.6 kpb SalI-DraI fragment from pTH29. Plasmid pRW744 was partially digested with DraI, the linear fragment isolated, recut with SalI and the plasmid now with eight bases deleted between SalI and DraI was used as a vector for the 1.6 kpb pTH29 SalI and DraI fragment. The resulting plasmid pRW759 was cut with EcoRV and DraI. The 1.7 kbp PRW759 EcoRV-DraI fragment containing the 3′ H6 promoter and the H5 gene was inserted between the EcoRV and HincII sites of pRW846 (previously described). The resulting plasmid pRW849 contains the H6 promoted avian influenza virus H5 gene in the de-ORFed F8 locus.
  • Construction of Insertion Vector for H7 Hemagglutinin at the F7 Locus. Plasmid pCVH71 containing the H7 hemagglutinin from A/CK/VIC/1/85 was received from Dr. R. Webster. An EcoRI-BamHI fragment containing the H7 gene was blunt-ended with the Klenow fragment of DNA polymerase and inserted into the HincII site of pIBI25 as PRW827. Synthetic oligonucleotides RW165 (SEQ ID NO:62) and RW166 (SEQ ID NO:63) were annealed, cut with HincII and StyI and inserted between the EcoRV and StyI sites of pRW827 to generate pRW845.
  • RW165 (SEQ ID NO: 62):
    5′ GTACAGGTCGACAAGCTTCCCGGGTATCGCGATATCCGTTAAGTTTG
    TATCGTAATGAATACTCAAATTCTAATACTCACTCTTGTGGCAGCCATTC
    ACACAAATGCAGACAAAATCTGCCTTGGACATCAT
    3′
    RW166 (SEQ ID NO: 63):
    5′ ATGATGTCCAAGGCAGATTTTGTCTGCATTTGTGTGAATGGCTGCCA
    CAAGAGTGAGTATTAGAATTTGAGTATTCATTACGATACAAACTTAACGG
    ATATCGCGATACCCGGGAAGCTTGTCGACCTGTAC
    3′
  • Oligonucleotides RW165 (SEQ ID NO:62) and RW166 (SEQ ID NO:63) link the 3′ portion of the H6 promoter to the H7 gene. The 3′ non-coding end of the H7 gene was removed by isolating the linear product of an ApaLI digestion of pRW845, recutting it with EcoRI, isolating the largest fragment and annealing with synthetic oligonucleotides RW227 (SEQ ID NO:64) and RW228 (SEQ ID NO:65). The resulting plasmid was pRW854.
  • RW227 (SEQ ID NO: 64):
    5′ ATAACATGCGGTGCACCATTTGTATATAAGTTAACGAATTCCAAGTC
    AAGC
    3′
    RW228 (SEQ ID NO: 65):
    5′ GCTTGACTTGGAATTCGTTAACTTATATACAAATGGTGCACCGCATG
    TTAT
    3′

    The stop codon of H7 in PRW854 is followed by an HpaI site. The intermediate H6 promoted H7 construct in the de-ORFed F7 locus (described below) was generated by moving the pRW854 EcoRV-HpaI fragment into pRW858 which had been cut with EcoRV and blunt-ended at its PstI site. Plasmid pRW858 (described below) contains the H6 promoter in an F7 de-ORFed insertion plasmid.
  • The plasmid pRW858 was constructed by insertion of an 850 bp SmaI/HpaI fragment, containing the H6 promoter linked to a non-pertinent gene, into the SmaI site of pF7DO described previously. The non-pertinent sequences were excised by digestion of pRW858 with EcoRV (site 24 bp upstream of the 3′-end of the H6 promoter) and PstI. The 3.5 kb resultant fragment was isolated and blunt-ended using the Klenow fragment of the E. coli DNA polymerase in the presence of 2 mM dNTPs. This blunt-ended fragment was ligated to a 1700 bp EcoRV/HpaI fragment derived from pRW854 (described previously). This EcoRV/HpaI fragment contains the entire AIV HA (H7) gene juxtaposed 3′ to the 3′-most 24 bp of the VV H6 promoter. The resultant plasmid was designated pRW861.
  • The 126 bp EH arm (defined previously) was lengthened in pRW861 to increase the recombination frequency with genomic TROVAC DNA. To accomplish this, a 575 bp AccI/SnaBI fragment was derived from pRW 731.13 (defined previously). The fragment was isolated and inserted between the AccI and NaeI sites of pRW861. The resultant plasmid, containing an EH arm of 725 bp and a HB arm of 404 bp flanking the AIV H7 gene, was designated as pRW869. Plasmid pRW869 therefore consists of the H7 coding sequence linked at its 5′ end to the vaccinia virus H6 promoter. The left flanking arm consists of 404 bp of TROVAC sequence and the right flanking arm of 725 bp of TROVAC sequence which directs insertion to the de-ORFed F7 locus.
  • Development of TROVAC-Avian Influenza Virus Recombinants. Insertion plasmids containing the avian influenza virus HA coding sequences were individually transfected into TROVAC infected primary CEF cells by using the calcium phosphate precipitation method previously described (Panicali et al., 1982; Piccini et al., 1987). Positive plaques were selected on the basis of hybridization to HA specific radiolabelled probes and subjected to sequential rounds of plaque purification until a pure population was achieved. One representative plaque was then amplified to produce a stock virus. Plasmid pRW849 was used in an in vitro recombination test to produce recombinant TROVAC-AIH5 (vFP89) expressing the H5 hemagglutinin. Plasmid pRW848 was used to produce recombinant TROVAC-AIH4 (vFP92) expressing the H4 hemagglutinin. Plasmid pRW869 was used to produce recombinant TROVAC-AIH7 (vFP100) expressing the H7 hemagglutinin.
  • Immunofluorescence. In influenza virus infected cells, the HA molecule is synthesized and glycosylated as a precursor molecule at the rough endoplasmic reticulum. During passage to the plasma membrane it undergoes extensive post-translational modification culminating in proteolytic cleavage into the disulphide linked HA1 and HA2 subunits and insertion into the host cell membrane where it is subsequently incorporated into mature viral envelopes. To determine whether the HA molecules produced in cells infected with the TROVAC-AIV recombinant viruses were expressed on the cell surface, immunofluorescence studies were performed. Indirect immunofluorescence was performed as described (Taylor et al., 1990). Surface expression of the H5 hemagglutinin in TROVAC-AIH5, H4 hemagglutinin in TROVAC-AIH4 and H7 hemagglutinin in TROVAC-AIH7 was confirmed by indirect immunofluorescence. Expression of the H5 hemagglutinin was detected using a pool of monoclonal antibodies specific for the H5HA. Expression of the H4HA was analyzed using a goat monospecific anti-H4 serum. Expression of the H7HA was analyzed using a H7 specific monoclonal antibody preparation.
  • Immunoprecipitation. It has been determined that the sequence at and around the cleavage site of the hemagglutinin molecule plays an important role in determining viral virulence since cleavage of the hemagglutinin polypeptide is necessary for virus particles to be infectious. The hemagglutinin proteins of the virulent H5 and H7 viruses possess more than one basic amino acid at the carboxy terminus of HA1. It is thought that this allows cellular proteases which recognize a series of basic amino acids to cleave the hemagglutinin and allow the infectious virus to spread both in vitro and in vivo. The hemagglutinin molecules of H4 avirulent strains are not cleaved in tissue culture unless exogenous trypsin is added.
  • In order to determine that the hemagglutinin molecules expressed by the TROVAC recombinants were authentically processed, immunoprecipitation experiments were performed as described (Taylor et al., 1990) using the specific reagents described above.
  • Immunoprecipitation analysis of the H5 hemagglutinin expressed by TROVAC-AIH5 (vFP89) showed that the glycoprotein is evident as the two cleavage products HA1 and HA2 with approximate molecular weights of 44 and 23 kDa, respectively. No such proteins were precipitated from uninfected cells or cells infected with parental TROVAC. Similarly immunoprecipitation analysis of the hemagglutinin expressed by TROVAC-AIH7 (vFP100) showed specific precipitation of the HA2 cleavage product. The HA1 cleavage product was not recognized. No proteins were specifically precipitated from uninfected CEF cells or TROVAC infected CEF cells. In contrast, immunoprecipitation analysis of the expression product of TROVAC-AIH4 (vFP92) showed expression of only the precursor protein HA0. This is in agreement with the lack of cleavage of the hemagglutinins of avirulent subtypes in tissue culture. No H4 specific proteins were detected in uninfected CEF cells or cells infected with TROVAC. Generation of recombinant virus by recombination, in situ hybridization of nitrocellulose filters and screening for B-galactosidase activity are as previously described (Panicali et al., 1982; Perkus et al., 1989).
  • Example 14 Generation of an ALVAC Recombinant Expressing HIV1 gag (+pro) (IIIB), gp120 (MN) (+transmembrane) Epitopes
  • A plasmid, pHXB2D, containing HIV1 (IIIB) cDNA sequence (Ratner et al, 1985), was obtained from Robert Gallo (NCI, NIH). The sequence encoding the 5′-end of the gag gene was cloned between vaccinia virus tk flanking arms. This was accomplished by cloning the 1,625 bp BglII fragment of pHXB2D, containing the 5′-end of the gag gene, into the 4,075 bp BglII fragment of pSD542VCVQ. The plasmid generated by this manipulation is called pHIVG2.
  • The 3′-end of the gag gene was then cloned into pHIVG2. This was accomplished by cloning a 280 bp ApaI-BamHI PCR fragment, containing the 3′-end of the gag gene, into the 5,620 bp ApaI-BamHI fragment of pHIVG2. (This PCR fragment was generated from the plasmid, pHXB2D, with the oligonucleotide primers, HIVP5 (SEQ ID NO:69; 5′-TGTGGCAAAGAAGGGC-3′) and HIVP6 (SEQ ID NO:70; 5′-TTGGATCCTTATTGTGACGAGGGGTC-3′).) The plasmid generated by this manipulation is called pHIVG3.
  • The I3L promoter was then cloned upstream of the gag gene. This was accomplished by cloning the oligonucleotides, HIVL17 (SEQ ID NO:71; 5′-GATCTTGAGATAAAGTGAAAATATATATCATTATATTACAAAGTACAATTATTTA GGTTTAATCATGGGTGCGAGAGCGTCAGTATTAAGCGGGGGAGAATTAGAT-3′) and HIVL18 (SEQ ID NO:72; 5′-CGATCTAATTCTCCCCCGCTTAATACTGACGCTCT CGCACCCATGATTAAACCTAAATAATTGTACTTTGTAATATAATGATATATATTTTCACTTT ATCTCAA-3′), encoding the vaccinia virus I3L promoter and the 5′-end of the gag gene, into the 5,540 bp partial BglII-ClaI fragment of pHIVG3. The plasmid generated by this manipulation is called pHIVG4.
  • The portion of the gag gene encoding p24, p2, p7 and p6 was then eliminated. This was accomplished by cloning the oligonucleotides, HIVL19 (SEQ ID NO:73; 5′-CTGACACAGG ACACAGCAATCAGGTCAGCCAAAATTACTAATTTTTATCTCGAGGTCGACAGGACCCG-3′) and HIVL20 (SEQ ID NO:74; 5′-GATCCGGGTCCTGTCGACCTCGAGATAAAAA TTAGTAATTTTGGCTGACCTGATTGCTGTGTCCTGTGTCAG-3′), into the 4,450 bp partial PvuII-BamHI fragment of pHIVG4. The plasmid generated by this manipulation is called pHIVG5.
  • The remainder of the gag gene, as well as the pol gene, was then cloned downstream of the p17 “gene”. This was accomplished by cloning the 4,955 bp ClaI-SalI fragment of pHXB2D, containing most of the gag gene and all of the pol gene, into the 4,150 bp ClaI-SalI fragment of pHIVG5. The plasmid generated by this manipulation is called pHIVG6.
  • Extraneous 3′-noncoding sequence was then eliminated. This was accomplished by cloning a 360 bp AflII-BamHI PCR fragment, containing the 3′-end of the pol gene, into the 8,030 bp AflII-BamHI fragment of pHIVG6. (This PCR fragment was generated from the plasmid, pHXB2D, with the oligonucleotide primers, HIVP7 (SEQ ID NO:75; 5′-AAG AAAATTATAGGAC-3′) and HIVP8 (SEQ ID NO:76; 5′-TTGGATCCC TAATCCTCATCCTGT-3′).) The plasmid generated by this manipulation is called pHIVG7.
  • The I3L-promoted gag and pol genes were then cloned between canary pox C3 flanking arms. This was accomplished by cloning the 4,360 bp partial BglII-BamHI fragment of pHIVG7, containing the I3L-promoted gag and pol genes, into the BamHI site of pVQH6CP3L. The plasmid generated by this manipulation is called pHIVGE14.
  • The H6-promoted HIV1gp120(MN) (+transmembrane) “gene” (Gurgo et al, 1988) was then cloned into pHIVGE14. This was accomplished by cloning the 1,700 bp NruI-SmaI fragment of pC5HIVMN120T, containing the gp120(+transmembrane) “gene”, into the 11,400 bp NruI-SmaI fragment of pHIVGE14. The plasmid generated by this manipulation is called pHIVGE14T.
  • Most of the pol gene was then removed. This was accomplished by cloning a 540 bp ApaI-BamHI PCR fragment, containing the 3′-end of the HIV1 protease “gene”, into the 10,000 bp ApaI-BamHI fragment of pHIVGE14T. (This PCR fragment was generated from the plasmid, pHIVG7, with the oligonucleotide primers, HIVP5 and HIVP37 (SEQ ID NO:77; 5′-AAAGGATCCCCCGGGTTAAAAATTTAAAGTGCAACC-3′).) This manipulation removes most of the pol gene, but leaves the protease “gene” intact. The plasmid generated by this manipulation is called pHIV32. The DNA sequence of pHIV32 (SEQ ID NOS: 78 and 79) is shown in FIGS. 14A-14C which shows the nucleotide sequence of the H6-promoted HIV1gp120(+transmembrane) gene and the I3L-promoted HIV1gag(+pro) gene contained in pHIV32:
  • gag (+pro) and gp120 (+transmembrane)
    FEATURES From To/Span Description
    frag
    1 56 C3 flanking arm
    frag 162 76 (C) HIV1 (IIIB) env
    transmembrane region
    frag 1728 163 (C) HIV1 (MM) gp120 gene
    frag 1853 1729 (C) vaccinia H6 promoter
    frag 1925 1983 vaccinia I3L promoter
    frag 1984 3746 HIV1 (IIB) gag/pro gene
    frag 3753 3808 C3 flanking arm
  • The DNA sequence of the ALVAC C3 flanking arm (SEQ ID NOS: 80 and 81) is shown in FIGS. 15A-F. FIGS. 15A to 15F show the nucleotide sequence of the C3 locus in pVQH6CP3L:
  • C3 LOCUS
    pVQH6CP3L
    FEATURES From To/Span Description
    frag
    1 1460 C3 flanking arm
    frag 1461 1501 Cloning sites
    frag 1630 1502 H6 promoter
    frag 1717 4291 C3 flanking arm
  • pHIV32 was used in vitro recombination with ALVAC as the rescuing virus to yield vCP205.
  • vCP205 (ALVAC-MN120TMG) was deposited on Mar. 6, 1997 under the terms of the Budapest Treaty with the American Type Culture Collection (ATCC), P.O. Box 1549, Manassas, Va. 20108 USA under ATCC accession number VR-2557.
  • Example 15 Generation of an ALVAC Recombinant Expressing HIV1 gag (+pro) (IIIB), gp120 (MN) (+transmembrane) and 2 nef (BRU) Epitopes
  • Expression cassettes encoding two nef CTL epitopes, CTL1 (amino acids 66-147) and CTL2 (amino acids 182-206) (Wain-Hobson et al, 1985; Nixon and McMichael, 1991), were then inserted into vCP205. The insertion plasmid, p2-60-HIV.3, containing the nef CTL epitopes, was generated by the following procedure. The I3L-promoted CTL2 epitope was cloned into pBSH6. This was accomplished by cloning a 255 bp PCR HindIII-XhoI fragment, containing the I3L-promoted CTL2 epitope, into the 3,100 bp HindIII-XhoI fragment of pBSH6. (The 255 bp PCR fragment was generated by the following procedure. A 216 bp PCR fragment, containing the I3L-promoter and the 5′-end of the CTL2 epitope, was generated from the plasmid, pMPI3H, with the oligonucleotide primers, VQPCRI3 (SEQ ID NO: 82; 5′-ATCATCAAGCTTAATTAATTAGTTATTAGACAAGGTGAAAACGAAACTATTTGTAGCTT AATTATTAGACATCATGCAGTGGTTAAAC-3′) and I3PCRCTL (SEQ ID NO: 83; 5′-CTAGCTACGTGATGAAATGCTAATCTAGAATCAAATCTCCACTCCATGATTAAACCTAA ATAATTGTAC-3′). This 216 bp PCR fragment was then used as a template in a second PCR reaction with the oligonucleotide primers, VQPCRI3 and CTLPCR (SEQ ID NO: 84; 5′-GAATTCCTCGAGGATCCTCTAGATTAACAATTTTTAAAATATTCAGGATGTAATTCTCT AGCTACGTGATGAAATGC-3′), to generate the PCR fragment, containing the I3L-promoted CTL2 epitope, that was digested with HindIII and XhoI and cloned into pBSH6). The plasmid generated by this manipulation is called p2-60-HIV.1.
  • The H6-promoted CTL1 epitope was then cloned into p2-60-HIV.1. This was accomplished by cloning a 290 bp NruI-EcoRI fragment, containing the H6-promoted CTL1 epitope, into the 3,300 bp NruI-EcoRI fragment of p2-60-HIV.1. (The 290 bp NruI-EcoRI fragment was generated by the following procedure. A 195 bp PCR fragment, containing the H6-promoter and the 5′-end of the CTL1 epitope, was generated from the plasmid, pH6T2, with the oligonucleotide primers, H6PCR1 (SEQ ID NO: 85; 5′-ACTACTAAGCTTCTTTATTCTATACTTAAAAAGTG-3′) and NCCPCR1 (SEQ ID NO: 86; 5′-CAGCTGCTTTGTAAGTCATTGGTCTTAAAGGTACTTGAGGTGTTACTGGAAAACCTACC ATTACGATACAAACTTAACGGATATCGCG-3′). This 195 bp PCR fragment and the oligonucleotides, NCC174A (SEQ ID NO: 87; 5′-ACTTACAAAGCAGCTGTAGATCTTTCTCACTTTTTAAAAGAAAAAGGAGGTTTAGAAGG GCTAATTCATTCTCAACGAAGACAAGATATTCTTGATTTGTGG-3′) and NCC174B (SEQ ID NO: 88; 5′-CCACAAATCAAGAATATCTTGTCTTCGTTGAGAATGAATTAGCCCTTCTAAACCTCCTT TTTCTTTTAAAAAGTGAGAAAGATCTACAGCTGCTTTGTAAGT-3′), were then used as templates in a second PCR reaction with the oligonucleotide primers, H6PCR1 and NCCPCR2 (SEQ ID NO: 89; 5′-CTGCCAATCAGGAAAATATCCTTGTGTATGATAAATCCACAAATCAAGAATATC-3′). The resulting 317 bp PCR fragment, containing the H6-promoter and most of the CTL1 epitope, and the oligonucleotides, NCC291A (SEQ ID NO: 90; 5′-GGATATTTTCCTGATTGGCAGAATTACACACCAGGACCAGGAGTCAGATACCCATTAAC CTTTGGTTGGTGCTACAAGC-3′) and NCC291B (SEQ ID NO: 91; 5′-GCTTGTAGCACCAACCAAAGGTTAATGGGTATCTGACTCCTGGTCCTGGTGTGTAATTC TGCCAATCAGGAAAATATCC-3′), were then used as templates in a third PCR reaction with the oligonucleotide primers, H6PCR1 and NCCPCR3 (SEQ ID NO: 92; 5′-ACTACTGAATTCTCGAGAAAAATTATGGTACTAGCTTGTAGCACCAACC-3′), to generate the PCR fragment, containing the H6-promoted CTL1 epitope, that was digested with NruI and EcoRI and cloned into p2-60-HIV.1) The plasmid generated by this manipulation is called p2-60-HIV.2.
  • The I3L-promoted CTL2 and H6-promoted CTL1 epitopes were then cloned between canarypox C6 flanking arms. This was accomplished by cloning the 640 bp XhoI fragment of p2-60-HIV.2, containing the two (2) nef CTL epitopes, into the XhoI site of pC6L. The plasmid generated by this manipulation is called p2-60-HIV.3. The DNA sequence of p2-60-HIV.3 (SEQ ID NOS: 93-96) is shown in FIG. 16. FIG. 16 shows the nucleotide sequence of the I3L-promoted nef CTL2 epitope and H6-promoted nef CTL1 epitope contained in p2-60-HIV.3:
  • NEF CTL epitopes
    FEATURES From To/Span Description
    frag
    1 51 C6 Left Arm
    pept 175 98 (C) nef CTL2
    frag 275 176 (C) I3L promoter
    frag 337 460 H6 promoter
    pept
    461 709 1 nef CTL1
    frag
    751 801 C6 Right Arm
  • The DNA sequence of the ALVAC C6 flanking arm (SEQ ID NOS: 97 and 98) is shown in FIGS. 17A-C. FIG. 17A to 17C show the nucleotide sequence of the C6 locus in pC6L:
  • C6 LOCUS
    pC6L
    FEATURES From To/Span Description
    frag
    1 381 C6 flanking arm
    frag 382 447 Cloning sites
    frag 448 1615 C6 flanking arm
  • p2-60HIV.3 was used in in vitro recombination experiments with vCP205 as the rescuing virus to yield vCP264.
  • Example 16 Generation of an ALVAC Recombinant Expressing HIV1 gag (+pro) (IIIB), gp120 (MN) (+transmembrane) and 2 nef (BRU) and 3 pol (IIIB) CTL Epitope Containing Regions
  • Expression cassettes encoding three (3) pol CTL epitopes, poll (amino acids 172-219), pol2 (amino acids 325-383) and pol3 (amino acids 461-519) (Ratner et al, 1985; Nixon and McMichael, 1991), were then inserted into vCP264. The insertion plasmid, pC5POLT5A, containing the three (3) pol CTL epitopes, was generated by cloning a 948 bp XhoI-BamHI fragment, containing the H6-promoted poll epitope, the I3L-promoted pol2 epitope and the 42K-promoted pol3 epitope, into the 2,940 bp XhoI-BamHI fragment of PBSK+. (The 948 bp XhoI-BamHI fragment was generated by the following procedure. A 183 bp PCR fragment, containing the poll epitope, was generated from the plasmid, pHXB2D, with the oligonucleotide primers, P1A (SEQ ID NO: 99; 5′-TTTGTATCGTAATGATTGAGACTGTACCAGTAAAATTAAAGCC-3′) and P1B (SEQ ID NO: 100; 5′-GGGCTGCAGGAATTCTAATCAATTAAGGCCCAATTTTTGAAATTTTCCCTTCCTTTTCC ATCTCTG-3′). A 224 bp PCR fragment, containing the pol2 epitope, was generated from the plasmid, pHXB2D, with the oligonucleotide primers, P2A (SEQ ID NO: 101; 5′-ACAAAGTACAATTATTTAGGTTTAATCATGGCAATATTCCAAAGTAGCATGAC-3′) and P2B (SEQ ID NO: 102; 5′-ATCATCCTCGAGAAAAATTAGGTAAGTCCCCACCTCAACAGATG-3′). A 236 bp PCR fragment, containing the pol3 epitope, was generated from the plasmid, pHXB2D, with the oligonucleotide primers, P3A (SEQ ID NO: 103; 5′-AAAATATATAATTACAATATAAAATGCCACTAACAGAAGAAGCAGAGCTAGAACTGGC-3′) and P3B (SEQ ID NO: 104; 5′-ATCATCTCTAGACTCGAGGATCCATAAAAATTATCCTGTTTTCAGATTTTTAAATGGCT C-3′). A 340 bp PCR fragment, containing the I3L and H6 promoters (in a head-to-head configuration) was generated from the plasmid, p2-60-HIV.2, with the oligonucleotide primers, P2IVH (SEQ ID NO: 105; 5′-GTCATGCTACTTTTGAATATTGCCATGATTAAACCTAAATAATTGTACTTTG-3,) and IVHP1 (SEQ ID NO: 106; 5′-TTTAATTTTACTGGTACAGTCTCAATCATTACGATACAAACTTAACGGATATCGCG-3′). A 168 bp PCR fragment, containing the 42K promoter, was generated from the plasmid, pVQ42KTh4.1, with the oligonucleotide primers, EPS42K (SEQ ID NO: 107; 5′-AATTGATTAGAATTCCTGCAGCCCGGGTCAAAAAAATATAAATG-3′) and 42 KP3B (SEQ ID NO: 108; 5′-CCAGTTCTAGCTCTGCTTCTTCTGTTAGTGGCATTTTATATTGTAATTATATATTTTC-3′). A 511 bp PCR fragment, containing the H6 promoter and I3L-promoted pol2 epitope, was generated by using the 224 bp PCR fragment, containing the pol2 epitope, and the 340 bp PCR fragment, containing the I3L and H6 promoters, as templates in a PCR reaction with the oligonucleotide primers, P2B and IVHP1. A 347 bp PCR fragment, containing the 42K-promoted pol3 epitope, was generated by using the 168 bp PCR fragment, containing the 42K promoter, and the 236 bp PCR fragment, containing the pol3 epitope, as templates in a PCR reaction with the oligonucleotide primers, IPS42K and P3B. A 506 bp PCR fragment, containing the poll epitope and the 42K-promoted pol3 epitope, was generated by using the 183 bp PCR fragment, containing the poll epitope, and the 347 bp PCR fragment, containing the 42K-promoted pol3 epitope, as templates in a PCR reaction with the oligonucleotide primers, P1A and P3B. A 977 bp PCR fragment, containing the H6-promoted poll epitope, the I3L-promoted pol2 epitope and the 42K-promoted pol3 epitope, was generated by using the 511 bp PCR fragment, containing the H6 promoter and I3L-promoted pol2 epitope, and the 506 bp PCR fragment, containing the poll epitope and 42K-promoted pol3 epitope, as templates in a PCR reaction with the oligonucleotide primers, P2B and P3B. The 977 bp PCR fragment was then digested with XhoI and BamHI and cloned into the 2,940 bp XhoI-BamHI fragment of pBSK+.) The plasmid generated by this manipulation is called pBSPOLT5.
  • Nucleotide sequence analysis of pBSPOLT5 indicated that there was an error in the pol2 epitope. In order to correct this mistake, the 948 bp XhoI-BamHI fragment, containing the H6-promoted poll epitope, the I3L-promoted pol2 epitope and the 42K-promoted pol3 epitope, was used as a template in a PCR reaction with the oligonucleotide primers, 13PCR1 (SEQ ID NO: 109; 5′-ATCATCGGATCCAAGCTTACATCATGCAGTGG-3′) and FIXPOL2 (SEQ ID NO: 110; 5′-ATCATCCTCGAGCTATTCAATTAGGTTGTAAGTCCCCACCTCAAC-3′). The resulting PCR fragment, containing the corrected I3L-promoted pol2 epitope, was digested with HindIII and XhoI and cloned into the 3,650 bp HindIII-XhoI fragment of pBSPOLT5. The plasmid generated by this manipulation is called pBSPOLT5A.
  • The H6-promoted poll epitope, I3L-promoted pol2 epitope and 42K-promoted pol3 epitope was then cloned between canary pox C5 flanking arms. This was accomplished by cloning the 897 bp BamHI-XhoI fragment of pBSPOLT5A, containing the H6-promoted poll epitope, the I3L-promoted pol2 epitope and the 42K-promoted pol3 epitope, into the 4,675 bp BamHI-XhoI fragment of pNC5L-SP5. The plasmid generated by this manipulation is called pC5POLT5A. The DNA sequence of pC5POLT5A (SEQ ID NOS: 111-115) is shown in FIGS. 18A-B. FIGS. 18A to 18B shows the nucleotide sequence of the I3L-promoted pol2 epitope, H6-promoted poll epitope and 42K-promoted pol3 epitope contained in pC5POLT5a:
  • POL CTL epitopes
    FEATURES From To/Span Description
    frag
    1 50 C5 Left Arm
    pept 272 92 (C) POL 2
    frag 372 273 (C) I3L promoter
    frag 377 500 H6 promoter
    pept 501 647 1 POL1
    frag 676 782 _42K promoter
    pept 783 962 1 POL 3
    frag 986 1035 C5 Right Arm
  • The DNA sequence of the ALVAC C5 flanking arm (SEQ ID NOS: 116 and 117) is shown in FIGS. 19A-C. FIGS. 19A to 19C show the nucleotide sequence of the C5 locus in pNC5L-SP5:
  • C5 LOCUS
    pNC5L-SP5
    FEATURES From To/Span Description
    frag
    1 1549 C5 flanking arm
    frag
    1550 1637 Cloning sites
    frag 1638 2049 C5 flanking arm
  • pC5POLT5A was used in in vitro recombination experiments with vCP264 as the rescuing virus to yield vCP300.
  • Example 17 Restriction and Immunoprecipitation Analyses
  • Restriction enzyme analysis was performed to confirm that the HIV1 sequences in vCP300 are in the proper loci. ALVAC, vCP205, vCP264 and vCP300 DNA were digested with HindIII, PstI or XhoI and the resultant fragments fractionated on an agarose gel. When the sizes of the resulting fragments were compared, it was determined that, as expected, the gag(+pro) and gp120(+transmembrane) genes were inserted into the C3 locus, the nef epitopes were inserted into the C6 locus and the pol epitopes were inserted into the C5 locus.
  • Immunoprecipitation analysis was performed to determine whether vCP300 expresses authentic HIV1gag and gp120(+transmembrane) gene products. HeLa cell monolayers were either mock infected or infected at an m.o.i. of 10 pfu/cell with ALVAC or vCP300. Following an hour adsorption period, the inoculum was aspirated and the cells were overlayed with 2 mls of modified Eagle's medium (minus methionine) containing 2% fetal bovine serum and [35S]-methionine (20 μCi/ml). Cells were harvested at 18 hrs post-infection by the addition of 1 ml 3× buffer A (3% NP-40, 30 mM Tris (pH7.4), 3 mM EDTA, 0.03% Na Azide and 0.6 mg/ml PMSF) and 50 ul aprotinin, with subsequent scraping of the cell monolayers. Lysates from the infected cells were analyzed for HIV1gag and gp120(+transmembrane) gene expression using serum from HIV1-seropositive individuals (obtained from New York State Department of Health). The sera was bound to Protein A-sepharose in an overnight incubation at 4° C. Following this incubation period, the material was washed 4× with 1× buffer A. Lysates, precleared with normal human sera and protein A-sepharose, were then incubated overnight at 4° C. with the HIV1-seropositive human sera bound to protein A-sepharose. After the overnight incubation period, the samples were washed 4× with 1× buffer A and 2× with a LiCl2/urea buffer. Precipitated proteins were dissociated from the immune complexes by the addition of 2× Laemmli's buffer (125 mM Tris (pH6.8), 4% SDS, 20% glycerol, 10% 2-mercaptoethanol) and boiling for 5 min. Proteins were fractionated on a 10% Dreyfuss gel system (Dreyfuss et al., 1984), fixed and treated with 1M Na-salicylate for fluorography. This analysis indicated that HIV1gag and gp120(+transmembrane) gene products were precipitated from vCP300-infected cells, but were not precipitated from mock infected or ALVAC-infected cells.
  • Expression of the nef and pol epitopes in vCP300-infected cells has not been confirmed because no epitope specific serological reagents are yet available. Nucleotide sequence analysis, however, has confirmed that the nef and pol sequences cloned into vCP300 are correct. PCR fragments, containing the nef and pol expression cassettes, were generated from vCP300 DNA. Nucleotide sequence analysis of these fragments indicated that the nef and pol sequences are correct. vCP205 expresses the same cell surface-associated form of HIV1 gp120 as expressed by vCP300. The immunogenicity of this gene product, as expressed by vCP205, has been assayed in small laboratory animals.
  • Example 18 Immunogenicity Studies
  • Groups of two rabbits or guinea pigs were inoculated intramuscularly (im) with 108 pfu of ALVAC, vCP205, or with 0.1 mg of peptide CLTB-36 (GPKEPFRDYVDRFYKNKRKRIHIGPGRAFYTTKN) (SEQ ID NOS: 118) adjuvanted with 0.05 mg of QS-21 according to the schedule below (Table 21).
  • TABLE 21
    Immunization schedule for rabbits and guinea pigs inoculated
    with ALVAC, vCP205, or with peptide CLTB-36 in QS-21.
    INOCULATION
    GROUP WEEK
    0 WEEK 4 WEEK 8
    1 ALVAC ALVAC CLTB-36/QS-21
    2 vCP205 vCP205 vCP205
    3 vCP205 vCP205 CLTB-36/QS-21
    4 CLTB-36/QS-21 CLTB-36/QS-21 CLTB-36/QS-21
  • Each rabbit and guinea pig was bled prior to the first inoculation and at 2-week intervals following the first inoculation through week 14. Serum was prepared from each blood sample and stored at −70° C. until use. Each serum was tested for antibody responses to recombinant HIV MN/BRU hybrid gp160 or to 25-mer synthetic HIV MN gp120 V3 loop (American Bio-Technologies, Inc. Cambridge, Mass., product # 686010) by kinetics enzyme-linked immunosorbant assay (KELISA).
  • Rabbits immunized with vCP205 (Group 2) produced the highest levels of anti-gp160 antibodies (FIG. 20). Rabbits were immunized according to the schedule in Table 21 (arrows in FIG. 20) and bled at 2 week intervals. Each serum was diluted 1:100 in dilution buffer and tested for reactivity with purified recombinant HIV MN/BRU gp160 using a kinetics ELISA. Both rabbits in this group began producing gp160 reactive antibodies after a single inoculation. Boosting with subsequent inoculations produced only minor increases in antibody levels. Rabbits inoculated twice with vCP205 and boosted with peptide CLTB-36 in QS-21 adjuvant (Group 3) apparently failed to make anti-gp160 antibodies when compared to control rabbits (Group 1). Of the rabbits immunized three times with peptide CLTB-36 in QS-21, only one responded by generating gp160-specific antibodies. The one responsive rabbit (A353) began producing gp160 antibodies only after the third immunization.
  • Rabbits immunized only with peptide CLTB-36 would not be expected to generate broadly reactive gp160-specific antibodies since the peptide contains only a small portion of the envelope glycoprotein, the V3 loop. Thus, sera were tested for reactivity to a peptide containing 25 amino acids of the HIV MN V3 loop (FIG. 21). Rabbits were immunized according to the schedule in Table 21 (arrows in FIG. 22) and bled at 2 week intervals. Each serum was diluted 1:100 in dilution buffer and tested for reactivity with a 25-mer synthetic peptide representing the HIV MN gp120 V3 loop (CNKRKRIHIGPGRAFYTTKNIIGTIC; (SEQ ID NO: 119) American Bio-Technologies, Inc. Cambridge, Mass., product # 686010) using a kinetics ELISA. As before, the highest V3 antibody responses were found in the sera of rabbits inoculated three times with vCP205. Two inoculations with vCP205 followed by peptide CLTB-36 in QS-21 produced anti-V3 antibody responses, but not as high as Group 2 rabbits. Also, as before, only one rabbit responded to three inoculations with peptide CLTB-36 in QS-21.
  • Guinea pigs in all groups, including one animal in Group 1, produced antibodies that reacted with HIV gp160 (FIG. 22). Guinea pigs were immunized according to the schedule in Table 21 (arrows in FIG. 22) and bled at 2 week intervals. Each serum was diluted 1:100 in dilution buffer and tested for reactivity with purified recombinant HIV MN/BRU gp160 using a kinetics ELISA. The single animal in Group 1 that responded did so only after inoculation with peptide CLTB-36 in QS-21 adjuvant. Antibody levels in the sera of all guinea pigs in Groups 2, 3, and 4 were similar. Most of the guinea pigs responded to a single inoculation by producing gp160 antibodies.
  • Similar results were seen using a HIV MN V3 25-mer peptide as the KELISA antigen (FIG. 23). Guinea pigs were immunized according to the schedule in Table 21 (arrows in FIG. 23) and bled at 2 week intervals. Each serum was diluted 1:100 in dilution buffer and tested for reactivity with a 25-mer synthetic peptide representing the HIV MN gp120 V3 loop (CNKRKRIHIGPGRAFYTTKNIIGTIC (SEQ ID NO: 120) American Bio-Technologies, Inc. Cambridge, Mass., product # 686010) using a kinetics ELISA. A single inoculation of peptide CLTB-36 in QS-21 elicited V3 antibody responses which were boosted by second and third inoculations. Two inoculations with vCP205 were necessary to induce V3 antibody responses which was boosted to higher levels by the third inoculation of vCP205 or CLTB-36 in QS-21.
  • Expression and immunogenicity of the Nef and Pol CTL epitopes expressed by vCP300 is demonstrated by the following in vitro assays. Fresh PBMC samples were derived from HIV-seropositive individuals. Twenty-percent of these cells were inoculated with vCP300 at an m.o.i. of 10. Two hours post-infection the cells were washed and mixed with autologous, uninoculated PBMCs at a ratio of uninoculated/inoculated of 10:1. (Seeding density equaled 1.5×106 cells/ml). On day 0, exogenous IL-7 was added at a final concentration of 1000 U/ml. On day three, the addition of an exogenous source of IL-7 and IL-2 was added at a final concentration of 1000 U/ml and 220 U/ml, respectively. After 12 days in culture, the in vitro stimulated cell population was used in a standard 51Cr-release assay using autologous Epstein-Barr virus-transformed B cells infected with vaccinia virus (WR) recombinants expressing HIV-1 proteins as targets. The results from assays obtained using an Effector/Target (E/T) cell ratio of 20:1 are shown in FIGS. 24 and 25 and expressed as percent specific lysis. The combined results demonstrate the ability of vCP300-infected PBMCs to stimulate HIV-1, Env-, Gag-, Pol-, and Nef-specific cytolytic activity. Further, abrogation of the cytolytic activities by anti-CD8 monoclonal antibodies demonstrates that the nature of the cell mediating the cytolytic activities are classical CD8+ CTLs.
  • In summary, the inoculation of rabbits and guinea pigs with the HIV ALVAC recombinant canarypox virus, vCP205, elicited antibodies to the HIV envelope glycoprotein and a region of the HIV envelope glycoprotein associated with neutralization of HIV, the gp120 V3 loop region. The expression and immunogenicity of the vCP300 expressed Env, Gag, Pol and Nef encoded products is demonstrated by the in vitro stimulation of CD8+ CTLs from seropositive individuals. Thus, vCP205 and vCP300 and precursors to these recombinants and expression products and DNA from these recombinants are useful, as described above.
  • Example 19 Generation of vCP1307; an ALVAC Recombinant Expressing a Form of HIV1 gp120+TM with 2 ELDKWA Epitopes Inserted into the gp120 V3 Loop
  • vCP1307, an ALVAC recombinant expressing HIV1 gp120+TM with 2 ELDKWA epitopes from HIV1 gp41 inserted into the gp120 V3 loop region, was generated by the following procedure. The sequence encoding part of the ELDKWA elements and V3 loop was cloned into pBSK+ (Stratagene, LaJolla, Calif.). This was accomplished by cloning a 225 bp EcoRI-SacI-digested PCR fragment, containing part of the ELDKWA-V3 loop sequence, into the 2,900 bp EcoRI-SacI fragment of pBSK+. (This PCR fragment was generated from the plasmid, pBSHIVMN120T, with the primers, HIVP72 (SEQ ID NO: 121; 5′-TTATTACCATTCCAAGTACTATT-3′) and HIVP74 (SEQ ID NO: 122) 5′-TCTGTACAAATTAATTGTACAAGACCCAACTACGAGCTCGACAAATGGGCCCATATAGGACC AGGGAGAGAATTGGATAAGTGGGCGAATATAATAGGAACTATAAGAC-3′).) The plasmid generated by this manipulation is called pHIV55.
  • pBSHIVMN120T, a plasmid containing the H6-promoted HIV1 gp120+TM gene, was generated by the following procedure. A plasmid, pMN1.8-9, containing a cDNA copy of the HIV1 (MN) env gene, was obtained from Marvin Reitz (NCI, NIH). An early transcription termination signal sequence, T5NT, in the env gene was modified. This was accomplished by cloning a 1,100 bp KpnI-EcoRI-digested PCR fragment, containing the T5NT-modified 5′-end of the env gene, into the 2,900 bp KpnI-EcoRI fragment of pBSK+. (This PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIVMN6 (SEQ ID NO: 123; 5′-GGGTTATTAATGATCTGTAG-3′) and HIV3B2 (SEQ ID NO: 124; 5′-GAATTACAGTAGAAGAATTCCCCTCCACAATTAAAAC-3′).) The plasmid generated by this manipulation is called pBSMIDMN.
  • The T5NT-modified 5′-end of the env gene was then cloned upstream to the rest of the env gene. This was accomplished by cloning the 1,025 bp KpnI-EcoRI fragment of pBSMIDMN, containing the T5NT-modified 5′-end of the env gene, into the 4,300 bp KpnI-EcoRI fragment of pBS3MN. (pBS3MN was generated by cloning a 430 bp EcoRI-SacI-digested PCR fragment, containing a central portion of the env gene, and a 1,050 bp SacI-XbaI-digested PCR fragment, containing the 3′-end of the env gene, into the 2,900 bp EcoRI-XbaI fragment of pBSK+. The 430 bp PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIV3B1 (SEQ ID NO: 125; 5′-GTTTTAATTGTGGAGGGGAATTCTTCTACTGTAATTC-3′) and HIVMN4 (SEQ ID NO: 126; 5′-ATCATCGAGCTCCTATCGCTGCTC-3′). The 1,050 bp PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIVMN5 (SEQ ID NO: 127; 5′-ATCATCGAGCTCTGTTCCTTGGGTTCTTAG-3′) and HIVMN3P (SEQ ID NO: 128; 5′-ATCATCTCTAGAATAAAAATTATAGCAAAGCCCTTTCCAAGCC-3′).) The plasmid generated by this manipulation is called pBSMID3MN.
  • The H6 promoter (Perkus et al., 1989) was then cloned upstream to the env gene. This was accomplished by cloning the 320 bp KpnI fragment of pH6IIIBE, containing the H6 promoter linked to the 5′-end of the HIV1 (IIIB) env gene, and the 2,450 bp KpnI-XbaI fragment of pBSMID3MN, containing the bulk of the HIV1 (MN) env gene, into the 2,900 bp KpnI-XbaI fragment of pBSK+. The plasmid generated by this manipulation is called pH6HMNE.
  • The sequence encoding gp41 was then replaced with the sequence encoding the HIV1 env transmembrane (TM) region. This was accomplished by cloning a 480 bp EcoRI-XbaI-digested PCR fragment, containing the 3′-end of the gp120 gene and the HIV1 env transmembrane region, into the 4,200 bp EcoRI-XbaI fragment of pH6HMNE. (This PCR fragment was generated from the PCR fragment, PCR-MN11, and oligonucleotides, HIVTM1 (SEQ ID NO: 129; 5′-TTATTCATAATGATAGTAGGAGGCTTGGTAGGTTTAAGAATAGTTTTTGCTGTACTCTCTGT AGTGAATAGAGTTAGGCAGGGATAA-3′) and HIVTM2 (SEQ ID NO: 130; 5′-TTATCCCTGCCTAACTCTATTCACTACAGAGAGTACAGCAAAAACTATTCTTAAACCTACCA AGCCTCCTACTATCATTATGAATAA-3′), with the oligonucleotides, HIV3B1 (SEQ ID NO: 125) and HIVTM3 (SEQ ID NO: 131; 5′-ATCATCTCTAGAATAAAAATTATCCCTGCCTAACTCTATTCAC-3′). PCR-MN11 was generated from the plasmid, pH6HMNE, with the oligonucleotides, HIV3B1 (SEQ ID NO: 125) and HIVMN18 (SEQ ID NO: 132; 5′-GCCTCCTACTATCATTATGAATAATCTTTTTTCTCTCTG-3′).) The plasmid generated by this manipulation is called pBSHIVMN120T.]
  • Another part of the sequence encoding the ELDKWA epitopes and V3 loop was then cloned into PBSK+. This was accomplished by cloning a 300 bp HindIII-SacI-digested PCR fragment, containing part of the ELDKWA-V3 loop sequence, into the 2,900 bp HindIII-SacI fragment of PBSK+. (This PCR fragment was generated from the plasmid, pBSHIVMN120T, with the primers, HIVP69 (SEQ ID NO: 133; 5′-TGATAGTACCAGCTATAGGTTGAT-3′) and HIVP75 (SEQ ID NO: 134; 5′-TTTGTCGAGCTCGTAGTTGGGTCTTGTACAATT-3′).) The plasmid generated by this manipulation is called pHIV56.
  • The ELDKWA-V3 loop sequences from pHIV55 and pHIV56 were then cloned into the H6-promoted gp120+TM gene. This was accomplished by cloning the 225 bp EcoRI-SacI fragment of pHIV55 and the 300 bp HindIII-SacI fragment of pHIV56, containing the ELDKWA-V3 loop sequences, into the 4,300 bp EcoRI-HindIII fragment of pBSHIVMN120T. The plasmid generated by this manipulation is called pHIV57.
  • The H6-promoted gp120+TM construct containing the ELDKWA epitopes was then cloned between C5 flanking arms. This was accomplished by cloning the 1,700 bp NruI-XbaI fragment of pHIV57, containing the H6-promoted gp120+TM (with ELDKWA epitopes) gene, into the 4,700 bp NruI-XbaI fragment of pSIVGC15. (pSIVGC15 contains the H6-promoted SIV env gene cloned between C5 flanking arms.) The plasmid generated by this manipulation is called pHIV59. The DNA sequence of the H6-promoted gp120+TM (with ELDKWA epitopes) gene in pHIV59 is shown in FIG. 26. pHIV59 was used in in vitro recombination experiments with ALVAC as the rescuing virus to yield vCP1307.
  • FACS analysis was performed to determine whether HIV1 gp120+TM (with ELDKWA epitopes) was expressed on the surface of vCP1307-infected cells. 5×106 HeLa-S3 cells in S-MEM (Sigma M-8028 Joklik suspension media) were infected at an m.o.i. of 5 pfu/cell with ALVAC, vP1286 (a WR recombinant expressing HIV1 gp120+TM) or vCP1307. Following a 60 minute adsorption period at 37° C., the cells were washed with 10 mls of S-MEM and centrifuged at 1,000 RPM for 5 minutes. The samples were then resuspended in 1 ml of S-MEM, transferred to 5 ml Sarstadt tubes and placed on a rotator at 37° C. After 18 hours, 200 ul aliquots (1×106 cells) were placed in polypropylene tubes and washed with 3 mls of PBS-CMF (with 0.2% NaN3+0.2% BSA). The supernatant was then decanted and the pellet was resuspended in 100 ul of a 1:100 dilution of sera from HIV1-seropositive humans (obtained from the New York State Dept. of Health) or a 1:100 dilution of a human monoclonal antibody specific for the ELDKWA epitope, IAM41-2F5 (obtained from Viral Testing Systems Corp., Houston, Tex.). The samples were incubated at 4° C. for 60 minutes, washed two times with PBS-CMF (with 0.2% NaN3+0.2% BSA) and centrifuged at 1,000 RPM for 5 minutes. The supernatant was decanted and the pellet was resuspended in a 1:100 dilution of goat anti-human FITC (obtained from Boehringer Mannheim). The samples were incubated at 4° C. for 30 minutes, washed twice with PBS-CMF (with 0.2% NaN3+0.2% BSA) and analyzed on a Facscan flow cytometer. A gene product containing the ELDKWA epitope was expressed at low levels on the surface of vCP1307-infected cells, but was not expressed on the surface of ALVAC-infected or vP1286-infected cells (FIG. 27, lower panel). A gene product reactive with the HIV1-seropositive sera was expressed on the surface of vP1286-infected cells and vCP1307-infected cells, but was not expressed on the surface of ALVAC-infected cells (FIG. 27, upper panel). These results indicate that the ELDKWA epitope of the HIV1 gp120+TM (with ELDKWA epitopes) gene product is expressed on the surface of vCP1307-infected cells, consistent with the fact that a portion of the V3 loop of this gene product has been replaced with ELDKWA epitopes.
  • Immunoprecipitation analysis was performed to determine whether vCP1307 expresses a form of gp120+TM which contains an immunogenic ELDKWA epitope. HeLa cell monolayers were infected at an m.o.i. of 10 pfu/cell with ALVAC (the parental virus), vP1286 (a WR recombinant expressing HIV1 gp120+TM) or vCP1307. Following an hour adsorption period, the inoculum was removed and the cells were overlayed with 2 mls of modified Eagle's medium (minus cysteine and methionine) containing 2% dialyzed fetal bovine serum and [35S]-TRANS label (30 μCi/ml). The lysates were harvested at 18 hrs post-infection by addition of 1 ml 3× buffer A (450 mM NaCl, 3% NP-40, 30 mM Tris (pH=7.4), 3 mM EDTA, 0.03% Na-Azide and 0.6 mg/ml PMSF) and analyzed for expression of 1) the ELDKWA epitope, using a 1:100 dilution of a human monoclonal antibody specific for the ELDKWA epitope, IAM41-2F5 (obtained from Viral Testing Systems Corp., Houston, Tex.) and 2) HIV1 gene products, using a 1:100 dilution of sera from HIV1-seropositive humans (obtained from the New York State Dept. of Health). Lysates, precleared with normal human sera and a protein A-sepharose complex, were incubated overnight at 4° C. with an IAM41-2F5-protein A-sepharose complex or an HIV1-seropositive sera-protein A-sepharose complex. The samples were washed 4× with 1× buffer A and 2× with a LiCl2/urea buffer. Precipitated proteins were dissociated from the immune complexes by the addition of 2× Laemmli's buffer (125 mM Tris (pH=6.8), 4% SDS, 20% glycerol, 10% 2-mercaptoethanol) and boiling for 5 min. Proteins were fractionated on an SDS-polyacrylamide gel, fixed and treated with 1 M Na-salicylate for fluorography. Proteins of the appropriate size were precipitated with the monoclonal antibody to the ELDKWA epitope from vCP1307-infected cells, but were not precipitated from ALVAC-infected cells or vP1286-infected cells. Furthermore, proteins of the appropriate size were precipitated with the human HIV1-seropositive sera from vP1286-infected cells and vCP1307-infected cells, but were not precipitated from ALVAC-infected cells. These results indicate that vCP1307 expresses a form of gp120+TM which contains an antigenic ELDKWA epitope.
  • Example 20 Generation of vP1313; a NYVAC Recombinant Expressing a Form of HIV1 gp120+TM with 2 ELDKWA Epitopes Inserted into the gp120 V3 Loop
  • vP1313, a NYVAC recombinant expressing HIV1 gp120+TM with 2 ELDKWA epitopes from HIV1 gp41 inserted into the gp120 V3 loop, was generated by the following procedure. The sequence encoding part of the ELDKWA epitopes and V3 loop was cloned into pBSK+. This was accomplished by cloning a 225 bp EcoRI-SacI-digested PCR fragment, containing part of the ELDKWA-V3 loop sequence, into the 2,900 bp EcoRI-SacI fragment of pBSK+. (This PCR fragment was generated from the plasmid, pBSHIVMN120T, with the primers, HIVP72 (SEQ ID NO: 144; 5′-TTATTACCATTCCAAGTACTATT-3′) and HIVP74 (SEQ ID NO: 145; 5′-TCTGTACAAATTAATTGTACAAGACCCAACTACGAGCTCGACAAATGGGCCCATATAGGACC AGGGAGAGAATTGGATAAGTGGGCGAATATAATAGGAACTATAAGAC-3′).) The plasmid generated by this manipulation is called pHIV55.
  • pBSHIVMN120T, a plasmid containing the H6-promoted HIV1 gp120+TM gene, was generated by the following procedure. A plasmid, pMN1.8-9, containing a cDNA copy of the HIV1 (MN) env gene, was obtained from Marvin Reitz (NCI, NIH). An early transcription termination signal sequence, T5NT, in the env gene was modified. This was accomplished by cloning a 1,100 bp KpnI-EcoRI-digested PCR fragment, containing the T5NT-modified 5′-end of the env gene, into the 2,900 bp KpnI-EcoRI fragment of pBSK+. (This PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIVMN6 (SEQ ID NO: 146; 5′-GGGTTATTAATGATCTGTAG-3′) and HIV3B2 (SEQ ID NO: 124; 5′-GAATTACAGTAGAAGAATTCCCCTCCACAATTAAAAC-3′).) The plasmid generated by this manipulation is called pBSMIDMN.
  • The T5NT-modified 5%-end of the env gene was then cloned upstream to the rest of the env gene. This was accomplished by cloning the 1,025 bp KpnI-EcoRI fragment of pBSMIDMN, containing the T5NT-modified 5′-end of the env gene, into the 4,300 bp KpnI-EcoRI fragment of pBS3MN. (pBS3MN was generated by cloning a 430 bp EcoRI-SacI-digested PCR fragment, containing a central portion of the env gene, and a 1,050 bp SacI-XbaI-digested PCR fragment, containing the 3′-end of the env gene, into the 2,900 bp EcoRI-XbaI fragment of pBSK+. The 430 bp PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIV3B1 (SEQ ID NO: 125; 5′-GTTTTAATTGTGGAGGGGAATTCTTCTACTGTAATTC-3′) and HIVMN4 (SEQ ID NO: 126; 5′-ATCATCGAGCTCCTATCGCTGCTC-3′). The 1,050 bp PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIVMN5 (SEQ ID NO: 127; 5′-ATCATCGAGCTCTGTTCCTTGGGTTCTTAG-3′) and HIVMN3P (SEQ ID NO: 128; 5′-ATCATCTCTAGAATAAAAATTATAGCAAAGCCCTTTCCAAGCC-3′).) The plasmid generated by this manipulation is called pBSMID3MN.
  • The H6 promoter was then cloned upstream to the env gene. This was accomplished by cloning the 320 bp KpnI fragment of pH6IIIBE, containing the H6 promoter linked to the 5′-end of the HIV1 (IIIB) env gene, and the 2,450 bp KpnI-XbaI fragment of pBSMID3MN, containing the bulk of the HIV1 (MN) env gene, into the 2,900 bp KpnI-XbaI fragment of pBSK+. The plasmid generated by this manipulation is called pH6HMNE.
  • The sequence encoding gp41 was then replaced with the sequence encoding the HIV1 env transmembrane (TM) region. This was accomplished by cloning a 480 bp EcoRI-XbaI-digested PCR fragment, containing the 3′-end of the gp120 gene and the HIV1 env transmembrane region, into the 4,200 bp EcoRI-XbaI fragment of pH6HMNE. (This PCR fragment was generated from the PCR fragment, PCR-MN11, and oligonucleotides, HIVTM1 (SEQ ID NO: 129; 5′-TTATTCATAATGATAGTAGGAGGCTTGGTAGGTTTAAGAATAGTTTTTGCTGTACTCTCTGT AGTGAATAGAGTTAGGCAGGGATAA-3′) and HIVTM2 (SEQ ID NO: 130; 5′-TTATCCCTGCCTAACTCTATTCACTACAGAGAGTACAGCAAAAACTATTCTTAAACCTACCA AGCCTCCTACTATCATTATGAATAA-3′), with the oligonucleotides, HIV3B1 (SEQ ID NO: 125) and HIVTM3 (SEQ ID NO: 131; 5′-ATCATCTCTAGAATAAAAATTATCCCTGCCTAACTCTATTCAC-3′). PCR-MN11 was generated from the plasmid, pH6HMNE, with the oligonucleotides, HIV3B1 (SEQ ID NO: 125) and HIVMN18 (SEQ ID NO: 132; 5′-GCCTCCTACTATCATTATGAATAATCTTTTTTCTCTCTG-3′).) The plasmid generated by this manipulation is called pBSHIVMN120T.]
  • Another part of the sequence encoding the ELDKWA epitopes and V3 loop was then cloned into pBSK+. This was accomplished by cloning a 300 bp HindIII-SacI-digested PCR fragment, containing part of the ELDKWA-V3 loop sequence, into the 2,900 bp HindIII-SacI fragment of pBSK+. (This PCR fragment was generated from the plasmid, pBSHIVMN120T, with the primers, HIVP69 (SEQ ID NO: 133; 5′-TGATAGTACCAGCTATAGGTTGAT-3′) and HIVP75 (SEQ ID NO: 134; 5′-TTTGTCGAGCTCGTAGTTGGGTCTTGTACAATT-3′).) The plasmid generated by this manipulation is called pHIV56.
  • The ELDKWA-V3 loop sequences from pHIV55 and pHIV56 were then cloned into the H6-promoted gp120+TM gene. This was accomplished by cloning the 225 bp EcoRI-SacI fragment of pHIV55 and the 300 bp HindIII-SacI fragment of pHIV56, containing the ELDKWA-V3 loop sequences, into the 4,300 bp EcoRI-HindIII fragment of pBSHIVMN120T. The plasmid generated by this manipulation is called pHIV57.
  • The H6-promoted gp120+TM construct containing the ELDKWA epitopes was then cloned between C5 flanking arms. This was accomplished by cloning the 1,700 bp NruI-XbaI fragment of pHIV57, containing the H6-promoted gp120+TM (with ELDKWA epitopes) gene, into the 4,700 bp NruI-XbaI fragment of pSIVGC15. (pSIVGC15 contains the H6-promoted SIV env gene cloned between C5 flanking arms) The plasmid generated by this manipulation is called pHIV59.
  • The H6-promoted gp120+TM (with ELDKWA epitopes) gene was then cloned between I4L flanking arms. This was accomplished by cloning the 1,850 bp BamHI-SmaI fragment of pHIV59, containing the H6-promoted gp120+TM (with ELDKWA epitopes) gene, into the 3,600 bp BamHI-SmaI fragment of pSD550VC. The plasmid generated by this manipulation is called pHIV60. The DNA sequence of the H6-promoted gp120+TM (with ELDKWA epitopes) gene in pHIV60 is shown in FIG. 28.
  • pHIV60 was used in in vitro recombination experiments with NYVAC as the rescuing virus to yield vP1313.
  • FACS analysis was performed to determine whether HIV1 gp120+TM (with ELDKWA epitopes) was expressed on the surface of vP1313-infected cells. 5×106 HeLa-S3 cells in S-MEM (Sigma M-8028 Joklik suspension media) were infected at an m.o.i. of 5 pfu/cell with NYVAC, vP1286 (a WR recombinant expressing HIV1 gp120+TM) or vP1313. Following a 60 minute adsorption period at 37° C., the cells were washed with 10 mls of S-MEM and centrifuged at 1,000 RPM for 5 minutes. The samples were then resuspended in 1 ml of S-MEM, transferred to 5 ml Sarstadt tubes and placed on a rotator at 37° C. After 18 hours, 200 ul aliquots (1×106 cells) were placed in polypropylene tubes and washed with 3 mls of PBS-CMF (with 0.2% NaN3+0.2% BSA). The supernatant was then decanted and the pellet was resuspended in 100 ul of a 1:100 dilution of sera from HIV1-seropositive humans (obtained from the New York State Dept. of Health), or a 1:100 dilution of a human monoclonal antibody specific for the ELDKWA epitope, IAM41-2F5 (obtained from Viral Testing Systems Corp. Houston, Tex.). The samples were incubated at 4° C. for 60 minutes, washed two times with PBS-CMF (with 0.2% NaN3+0.2% BSA) and centrifuged at 1,000 RPM for 5 minutes. The supernatant was decanted and the pellet was resuspended in a 1:100 dilution of goat anti-human FITC (obtained from Boehringer Mannheim). The samples were incubated at 4° C. for 30 minutes, washed twice with PBS-CMF (with 0.2% NaN3+0.2% BSA) and analyzed on a Facscan flow cytometer. A gene product containing the ELDKWA epitope was expressed on the surface of vP1313-infected cells, but was not expressed on the surface of NYVAC-infected or vP1286-infected cells (FIG. 29, lower panel). A gene product reactive with the HIV1-seropositive sera was expressed on the surface of vP1286-infected cells and vP1313-infected cells, but was not expressed on the surface of NYVAC-infected cells (FIG. 29, upper panel). These results indicate that the ELDKWA epitope of the HIV1 gp120+TM (with ELDKWA epitopes) gene product is expressed on the surface of vP1313-infected cells, consistent with the fact that a portion of the V3 loop of this gene product has been replaced with ELDKWA epitopes.
  • Immunoprecipitation analysis was performed to determine: whether vP1313 expresses a form of gp120+TM which contains an immunogenic ELDKWA epitope. HeLa cell monolayers were infected at an m.o.i. of 10 pfu/cell with NYVAC (the parental virus), vP1286 (a WR recombinant expressing HIV1 gp120+TM) or vP1313. Following an hour adsorption period, the inoculum was removed and the cells were overlayed with 2 mls of modified Eagle's medium (minus cysteine and methionine) containing 2% dialyzed fetal bovine serum and [35S]-TRANS label (30 μCi/ml). The lysates were harvested at 18 hrs post-infection by addition of 1 ml 3× buffer A (450 mM NaCl, 3% NP-40, 30 mM Tris (pH=7.4), 3 mM EDTA, 0.03% Na-Azide and 0.6 mg/ml PMSF) and analyzed for expression of 1) the ELDKWA epitope, using a 1:100 dilution of a human monoclonal antibody specific for the ELDKWA epitope, IAM41-2F5 (obtained from Viral Testing Systems Corp., Houston, Tex.) and 2) HIV1 gene products, using a 1:100 dilution of sera from HIV1-seropositive humans (obtained from the New York State Dept. of Health). Lysates, precleared with normal human sera and a protein A-sepharose complex, were incubated overnight at 4° C. with an IAM41-2F5-protein A-sepharose complex or an HIV1-seropositive sera-protein A-sepharose complex. The samples were washed 4× with 1× buffer A and 2× with a LiCl2/urea buffer. Precipitated proteins were dissociated from the immune complexes by the addition of 2× Laemmli's buffer (125 mM Tris (pH=6.8), 4% SDS, 20% glycerol, 10% 2-mercaptoethanol) and boiling for 5 min. Proteins were fractionated on an SDS-polyacrylamide gel, fixed and treated with 1 M Na-salicylate for fluorography. Proteins of the appropriate size were precipitated with the monoclonal antibody to the ELDKWA epitope from vP1313-infected cells, but were not precipitated from NYVAC-infected cells or vP1286-infected cells. Furthermore, proteins of the appropriate size were precipitated with the human HIV1-seropositive sera from vP1286-infected cells and vP1313-infected cells, but were not precipitated from NYVAC-infected cells. These results indicate that vP1313 expresses a form of gp120+TM which contains an immunogenic ELDKWA epitope.
  • Example 21 Generation of vP1319; a COPAK Recombinant Expressing a Form of HIV1 gp120+TM with 2 ELDKWA Epitopes Inserted into the gp120 V3 Loop
  • vP1319, a COPAK recombinant expressing HIV1 gp120+TM with 2 ELDKWA epitopes from HIV1 gp41 inserted into the gp120 V3 loop, was generated by the following procedure. The sequence encoding part of the ELDKWA epitopes and V3 loop was cloned into pBSK+. This was accomplished by cloning a 225 bp EcoRI-SacI-digested PCR fragment, containing part of the ELDKWA-V3 loop sequence, into the 2,900 bp EcoRI-SacI fragment of pBSK+. (This PCR fragment was generated from the plasmid, pBSHIVMN120T, with the primers, HIVP72 (SEQ ID NO: 121; 5′-TTATTACCATTCCAAGTACTATT-3′) and HIVP74 (SEQ ID NO: 122; 5′-TCTGTACAAATTAATTGTACAAGACCCAACTACGAGCTCGACAAATGGGCCCATATAGGACC AGGGAGAGAATTGGATAAGTGGGCGAATATAATAGGAACTATAAGAC-3′).) The plasmid generated by this manipulation is called pHIV55. pBSHIVMN120T, a plasmid containing the H6-promoted HIV1 gp120+TM gene, was generated by the following procedure. A plasmid, pMN1.8-9, containing a cDNA copy of the HIV1 (MN) env gene, was obtained from Marvin Reitz (NCI, NIH). An early transcription termination signal sequence, T5NT, in the env gene was modified. This was accomplished by cloning a 1,100 bp KpnI-EcoRI-digested PCR fragment, containing the T5NT-modified 5′-end of the env gene, into the 2,900 bp KpnI-EcoRI fragment of pBSK+. (This PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIVMN6 (SEQ ID NO: 123; 5′-GGGTTATTAATGATCTGTAG-3′) and HIV3B2 (SEQ ID NO: 124; 5′-GAATTACAGTAGAAGAATTCCCCTCCACAATTAAAAC-3′).) The plasmid generated by this manipulation is called pBSMIDMN.
  • The T5NT-modified 5′-end of the env gene was then cloned upstream to the rest of the env gene. This was accomplished by cloning the 1,025 bp KpnI-EcoRI fragment of pBSMIDMN, containing the T5NT-modified 5′-end of the env gene, into the 4,300 bp KpnI-EcoRI fragment of pBS3MN. (pBS3MN was generated by cloning a 430 bp EcoRI-SacI-digested PCR fragment, containing a central portion of the env gene, and a 1,050 bp SacI-XbaI-digested PCR fragment, containing the 3′-end of the env gene, into the 2,900 bp EcoRI-XbaI fragment of pBSK+. The 430 bp PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIV3B1 (SEQ ID NO: 125; 5′-GTTTTAATTGTGGAGGGGAATTCTTCTACTGTAATTC-3′) and HIVMN4 (SEQ ID NO: 126; 5′-ATCATCGAGCTCCTATCGCTGCTC-3′). The 1,050 bp PCR fragment was generated from the plasmid, pMN1.8-9, with the oligonucleotides, HIVMN5 (SEQ ID NO: 127; 5′-ATCATCGAGCTCTGTTCCTTGGGTTCTTAG-3′) and HIVMN3P (SEQ ID NO: 128; 5′-ATCATCTCTAGAATAAAAATTATAGCAAAGCCCTTTCCAAGCC-3′).) The plasmid generated by this manipulation is called pBSMID3MN.
  • The H6 promoter was then cloned upstream to the env gene. This was accomplished by cloning the 320 bp KpnI fragment of pH6IIIBE, containing the H6 promoter linked to the 5′-end of the HIV1 (IIIB) env gene, and the 2,450 bp KpnI-XbaI fragment of pBSMID3MN, containing the bulk of the HIV1 (MN) env gene, into the 2,900 bp KpnI-XbaI fragment of pBSK+. The plasmid generated by this manipulation is called pH6HMNE.
  • The sequence encoding gp41 was then replaced with the sequence encoding the HIV1 env transmembrane (TM) region. This was accomplished by cloning a 480 bp EcoRI-XbaI-digested PCR fragment, containing the 3′-end of the gp120 gene and the HIV1 env transmembrane region, into the 4,200 bp EcoRI-XbaI fragment of pH6HMNE. (This PCR fragment was generated from the PCR fragment, PCR-MN11, and oligonucleotides, HIVTM1 (SEQ ID NO: 129; 5′-TTATTCATAATGATAGTAGGAGGCTTGGTAGGTTTAAGAATAGTTTTTGCTGTACTCTCTGT AGTGAATAGAGTTAGGCAGGGATAA-3′) and HIVTM2 (SEQ ID NO: 130; 5′-TTATCCCTGCCTAACTCTATTCACTACAGAGAGTACAGCAAAAACTATTCTTAAACCTACCA AGCCTCCTACTATCATTATGAATAA-3′), with the oligonucleotides, HIV3B1 (SEQ ID NO: 125) and HIVTM3 (SEQ ID NO: 131; 5′-ATCATCTCTAGAATAAAAATTATCCCTGCCTAACTCTATTCAC-3′). PCR-MN11 was generated from the plasmid, pH6HMNE, with the oligonucleotides, HIV3B1 (SEQ ID NO: 125) and HIVMN18 (SEQ ID NO: 132; 5′-GCCTCCTACTATCATTATGAATAATCTTTTTTCTCTCTG-3′).) The plasmid generated by this manipulation is called pBSHIVMN120T.
  • Another part of the sequence encoding the ELDKWA epitopes and V3 loop was then cloned into pBSK+. This was accomplished by cloning a 300 bp HindIII-SacI-digested PCR fragment, containing part of the ELDKWA-V3 loop sequence, into the 2,900 bp HindIII-SacI fragment of pBSK+. (This PCR fragment was generated from the plasmid, pBSHIVMN120T, with the primers, HIVP69 (SEQ ID NO: 133; 5′-TGATAGTACCAGCTATAGGTTGAT-3′) and HIVP75 (SEQ ID NO: 134; 5′-TTTGTCGAGCTCGTAGTTGGGTCTTGTACAATT-3′).) The plasmid generated by this manipulation is called pHIV56.
  • The ELDKWA-V3 loop sequences from pHIV55 and pHIV56 were then cloned into the H6-promoted gp120+TM gene. This was accomplished by cloning the 225 bp EcoRI-SacI fragment of pHIV55 and the 300 bp HindIII-SacI fragment of pHIV56, containing the ELDKWA-V3 loop sequences, into the 4,300 bp EcoRI-HindIII fragment of pBSHIVMN120T. The plasmid generated by this manipulation is called pHIV57.
  • The H6-promoted gp120+TM construct containing the ELDKWA epitopes was then cloned between C5 flanking arms. This was accomplished by cloning the 1,700 bp NruI-XbaI fragment of pHIV57, containing the H6-promoted gp120+TM (with ELDKWA epitopes) gene, into the 4,700 bp NruI-XbaI fragment of pSIVGC15. (pSIVGC15 contains the H6-promoted SIV env gene cloned between C5 flanking arms.) The plasmid generated by this manipulation is called pHIV59.
  • The H6-promoted gp120+TM (with ELDKWA epitopes) gene was then cloned between COPAK flanking arms. This was accomplished by cloning the 1,850 bp BamHI-SmaI fragment of pHIV59, containing the H6-promoted gp120+TM (with ELDKWA epitopes) gene, into the 4,600 bp BamHI-SmaI fragment of pSD553VC. The plasmid generated by this manipulation is called pHIV61. The DNA sequence of the H6-promoted gp120+TM (with ELDKWA epitopes) gene in pHIV61 is shown in FIG. 30.
  • pHIV61 was used in in vitro recombination experiments with COPAK as the rescuing virus to yield vP1319.
  • FACS analysis was performed to determine whether HIV1 gp120+TM (with ELDKWA epitopes) was expressed on the surface of vP1319-infected cells. 5×106 HeLa-S3 cells in S-MEM (Sigma M-8028 Joklik suspension media) were infected at an m.o.i. of 5 pfu/cell with WR, vP1286 (a WR recombinant expressing HIV1 gp120+TM) or vP1319. Following a 60 minute adsorption period at 37° C., the cells were washed with 10 mls of S-MEM and centrifuged at 1,000 RPM for 5 minutes. The samples were then resuspended in 1 ml of S-MEM, transferred to 5 ml Sarstadt tubes and placed on a rotator at 37° C. After 18 hours, 200 ul aliquots (1×106 cells) were placed in polypropylene tubes and washed with 3 mls of PBS-CMF (with 0.2% NaN3+0.2% BSA). The supernatant was then decanted and the pellet was resuspended in 100 ul of a 1:100 dilution of sera from HIV1-seropositive humans (obtained from the New York State Dept. of Health), a 1:500 dilution of a mouse monoclonal antibody specific for the HIV1 (MN) V3 loop, 50.1 (obtained from M. Robert-Guroff, NCI, NIH.) or a 1:100 dilution of a human monoclonal antibody specific for the ELDKWA epitope, IAM41-2F5 (obtained from Viral Testing Systems Corp., Houston, Tex.). The samples were incubated at 4° C. for 60 minutes, washed two times with PBS-CMF (with 0.2% NaN3+0.2% BSA) and centrifuged at 1,000 RPM for 5 minutes. The supernatant was decanted and the pellet was resuspended in a 1:100 dilution of goat anti-human FITC or goat anti-mouse FITC (obtained from Boehringer Mannheim). The samples were incubated at 4° C. for 30 minutes, washed twice with PBS-CMF (with 0.2% NaN3+0.2% BSA) and analyzed on a Facscan flow cytometer. A gene product containing the ELDKWA epitope was expressed on the surface of vP1319-infected cells, but was not expressed on the surface of WR-infected cells or vP1286-infected cells (FIG. 31, middle panel). A gene product containing the V3 loop was expressed on the surface of vP1286-infected cells, but was not expressed on the surface of WR-infected cells or vP1319-infected cells (FIG. 31, lower panel). A gene product reactive with the HIV1-seropositive sera was expressed on the surface of vP1286-infected cells and vP1319-infected cells, but was not expressed on the surface of WR-infected cells (FIG. 31, upper panel). This analysis indicated that 1) the ELDKWA epitope of the HIV1 gp120+TM (with ELDKWA epitopes) gene product is expressed on the surface of vP1319-infected cells and 2) the gene product expressed on the surface of vP1319-infected cells does not contain a wild-type V3 loop, consistent with the fact that the V3 loop of this gene product has been replaced with ELDKWA epitopes.
  • Immunoprecipitation analysis was performed to determine whether vP1319 expresses a form of gp120+TM which contains an immunogenic ELDKWA epitope. HeLa cell monolayers were infected at an m.o.i. of 10 pfu/cell with NYVAC (the parental virus), vP1286 (a WR recombinant expressing HIV1 gp120+TM) or vP1319. Following an hour adsorption period, the inoculum was removed and the cells were overlayed with 2 mls of modified Eagle's medium (minus cysteine and methionine) containing 2% dialyzed fetal bovine serum and [35S]-TRANS label (30 μCi/ml). The lysates were harvested at 18 hrs post-infection by addition of 1 ml 3× buffer A (450 mM NaCl, 3% NP-40, 30 mM Tris (pH=7.4), 3 mM EDTA, 0.03% Na-Azide and 0.6 mg/ml PMSF) and analyzed for expression of 1) the ELDKWA epitope, using a 1:100 dilution of a human monoclonal antibody specific for the ELDKWA epitope, IAM41-2F5 (obtained from Viral Testing Systems Corp., Houston, Tex.) and 2) HIV1 gene products, using a 1:100 dilution of sera from HIV1-seropositive humans (obtained from the New York State Dept. of Health). Lysates, precleared with normal human sera and a protein A-sepharose complex, were incubated overnight at 4° C. with an IAM41-2F5-protein A-sepharose complex or an HIV1-seropositive sera-protein A-sepharose complex. The samples were washed 4× with 1× buffer A and 2× with a LiCl2/urea buffer. Precipitated proteins were dissociated from the immune complexes by the addition of 2× Laemmli's buffer (125 mM Tris (pH=6.8), 4% SDS, 20% glycerol, 10% 2-mercaptoethanol) and boiling for 5 min. Proteins were fractionated on an SDS-polyacrylamide gel, fixed and treated with 1 M Na-salicylate for fluorography. Proteins of the appropriate size were precipitated with the monoclonal antibody to the ELDKWA epitope from vP1319-infected cells, but were not precipitated from NYVAC-infected cells or vP1286-infected cells. Furthermore, proteins of the appropriate size were precipitated with the human HIV1-seropositive sera from vP1286-infected cells and vP1319-infected cells, but were not precipitated from NYVAC-infected cells. These results indicate that vP1319 expresses a form of gp120+TM which contains an immunogenic ELDKWA epitope.
  • Since vCP1307, vP1313 and vP1319 each express the ELDKWA epitope in an immunogenic configuration, these recombinants have numerous utilities, as do the expression products, antibodies elicited thereby, and DNA from these recombinants, as discussed above.
  • Example 22 Inocuity and the Immunogenicity of vCP205 in Macaques Inoculated by Intramuscular Route Experimental Animals:
  • Species: Macaca fascicularis (adult, wild caught)
  • Number: 8 Sex: Males
  • Origin: Mauritius Island considered free of Herpes B,
    Filovirus and Tuberculosis. Previous history: polio experiments.
    Diet and drinking water: Commercial diet and fruits; tap water ad libitum.
  • Four male Cynomolgus macaques were inoculated five times, at one month intervals, with one dose of ALVAC-HIV (vCP205) (containing 105.8 TCID50/dose) by intramuscular route. The injections caused neither symptoms nor lesions. Body weight of monkeys was not altered by the injections. Four control animals were injected with placebo. (Mixture of DMEM-F12 medium (25%), Lactoglutamate (25%) and freeze-drying substrate (50%)). General condition was monitored daily and injection sites were observed on days 1, 2, 3, 4 and 7 after each inoculation. Body weights were recorded once a week.
  • Blood samples were collected in EDTA blood collection Vacutainer® tubes (Becton-Dickinson, Meyland, France) for hematological analyses, in lithium-heparin microvette CB 100 tubes (Sarstedt, Nümbrecht, Germany) for biochemical analysis and in tubes with serum separator SST Vacutainer® tubes (Becton-Dickinson, Meylan, France) for serological analyses (MON:TSA.034.00). Samplings were done on days 0, 3, 7, 14, 28, 31, 35, 42, 56, 59, 63, 70, 84, 87, 91, 98, 112, 115, 119, 126 and 140. Anesthesia (Ketamine, 20 mg/kg, intramuscular) was used for clinical examinations and blood sampling.
  • Hematological and biochemical analysis were carried out with the VET TEST 8008 Apparatus. Anti-HIV gp160, p24 proteins and V3 peptide antibodies were titered according to an ELISA technique. Maxisorp F96 NUNC plates wells were coated for 1 hour at 37° C., with one of the following antigens diluted in 0.1 M carbonate buffer, pH 9.6:
      • 130 ng per well of purified gp160 MN/BRU (from recombinant vaccinia containing 30% of cleaved gp160 and no alpha2 macroglobulin),
      • 200 ng of V3MN peptide,
      • 130 ng of purified “p24”HIV (E. coli, P25 LAI isolate, batch 672Cl, Transgene).
  • All incubations were carried out in a final volume of 100 μl, followed by 3 washings performed with phosphate buffered saline, pH 7.1-0.1% Tween 20. Plates were blocked for 1 hour at 37° C. with 150 μl of phosphate buffered saline pH 7.1-0.05% Tween 20-5% (W/V) powdered skim milk (Gloria).
  • Serial threefold dilutions of the sera, ranging from 1/50 to 1/12150, in phosphate buffered saline—0.05% Tween 20-5% (W/V) powdered skim milk, were added to the wells and incubated for 90 min at 37° C.
  • After washing, anti-monkey IgG peroxidase conjugate (Cappel, goat IgG fraction), diluted 1/3000 in phosphate buffered saline—0.5% Tween 20-5% powdered skim milk, was added and the plates incubated for another 90 min at 37° C. The plates, washed four times, were incubated in the dark for 30 min at room temperature with the substrate O-phenylenediamine dihydrochloride (Sigma tablets). The substrate was used at the concentration of 1.5 mg/ml in 0.05 M phosphate citrate buffer, pH 5.0 containing 0.03 containing 0.03% sodium perborate (Sigma capsules).
  • The reactions were stopped with 50 μl of 4N H2SO4. The optical density was measured at 490-650 nm with an automatic plate reader (Vmax, Molecular Devices). The antibody titers were calculated according to the formula:
  • Titer = log OD 490 - 650 × 10 1 / dilution ( OD value range : 0.2 to 1 )
  • Neutralizing antibody assay determines the dilution of serum that prevents the development of syncytia in 50% of microwells infected with 10 TCID50 of HIV MN. The MN strain was obtained from F. Barre-Sinoussi and propagated in CEM clone 166 cells.
  • Sera were decomplemented and twofold serial dilutions in RPMI beginning 1/10 were prepared. Equal volumes of serum dilution and HIV suspension (500 ul each) were mixed and incubated for 2 h at 37° C. The HIV suspension had been adjusted to contain 102 to 102.5 TCID50 per ml.
  • Prior to use, indicator CEMss cells were plated in microwells coated with poly-L-lysine, and incubated for 1 h at 37° C. Culture medium was removed and replaced with the virus/serum mixtures (100 μl/well, 6 wells per dilution). After 1 h incubation at 37° C. culture medium was added to each well and the plates were incubated at 37° C. All incubations were in a CO 2 5% incubator.
  • Seven and 14 days later, the cultures were examined under the microscope and wells showing syncytia were recorded. Neutralizing 50% titer was computed according to SPEARMAN and KÄRBER and expressed as the log10 of the end-point. As a confirmation, supernatants of the cultures were collected on day seven, pooled for each dilution and assayed for RT activity. Each assay includes an infectivity titration of the virus suspension, titration of antibody in a reference serum and a set of uninfected microwells as negative controls.
  • Results:
  • A majority of the parameters selected to monitor hematological and biochemical status varied within normal limits, including: erythrocyte number, mean corpuscle volume, hematocrite, creatinin and alanine aminotransferase.
  • Some variations were seen, which cannot be attributed to the repeated immunizations with ALVAC-HIV (vCP205): i) unexplained lymphocytosis on weeks 8 and 9 in both the test and the control groups; ii) a decreased level of hemoglobin in both groups on weeks 17 and 20 and in control groups; ii) a decreased level of hemoglobin in both groups on weeks 17 and 20 and in controls on week 9; iii) erratic high values of the aspartate aminotransferase in two control monkeys and last; iv) irregular trombocytes counts caused by microcoagulation of some specimens.
  • The anti-HIV immune response induced by vCP205 was assessed by ELISA tests using purified gp160 MN/BRU (from recombinant vaccinia), V3MN synthetic peptide and p24 (from E. coli, LAI isolate). All the animals developed antibodies against gp160 and V3, and 2/4 against p24. The positive anti-HIV immune response usually appeared after 2, or maximum, 3 injections. Subsequent vCP205 inoculations mainly maintained (sometimes slightly increased) the antibody levels and improved homogeneity of the response between macaques. Highest antibody titers were usually observed two weeks after each inoculation, followed by a decrease until the next booster. Neutralizing antibodies against HIV/MN were detectable in all immunized monkeys.
  • Clinical observation: neither erythema nor edema were reported at the site of inoculation. Body weights were stable in control monkeys and in ALVAC-HIV (vCP205) recipients (FIG. 32).
  • Hematological analyses: Leucocyte counts were greatly modified in both control and tested animals on weeks 8 and 9 with formula inversion (FIG. 33 a). This fact, noted in both groups, is without correlation with the viral injections.
  • Erythrocyte number, corpuscle mean volume and hematocrite varied within normal limits but hemoglobin showed some discrepancy on weeks 9, 17 and 20 in controls and on weeks 17 and 20 in animals inoculated with ALVAC-HIV (vCP205) (FIGS. 33 b and c). Thrombocytes values varied depending on the sampling quality (microcoagulation) (FIG. 33 c).
  • Biochemical analyses: Creatinin and ALAT (SGPTransaminase) did not vary significantly after the reiterated inoculations FIGS. 34 and 36). The AST (SGOTransaminase) values presented variations particularly important in control monkeys # 3 and 2 respectively on week 5 and 8-9 (FIG. 35).
  • Serological analyses (considering the ELISA titers of the negative control group of macaques sera, the negative detection threshold of the serological response was considered to be, in log10: 1.56±0.24, 1.92±0.12 and 2.18±0.34, for gp160, V3 and p24 respectively): gp160 and V3 specific response (FIGS. 37 a-37 b, 38 a-38 b): the kinetics of antibody of gp160 was similar to that to V3. The magnitude of the latter was slightly weaker (mean titer at week 20 of 4.37 versus 8.84).
  • Two injections were necessary to induce a detectable immune response. Three monkeys showed a maximum response after the second injection; the fourth one required three (gp160) or four (V3) injections to do so. During the four week interval between injections, antibody titers consistently increased then faded, to be boosted by the next inoculation. While there were significant individual differences in the responses to the initial injections, the responses leveled out as the experiment progressed.
  • p24 a specific response (FIGS. 37 c, 38 c): a response was observed for 2 macaques (macaques 5 and 7) out of 4 after respectively 2 and 3 injections of vCP205. This is in contrast with a guinea-pig test in which no anti-p24 antibodies were detected in any inoculated animal groups. As with anti-gp160 and anti-V3 antibodies, titers fluctuated up and down between injections and individual differences progressively disappeared. Unlike that of gp160 and V3, the anti-p24 antibody profile did not reach a plateau.
  • Neutralizing antibody: as shown in FIG. 39, all four monkeys with vCP205 developed detectable levels of neutralizing antibody against HIV (MN). One of them tested positive after one injection, two after the second injection and the last one required five administrations. It is noteworthy that the latter animal also showed the slowest kinetics of ELISA antibody. The levels of neutralizing activity are relatively modest (1/10 to 1/30 in arithmetical expression) and, likewise ELISA measurements, went up and down in the intervals between injections.
  • Effect of a late boost with the proteins gp160 and p24: The four monkeys were boosted 7 weeks post the last injection of vCP205 with 200 μg of gp160 and 200 μg of p24 proteins in incomplete Freund's adjuvant (Montanide ISA51) to raise hyperimmune reference sera; this caused a pronounced increase (at least 10-fold) in antibody titers, suggesting that the plateau seen in the ELISA analysis were not the limit of response.
  • The immunization regimen induced high levels of binding antibody to gp160 MN/BRU and V3 MN peptide, and low but definite neutralizing antibody. Serological results showed higher antibody levels than those observed in macaques inoculated with ALVAC-HIV (vCP125) and one booster (instead of two) was sufficient to obtain a good anamnestic type response. This Example shows that vCP205 and expression products thereof, antibodies therefrom, and DNA from vCP205, can be used as described above.
  • Example 23 Inocuity and Immunogenicity of vCP300 In Macaques Experimental Animals:
  • Species: Macaca fascicularis
  • Number: 8 Sex: Males
  • Origin: Mauritius Island considered without Herpes B, Filovirus and tuberculosis.
  • Four male Cynomolgus macaques were immunized five times, at one month intervals, with one dose of ALVAC-HIV (vCP300) (containing 106.16 TCID50/dose) by intramuscular route. Four control animals were injected with placebo. As a sixth injection, all the animals received ALVAC-HIV (vCP300) by intravenous route. The regimen was as follows:
  • Group #1 Product: Placebo
  • Route: Intramuscular alternately in the left or right deltoid muscle
  • Volume: 1 ml
  • Number of injections: 5 (on weeks 0, 4, 8, 12 and 16).
  • Group #2 Product: ALVAC-HIV
  • Route: Intramuscular alternately in the left or right deltoid muscle.
  • Volume: 1 ml. Dose: 106.16 TCID50.
  • Number of injections: 5 (on weeks 0, 4, 8, 12 and 16).
  • Groups #1 and #2
  • On week 20
    Product: ALVAC-HIV (vCP300)
  • Route: Intravenous Volume: 1 ml Dose: 106.16 TCID50.
  • Number of injections: 1.
  • Clinical observations: Injection site was observed on days 1, 2, 3, 4 and 7 following each inoculation. Animals were weighed once a week. Samplings: Blood samples were taken under ketamin anesthesia from the femoral vein. Blood was collected in the following order in Vacutainer tubes (Becton Dickinson, Meylan, France):
  • 1) 1.8 ml in 0.129M buffered sodium citrated tube (prothrombine).
    2) 1 ml in 5 mg sodium fluoride and 4 mg potassium oxalate tube (glucose).
    3) 2 ml in 0.17M EDTA K3 tube (hematological analyses).
    4) 2 to 3 ml in tubes for serum separation with inert barrier material and clot activator (biochemical and serological analyses).
  • Samplings were done on days 0, 3, 7, 14, 28, 31, 35, 42, 56, 59, 63, 70, 84, 87, 91, 98, 112, 119, 126, 140 and 143.
  • Dosages:
  • Hematological analyses included: blood counts and differential leucocyte counts, hemoglobin, thrombocytes, prothrombin, reticulocytes and sedimentation rate.
  • Biochemical analyses included: sodium, potassium, glucose, alkalin phosphatases, cholesterol, total proteins and electrophoresis, transaminases SGOT and SGPT.
  • Serological analyses: Anti-HIV gp160 glycoprotein, p24 protein, V3 peptide and nef protein antibodies were titrated according to a modification of the ELISA technique:
  • Maxisorp F96 NUNC plates wells were coated for 1 hour at 37° C., then overnight at 4° C., with one of the following antigens diluted in 0.1 M carbonate buffer, pH 9.6:
      • 130 ng per well of purified gp160 MN/BRU (from recombinant vaccinia VVTG 5156),
      • 200 ng of V3MN peptide,
      • 130 ng of purified p24 HIV (E. coli, p25 LAI isolate, batch 672Cl, Transgene).
  • All incubations were carried out in a final volume of 100 μl, followed by 3 washings performed with phosphate buffered saline, pH 7.1-0.1% Tween 20. Plates were blocked for 1 hour at 37° C. with 150 μl of phosphate buffered saline pH 7.1-0.05% Tween 20-5% (W/V) powdered skim milk (Gloria). Serial threefold dilutions of the sera, ranging from 1/50 to 1/12150 or 1/500 to 1/121500, in phosphate buffered saline—0.05% Tween 20-5% (W/V) powdered skim milk, were added to the wells and incubated for 90 min. at 37° C.
  • After washing, anti-monkey IgG peroxidase conjugate (Cappel, goat IgG fraction), diluted 1/3000 in phosphate buffered saline—0.05% Tween 20-5% powdered skim milk, was added and the plates incubated for another 90 min. at 37° C. The plates, washed four times, were incubated in the dark for 30 min. at room temperature with the substrate O-phenylenediamine dihydrochloride (Sigma tablets), the substrate was used at the concentration of 1.5 mg/ml in 0.05 M phosphate citrate buffer, pH 5.0 containing 0.03% sodium perborate (Sigma capsules). The reactions were stopped with 50 μl of 4N H2SO4.
  • The optical density was measured at 490-650 nm with an automatic plate reader (Vmax, Molecular Devices). The blanks were subtracted and the values of the duplicates averaged. The antibody titers were calculated for the OD value range of 0.2 to 1.2, from the regression curve of a standard anti-gp160 and anti-p24 hyperimmune serum of guinea-pig which was present on each ELISA plate. The titer of the standard serum had been previously determined according to the formula:
  • Titer = log OD 490 - 650 × 10 1 / dilution ( OD value range : 0.2 to 1.2 )
  • Since no standard monkey anti-nef serum was available, the determination of anti-nef antibodies was performed by including in the test a reference monoclonal mouse antibody (anti-nef HIV1 ALI, MATG0020, Transgene) as an internal positive control. Anti-mouse IgG peroxidase conjugate (Amersham) diluted 1/5000, was then used and sera titers were calculated using the formula mentioned above.
  • Results:
  • The injections caused neither symptoms nor lesions. Body weight of monkeys was not altered by the injections. Hematological parameters did not vary significantly and biochemical analyses showed no alteration of kidneys and liver functions.
  • Hematological results: Variations, when present, were similar in pattern and in range in the placebo and in the vaccinee groups.
  • Individual WBC counts varied within normal limits. Differential WBC counts often showed a diminution of lyphocytes 3 days after the blood samplings (FIG. 40). Erythrocyte counts, hematocrite and hemoglobin transiently decreased after each blood sampling contrary to reticulocyte counts which increased regularly after the puncture (FIGS. 41 a, 41 b, 41 c). Mean corpuscle volume was stable in all the animals except an increase on day 140. Thrombocyte counts showed some variations (FIG. 41) but prothrombin level was stable (FIG. 42). There was no sign of anemia in either group. Sedimentation rate was 1 mm after one hour in all the samples.
  • Biochemical results: For a better interpretation of the variations observed, a standard serum (pool of 18 macaque sera) was analyzed at the beginning (Std a) and at the end (Std p) of each series of samples to be tested.
  • Cholesterol values varied in the same way in controls and in test group (FIGS. 43 a and 43 b).
  • Sodium and potassium were stable after all the injections but, as for total proteins and glucose, there was a great rising on day 140. On that day, blood specimens were drawn prior to the intravenous injection without anesthesia (so that clinical reactions could be monitored without interference); the change observed in several biological parameters was likely due to the stress associated with handling and sampling in the absence of anesthesia (FIGS. 43 a and 43 b). Electrophoresis profiles (data not shown) were very similar in all the samples. Creatinine, bilirubin, glutamic oxaloacetic and glutamic pyruvic transaminases and alkalin phosphatases varied within normal limits and always in the same direction in both control and test groups (FIGS. 43 c and 43 d). Kidneys and liver functions were therefore not affected by the inoculations of ALVAV-HIV (vCP300).
  • Serological results: Two ( macaques # 6, 7, 8) or three (macaque #5) injections were necessary to induce detectable anti-gp160 and anti-V3 responses (FIG. 44 a, 44 b, 45 a, 45 b). Two weeks after the second injection, these responses were variable between animals (anti-gp160 titers fluctuating between 2 to 4.6 logs). This response heterogeneity was smoothed out by the third injection. The subsequent intramuscular injections mainly maintained or increased the titers which reached around 4.3 and 3.6 for respectively anti-gp160 and anti-V3 antibodies after the fourth to fifth injection. Detectable anti-p24 antibodies (FIGS. 46 a, 46 b) were observed after three (macaques # 6, 8) to four (macaque #7) or five (macaque 5) vCP300 intramuscular injections. The animals with the highest anti-gp160/V3 titers exhibited the highest anti-p24 (≈4.3 on week 18 post-primoimmunization). None of the animals raised anti-nef antibodies (FIG. 47 a, 47 b).
  • The immune response induced by vCP300 was assessed by analyzing in ELISA the anti-HIV-1 gp160, V3, p24 and nef sera antibodies.
  • All the animals developed antibodies against gp160, V3 and p24: significant anti-gp160 or V3 responses were obtained after 2 or at most 3 intramuscular injections. Subsequent inoculations maintained or increased the antibody levels. Anti-p24 responses were detected after 3 to 5 injections and each inoculation of vCP300 increased the levels. No anti-nef antibodies could be detected in any of the animals.
  • The highest antibody titers were usually observed two weeks after each intramuscular injection, followed by a decrease until the next boost.
  • These serological results are very close to those obtained with ALVAC-HIV (vCP205) which expressed the same proteins but no CTL epitopes. Two minor differences can be pointed out in this example with vCP300: slightly lower anti-gp160/V3 antibody titers (≈0.2 to 0.5 log), and higher anti-p24 responses (all macaques positive, higher sera titers). Because of the individual variations between animals, these differences were not deemed significant. No indication of hypersensitivity was seen following intravenous inoculation. No side effects were recorded. This regimen induced high levels of binding antibodies to gp160 (though lower than with vCP205), V3 and p24 antigens. This Example shows that vCP300 and expression products thereof, antibodies therefrom, and DNA from vCP300 can be used as described above.
  • Having thus described in detail preferred embodiments of the present invention, it is to be understood that the invention defined by the appended claims is not to be limited by particular details set forth in the above description as many apparent variations thereof are possible without departing from the spirit or scope thereof.
  • REFERENCES
    • 1. Altenburger, W., C-P. Suter and J. Altenburger, Archives Virol. 105, 15-27 (1989).
    • 2. Avery, R. J., and J. Niven., Infect. and Immun. 26, 795-801 (1979).
    • 3. Bachacher, A., Predl, R., Strutzenberger, K., Steinfellner, W., Trkola, A., Purtscher, M., Gruber, G., Tauer, C., Steindl, F., Jungbauer, A. and Katinger, H. AIDS Research and Human Retroviruses 10, 359-369 (1994).
    • 4. Behbehani, A. M., Microbiological Reviews 47, 455-509 (1983).
    • 5. Bergoin, M., and Dales, S., In Comparative Virology, eds. K. Maramorosch and E. Kurstak, (Academic Press, NY) pp. 169-205 (1971).
    • 6. Berman, P., Eastman, D., Wilkes, D., Nakamura, G., Gregory, T., Schwartz, D., Gorse, G., Belshe, R., Clements, M. and Byrn, R., AIDS 8, 591-601 (1994).
    • 7. Berman, P., Gregory, T., Riddle, L., Nakamura, G., Champe, M., Porter, J., Wurm, F., Hershberg, R., Cobb, E. and Eichberg, J., Nature 345, 622-625 (1990).
    • 8. Bertholet, C., Drillien, R., and Wittek, R., Proc. Natl. Acad. Sci. USA 82, 2096-2100 (1985).
    • 9. Boursnell, M. E. G., P. F. Green, A. C. R. Samson, J. I. A. Campbell, A. Deuter, R. W. Peters, N. S. Millar, P. T. Emmerson, and M. M. Binns, Virology 178, 297-300. (1990c).
    • 10. Boursnell, M. E. G., P. F. Green, J. I. A. Campbell, A. Deuter, R. W. Peters, F. M. Tomley, A. C. R. Samson, P. T. Emmerson, and M. M. Binns, Veterinary Microbiology 23, 305-316 (1990b).
    • 11. Boursnell, M. E. G., P. F. Green, J. I. A. Campbell, A. Deuter, R. W. Peters., F. M. Tomley, A. C. R. Samson, P. Chambers, P. T. Emmerson, and M. M. Binns, J. Gen. Virol. 71, 621-628 (1990a).
    • 12. Broliden, P.-A., von Gegerfelt, A., Clapham, P., Rosen, J., Fenyo, E-M., Wahren, B. and Broliden, K., Proc. Natl. Acad. Sci. USA 89, 461-465 (1992).
    • 13. Buller, R. M. L., Chakrabarti, S., Cooper, J. A., Twardzik, D. R., and Moss, B., J. Virol. 62, 866-874 (1988).
    • 14. Buller, R. M. L., G. L. Smith, Cremer, K., Notkins, A. L., and Moss, B., Nature 317, 813-815 (1985).
    • 15. Cadoz, M., A. Strady, B. Meignier, J. Taylor, J. Tartaglia, E. Paoletti and S. Plotkin, The Lancet, 339, 1429 (1992).
    • 16. Chambers, P., N. S. Millar, and P. T. Emmerson, J. Gen. Virol. 67, 2685-2694 (1986).
    • 17. Child, S. J., Palumbo, G. J., Buller, R. M. L., and Hruby, D. E. Virology 174, 625-629 (1990).
    • 18. Clewell, D. B. and D. R. Helinski, Proc. Natl. Acad. Sci. USA 62, 1159-1166 (1969).
    • 19. Clewell, D. B., J. Bacteriol 110, 667-676 (1972).
    • 20. Colinas, R. J., R. C. Condit and E. Paoletti, Virus Research 18, 49-70 (1990).
    • 21. Conley, A., Kessler, J., Boots, L., Tung, J.-S., Arnold, B., Keller, P., Shaw, A. and Emini, E., Proc. Natl. Acad. Sci. USA 91, 3348-3352 (1994).
    • 22. Cooney E. L., Corrier A. C., Greenberg P. D., et al., Lancet 337, 567-572 (1991).
    • 23. Cox, W. I., Tartaglia, J., and E. Paoletti. Virology 195, 845-850 (1993).
    • 24. Dreyfuss, G., Adam, S. A., and Choi, Y. D., Mol. Cell. Biol. 4, 415-423 (1984).
    • 25. Edbauer, C., R. Weinberg, J. Taylor, A. Rey-Senelonge, J. F. Bouquet, P. Desmettre, and E. Paoletti, Virology 179, 901-904 (1990).
    • 26. Emini, E., Schleif, W., Nunberg, J., Conley, A., Eda, Y., Tokiyoshi, S., Putney, S., Matsushita, S., Cobb, K., Jett, C., Eichberg, J., and K. Murthy, Nature 355, 728-730 (1992).
    • 27. Engelke, D. R., Hoener, P. A., and Collins, F. S., Proc. Natl. Acad. Sci. USA 85, 544-548 (1988).
    • 28. Espion, D., S. de Henau, C. Letellier, C.-D. Wemers, R. Brasseur, J. F. Young, M. Gross, M. Rosenberg, G. Meulemans and A. Burny, Arch. Virol. 95, 79-95 (1987).
    • 29. Fenner, F., Virology 5, 502-529 (1958).
    • 30. Flexner, C., Hugen, A., and Moss, B., Nature 330, 259-262 (1987).
    • 31. Fries et al., 32nd Interscience Conference on Antimicrobial Agents and Chemotherapy, Anaheim, Calif. (October 1992).
    • 32. Fultz, P., Nara, P., Barre-Sinoussi, F., Chaput, A., Greenberg, M., Muchmore, E., Kieny, M.-P. and Girard, M. Science 256, 1687-1689 (1992).
    • 33. Funahashi, S., T. Sato and H. Shida, J. Gen. Virol. 69, 35-47 (1988).
    • 34. Garten, W., Kohama, T., and H-D. Klenk. J. Gen. Virol. 51, 207-211 (1980).
    • 35. Ghendon, Y. Z., and Chemos, V. I., Acta Virol. 8, 359-368 (1964).
    • 36. Gillard, S., Spehner, D., Drillien, R., and Kirn, A., Proc. Natl. Acad. Sci. USA 83, 5573-5577 (1986).
    • 37. Girard, M., Kieny, M.-P., Pinter, A., Barre-Sinoussi, F., Nara, P., Kolbe, H., Kusui, K., Chaput, A., Reinhart, T., Muchmore, E., Ronco, J., Kaczorek, M., Gomard, E., Gluckman, J.-C. and Fultz, P., Proc. Natl. Acad. Sci. USA 88, 542-546 (1991).
    • 38. Goebel, S. J., Johnson, G. P., Perkus, M. E., Davis, S. W., Winslow, J. P., Paoletti, E., Virology 179, 247-266 (1990a).
    • 39. Goebel, S. J., G. P. Johnson, M. E. Perkus, S. W. Davis, J. P. Winslow and E. Paoletti, Virology 179, 517-563 (1990b).
    • 40. Golding, H., Robey, F., Gates, F., Linder, W., Beining, P., Hoffman, T. and Golding, B., J. Exp, Med. 167, 914-923 (1988).
    • 41. Golding, H., Shearer, G., Hillman, K., Lucas, P., Manischewitz, J., Zajac, R., Clerici, M., Gress, R., Boswell, R. and Golding, B., J. Clin. Invest. 83, 1430-1435 (1989).
    • 42. Goldstein, D. J. and S. K. Weller, Virology 166, 41-51 (1988).
    • 43. Guo, P., Goebel, S., Davis, S., Perkus, M. E., Languet, B., Desmettre, P., Allen, G., and Paoletti, E., J. Virol. 63, 4189-4198 (1989).
    • 44. Guo et al., J. Virol. 64, 2399-2406 (1990).
    • 45. Hammond, S., Bollinger, R., Stanhope, P., Quinn, T., Schwartz, D., Clements, M. and Siliciano, R., J. Exp. Med. 176, 1531-1542 (1992).
    • 46. Hanson, C., AIDS Research and Human Retroviruses 10, 645-648 (1994).
    • 47. Homma, M., and M. Ohuchi, J. Virol. 12, 1457-1465 (1973).
    • 48. Hruby, D. E. and L. A. Ball, J. Virol. 43, 403-409 (1982).
    • 49. Hruby, D. E., R. A. Maki, D. B. Miller and L. A. Ball, Proc. Natl. Acad. Sci. USA 80, 3411-3415 (1983).
    • 50. Hu, S.-L., Abrams, K., Barber, G., Morn, P., Zarling, J., Langlois, A., Kuller, L., Morton, W. and Benveniste, R., Science 255, 456-459 (1992).
    • 51. Ichihashi, Y. and Dales, S., Virology 46, 533-543 (1971).
    • 52. Itamura, S., H. Iinuma, H. Shida, Y. Morikawa, K. Nerome and A. Oya, J. Gen. Virol. 71, 2859-2865 (1990).
    • 53. Jacobson, J. G., D. A. Leib, D. J. Goldstein, C. L. Bogard, P. A. Schaffer, S. K. Weller and D. M. Coen, Virology 173, 276-283 (1989).
    • 54. Jamieson, A. T., G. A. Gentry and J. H. Subak-Sharpe, J. Gen. Virol. 24, 465-480 (1974).
    • 55. Katinger, H., Muster, T., Buchacher, A., Trkola, A., Purtscher, M., Gruber, G., Steindl, F., Himmler, G., Jungbauer, A. and Ruker, F., Septieme Colloque Des Cent Gardes—1992, 299-303 (1992).
    • 56. Kato, S., M. Takahashi, S. Kameyama and J. Kamahora, Biken's 2, 353-363 (1959).
    • 57. Kieny, M. P., Lathe, R., Drillien, R., Spehner, D., Skory, S., Schmitt, D., Wiktor, T., Koprowski, H., and Lecocq, J. P., Nature (London) 312, 163-166 (1984).
    • 58. Klasse, P., Pipkorn, R. and Blomberg, J., Proc. Natl. Acad. Sci. USA 85, 5225-5229 (1988).
    • 59. Konishi et al., Virology 190, 454-458 (1992).
    • 60. Kotwal, G. J., S. N. Isaacs, R. McKenzie, M. M. Frank and B. Moss, Science 250, 827-830 (1990).
    • 61. Kotwal, G. J., A. W. Hugin and B. Moss, Virology 171, 579-587 (1989a).
    • 62. Kotwal, G. J. and Moss, B., Nature (Lond.) 335, 176-178 (1988).
    • 63. Kotwal, G. J. and B. Moss, J. Virol. 63, 600-606 (1989b).
    • 64. Le, L., R. Brasseur, C. Wemers, G. Meulemans, and A. Burny, Virus Genes 1, 333-350 (1988).
    • 65. Mandecki, W., Proc. Natl. Acad. Sci. USA 83, 7177-7182 (1986).
    • 66. Maniatis, T., Fritsch, E. F., and Sambrook, J. In Molecular cloning: a laboratory manual, (Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.) (1982).
    • 67. Matthews, R. E. F., Intervirology 17, 42-44 (1982).
    • 68. McGinnes, L. W., and T. G. Morrison, Virus Research 5, 343-356 (1986).
    • 69. Merz, D.C., A. Scheid, and P. Choppin, J. Exper. Med. 151, 275-288 (1980).
    • 70. Miller, M., Warmerdam, M., Gaston, I., Greene, W. and Feinberg, M., J. Exp. Med. 179, 101-113 (1994).
    • 71. Morgan, A. J., M. Mackett, S. Finerty, J. R. Arrand, F. T. Scullion and M. A. Epstein, J. Med. Virol. 25, 189-195 (1988).
    • 72. Moss, B., E. Winters and J. A. Cooper, J. Virol. 40, 387-395 (1981).
    • 73. Nagai, Y., T. Yoshida, M. Hamaguchi, H. Naruse, M. Iinuma, K. Maeno, and T. Matsumoto, Microbiol. Immunol. 24, 173-177 (1980).
    • 74. Nabel et al., Tibtech, May 1993, 11:211-215.
    • 75. Nagai, Y., H. D. Klenk, and R. Rott, Virology 72, 494-508 (1976).
    • 76. Norrby, E., and Y. Gollmar, Infect. and Immun. 11, 231-239 (1975).
    • 77. Ogawa, R., N. Yanagida, S. Saeki, S. Saito, S. Ohkawa, H. Gotoh, K. Kodama, K. Kamogawa, K. Sawaguchi and Y. Iritani, Vaccine 8, 486-490 (1990).
    • 78. Palumbo, G. J., Pickup, D. J., Fredrickson, T. N., Mcintyre, L. J., and Buller, R. M. L., Virology 172, 262-273 (1989).
    • 79. Panicali, D. and E. Paoletti, Proc. Natl. Acad. Sci. USA 79, 4927-4931 (1982).
    • 80. Panicali, D., Davis, S. W., Mercer, S. R., and Paoletti, E., J. Virol. 37, 1000-1010 (1981).
    • 81. Patel, D. D. and Pickup, D. J., EMBO 6, 3787-3794 (1987).
    • 82. Patel, D. D., Ray, C.A., Drucker, R. P., and Pickup, D. J., Proc. Natl. Acad. Sci. USA 85, 9431-9435 (1988).
    • 83. Perkus, M. E., D. Panicali, S. Mercer and E. Paoletti, Virology 152, 285-297 (1986).
    • 84. Perkus, M., Limbach, K. and Paoletti, E., Journal of Virology 63, 3829-3836 (1989).
    • 85. Perkus, M. E., A. Piccini, B. R. Lipinskas and E. Paoletti, Science 229, 981-984 (1985).
    • 86. Perkus, M. E., Limbach, K., and Paoletti, E., J. Virol. 63, 3829-3836 (1989).
    • 87. Perkus, M. E., Goebel, S.J., Davis, S. W., Johnson, G. P., Limbach, K., Norton, E. K., and Paoletti, E., Virology 179, 276-286 (1990).
    • 88. Perkus, M. E., S. J. Goebel, S. W. Davis, G. P. Johnson, E. K. Norton and E. Paoletti, Virology 180, 406-410 (1991).
    • 89. Pialoux et al., Aids Research and Human Retroviruses, 11(3):373-81 (1995).
    • 90. Piccini, A., M. E. Perkus, and E. Paoletti, Methods in Enzymology 153, 545-563 (1987).
    • 91. Pickup, D. J., B. S. Ink, B. L. Parsons, W. Hu and W. K. Joklik, Proc. Natl. Acad. Sci. USA 81, 6817-6821 (1984).
    • 92. Pickup, D. J., B. S. Ink, W. Hu, C.A. Ray and W. K. Joklik, Proc. Natl. Acad. Sci. USA 83, 7698-7702 (1986).
    • 93. Robinson, W., Kawamura, T., Gorny, M., Lake, D., Xu, J.-Y., Matsumoto, Y., Sugano, T., Masuho, Y., Mitchell, W., Hersh, E. and Zolla-Pazner, S., Proc. Natl. Acad. Sci. USA 87, 3185-3189 (1990).
    • 94. Sanger, F., Nickel, S. Coulson, A. R., Proc. Natl. Acad. Sci. 74, 5463-5467 (1977).
    • 95. Schmidtt, J. F. C. and H. G. Stunnenberg, J. Virol. 62, 1889-1897 (1988).
    • 96. Seligmann, E. B., In Laboratory Techniques in Rabies, eds. M. M. Kaplan and H. Koprowski, (World Health Organization, Geneva) pp. 279-285 (1973).
    • 97. Shafferman, A., Lennox, J., Grosfeld, H., Sadoff, J., Redfield, R. and Burke, D., AIDS Res. Hum. Retroviruses 5, 33-39 (1989).
    • 98. Shapira, S. K., Chou, J., Richaud, F. V. and Casadaban, M. J., Gene 25, 71-82 (1983).
    • 99. Shida, H., Hinuma, Y., Hatanaka, M., Morita, M., Kidokoro, M., Suzuki, K., Maruyzam, T., Takahashi-Nishimaki, F., Sugimoto, M., Kitamura, R., Miyazawa, T., and Hayami, M., J. Virol. 62, 4474-4480 (1988).
    • 100. Shida, H., T. Tochikura, T. Sato, T. Konno, K. Hirayoshi, M. Seki, Y. Ito, M. Hatanaka, Y. Hinuma, M. Sugimoto, F. Takahashi-Nishimaki, T. Maruyama, K. Miki, K. Suzuki, M. Morita, H. Sashiyama and M. Hayami, EMBO 6, 3379-3384 (1987).
    • 101. Shida, H., Virology 150, 451-462 (1986).
    • 102. Slabaugh, M., N. Roseman, R. Davis and C. Mathews, J. Virol. 62, 519-527 (1988).
    • 103. Smith, J. S., P. A. Yager and G. M. Baer, In Laboratory Techniques in Rabies, eds. M. M. Kaplan and H. Koprowski (WHO Geneva) pp. 354-357 (1973).
    • 104. Spear, G., Takefman, D., Sharpe, S., Ghassemi, M. and Zolla-Pazner, S., Virology 204, 609-615 (1994).
    • 105. Spina, C., Kwoh, T., Chowers, M., Guatelli, J. and Richman, D., J. Exp. Med. 179, 115-123 (1994).
    • 106. Stanberry, L. R., S. Kit and M. G. Myers, J. Virol. 55, 322-328 (1985).
    • 107. Tabor, S, and C. C. Richardson, Proc. Natl. Acad. Sci. USA 84, 4767-4771 (1987).
    • 108. Tartaglia, J., Perkus, M. E., Taylor, J., Norton, E. K., Audonnet, J.-C., Cox, W. I., Davis, S. W., Van Der Hoeven, J., Meignier, B., Riviere, M., Languet, B., Paoletti, E., Virology 188, 217-232 (1992).
    • 109. Tartaglia, J., R. Gettig & E. Paoletti, Virology (In press).
    • 110. Tartaglia, J., J. Taylor, W. I. Cox, J.-C. Audonnet, M. E. Perkus, A. Radaelli, C. de Giuli Morghen, B. Meignier, M. Riviere, K. Weinhold & E. Paoletti, In AIDS Research Reviews, W. Koff, F. Wong-Staal & R. C. Kenedy, Eds., Vol. 3, Marcel Dekker, NY, pp. 361-378 (1993a).
    • 111. Tartaglia, J. & E. Paoletti, In Immunochemistry of Viruses, II. The Basis for Serodiagnosis and Vaccines. M. H. V. van Regenmortel & A. R. Neurath, Eds. 125-151. Elsevier Science Publishers, Amsterdam (1990b).
    • 112. Tartaglia, J., Jarrett, O., Desmettre, P., Paoletti, E. (1993b) J. Virol. 67, 2370-2375 (1993).
    • 113. Tartaglia, J., Pincus, S., Paoletti, E., Critical Reviews in Immunology 10, 13-30 (1990a).
    • 114. Taylor, J., Weinberg, R., Kawaoka, Y., Webster, R. G., and Paoletti, E., Vaccine 6, 504-508 (1988a).
    • 115. Taylor, J., C. Trimarchi, R. Weinberg, B. Languet, F. Guillemin, P. Desmettre and E. Paoletti, Vaccine 9, 190-193 (1991b).
    • 116. Taylor, G., E. J. Stott, G. Wertz and A. Ball, J. Gen. Virol. 72, 125-130 (1991a).
    • 117. Taylor, J., R. Weinberg, B. Lanquet, P. Desmettre, and E. Paoletti, Vaccine 6, 497-503 (1988b).
    • 118. Taylor, J., R. Weinberg, J. Tartaglia, C. Richardson, G. Alkhatib, D. Briedis, M. Appel, E. Norton & E. Paoletti, Virology 187, 321-328 (1992).
    • 119. Taylor, J., Edbauer, C., Rey-Senelonge, A., Bouquet, J.-F., Norton, E., Goebel, S., Desmettre, P., Paoletti, E., J. Virol. 64, 1441-1450 (1990).
    • 120. Toyoda, T., T. Sakaguchi, K. Imai, N. M. Inocencio, B. Gotoh, M. Hamaguchi, and Y. Nagai, Virology 158, 242-247 (1987).
    • 121. Webster et al., Vaccine, 1994, 12(16): 1495-1498.
    • 122. Weir, J. P. and B. Moss, J. Virol. 46, 530-537 (1983).
    • 123. Yuen, L., and Moss, B., Proc. Natl. Acad. Sci. USA 84, 6417-6421 (1987).
    • 124. Zhou, J., L. Crawford, L. McLean, X. Sun, M. Stanley, N. Almond and G. L. Smith, J. Gen. Virol. 71, 2185-2190 (1990).

Claims (19)

1-35. (canceled)
36. A protein having an amino acid sequence comprising the amino acid sequence of HIV1 gp120, wherein the amino acid sequence of the gp120 is modified so as to contain an epitope not naturally occurring in HIV1 gp120.
37. The protein of claim 36, wherein the epitope is a B-cell epitope.
38. The protein of claim 36, wherein the amino acid sequence of the gp120 is modified in the V3 loop so as to contain the epitope.
39. The protein of claim 38, wherein the epitope is a B-cell epitope.
40. The protein of claim 38, wherein the epitope is ELDKWA or LDKW.
41. The protein of claim 36, wherein the amino acid sequence of the gp120 is modified to contain at least one of HIV1gag(+ pro) (IIIB), gp120(MN) (+ transmembrane), nef(BRU)CTL, pol(IIIB)CTL, and ELDKWA or LDKW epitopes.
42. The protein of claim 41, wherein the amino acid sequence of the gp120 is modified in the V3 loop to contain the epitope.
43. The protein of claim 38, comprising the amino acid sequence identified as SEQ ID NO: 137, SEQ ID NO: 140 or SEQ ID NO: 143.
44. The protein having the amino acid sequence identified as SEQ ID NO: 137, SEQ ID NO: 140 or SEQ ID NO: 143.
45. A nucleic acid molecule comprising a nucleic acid sequence which encodes the protein of claim 36.
46. A nucleic acid molecule comprising a nucleic acid sequence which encodes the protein of claim 37.
47. A nucleic acid molecule comprising a nucleic acid sequence which encodes the protein of claim 38.
48. A nucleic acid molecule comprising a nucleic acid sequence which encodes the protein of claim 39.
49. A nucleic acid molecule comprising a nucleic acid sequence which encodes the protein of claim 40.
50. A nucleic acid molecule comprising a nucleic acid sequence which encodes the protein of claim 41.
51. A nucleic acid molecule comprising a nucleic acid sequence which encodes the protein of claim 42.
52. A nucleic acid molecule comprising the nucleic acid sequence which encodes the amino acid sequence identified as SEQ ID NO: 137, SEQ ID NO: 140 or SEQ ID NO: 143.
53. The nucleic acid molecule of claim 52 selected from the group consisting of the nucleic acid molecules identified as SEQ ID NO: 135, SEQ ID NO: 136, SEQ ID NO: 138, SEQ ID NO: 139, SEQ ID NO: 141 and SEQ ID NO: 142.
US11/891,027 1991-03-07 2007-08-08 Immunodeficiency recombinant poxvirus Abandoned US20080188640A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US11/891,027 US20080188640A1 (en) 1991-03-07 2007-08-08 Immunodeficiency recombinant poxvirus

Applications Claiming Priority (11)

Application Number Priority Date Filing Date Title
US66605691A 1991-03-07 1991-03-07
US71396791A 1991-06-11 1991-06-11
US71592191A 1991-06-14 1991-06-14
US84795192A 1992-03-06 1992-03-06
US89738292A 1992-06-11 1992-06-11
US08/105,483 US5494807A (en) 1991-03-07 1993-08-12 NYVAC vaccinia virus recombinants comprising heterologous inserts
US22384294A 1994-04-06 1994-04-06
US08/417,210 US5863542A (en) 1991-03-07 1995-04-05 Recombinant attenuated ALVAC canaryopox virus containing heterologous HIV or SIV inserts
US09/136,159 US6596279B1 (en) 1991-03-07 1998-08-14 Immunodeficiency recombinant poxvirus
US10/441,788 US20030223987A1 (en) 1991-03-07 2003-05-20 Immunodeficiency recombinant poxvirus
US11/891,027 US20080188640A1 (en) 1991-03-07 2007-08-08 Immunodeficiency recombinant poxvirus

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US10/441,788 Continuation US20030223987A1 (en) 1991-03-07 2003-05-20 Immunodeficiency recombinant poxvirus

Publications (1)

Publication Number Publication Date
US20080188640A1 true US20080188640A1 (en) 2008-08-07

Family

ID=26918187

Family Applications (4)

Application Number Title Priority Date Filing Date
US08/417,210 Expired - Lifetime US5863542A (en) 1991-03-07 1995-04-05 Recombinant attenuated ALVAC canaryopox virus containing heterologous HIV or SIV inserts
US09/136,159 Expired - Lifetime US6596279B1 (en) 1991-03-07 1998-08-14 Immunodeficiency recombinant poxvirus
US10/441,788 Abandoned US20030223987A1 (en) 1991-03-07 2003-05-20 Immunodeficiency recombinant poxvirus
US11/891,027 Abandoned US20080188640A1 (en) 1991-03-07 2007-08-08 Immunodeficiency recombinant poxvirus

Family Applications Before (3)

Application Number Title Priority Date Filing Date
US08/417,210 Expired - Lifetime US5863542A (en) 1991-03-07 1995-04-05 Recombinant attenuated ALVAC canaryopox virus containing heterologous HIV or SIV inserts
US09/136,159 Expired - Lifetime US6596279B1 (en) 1991-03-07 1998-08-14 Immunodeficiency recombinant poxvirus
US10/441,788 Abandoned US20030223987A1 (en) 1991-03-07 2003-05-20 Immunodeficiency recombinant poxvirus

Country Status (7)

Country Link
US (4) US5863542A (en)
EP (1) EP0752887B1 (en)
JP (4) JP4007456B2 (en)
AT (1) ATE395932T1 (en)
CA (1) CA2187031A1 (en)
DE (1) DE69535757D1 (en)
WO (1) WO1995027507A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011090708A2 (en) 2009-12-28 2011-07-28 Merial Limited Recombinant ndv antigen and uses thereof

Families Citing this family (52)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5505941A (en) * 1981-12-24 1996-04-09 Health Research, Inc. Recombinant avipox virus and method to induce an immune response
US7767449B1 (en) 1981-12-24 2010-08-03 Health Research Incorporated Methods using modified vaccinia virus
US7374768B1 (en) 1990-09-25 2008-05-20 Xenova Research Limited Viral vaccines
US5863542A (en) * 1991-03-07 1999-01-26 Virogenetics Corporation Recombinant attenuated ALVAC canaryopox virus containing heterologous HIV or SIV inserts
DE69229390T2 (en) * 1991-08-26 1999-11-11 Immuno Ag, Wien Direct molecular cloning of a modified genome of a chordopox virus
AU694519B2 (en) * 1994-04-29 1998-07-23 Immuno Aktiengesellschaft Recombinant poxviruses with foreign polynucleotides in essential regions
CA2266656A1 (en) * 1996-09-17 1998-03-26 Chiron Corporation Compositions and methods for treating intracellular diseases
US7255862B1 (en) * 1996-11-14 2007-08-14 Connaught Technology Corporation ALVAC/FIV constructs
US5990091A (en) * 1997-03-12 1999-11-23 Virogenetics Corporation Vectors having enhanced expression, and methods of making and uses thereof
US6641816B1 (en) * 1998-06-26 2003-11-04 Aventis Pasteur S.A. Use of poxviruses as enhancer of specific immunity
US20040002472A1 (en) * 2000-01-21 2004-01-01 Audonnet Jean-Christophe Francis Vaccination or immunization using a prime-boost regimen
OA12168A (en) * 2000-01-31 2006-05-08 Smithkline Beecham Biolog Vaccine for the prophylactic or therapeutic immunization against HIV.
US8623379B2 (en) * 2000-03-02 2014-01-07 Emory University Compositions and methods for generating an immune response
US20040105871A1 (en) * 2000-03-02 2004-06-03 Robinson Harriet L. Compositions and methods for generating an immune response
WO2001092470A2 (en) 2000-03-02 2001-12-06 Emory University Dna expression vectors and methods of use
JP2003531865A (en) * 2000-04-28 2003-10-28 アメリカ合衆国 Improving immunogenicity using a combination of DNA and vaccinia virus vector vaccines
US6582920B2 (en) * 2000-09-01 2003-06-24 Gen-Probe Incorporated Amplification of HIV-1 RT sequences for detection of sequences associated with drug-resistance mutations
EP2333543B1 (en) 2000-09-26 2018-01-10 Health Research, Incorporated Analysis of hiv-1 coreceptor use in the clinical care of hiv-1 infected patients
PT1372710E (en) * 2001-03-08 2009-12-21 Us Gov Health & Human Serv Mva expressing modified hiv envelope, gag, and pol genes
EP1281767A3 (en) * 2001-07-31 2003-05-28 Aladar A. Szalay Light emitting microorganisms and cells for diagnosis and therapy of tumors
CN1880457B (en) 2001-10-11 2010-05-26 麦克公司 Ad6 recombinant nucleic acid
US20060094006A1 (en) * 2002-05-01 2006-05-04 Genoveffa Franchini Immunotherapy regimens in hiv-infected patients
US7501127B2 (en) 2002-05-16 2009-03-10 Bavarian Nordic A/S Intergenic regions as novel sites for insertion of HIV DNA sequences in the genome of Modified Vaccinia virus Ankara
EP1369491A1 (en) * 2002-06-05 2003-12-10 Aladar A. Szalay Light emitting microorganisms and cells for diagnosis and therapy of diseases associated with wounded or inflamed tissue
US20030228261A1 (en) * 2002-06-05 2003-12-11 Aladar Szalay Light emitting microorganisms and cells for diagnosis and therapy of diseases associated with wounded or inflamed tissue
US7135556B2 (en) * 2002-07-19 2006-11-14 Schering Corporation NPC1L1 (NPC3) and methods of use thereof
WO2005047458A2 (en) 2003-06-18 2005-05-26 Genelux Corporation Modified recombinant vaccina viruses and other microorganisms, uses thereof
US20100189747A1 (en) * 2003-07-31 2010-07-29 Raymond Weinstein Compositions and methods for treating or preventing hiv infection
JP5475279B2 (en) 2005-06-17 2014-04-16 イステイチユート・デイ・リチエルケ・デイ・ビオロジア・モレコラーレ・ピ・アンジエレツテイ・エツセ・エルレ・エルレ Hepatitis C virus nucleic acid vaccine
CA2623197A1 (en) * 2005-09-22 2007-03-29 Prosci Incorporated Glycosylated polypeptides produced in yeast mutants and methods of use thereof
EP2025762A3 (en) 2006-01-17 2009-09-30 Health Research Inc. Heteroduplex tracking assay
US8691945B2 (en) * 2006-04-27 2014-04-08 Singapore Health Services Pte Ltd. Antimicrobial peptides
EP2023954B1 (en) * 2006-05-19 2013-07-17 Sanofi Pasteur, Inc. Immunological composition
TW200819540A (en) 2006-07-11 2008-05-01 Genelux Corp Methods and compositions for detection of microorganisms and cells and treatment of diseases and disorders
US20100068217A1 (en) * 2006-08-25 2010-03-18 Kwong Peter D Epitope-transplant scaffolds and their use
WO2008100292A2 (en) 2006-10-16 2008-08-21 Genelux Corporation Modified vaccinia virus strains for use in diagnostic and therapeutic methods
WO2008150496A2 (en) * 2007-05-31 2008-12-11 Genelux Corporation Assay for sensitivity to chemotherapeutic agents
BRPI0820576B1 (en) * 2007-11-19 2021-10-19 Transgène S.A. USE OF AN ONCOLYTIC POXVIRUS COMPRISING A DEFECTIVE I4L AND/OR F4L GENE OR A COMPOSITION COMPRISING THE SAME
EP2236520A1 (en) * 2009-03-31 2010-10-06 Leukocare Ag Stabilizing composition for immobilized biomolecules
CN103585643A (en) 2009-04-03 2014-02-19 梅里亚有限公司 Newcastle disease virus vectored avian vaccines
WO2010127115A1 (en) 2009-04-30 2010-11-04 Centre Hospitalier Universitaire Vaudois Lausanne (Chuv) Modified immunization vectors
US20130052221A1 (en) 2010-02-26 2013-02-28 The Govt. of the U.S, as represented by The Sec. of The Dept. of Health and Human Services Dna-protein vaccination protocols
WO2012030720A1 (en) 2010-08-31 2012-03-08 Merial Limited Newcastle disease virus vectored herpesvirus vaccines
WO2012129295A1 (en) 2011-03-21 2012-09-27 Vaxin Inc. Rapid and prolonged immunologic-therapeutic
DK2788021T3 (en) 2011-12-09 2017-04-10 Bavarian Nordic As POXVIRUS VECTOR FOR EXPRESSION OF BACTERIAL ANTIGENES CONNECTED TO TETANANOX INFRAGMENT C
EP4276106A3 (en) 2015-05-13 2024-01-24 The United States of America as represented by the Secretary of the Department of Health and Human Services Methods and compositions for inducing an immune response using conserved element constructs
WO2016196366A1 (en) 2015-05-29 2016-12-08 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Extension of replicative lifespan in diseases of premature aging using p53 isoforms
ES3050936T3 (en) 2015-06-23 2025-12-23 Boehringer Ingelheim Vetmedica Gmbh Prrsv minor protein-containing recombinant viral vectors and methods of making and use thereof
CN113453712A (en) * 2018-12-28 2021-09-28 特兰斯吉恩股份有限公司 M2-deficient poxvirus
WO2020230785A1 (en) 2019-05-14 2020-11-19 国立大学法人鳥取大学 Cell fusion-inducing vaccinia virus and use thereof
EP4249596A4 (en) 2020-11-17 2025-03-12 National University Corporation Tottori University NEW RECOMBINANT GENETIC VACCINIA VIRUS AND ITS USE
CN120676952A (en) 2022-07-08 2025-09-19 维罗米梭公司 Oncolytic vaccinia virus and recombinant viruses and methods of use thereof

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5494807A (en) * 1991-03-07 1996-02-27 Virogenetics Corporation NYVAC vaccinia virus recombinants comprising heterologous inserts

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE10399031I1 (en) * 1987-08-28 2004-01-29 Health Research Inc Recombinant viruses.
GB8923123D0 (en) * 1989-10-13 1989-11-29 Connaught Lab A vaccine for human immunodeficiency virus
US5863542A (en) * 1991-03-07 1999-01-26 Virogenetics Corporation Recombinant attenuated ALVAC canaryopox virus containing heterologous HIV or SIV inserts
EP0592546B1 (en) * 1991-06-14 2003-05-28 Virogenetics Corporation Immunodeficiency virus recombinant poxvirus vaccine
JPH08511007A (en) * 1993-06-09 1996-11-19 コノート ラボラトリーズ リミテッド Tandem synthetic HIV-1 peptide

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5494807A (en) * 1991-03-07 1996-02-27 Virogenetics Corporation NYVAC vaccinia virus recombinants comprising heterologous inserts
US5762938A (en) * 1991-03-07 1998-06-09 Virogenetics Corporation Modified recombinant vaccinia virus and expression vectors thereof

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011090708A2 (en) 2009-12-28 2011-07-28 Merial Limited Recombinant ndv antigen and uses thereof
EP3213766A1 (en) 2009-12-28 2017-09-06 Merial Ltd. Recombinant ndv antigen and uses thereof

Also Published As

Publication number Publication date
US20030223987A1 (en) 2003-12-04
JP4007456B2 (en) 2007-11-14
DE69535757D1 (en) 2008-07-03
JP4098811B2 (en) 2008-06-11
CA2187031A1 (en) 1995-10-19
ATE395932T1 (en) 2008-06-15
JP2006141407A (en) 2006-06-08
WO1995027507A1 (en) 1995-10-19
JPH09511649A (en) 1997-11-25
EP0752887B1 (en) 2008-05-21
JP4138848B2 (en) 2008-08-27
JP2008000138A (en) 2008-01-10
JP2007297396A (en) 2007-11-15
EP0752887A4 (en) 1997-08-20
US6596279B1 (en) 2003-07-22
EP0752887A1 (en) 1997-01-15
US5863542A (en) 1999-01-26

Similar Documents

Publication Publication Date Title
US5863542A (en) Recombinant attenuated ALVAC canaryopox virus containing heterologous HIV or SIV inserts
US7144578B2 (en) Poxvirus-rabies recombinants and compositions and methods employing the recombinants
US5756102A (en) Poxvirus-canine distemper virus (CDV) recombinants and compositions and methods employing the recombinants
US5766599A (en) Trova fowl pox virus recombinants comprising heterologous inserts
US5843456A (en) Alvac poxvirus-rabies compositions and combination compositions and uses
EP0831899B1 (en) Recombinant poxvirus-calicivirus compositions and uses
EP0752888B1 (en) NUCLEOTIDE AND AMINO ACID SEQUENCES OF CANINE HERPESVIRUS gB, gC and gD AND USES THEREFOR
JP2007254489A (en) Immunogenic composition containing recombinant attenuated poxvirus expressing htlv antigen
WO1996039177A9 (en) Recombinant poxvirus-calicivirus [rabbit hemorrhagic disease virus (rhdv)] compositions and uses
AU2002300582B2 (en) Immunodeficiency Recombinant Poxvirus
AU747139B2 (en) Immunodeficiency recombinant poxvirus
AU702634B2 (en) Immunodeficiency recombinant poxvirus
AU2006201066A1 (en) Immunodeficiency recombinant poxvirus
AU717809B2 (en) Immunogenic compositions containing recombinant attenuated poxviruses expressing HTLV antigens
AU701599B2 (en) TROVAC fowlpox virus recombinants comprising heterologous inserts
AU2283395A (en) Poxvirus-canine distemper virus (cdv) recombinants and compositions and methods employing the recombinants

Legal Events

Date Code Title Description
STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION