US20060153837A1 - Treating autoimmune diseases with humanized anti-CD401 antibodies - Google Patents

Treating autoimmune diseases with humanized anti-CD401 antibodies Download PDF

Info

Publication number
US20060153837A1
US20060153837A1 US11/370,898 US37089806A US2006153837A1 US 20060153837 A1 US20060153837 A1 US 20060153837A1 US 37089806 A US37089806 A US 37089806A US 2006153837 A1 US2006153837 A1 US 2006153837A1
Authority
US
United States
Prior art keywords
antibody
humanized
human
cells
antibodies
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US11/370,898
Inventor
Amelia Black
Nabil Hanna
Eduardo Padlan
Roland Newman
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Individual
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US08/554,840 external-priority patent/US6001358A/en
Application filed by Individual filed Critical Individual
Priority to US11/370,898 priority Critical patent/US20060153837A1/en
Publication of US20060153837A1 publication Critical patent/US20060153837A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/461Igs containing Ig-regions, -domains or -residues form different species
    • C07K16/467Igs with modifications in the FR-residues only
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0014Skin, i.e. galenical aspects of topical compositions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0048Eye, e.g. artificial tears
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/007Pulmonary tract; Aromatherapy
    • A61K9/0073Sprays or powders for inhalation; Aerolised or nebulised preparations generated by other means than thermal energy
    • A61K9/008Sprays or powders for inhalation; Aerolised or nebulised preparations generated by other means than thermal energy comprising drug dissolved or suspended in liquid propellant for inhalation via a pressurized metered dose inhaler [MDI]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2875Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/564Immunoassay; Biospecific binding assay; Materials therefor for pre-existing immune complex or autoimmune disease, i.e. systemic lupus erythematosus, rheumatoid arthritis, multiple sclerosis, rheumatoid factors or complement components C1-C9
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30 CD40 or CD95
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/24Immunology or allergic disorders
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/24Immunology or allergic disorders
    • G01N2800/245Transplantation related diseases, e.g. graft versus host disease

Definitions

  • the present invention is directed to humanized antibodies specific for human gp39, DNA encoding such antibodies, methods for their production, pharmaceutical compositions containing, and the use of such humanized antibodies as therapeutic agents.
  • These antibodies have particular application in the treatment of autoimmune diseases including, e.g., rheumatoid arthritis, multiple sclerosis, diabetes, and systemic lupus erythematosus as well as non-autoimmune diseases including, e.g., graft-versus-host disease and for preventing graft rejection.
  • the immune system is capable of producing two types of antigen-specific responses to foreign antigens.
  • Cell-mediated immunity is the term used to refer to effector functions of the immune system mediated by T lymphocytes.
  • Humoral immunity is the term used to refer to production of antigen-specific antibodies by B lymphocytes. It has long been appreciated that the development of humoral immunity against most antigens requires not only antibody-producing B lymphocytes but also the involvement of helper T (hereinafter Th) lymphocytes.
  • Th lymphocytes helper T lymphocytes.
  • Th cells Certain signals, or “help”, are provided by Th cells in response to stimulation by Thymus-dependent (hereinafter TD) antigens. While some B lymphocyte help is mediated by soluble molecules released by Th cells (for instance lymphokines such as IL-4 and IL-5), activation of B cells also requires a contact-dependent interaction between B cells and Th cells. (Hirohata et al, J. Immunol., 140:3736-3744 (1988); Bartlett et al, J. Immunol., 143:1745-1765 (1989)).
  • B cell activation involves an obligatory interaction between cell surface molecules on B cells and Th cells.
  • isolated plasma membranes of activated T cells can provide helper functions necessary for B cell activation.
  • T cell helper function CD4 + T lymphocytes direct the activation and differentiation of B lymphocytes and thereby regulate the humoral immune response by modulating the specificity, secretion and isotype-encoded functions of antibody molecules
  • T cells help B cells to differentiate has been divided into two distinct phases; the inductive and effector phases (Vitetta et al, Adv. Immunol., 45:1 (1989); Noelle et al, Immunol. Today, 11:361 (1990)).
  • the inductive phase resting T cells contact antigen-primed B cells and this association allows clonotypic T cell receptor (TCR)-CD4 complexes to interact with Ia/Ag complexes on B cells (Janeway et al, Immunol. Rev., 101:39 (1988); Katz et al, Proc. Natl. Acad. Sci., 70:2624 (1973); Zinkernagel, Adv. Exp.
  • T cell helper function can be Ag-independent and MHC-nonrestricted (Clement et al, J. Immunol., 132:740 (1984); Hirohata et al, J. Immunol., 140:3736 (1988); Whalen et al, J. Immunol., 143:1715 (1988)).
  • inductive phase of T cell help often requires CD4 molecules and is inhibited by anti-CD4 mAb (Rogozinski et al, J. Immunol., 126:735 (1984)), whereas helper effector function does not require CD4 molecules (Friedman et al, Cell Immunol., 103:105 (1986)) and is not inhibited by anti-CD4 mabs (Brian, Proc. Natl. Acad. Sci., USA, 85:564 (1988); Hirohata et al, J. Immunol., 140:3736 (1988); Whalen et al, J.
  • terminal B cell differentiation requires both contact- and lymphokine-mediated stimuli from T cells
  • intermediate stages of B cell differentiation can be induced by activated T cell surfaces in the absence of secreted factors (Crow et al, J. Exp. Med., 164:1760 (1986); Brian, Proc. Natl. Acad. Sci., USA, 85:564 (1988); Sekita et al, Eur. J. Immunol., 18:1405 (1988); Hodgkin et al, J. Immunol., 145:2025 (1990); Noelle et al, FASEB J, 5:2770 (1991)).
  • T cells acquire the ability to stimulate B cells 4-8 h following activation (Bartlett et al, J. Immunol., 145:3956 (1990) and Tohma et al, J. Immunol., 146:2544 (1991)).
  • a cell surface molecule, CD40 has been identified on immature and mature B lymphocytes which, when crosslinked by antibodies, induces B cell proliferation.
  • Valle et al Eur. J. Immunol., 19:1463-1467 (1989); Gordon et al, J. Immunol., 140:1425-1430 (1988); Gruder et al, J. Immunol., 142:4144-4152 (1989).
  • CD40 has been molecularly cloned and characterized (Stamenkovic et al, EMBO J., 8:1403-1410 (1989)).
  • CD40 is expressed on B cells, interdigitating dendritic cells, macrophages, follicular dendritic cells, and thymic epithelium (Clark, Tissue Antigens 36:33 (1990); Alderson et al, J. Exp. Med., 178:669 (1993); Galy et al, J. Immunol. 142:772 (1992)).
  • Human CD40 is a type I membrane protein of 50 kDa and belongs to the nerve growth factor receptor family (Hollenbaugh et al, Immunol. Rev., 138:23 (1994)).
  • CD40 Signaling through CD40 in the presence of IL-10 induces IgA, IgM and IgG production, indicating that isotype switching is regulated through these interactions.
  • the interaction between CD40 and its ligand results in a primed state of the B cell, rendering it receptive to subsequent signals.
  • a ligand for CD40, gp39 (also called CD40 ligand or CD40L) has recently been molecularly cloned and characterized (Armitage et al, Nature, 357:80-82 (1992); Lederman et al, J. Exp. Med., 175:1091-1101 (1992); Hollenbaugh et al, EMBO J., 11:4313-4319 (1992)).
  • the gp39 protein is expressed on activated, but not resting, CD4 + Th cells.
  • gp39 is a type II membrane protein and is part of a new gene super family which includes TNF- ⁇ , TNF- ⁇ and the ligands for FAS, CD27, CD30 and 4-1BB.
  • gp39 can be readily induced in vitro on CD4 + T cells using either anti-CD3 antibody or phorbol myristate acetate (PMA) plus ionomycin. Expression is rapid and transient, peaking at 6-8 hours and returning to near resting levels between 24 and 48 hours (Roy et al, J. Immunol., 151:2497 (1993)). In vivo, gp39 has been reported in humans to be present on CD4 + T cells in the mantle and centrocytic zones of lymphoid follicles and the periarteriolar lymphocyte sheath of the spleen, in association with CD40 + B cells (Lederman et al, J.
  • gp39 + T cells produce IL-2, IL-4 and IFN- ⁇ (Van der Eetwegh et al, J. Exp. Med., 178:1555 (1993)).
  • HIM hyper-IgM syndrome
  • CIA is an animal model for the human autoimmune disease rheumatoid arthritis (RA) (Trenthorn et al, J. Exp. Med., 146:857 (1977)).
  • RA rheumatoid arthritis
  • This disease can be induced in many species by the administration of heterologous type II collagen (Courtenay et al, Nature, 283:665 (1980); Cathcart et al, Lab. Invest., 54:26 (1986)).
  • mice Male DBA1/J mice were injected intradermally with chick type II collagen emulsified in complete Freund's adjuvant at the base of the tail. A subsequent challenge was carried out 21 days later. Mice were then treated with the relevant control antibody or anti-gp39. Groups of mice treated with anti-gp39 showed no titers of anti-collagen antibodies compared to immunized, untreated control mice. Histological analysis indicated that mice treated with anti-gp39 antibody showed no signs of inflammation or any of the typical pathohistological manifestations of the disease observed in immunized animals. These results indicated that gp39-CD40 interactions are absolutely essential in the induction of CIA. If the initial cognate interaction between the T cell and B cell is not obtained, then the downstream processes, such as autoantibody formation and the resulting inflammatory responses, do not occur.
  • TNF- ⁇ has been implicated in the CIA disease process (Thorbecke et al, Eur. J. Immunol., 89:7375 (1992) and in RA (DiGiovane et al, Ann. Rheum. Dis., 47:68 (1988); Chu et al, Arthrit. Rheum., 39:1125 (1991); Brennan et al, Eur. J.
  • TNF- ⁇ inhibition by anti-gp39 may have profound anti-inflammatory effects in the joints of arthritic mice. Both inhibition of TNF- ⁇ and of T cell-B cell interactions by anti-gp39 may be contributory to manifestations of CIA.
  • EAE is an experimental autoimmune disease of the central nervous system (CNS) (Zamvil et al, Ann. Rev. Immunol., 8:579 (1990) and is a disease model for the human autoimmune condition, multiple sclerosis (MS) (Alvord et al, “Experimental Allergic Model for Multiple Sclerosis,” NY 511 (1984)). It is readily induced in mammalian species by immunizations of myelin basic protein purified from the CNS or an encephalitogenic proteolipid (PLP). SJL/J mice are a susceptible strain of mice (H-2 S ) and, upon induction of EAE, these mice develop an acute paralytic disease and an acute cellular infiltrate is identifiable within the CNS.
  • CNS central nervous system
  • MS multiple sclerosis
  • PBP encephalitogenic proteolipid
  • EAE is an example of a cell-mediated autoimmune disease mediated via T cells, with no direct evidence for the requirement for autoantibodies in disease progression. Interference with the interaction between gp39 and CD40 prevents disease induction and the adoptive transfer of disease.
  • GVHD Chronic and acute GVHD result from donor cells responding to host disparate MHC alleles.
  • cGVHD H-2 d ->H-2 bd
  • heightened polyclonal immunoglobulin production is due to the interaction of allospecific helper T cells and the host B cells.
  • IgE production In vivo administration of anti-gp39 antibody blocked cGVHD-induced serum anti-DNA autoantibodies, IgE production, spontaneous immunoglobulin production in vitro, associated splenomegaly and the ability to transfer disease.
  • Antibody production remained inhibited for extended periods of time after termination of anti-gp39 administration.
  • CTL cytotoxic T lymphocyte
  • murine antibodies have applicability as therapeutic agents in humans, they are disadvantageous in some respects. Specifically, murine antibodies, because of the fact that they are of foreign species origin, may be immunogenic in humans. This often results in a neutralizing antibody response, which is particularly problematic if the antibodies are desired to be administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition. Also, because they contain murine constant domains they may not exhibit human effector functions.
  • Chimeric antibodies contain portions of two different antibodies, typically of two different species. Generally, such antibodies contain human constant and another species, typically murine variable regions. For example, some mouse/human chimeric antibodies have been reported which exhibit binding characteristics of the parental mouse antibody, and effector functions associated with the human constant region. See, e.g., Cabilly et al, U.S. Pat. No. 4,816,567; Shoemaker et al., U.S. Pat. No. 4,978,745; Beavers et al., U.S. Pat. No. 4,975,369; and Boss et al., U.S. Pat. No.
  • these chimeric antibodies are constructed by preparing a genomic gene library from DNA extracted from pre-existing murine hybridomas (Nishimura et al, Cancer Research, 47:999 (1987)). The library is then screened for variable region genes from both heavy and light chains exhibiting the correct antibody fragment rearrangement patterns.
  • cDNA libraries are prepared from RNA extracted from the hybridomas and screened, or the variable regions are obtained by polymerase chain reaction. The cloned variable region genes are then ligated into an expression vector containing cloned cassettes of the appropriate heavy or light chain human constant region gene. The chimeric genes are then expressed in a cell line of choice, usually a murine myeloma line. Such chimeric antibodies have been used in human therapy.
  • humanized antibodies are known in the art. Ideally, “humanization” results in an antibody that is less immunogenic, with complete retention of the antigen-binding properties of the original molecule. In order to retain all the antigen-binding properties of the original antibody, the structure of its combining-site has to be faithfully reproduced in the “humanized” version. This can potentially be achieved by transplanting the combining site of the nonhuman antibody onto a human framework, either (a) by grafting the entire nonhuman variable domains onto human constant regions to generate a chimeric antibody (Morrison et al, Proc. Natl. Acad. Sci., USA, 81:6801 (1984); Morrison and Oi, Adv.
  • humanization by CDR grafting involves transplanting only the CDRs onto human fragment onto human framework and constant regions. Theoretically, this should substantially eliminate immunogenicity (except if allotypic or idiotypic differences exist). However, it has been reported that some framework residues of the original antibody also need to be preserved (Riechmann et al, Nature, 332:323 (1988); Queen et al, Proc. Natl. Acad. Sci. USA, 86:10,029 (1989)).
  • framework residues which need to be preserved can be identified by computer modeling.
  • critical framework residues may potentially be identified by comparing known antibody combining site structures (Padlan, Molec. Immun., 31(3):169-217 (1994)).
  • the residues which potentially affect antigen binding fall into several groups.
  • the first group comprises residues that are contiguous with the combining site surface which could therefore make direct contact with antigens. They include the amino-terminal residues and those adjacent to the CDRs.
  • the second group includes residues that could alter the structure or relative alignment of the CDRs either by contacting the CDRs or the opposite chains.
  • the third group comprises amino acids with buried side chains that could influence the structural integrity of the variable domains.
  • the residues in these groups are usually found in the same positions (Padlan, 1994 (Id.) according to the adopted numbering system (see Kabat et al, “Sequences of proteins of immunological interest, 5th ed., Pub. No. 91-3242, U.S. Dept. Health & Human Services, NIH, Bethesda, Md., 1991).
  • humanized antibodies are desirable because of their potential low immunogenicity in humans, their production is unpredictable. For example, sequence modification of antibodies may result in substantial or even total loss of antigen binding function, or loss of binding specificity. Alternatively, “humanized antibodies” may still exhibit immunogenicity in humans, irrespective of sequence modification.
  • compositions containing humanized antibodies which are specific to human gp39 It is also an object of the invention to provide pharmaceutical compositions containing humanized antibodies which are specific to human gp39.
  • autoimmune diseases such as systemic lupus erythematosus, rheumatoid arthritis, multiple sclerosis, idiopathic thrombocytopenic purpura (ITP), diabetes
  • ITP idiopathic thrombocytopenic purpura
  • the present invention is directed to humanized antibodies which retain not less than about one-tenth and more preferably not lower than one-third the gp39 antigen binding affinity of the murine 24-31 antibody and/or which retain not less than about one-tenth and more preferably not less than about one-third the in vitro functional activity of the murine antibody 24-31, e.g., in B-cell assays which measure T-cell dependent antibody production. More particularly, the present humanized antibodies retain at least one-tenth and more preferably at least about one-third the half-maximal potency in in vitro functional activity in a B cell assay at a concentration of not more than three times the concentration of the 24-31 antibody.
  • the present invention is further directed to humanized antibodies which bind to the same epitope as the murine 24-31 antibody and/or which are capable of competing with the murine 24-31 antibody for inhibiting the binding of CD40 to gp39 and/or which contain the CDR's of the 24-31 antibody.
  • the present invention is more preferably directed to humanized antibodies derived from murine 24-31 which possess the humanized variable light sequences and/or humanized variable heavy sequences set forth below: (1) DIVMTQSPSFLSASVGDRVTITC KASQNVITAVA WYQQKPGKSP KLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSLQPEDFADYFC QQYNSYPYT FGGGTKLEIK; (2) DIVMTQSPDSLAVSLGERATINC KASQNVITAVA WYQQKPGQSP KLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSLQAEDVADYFC QQYNSYPYT FGGGTKLEIK; (3) DIVMTQSPSFMSTSVGDRVTITC KASQNVITAVA WYQQKPGKSP KLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSMQPEDFADYFC QQYNSYPYT FGGGTKLEIK; (4) DIVMT
  • a humanized variable heavy sequence selected from the following group: (1) EVQLQESGPGLVKPSETLSLTCTVSGDSIT NGFWI WIRKPPGNK LEYMG YISYSGSTYYNPSLKS RISISRDTSKNQFSLKLSSVTAA DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS; (2) EVQLQESGPGLVKPSQTLSLTCTVSGDSIT NGFWI WIRKHPGNK LEYMG YISYSGSTYYNPSLKS RISISRDTSKNQFSLKLSSVTAA DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS; (3) EVQLQESGPGLVKPSQTLSLTCAVSGDSIT NGFWI WIRKHPGNK LEYMG YISYSGSTYYNPSLKS RISISRDTSNNQFSLNLNSVTRA DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS; (4)
  • Variants and equivalents thereof in the present invention are intended to embrace humanized immunoglobulin sequences wherein one or several of the amino acid residues in the above identified humanized variable heavy and/or variable light sequences are modified by substitution, addition and/or deletion in such manner that does not substantially effect gp39 antigen binding affinity.
  • the present invention embraces variants and equivalents which contain conservative substitution mutations, i.e., the substitution of one or more amino acids by similar amino acids.
  • conservative substitution refers to the substitution of an amino acid within the same general class, e.g., an acidic amino acid, or a basic amino acid, a neutral amino acid by another amino acid within the same class. What is intended by a conservative amino acid substitution is well known in the art.
  • such variants and equivalents will retain not less than about one-tenth and more preferably not less than about one-third the gp39 antigen binding affinity as the parent murine 24-31 antibody and more preferably not less than about one-third the gp39 antigen binding affinity as the murine 24-31 antibody. Additionally, such variants and equivalents will preferably retain not lower than one-tenth and more preferably retain at least about one-third the in vitro functional activity of murine antibody 24-31, e.g., in B-cell assays which measure T-cell dependent antibody production. More preferably, these variants and equivalents will retain at least about one-third the in vitro functional activity of murine antibody 24-31, for example, in B-cell assays which measure T-cell dependent antibody production. More specifically, these antibodies will retain the half-maximal potency in in vitro functional activity in a B cell assay at a concentration of not more than about three times the concentration of the parent 24-31 antibody.
  • the present invention is further directed to nucleic acid sequences which encode for the expression of such humanized antibodies, as well as expression vectors which provide for the production of humanized antibodies in recombinant host cells.
  • these DNA sequences will encode for the humanized variable heavy and/or humanized variable light sequences set forth below: (1) DIVMTQSPSFLSASVGDRVTITC KASQNVITAVA WYQQKPGKSP KLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSLQPEDFADYFC QQYNSYPYT FGGGTKLEIK; (2) DIVMTQSPDSLAVSLGERATINC KASQNVITAVA WYQQKPGQSP KLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSLQAEDVADYFC QQYNSYPYT FGGGTKLEIK; (3) DIVMTQSPSFMSTSVGDRVTITC KASQNVITAVA WYQQKPGKSP KLLIY SASNRYT GV
  • a humanized variable heavy sequence selected from the following group: (1) EVQLQESGPGLVKPSETLSLTCTVSGDSIT NGFWI WIRKPPGNK LEYMG YISYSGSTYYNPSLKS RISISRDTSKNQFSLKLSSVTAA DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS; (2) EVQLQESGPGLVKPSQTLSLTCTVSGDSIT NGFWI WIRKHPGNK LEYMG YISYSGSTYYNPSLKS RISISRDTSKNQFSLKLSSVTAA DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS; (3) EVQLQESGPGLVKPSQTLSLTCAVSGDSIT NGFWI WIRKHPGNK LEYMG YISYSGSTYYNPSLKS RISISRDTSNNQFSLNLNSVTRA DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS; (4)
  • the present invention is further directed to the use of the above-identified humanized antibodies specific to gp39 as pharmaceuticals.
  • the present invention is also directed to the use of the subject humanized anti-gp39 antibodies for treating diseases treatable by modulation of gp39 expression or by inhibition of the gp39/CD40 interaction.
  • the present invention is more particularly directed to the use of humanized antibodies of the above-identified humanized antibodies specific to gp39 for the treatment of autoimmune disorders, for example, rheumatoid arthritis, multiple sclerosis, diabetes, systemic lupus erythematosus and ITP.
  • the present invention is further directed to the use of the subject humanized antibodies to gp39 for the treatment of non-autoimmune disorders including graft-versus-host disease and for inhibiting graft rejection.
  • the subject invention is further directed to usage of the subject humanized antibodies as immunosuppressants, in particular during gene or cellular therapy.
  • the subject humanized antibodies should enhance the efficacy of gene therapy or cellular therapy by inhibiting adverse immunogenic reaction to vectors and cells used therein.
  • they may be used to inhibit humoral and cellular immune responses against viral vectors, e.g., retro-viral vectors, adenoviral vectors.
  • the use of such antibodies should enable such cells or vectors to be administered repeatedly, which will facilitate treatment of chronic diseases such as cancers and autoimmune diseases.
  • FIG. 1 depicts the IDEC expression vector N5KG1 used to express humanized and chimeric antibodies derived from 24-31.
  • FIG. 2 a contains results of a B cell proliferation assay which contacts human PBLs with soluble gp39-CD8, recombinant human IL-4 and the murine 24-31 antibody or control murine IgG1 monoclonal antibody which demonstrate that 24-31 antibody inhibits B cell proliferation induced by gp39.
  • FIG. 2B contains results of B cell differentiation assay using mitomycin treated T cells activated with immobilized anti-CD3 cultured in the present of IGD + B cells and different concentrations of the 24-31 antibody which demonstrate that 24-31 antibody inhibits T-cell dependent polyclonal antibody production by human B cells.
  • FIG. 3 contains FACS of non-transfected CHO cells and a gp39 transfectant.
  • FIG. 4 contains the amino acid sequence and DNA sequence corresponding to a preferred humanized variable light sequence (including the complementarity determining regions) referred to as VL#1 or preferred humanized variable light sequence (1).
  • FIG. 5 contains the amino acid and DNA sequence corresponding to a preferred humanized variable ligand sequence (including the complementarity determining regions) referred to as VL#2 or preferred humanized variable light sequence (2).
  • FIG. 6 contains the amino acid and DNA sequence corresponding to a preferred humanized variable heavy sequence (including the complementarity determining regions) referred to as VH#1 of preferred humanized variable heavy sequence (1).
  • FIG. 7 contains the amino acid and DNA sequence of the variable light sequence of 24-31 (non-humanized)
  • FIG. 8 contains the amino acid and DNA sequence of the variable heavy sequence of 24-31 (non-humanized)
  • FIG. 9 compares binding of murine 24-31, chimeric 24-31 and a humanized 24-31 antibody to gp39 expressing CHO cells.
  • FIG. 10 contains results of a competition assay comparing the binding of 24-31 (biotin) and humanized, chimeric and 24-31 to gp39 expressing CHO cells.
  • FIG. 11 contains results of an assay which measures effects of murine 24-31 and a humanized 24-31 antibody of the invention on human IgM production by B cells cultured in the presence of mitomycin C treated T cells.
  • FIG. 12 contains results of an assay comparing binding of two humanized antibodies of the present invention to gp39 expressing CHO cells.
  • FIG. 13 contains the Scatchard plot for murine 24-31.
  • FIG. 14 contains the Scatchard plot for humanized Version 1.
  • FIG. 15 contains the Scatchard plot for humanized Version 2.
  • Humanized antibody This will refer to an antibody derived from a non-human antibody, typically murine, that retains or substantially retains the antigen-binding properties of the parent antibody but which is less immunogenic in humans. This may be achieved by various methods including (a) grafting the entire non-human variable domains onto human constant regions to generate chimeric antibodies, (b) grafting only the non-human CDRs onto human framework and constant regions with or without retention of critical framework residues, or (c) transplanting the entire non-human variable domains, but “cloaking” them with a human-like section by replacement of surface residues. Such methods are disclosed in Jones et al, Morrison et al, Proc. Natl. Acad.
  • CDR Complementarity Determining Region
  • FR refers to amino acid sequences interposed between CDRs. These portions of the antibody serve to hold the CDRs in appropriate orientation (allows for CDRs to bind antigen).
  • Constant Region The portion of the antibody molecule which confers effector functions.
  • murine constant regions are substituted by human constant regions.
  • the constant regions of the subject chimeric or humanized antibodies are derived from human immunoglobulins.
  • the heavy chain constant region can be selected from any of the five isotypes: alpha, delta, epsilon, gamma or mu. Further, heavy chains of various subclasses (such as the IgG subclasses of heavy chains) are responsible for different effector functions and thus, by choosing the desired heavy chain constant region, chimeric antibodies with desired effector function can be produced.
  • Preferred constant regions are gamma 1 (IgG1), gamma 3 (IgG3) and gamma 4 (IgG4). More preferred is an Fc region of the gamma 1 (IgG1) isotype.
  • the light chain constant region can be of the kappa or lambda type, preferably of the kappa type.
  • Chimeric antibody This is an antibody containing sequences derived from two different antibodies, which typically are of different species. Most typically chimeric antibodies comprise human and murine antibody fragments, generally human constant and murine variable regions.
  • Immunogenicity A measure of the ability of a targeting protein or therapeutic moiety to elicit an immune response (humoral or cellular) when administered to a recipient.
  • the present invention is concerned with the immunogenicity of the subject humanized antibodies or fragments thereof.
  • Humanized or chimeric antibody of reduced immunogenicity This refers to an antibody or humanized antibody exhibiting reduced immunogenicity relative to the parent antibody, e.g., the 24-31 antibody.
  • Humanized antibody substantially retaining the binding properties of the parent antibody This refers to a humanized or chimeric antibody which retains the ability to specifically bind the antigen recognized by the parent antibody used to produce such humanized or chimeric antibody.
  • Humanized or chimeric antibodies which substantially retain the binding properties of 24-31 will bind to human gp39.
  • the humanized or chimeric antibody will exhibit the same or substantially the same antigen-binding affinity and avidity as the parent antibody.
  • the affinity of the antibody will not be less than 10% of the parent antibody affinity, more preferably not less than about 30%, and most preferably the affinity will not be less than 50% of the parent antibody.
  • Methods for assaying antigen-binding affinity are well known in the art and include half-maximal binding assays, competition assays, and Scatchard analysis. Suitable antigen binding assays are described in this application.
  • the present invention is directed to novel humanized monoclonal antibodies which bind human gp39 and their use as therapeutic agents.
  • the present invention is further directed toward nucleic acid sequences which encode said humanized antibodies, and their expression in recombinant host cells.
  • the present invention is directed toward humanized antibodies derived from murine antibody 24-31 which specifically binds to human gp39.
  • Murine antibody 24-31 is a murine antibody raised against human gp39 which functionally inactivates gp39 both in vitro and in vivo. Therefore, it possesses properties which render it potentially useful for treatment of diseases wherein gp39 inactivation and/or modulation or inhibition of the gp39/CD40 interaction is desirable.
  • diseases include autoimmune diseases such as, e.g., rheumatoid arthritis, multiple sclerosis, ITP, diabetes, and systemic lupus erythematosus as well as non-auto-immune diseases such as graft-versus-host disease and graft rejection.
  • murine antibody 24-31 possesses functional properties which render it potentially suitable as a therapeutic agent, it possesses several potential disadvantages. Namely, because it is of murine origin it potentially will be immunogenic in humans. Also, because it contains murine constant sequences, it will likely not exhibit the full range of human effector functions and will probably be more rapidly cleared if administered to humans. While such disadvantages should not be problematic in the treatment of some disease conditions or persons, they pose substantial concern if the disease treated is of a chronic or recurrent nature. Examples of recurrent or chronic diseases include, e.g., autoimmune diseases, wherein the host continually or chronically exhibits an autoimmune reaction against self-antigens.
  • the present inventors desired to produce improved, humanized derivatives of the murine 24-31 antibody. While this was the goal of the present invention, the desired result was not of a routine or predictable nature. Humanization of antibodies requires the careful selection of amino acid residues which are to be modified, and the judicious selection of residues which are to be substituted therefor. This is because modification of antibody variable regions, even those involving a few amino acid residues, may cause substantial deleterious effects on antigen binding. For example, humanized antibodies may exhibit substantially reduced antigen affinity and/or antigen-specificity in relation to the parent antibody.
  • CDR grafting techniques while successful in some instances, may substantially adversely affect the affinity of the resultant humanized antibodies. This is believed to occur because some framework residues affect or are essential for and at least affect antigen binding.
  • Our technique Padlan (1994) (Id.)) is more refined because we retain only those murine framework residues which we deem critical to the preservation of the antibody combining site while keeping the surface properties of the molecule as human as possible. Accordingly, this technique has the potential of producing humanized antibodies which retain the antigen-binding characteristics of the parent antibody. Because of this, this technique was selected by the present inventors as the means by which humanized antibodies derived from murine antibody 24-31 specific to human gp39 would potentially be obtained.
  • variable regions of 24-31 resulted in the identification of the V L and V H sequences utilized by the 24-31 antibody respectively shown in FIG. 7 and FIG. 8 .
  • the variable regions were then humanized. As noted, this was effected substantially according to the method of Padlan (1994) (Id.), incorporated by reference supra.
  • This method generally comprises replacement of the non-human framework by human framework residues, while retaining only those framework residues that we deem critical to the preservation of antigen binding properties.
  • this methodology will confer a human-like character on the surface of the xenogeneic antibody thus rendering it less immunogenic while retaining the interior and contacting residues which affect its antigen-binding properties.
  • the 24-31 V K and V H sequences set forth in FIGS. 7 and 8 were humanized by comparison to human antibodies of reported sequence, which are referred to as “templates.”
  • the 24-31 V K was humanized using as templates:
  • VL#1 For VL#1, the human V-Kappa subgroup I sequences, e.g., DEN and the like, as well as the germline 012 (see Cox et al, Eur. J. Immunol. 24:827-836 (1994)), and for VL#2, the human V-Kappa subgroup IV sequences, e.g., LEN.
  • Such template sequences are known and are reported in Kabat et al (1991) (Id.) or GenBank.
  • the 24-31 V H #1 was humanized using as templates
  • Such template variable heavy antibody sequences are also known and are reported in Kabat et al, “Sequences of Proteins of Immunological Interest,” 5th Ed., NIH (1991) and in GenBank.
  • the template human variable heavy and light sequences were selected based on a number of different criteria, including, in particular, high degree of sequence similarity with 24-31 overall, as well as similarity in the “important” residues, i.e., those which are believed to be comprised in the V L :V H interface; those which are in contact with the complementarity determining regions, or which are inwardly pointing. Also, the templates were selected so as to potentially preserve the electrostatic charge of the 24-31 F v as much as possible, and also so as to preserve glycines, prolines and other specific amino acid residues which are believed to affect antigen binding.
  • V L and V H heavy sequences derived from the 24-31 antibody which are set forth below in Table 1 and Table 2.
  • the invention further embraces equivalents and variants of these preferred humanized sequences, e.g., those containing one or more conservative amino acid substitutions which do not substantially affect gp39 binding.
  • the complementarity determining regions are identified in FIGS. 7 and 8 which contain the entire variable heavy and light chain CDR sequences of the parent (non-humanized) 24-31 antibody.
  • Humanized 24-31 antibodies containing these humanized variable heavy and light sequences may be obtained by recombinant methods. It is expected that humanized sequences which contain any combination of the above preferred humanized variable sequences will result in humanized antibodies which bind human gp39. Moreover, based on these sequences, the order of preference using the numbering set forth in Table 1 and Table 2 is expected to be as follows:
  • the above-identified humanized V H and V L sequences may be further modified, e.g., by the introduction of one or more additional substitution modifications and also by the addition of other amino acids. Additional modifications will be selected which do not adversely affect antigen (gp39) binding.
  • the inventors contemplate further modification of the V H chain by substitution of one or more of residues 34, 43, 44 and 68 (according to Kabat numbering scheme) Kabat et al (1991) (Id.).
  • residue 85 of the V L chain Based on the structural features of the antibody combining site, it is believed that modification of such residues should also not adversely impact antigen binding.
  • the introduction of one or more conservative amino acid substitutions should not adversely affect gp39 binding.
  • the preferred humanized framework sequences are also set forth in Table 3 below, which compares these sequences to the template human variable heavy and light framework sequences, i.e., human DEN VK1, Human o12/V36 germline, human LEN VKIV, human 58p2, human Z18320, and human 3d75d as well as to the unhumanized murine 24-31 V H and V L framework sequences.
  • DNA sequences are synthesized which encode for the afore-identified humanized V L and V H sequences.
  • humanized V L sequences and four humanized V H sequences, there are 16 potential humanized antigen combining sites which may be synthesized.
  • there are even more potential humanized antigen combining sites taking into account the potential substitution of residues 34, 43, 44 and 68 of the humanized V H and residue 85 of the humanized V L by other amino acid residues and/or the potential incorporation of conservative substitution mutations.
  • Two of the preferred humanized variable light sequences (1) and (2) and a preferred humanized variable heavy sequence (1) including the complementarity determining regions and corresponding DNA sequences are set forth in FIGS. 4, 5 and 6 , respectively.
  • DNA sequences which encode the subject humanized V L and V H sequences are synthesized, and then expressed in vector systems suitable for expression of recombinant antibodies. This may be effected in any vector system which provides for the subject humanized V L and V H sequences to be expressed as a fusion protein with human constant domain sequences and associate to produce functional (antigen binding) antibodies.
  • Expression vectors and host cells suitable for expression of recombinant antibodies and humanized antibodies in particular, are well known in the art.
  • Host cells known to be capable of expressing functional immunoglobulins include by way of example mammalian cells such as Chinese Hamster Ovary (CHO) cells, COS cells, myeloma cells, bacteria such as Escherichia coli, yeast cells such as Saccharomyces cerevisiae, among other host cells.
  • mammalian cells such as Chinese Hamster Ovary (CHO) cells, COS cells, myeloma cells, bacteria such as Escherichia coli, yeast cells such as Saccharomyces cerevisiae, among other host cells.
  • CHO cells are used by many researchers given their ability to effectively express and secrete immunoglobulins.
  • recombinant expression of humanized antibodies are effected by one of two general methods.
  • the host cells are transfected with a single vector which provides for the expression of both heavy and light variable sequences fused to selected constant regions.
  • the second method host cells are transfected with two vectors, which respectively provide for expression of either the variable heavy or light sequence fused to selected constant regions.
  • Human constant domain sequences are well known in the art, and have been reported in the literature.
  • Preferred human V L sequences includes the Kappa and lambda constant light sequences.
  • Preferred human heavy constant sequences include human gamma 1, human gamma 2, human gamma 3, human gamma 4 and mutated versions thereof which provide for altered effect or function, e.g. enhanced in vivo half-life and reduced Fc receptor binding.
  • Preferred modifications of the human gamma 4 constant domain include P and/or E modifications, which respectively refer to the change of a leucine to a glutamic acid at position 236 and/or the change of a serine to a proline (Kabat numbering) at position 229 such as described in commonly assigned Attorney Docket No. 012712-165 filed on Sep. 6, 1995 and incorporated by reference in its entirety herein.
  • a particularly preferred vector system comprises the expression vectors described in commonly assigned U.S. Ser. No. 08/476,237 filed Jun. 7, 1995, Ser. No. 08/397,072, filed Jan. 25, 1995 and 07/912,122 filed Jul. 10, 1992, Ser. No. 07/886,281 filed Mar. 23, 1992, and Ser. No. 07/735,064 filed Jul. 25, 1991, all incorporated by reference in their entirety.
  • TCAE 5.2 and TCAE 6 which comprise the following:
  • the human immunoglobulin light and heavy chain cassettes contain synthetic signal sequences for secretion of the immunoglobulin chains;
  • the human immunoglobulin light and heavy chain cassettes contain specific DNA links which allow for the insertion of light and heavy immunoglobulin variable regions which maintain the translational reading frame and do not alter the amino acids normally found in immunoglobulin chains.
  • vectors are preferably utilized in CHO cells.
  • the subject antibodies are preferably expressed in the above-described vector systems.
  • the subject humanized antibody sequences derived from the number 24-31 antibody may be expressed in any vector system which provides for the expression of functional antibodies, i.e., those which bind gp39 antigen.
  • the inventors elected to express the subject humanized V L and V H sequences, as well as the native (unmodified) V L and V H sequences derived from 24-31 in CHO cells using the N5KG1 expression vector which contains human Kappa and human gamma 1 constant regions.
  • the N5KG1 expression vector is depicted schematically in FIG. 1 .
  • the chimeric antibody derived from 24-31 when expressed in CHO cells binds gp39 (by demonstrated binding to CHO-gp39 transfectant).
  • several humanized anti-bodies of the invention derived from 24-31 when expressed using this vector system resulted in functional (gp39 binding) antibodies.
  • a panel of 6 murine (all IgG1) anti-gp39 antibodies was generated by immunization with a soluble fusion protein of human gp39 (gp39-CD8), followed by challenge with activated human peripheral blood T cells.
  • Flow cytometric analysis of human peripheral blood T cells demonstrated that the mAbs recognized a cell surface molecule expressed on activated (PMA/ionomycin), but not resting, CD3 + T cells, and that the pattern of reactivity was similar to that seen with a recombinant CD40 fusion protein (CD40-Ig) (data not shown).
  • Anti-gp39 Treatment does not Inhibit the Antigen-Specific T Cell Proliferative Response of hu-PBL-scid Spleen Cells.
  • Anti-gp39 treatment does not alter the anti-tetanus T cell proliferative response following engraftment of human PBL in C.B-17-scid/scid or NOD/LtSz-scid/scid mice immunized with tetanus toxoid.
  • *Four-six week old C.B-17-scid/scid or NOD/LtSz-scid/scid mice were injected i.p. with 20 ⁇ 10 6 human PBL and 0.25 ml tetanus toxoid.
  • a CHO transfectant that constitutively expresses cell-surface gp39 was generated to use as a reagent for the humanized anti-gp39 24-31 binding studies proposed in this application.
  • the full-length gp39 gene (Hollenbaugh et al, Immunol. Rev., 138:23 (1994)) was amplified by polymerase chain reaction (PCR) of phytohemag-glutinin-activated human PBL and cloned into IDEC's INPEP4 vector under the transcriptional control of the cytomegalo-virus (CMV) promoter and enhancer elements.
  • CMV cytomegalo-virus
  • a CHO transfectant was established and amplified in 50 nM methotrexate.
  • the transfectant, 50D4 was shown to express cell-surface gp39 by ELISA (data not shown) and FACS analysis ( FIG. 3 ).
  • IDEC's proprietary NSKG1 expression vector is used in CHO cells for expression of the humanized anti-gp39 24-31 antibody. This vector is depicted schematically in FIG. 1 . High-level expression of recombinant antibodies is consistently obtained in CHO cells using this vector and similar vectors. Using these vectors, a high percentage of G418 resistant clones, 5-10%, are found to express significant amounts of recombinant proteins (1-10 mg/l of antibody). These are usually single plasmid copy integrants, and can easily be amplified using methotrexate to obtain 30-100 pg/cell/day of secreted immunoglobulin. Table 6 lists the antibody levels obtained before and after gene amplification of 3 antibodies expressed in CHO cells utilizing this system.
  • the anti-gp39 24-31 V k and V H gene segments were cloned and sequenced. Following analyses of their sequences, humanized versions of the V region gene segments were designed. The corresponding DNA sequences were synthesized and cloned into a high-level expression vector containing human constant region genes. A CHO transfectant producing the humanized 24-31 antibody is then established. To confirm that the humanized version of the anti-gp39 antibody retains its gp39 binding affinity, the relative affinities of the murine and humanized antibodies were compared in direct binding and competition assays. In addition, the ability of the humanized 24-31 to block CD40 binding to gp39 and to inhibit T cell-dependent antibody production is evaluated.
  • cDNA Preparation of cDNA.
  • PolyA + mRNA was prepared from 2 ⁇ 10 6 cells each of the 24-31 hybridoma and the NS1 cell line, (Carroll et al, Mol. Immunol., 10:991 (1988)), the fusion partner used in the generation of the 24-31 hybridoma, utilizing an Invitrogen Corporation Micro-Fast TrackTM mRNA isolation kit, according to the manufacturer's protocol.
  • First strand cDNA was synthesized utilizing 50 pmoles oligo-dT and 5 units M-MLV reverse transcriptase (Promega) (Sambrook et al, Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory Press (1989)) followed by Sephadex G-25 chromatography.
  • V k and V H cDNA 24-31 and NS1 cDNA were amplified by PCR using a panel of 5′ primers specific for V k or V H leader sequences in combination with 3′ constant region primers.
  • the panel of 5′V H primers are identical to those described by Jones and Bendig ( Bio/Technol., 9:88 (1991); Errata, Bio/Technol., 9:579 (1991)).
  • the panel of 5′V k primers (Jones et al, (Id.)) were modified to convert the Sal I cloning site recognition sequences (GTCGAC) into Bgl II recognition sequences (AGATCT) to facilitate the cloning of the amplified gene segments into IDEC's N5KG1 expression vector (See FIG. 1 ).
  • the 3′ V k and V H primers contain a Bsi WI cloning site sequence at amino acid positions 108-109 (numbering according to Kabat et al, “Sequences of Proteins of Immunological Interest,” 5th Ed., NIH (1991)) and a Nhe I cloning site sequence at positions 114-115, respectively, and have the following sequences: TGCAGCATC CGTACG TTTGATTCCAGCTT (Ck) and GGGGGTGTCGT GCTAG CTG (A/C)(G/A) GAGAC(G/A)GTGA (C ⁇ 1).
  • This primer panel has been previously used by the Assignee to amplify and clone the C2B8 anti-CD20 antibody (Nishioka et al, J. Immunol., 153:1027 (1994)) and numerous other mouse V k and V H gene segments (data not shown).
  • the 24-31 cDNA were amplified in 23 individual reactions containing one of the 11 5′V k primers in combination with the C K primer or one of the 12 5′V H primers in combination with the C ⁇ 1 primer.
  • NS1 cDNA was amplified using the same panel of primers.
  • 1 ⁇ l cDNA (1/50 of the cDNA sample) was amplified in a 100 ⁇ l final volume containing 5 units Tag DNA polymerase (Perkin Elmer), 10 mM Tris-HCl, pH 8.3, 50 mM KCl, 1.5 mM MgCl 2 , 0.25 mM each of dCTP, dGTP, DATP, and TTP, 50 pmoles 3′ constant region primer, and 50 pmoles 5′ primer.
  • The-amplification cycle consisted of denaturation for 1 minute at 95° C., annealing for 2 minutes at 50° C., and extension for 2 minutes at 72° C., repeated 34 times.
  • the amplified products were analyzed by agarose gel electrophoresis.
  • PCR amplified products are agarose gel-purified (Sambrook et al, Molecular Cloning: A Laboratory Manual, 2nd Ed. (1989)) and digested with Bgl II and Bsi WI (for Vk) or Sal I and Nhe I (for V H ).
  • the products are ligated (Ausabel et al, Current Protocols in Molecular Biology, Vol. 2, Greene Publ. Assoc. (1992)) sequentially into IDEC's vector, N5KG1.
  • plasmid DNA was prepared, and the V k and V H sequences obtained from the duplicate constructs (sequencing performed by Scripps Research Institute Core Facility, La Jolla, Calif.).
  • the sequences of the endogenous light and heavy chains of the NS1 fusion partner are known (Carroll et al, Mol. Immunol., 10:991 (1988); Kabat et al, (1991) (Id.)) and were used to distinguish PCR products resulting from the amplification of the 24-31 versus the NS1 fusion partner V regions.
  • Humanized versions containing the most preferred humanized 24-31 V k and V H sequences identified in Tables 1 and 2 as humanized V L and V H (1) were synthesized. Specifically, four pairs of overlapping, complementary olionucleotides (oligos) encoding the above-identified humanized V k or V H regions were synthesized (Midland Chemicals) and purified by denaturing polyacrylamide gel electrophoresis (Ausubel et al, Current Protocols in Molecular Biology, Vol. 2, Greene Publ. Assoc. (1992)). Each oligo is approximately 100 bases in length and overlap by 20 bases the adjacent complementary oligonucleotide.
  • V k and V H 5 ′ oligos contain Bgl II and Sal I cloning sites and the 3′ oligos possess Bsi WI and Nhe I cloning sites, respectively.
  • Each variable region gene segment was assembled from the synthetic oligos, diagrammed below, using the following procedure (summarized in Watson et al, Recombinant DNA, 2nd Ed., Scientif. Amer. Books, NY, N.Y. (1992)).
  • Complementary oligo pairs (A+E, B+F, C+G, D+F) were kinased using 300 pmoles of each primer and T4 polynucleotide kinase (Promega) according to the manufacturer's protocol.
  • the oligos were annealed by heating to 95° C. and slow cooling to room temperature.
  • the annealed oligo pairs were ligated (A/E with B/F and C/G with D/H) utilizing 6 units T4 DNA ligase (New England Biolabs).
  • T4 DNA ligase New England Biolabs
  • the approximately 200 base pair DNA fragments were purified by electroelution following polyacrylamide gel electrophoresis (Sambrook et al, (Id.)).
  • the synthetic gene fragments were then inserted into IDEC's proprietary high-level expression vector, N5KG1, under the transcriptional control of the CMV promoter and enhancer elements.
  • the ligation reaction contains the 2 gel-purified fragments (A/E/B/F and C/G/D/H) and N5KG1 at a molar ratio of 100:100:1, respectively.
  • plasmid DNA was prepared and the sequences of the synthetic gene segments confirmed.
  • the resulting construct, h24-31 encodes the humanized 24-31 V region segments and human kappa and gamma 1 constant regions.
  • this antibody contains the humanized variable heavy and humanized-variable light sequences identified in Table 1 and Table 2 as the “(1)” sequences, which are predicted to provide for humanized antibody having optimal gp39 properties.
  • CHO transfectants expressing humanized 24-31 were generated by electroporation of 4 ⁇ 10 6 CHO cells with linearized h24-31 DNA (version 1 or version 2) followed by selection in G418.
  • the cell culture supernatants from G418 resistant clones were assayed for immunoglobulin production by sandwich ELISA employing a goat anti-human kappa to capture the immunoglobulin.
  • Immunoglobulin binding was measured by incubating with a horse radish peroxidase (HRP)-conjugated goat antibody specific for human IgG, followed by HRP substrate, 0.4 mg/ml O-Phenylene-diamine (OPD) in a citrate buffer (9-34 g/l C 6 H 8 O 7 , and 14.2 g/l Na 2 HPO 4 ), pH 5.0, including 0.0175% H 2 O 2 .
  • HRP substrate horse radish peroxidase
  • OPD O-Phenylene-diamine
  • the humanized anti-gp39 24-31 antibody is evaluated initially for direct binding to cell surface gp39 expressed on 50D4, the gp39 CHO transfectant described in Example 5.
  • Supernatants from the G418-resistant h24-31 CHO transfectants that produce immunoglobulin are tested for binding to 50D4 cells and, as negative control, to CHO cells.
  • 50D4 1 ⁇ 10 5 / well, are bound to the bottom of 96 well, poly-L-lysine coated polystyrene plates.
  • the cells are fixed in 0.5% glutaraldehyde in phosphate buffered saline (PBS) for 15 minutes. Plates coated with CHO cells are generated similarly.
  • the cell culture supernatants are added and antibody binding measured using a HRP-conjugated goat anti-human IgG, as described above.
  • Two assays are used to determine if the humanized 24-31 antibody retains its affinity to gp39 relative to the original murine 24-31 antibody, (i) half-maximal binding concentration and (ii) a competition assay using 50D4 cells.
  • the antibodies will be purified on protein A and the concentration of each antibody determined by ELISA by a comparison to isotype matched controls.
  • Half-maximal binding (i) are determined by incubating humanized 24-31 with 50D4 cells at various concentrations from 2 ⁇ g/ml to 0.1 ng/ml. The concentration resulting in a half-maximal OD 490 reading, as described above, is compared with the half-maximal binding of murine 24-31.
  • the humanized 24-31 antibody and the murine 24-31 antibody are mixed in various molar ratios ranging from 100:1 to 1:100, and their ability to compete for binding to 50D4 cells measured.
  • Two sets are run, one where the binding of the humanized antibody will be measured using goat-anti-human IgG (anti-mouse IgG depleted)-HRP and one where the binding of murine antibody is measured using goat-anti-mouse IgG (anti-human IgG depleted)-HRP.
  • Binding curves, one for the murine and one for the humanized antibody, based on molar ratios, are generated and their relative affinities calculated.
  • an assay is effected to confirm that the humanized anti-gp39 retains its ability to block the binding of the ligand to its receptor.
  • activated human peripheral blood T cells, or the gp39-transfected CHO cells, 50D4 are pretreated with graded concentrations of murine 24-31 or with humanized 24-31 for 15 minutes at 4° C.
  • CD40-Ig-biotin is added and the binding determined by flow cytometry using PE-avidin. Concentrations of mAbs to achieve a 50% reduction in CD40-Ig binding are determined.
  • B cells are cultured with a soluble fusion protein of gp39 (gp39-CD8) in the presence or absence of a range of doses of murine 24-31 or humanized 24-31.
  • B cell proliferative response is assessed by 3 H-thymidine incorporation as shown in FIG. 2A .
  • T cell dependent B cell differentiation is blocked by mAbs to gp39.
  • the ability of the subject humanized 24-31 antibodies inhibit T cell-induced B cell differentiation is assessed.
  • B cells are co-cultured with anti-CD3 activated T cells in the presence or absence of humanized 24-31 and murine 24-31.
  • Polyclonal IgM, IgG, and IgA production is assessed after 12 days (see FIG. 2B ).
  • This experiment was effected to determine the reactivity of the murine, chimeric, and humanized (version 1) 24-31 antibodies to the gp39 antigen relative to the concentration of antibody.
  • the ability of the chimeric and humanized (version 1) 24-31 antibodies to compete with the murine 24-31 for binding to mgp39-CHO cells basis was evaluated.
  • the ability of the humanized 24-31 to compete with the murine 24-31 for binding to mgp39-CHO was used to evaluate whether in the humanized antibody the exchanges of the murine framework residues with their human counterparts resulted in a significant loss ( ⁇ 3 ⁇ decrease) of affinity.
  • the humanized 24-31 was compared to the murine 24-31 in a “Lipsky” assay.
  • Donor peripheral blood mononuclear cells were separated into two fractions, a T and a B cell fraction.
  • the T cells were first treated with mitomycin C, to prevent mitosis, and then activated with an anti-CD3 antibody.
  • the B cells were added, together with either the murine or humanized (version 1) 24-31 antibodies.
  • a positive control without antibody, and a negative control without B cells were included in the experiment. After a 10 day incubation, the supernatants were tested for the presence of human IgM.
  • the results show that the production of human IgM is inhibited 50% by the humanized 24-31 at a concentration below 0.01 ⁇ g/ml, similar to the inhibition level obtained with the murine 24-31 (see FIG. 11 ).
  • the humanized antibody retained its ability to inhibit T cell dependent B cell differentiation (IgM production) in this experiment.
  • a predetermined amount of each of the three antibodies (murine, version 1 or version 2 24-31) was labeled with 125 I using IODO-BEADS® (Pierce).
  • Antibody bound- 125 I was separated from free 125 I by size separation on a Sephadex-G25/DEAE/Amberlite column.
  • 125 I-labeled antibody was mixed and incubated with non-labeled antibody in a dilution series. Based on the total amount of bound antibody and the amount of free antibody, a Scatchard plot was generated from a bound vs. bound-free graph. The total antibody concentration was based on a standard size of 75 kD for one active site.
  • the Kd was calculated by generating a “best fit” line.
  • the inverse of the slope of the curve is the Kd.
  • the correlation coefficient, r 2 was also computed.
  • the humanized anti-gp39 antibodies of the present invention have potential in treating any disease condition wherein gp39 modulation and/or inhibition of the gp39-CD40 interaction is therapeutically beneficial.
  • the subject humanized anti-gp39 antibodies may be used in treatment of diseases wherein suppression of antibody responses to antigens are desirable. Such conditions include both autoimmune and non-autoimmune disorders.
  • anti-gp39 antibodies to prevent CD40 signaling in B cells is functionally translated into marked inhibition of T cell-dependent antibody responses in vivo. Therefore, autoimmune diseases which are mediated by auto-antibody production would be expected to benefit from anti-gp39 antibody therapy.
  • diseases include systemic lupus erythematosus, idiopathic thrombocytopenic purpura, myasthenia gravis and a subpopulation of diabetic patients with anti-insulin and anti-insulin receptor antibodies.
  • CD40 signaling in B cells and dendritic cells is essential for upregulation of co-signaling receptors such as B7.1 and B7.2 molecules.
  • Blocking of this CD40 signaling by anti-gp39 antibodies interferes with antigen presentation to T cells, resulting in inhibition of T cell activation and T cell-mediated responses.
  • the therapeutic efficacy of anti-gp39 antibodies in disease models such as CIA, EAE, NOD mice, GVHD and graft rejection further confirms the antibody's inhibitory effect on T cell-mediated responses. Based on this mechanism of action supported by the efficacy in animal models, the therapeutic potential of the subject humanized anti-gp39 antibodies extend to such diseases as RA, MS, diabetes, psoriasis, GVHD and graft rejection.
  • Specific conditions which are potentially treatable by administration of the subject humanized antibodies include the following:
  • Allergic bronchopulmonary aspergillosis Autoimmune hemolytic anemia; Acanthosis nigricans; Allergic contact dermatitis; Addison's disease; Atopic dermatitis; Alopecia areata; Alopecia universalis; Amyloidosis; Anaphylactoid purpura; Anaphylactoid reaction; Aplastic anemia; Angioedema, hereditary; Angioedema, idiopathic; Ankylosing spondylitis; Arteritis, cranial; Arteritis, giant cell; Arteritis, Takayasu's; Arteritis, temporal; Asthma; Ataxia-telangiectasia; Autoimmune oophoritis; Autoimmune orchitis; Autoimmune polyendocrine failure; Behcet's disease; Berger's disease; Buerger's disease; Bullous pemphigus; Candidiasis, chronic mucocutaneous; Caplan's syndrome;
  • the preferred indications treatable or presentable by administration of anti-gp39 antibodies include autoimmune hemolytic anemia; aplastic anemia; arteritis, temporal; diabetes mellitus; Felty's syndrome; Goodpasture's syndrome; graft-vs-host disease; idiopathic thrombocytopenia pupura; myasthenia gravis; multiple sclerosis; polyarteritis nodosa; psoriasis; psoriatic arthritis; rheumatoid arthritis; systemic lupus erythematosus; asthma; allergic conditions; and transplant rejection.
  • the amount of antibody useful to produce a therapeutic effect can be determined by standard techniques well known to those of ordinary skill in the art.
  • the antibodies will generally be provided by standard technique within a pharmaceutically acceptable buffer, and may be administered by any desired route. Because of the efficacy of the presently claimed antibodies and their tolerance by humans it is possible to administer these antibodies repetitively in order to combat various diseases or disease states within a human.
  • the subject anti-gp39 humanized antibodies (or fragments thereof) of this invention are also useful for inducing immunomodulation, e.g., inducing suppression of a human's or animal's immune system.
  • This invention therefore relates to a method of prophylactically or therapeutically inducing immunomodulation in a human or other animal in need thereof by administering an effective, non-toxic amount of such an antibody of this invention to such human or other animal.
  • the antibodies of this invention have utility in inducing immunosuppression means that they are useful in the treatment or prevention of resistance to or rejection of transplanted organs or tissues (e.g., kidney, heart, lung, bone marrow, skin, cornea, etc.); the treatment or prevention of autoimmune, inflammatory, proliferative and hyperproliferative diseases, and of cutaneous manifestations of immunologically mediated diseases (e.g., rheumatoid arthritis, lupus erythematosus, systemic lupus erythematosus, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, type 1 diabetes, uveitis, nephrotic syndrome, psoriasis, atopical dermatitis, contact dermatitis and further eczematous dermatitides, seborrheic dermatitis, Lichen planus, Pemplugus, bullous pemphicjus, Epidermolysis bullosa,
  • the subject antibodies can be used as immunosuppressants during cellular or gene therapy. This potentially will enable such cells or gene therapy constructs to be administered repeatedly, or at higher dosages without an adverse immunogenic response.
  • an effective dosage will be in the range of about 0.05 to 100 milligrams per kilogram body weight per day.
  • the antibodies of the invention may be administered to a human or other animal in accordance with the aforementioned methods of treatment in an amount sufficient to produce such effect to a therapeutic or prophylactic degree.
  • Such antibodies of the invention can be administered to such human or other animal in a conventional dosage form prepared by combining the antibody of the invention with a conventional pharmaceutically acceptable carrier or diluent according to known techniques. It will be recognized by one of skill in the art that the form and character of the pharmaceutically acceptable carrier or diluent is dictated by the amount of active ingredient with which it is to be combined, the route of administration and other well-known variables.
  • the route of administration of the antibody (or fragment thereof) of the invention may be oral, parenteral, by inhalation or topical.
  • parenteral as used herein includes intravenous, intramuscular, subcutaneous, rectal, vaginal or intraperitoneal administration.
  • the subcutaneous and intramuscular forms of parenteral administration are generally preferred.
  • the daily parenteral and oral dosage regimens for employing compounds of the invention to prophylactically or therapeutically induce immunosuppression will generally be in the range of about 0.05 to 100, but preferably about 0.5 to 10, milligrams per kilogram body weight per day.
  • the antibody of the invention may also be administered by inhalation.
  • inhalation is meant intranasal and oral inhalation administration.
  • Appropriate dosage forms for such administration such as an aerosol formulation or a metered dose inhaler, may be prepared by conventional techniques.
  • the preferred dosage amount of a compound of the invention to be employed is generally within the range of about 10 to 100 milligrams.
  • the antibody of the invention may also be administered topically.
  • topical administration is meant non-systemic administration and includes the application of an antibody (or fragment thereof) compound of the invention externally to the epidermis, to the buccal cavity and instillation of such an antibody into the ear, eye and nose, and where it does not significantly enter the blood stream.
  • systemic administration is meant oral, intravenous, intraperitoneal and intramuscular administration.
  • the amount of an antibody required for therapeutic or prophylactic effect will, of course, vary with the antibody chosen, the nature and severity of the condition being treated and the animal undergoing treatment, and is ultimately at the discretion of the physician.
  • a suitable topical dose of an antibody of the invention will generally be within the range of about 1 to 100 milligrams per kilogram body weight daily.
  • the active ingredient may comprise, for topical administration, from 0.001% to 10% w/w, e.g., from 1% to 2% by weight of the formulation, although it may comprise as much as 10% w/w but preferably not in excess of 5% w/w and more preferably from 0.1% to 1% w/w of the formulation.
  • the topical formulations of the present invention comprise an active ingredient together with one or more acceptable carrier(s) therefor and optionally any other therapeutic ingredients(s) .
  • the carrier(s) must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not deleterious to the recipient thereof.
  • Formulations suitable for topical administration include liquid or semi-liquid preparations suitable for penetration through the skin to the site of where treatment is required, such as liniments, lotions, creams, ointments or pastes, and drops suitable for administration to the eye, ear or nose.
  • Drops according to the present invention may comprise sterile aqueous or oily solutions or suspensions and may be prepared by dissolving the active ingredient in a suitable aqueous solution of a bactericidal and/or fungicidal agent and/or any other suitable preservative, and preferably including a surface active agent.
  • the resulting solution may then be clarified by filtration, transferred to a suitable container which is then sealed and sterilized by autoclaving or maintaining at 90°-100° C. for half an hour.
  • the solution may be sterilized by filtration and transferred to the container by an aseptic technique.
  • bactericidal and fungicidal agents suitable for inclusion in the drops are phenylmercuric nitrate or acetate (0.002%), benzalkonium chloride (0.01%) and chlorhexidine acetate (0.01%).
  • Suitable solvents for the preparation of an oily solution include glycerol, diluted alcohol and propylene glycol.
  • Lotions according to the present invention include those suitable for application to the skin or eye.
  • An eye lotion may comprise a sterile aqueous solution optionally containing a bactericide and may be prepared by methods similar to those for the preparation of drops.
  • Lotions or liniments for application to the skin may also include an agent to hasten drying and to cool the skin, such as an alcohol or acetone, and/or a moisturizer such as glycerol or an oil such as castor oil or arachis oil.
  • Creams, ointments or pastes according to the present invention are semi-solid formulations of the active ingredient for external application. They may be made by mixing the active ingredient in finely-divided or powdered form, alone or in solution or suspension in an aqueous or non-aqueous fluid, with the aid of suitable machinery, with a greasy or non-greasy basis.
  • the basis may comprise hydrocarbons such as hard, soft or liquid paraffin, glycerol, beeswax, a metallic soap; a mucilage; an oil of natural origin such as almond, corn, arachis, castor or olive oil; wool fat or its derivatives, or a fatty acid such as stearic or oleic acid together with an alcohol such as propylene glycol or macrogels.
  • the formulation may incorporate any suitable surface active agent such as an anionic, cationic or non-ionic surface active such as sorbitan esters or polyoxyethylene derivatives thereof.
  • Suspending agents such as natural gums, cellulose derivatives or inorganic materials such as silicaceous silicas, and other ingredients such as lanolin, may also be included.
  • the optimal quantity and spacing of individual dosages of an antibody or fragment thereof of the invention will be determined by the nature and extent of the condition being treated, the form, route and site of administration, and the particular animal being treated, and that such optimums can be determined by conventional techniques. It will also be appreciated by one of skill in the art that the optimal course of treatment, i.e., the number of doses of an antibody or fragment thereof of the invention given per day for a defined number of days, can be ascertained by those skilled in the art using conventional course of treatment determination tests.
  • a pharmaceutical composition of this invention in the form of a capsule is prepared by filling a standard two-piece hard gelatin capsule with 50 mg. of an antibody or fragment thereof of the invention, in powdered form, 100 mg. of lactose, 32 mg. of talc and 8 mg. of magnesium stearate.
  • a pharmaceutical composition of this invention in a form suitable for administration by injection is prepared by stirring 1.5 k by weight of an antibody or fragment thereof of the invention in 10 k by volume propylene glycol and water. The solution is sterilized by filtration.
  • Antibody or fragment thereof of the invention 1.0 g.
  • the antibody or fragment thereof of the invention is dispersed in a small volume of the vehicle to produce a smooth, homogeneous product. Collapsible metal tubes are then filled with the dispersion.
  • Antibody or fragment thereof of the invention 1.0 g.
  • the polawax, beeswax and lanolin are heated together at 60° C.
  • a solution of methyl hydroxybenzoate is added and homogenization is achieved using high speed stirring.
  • the temperature is then allowed to fall to SOOC.
  • the antibody or fragment thereof of the invention is then added and dispersed throughout, and the composition is allowed to cool with slow speed stirring.
  • Antibody or fragment thereof of the invention 1.0 g.
  • Sorbitan Monolaurate 0.6 g. Polysorbate 20 0.6 g.
  • Cetostearyl Alcohol 1.2 9. Glycerin 6.0 g.
  • the methyl hydroxybenzoate and glycerin are dissolved in 70 ml. of the water at 75° C.
  • the sorbitan monolaurate, polysorbate 20 and cetostearyl alcohol are melted together at 75° C. and added to the aqueous solution.
  • the resulting emulsion is homogenized, allowed to cool with continuous stirring and the antibody or fragment thereof of the invention is added as a suspension in the remaining water. The whole suspension is stirred until homogenized.
  • Antibody or fragment thereof of the invention 0.5 g.
  • methyl and propyl hydroxybenzoates are dissolved in 70 ml. purified water at 75° C. and the resulting solution is allowed to cool.
  • the antibody or fragment thereof of the invention is then added, and the solution is sterilized by filtration through a membrane filter (0.022 Am pore size), and packed aseptically into suitable sterile containers.
  • composition for Administration by Inhalation Composition for Administration by Inhalation
  • an aerosol container with a capacity of 15-20 ml mix 10 mg. of an antibody or fragment thereof of the invention with 0.2-0.5 k of a lubricating agent, such as polysorbate 85 or oleic acid, and disperse such mixture in a propellant, such as freon, preferably in a combination of (1,2 dichlorotetrafluoroethane) and difluorochloromethane and put into an appropriate aerosol container adapted for either intranasal or oral inhalation administration.
  • a propellant such as freon
  • Composition for Administration by Inhalation For an aerosol container with a capacity of 15-20 ml: dissolve 10 mg.
  • a lubricating agent such as polysorbate 85 or oleic acid
  • disperse such in a propellant, such as freon, preferably in combination of (1-2 dichlorotetrafluoroethane) and difluorochloromethane, and put into an appropriate aerosol container adapted for either intranasal or oral inhalation administration.
  • compositions for parenteral administration are particularly useful for parenteral administration, i.e., subcutaneously, intramuscularly or intravenously.
  • the compositions for parenteral administration will commonly comprise a solution of an antibody or fragment thereof of the invention or a cocktail thereof dissolved in an acceptable carrier, preferably an aqueous carrier.
  • an acceptable carrier preferably an aqueous carrier.
  • aqueous carriers may be employed, e.g., water, buffered water, 0.4 k saline, 0.3% glycine, and the like. These solutions are sterile and generally free of particulate matter. These solutions may be sterilized by conventional, well-known sterilization techniques.
  • the compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, etc.
  • the concentration of the antibody or fragment thereof of the invention in such pharmaceutical formulation can vary widely, i.e., from less than about 0.5 k, usually at or at least about 1% to as much as 15 or 20% by weight, and will be selected primarily based on fluid volumes, viscosities, etc., according to the particular mode of administration selected.
  • a pharmaceutical composition of the invention for intramuscular injection could be prepared to contain 1 mL sterile buffered water, and 50 mg. of an antibody or fragment thereof of the invention.
  • a pharmaceutical composition of the invention for intravenous infusion could be made up to contain 250 ml. of sterile Ringer's solution, and 150 mg. of an antibody or fragment thereof of the invention.
  • Actual methods for preparing parenterally administrable compositions are well-known or will be apparent to those skilled in the art, and are described in more detail in, e.g., Remington's Pharmaceutical Science, 15th ed., Mack Publishing Company, Easton, Pa., hereby incorporated by reference herein.
  • the antibodies (or fragments thereof) of the invention can be lyophilized for storage and reconstituted in a suitable carrier prior to use. This technique has been shown to be effective with conventional immune globulins and art-known lyophilization and reconstitution techniques can be employed.
  • compositions of the invention can be administered for prophylactic and/or therapeutic treatments.
  • compositions are administered to a patient already suffering from a disease, in an amount sufficient to cure or at least partially arrest the disease and its complications.
  • compositions containing the present antibodies or a cocktail thereof are administered to a patient not already in a disease state to enhance the patient's resistance.
  • Single or multiple administrations of the pharmaceutical compositions can be carried out with dose levels and pattern being selected by the treating physician.
  • the pharmaceutical composition of the invention should provide a quantity of the altered antibodies (or fragments thereof) of the invention sufficient to effectively treat the patient.
  • antibodies of this invention may be used for the design and synthesis of either peptide or non-peptide compounds (mimetics) which would be useful in the same therapy as the antibody. See, e.g., Saragovi et al, Science, 253:792-795 (1991).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • Hematology (AREA)
  • Molecular Biology (AREA)
  • Dermatology (AREA)
  • Biochemistry (AREA)
  • Pulmonology (AREA)
  • Microbiology (AREA)
  • Urology & Nephrology (AREA)
  • Biomedical Technology (AREA)
  • Diabetes (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Mycology (AREA)
  • Rheumatology (AREA)
  • Otolaryngology (AREA)
  • Pathology (AREA)
  • Cell Biology (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Obesity (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Ophthalmology & Optometry (AREA)

Abstract

The present invention is directed to humanized antibodies which bind human gp39 and their use as therapeutic agents. These humanized antibodies are especially useful for treatment of autoimmune diseases; and an immunosuppressant during transplantation of heterologous cells, tissues or organs, cell therapy, and gene therapy.

Description

    CROSS-REFERENCE TO RELATED APPLICATION
  • This application is a continuation-in-part of copending application Ser. No. 08/554,840, filed Nov. 7, 1995.
  • FIELD OF THE INVENTION
  • The present invention is directed to humanized antibodies specific for human gp39, DNA encoding such antibodies, methods for their production, pharmaceutical compositions containing, and the use of such humanized antibodies as therapeutic agents. These antibodies have particular application in the treatment of autoimmune diseases including, e.g., rheumatoid arthritis, multiple sclerosis, diabetes, and systemic lupus erythematosus as well as non-autoimmune diseases including, e.g., graft-versus-host disease and for preventing graft rejection.
  • BACKGROUND OF THE INVENTION
  • The immune system is capable of producing two types of antigen-specific responses to foreign antigens. Cell-mediated immunity is the term used to refer to effector functions of the immune system mediated by T lymphocytes. Humoral immunity is the term used to refer to production of antigen-specific antibodies by B lymphocytes. It has long been appreciated that the development of humoral immunity against most antigens requires not only antibody-producing B lymphocytes but also the involvement of helper T (hereinafter Th) lymphocytes. (Mitchison, Eur. J. Immunol., 1:18-25 (1971); Claman and Chaperon, Transplant Rev., 1:92-119 (1969); Katz et al, Proc. Natl. Acad. Sci. USA, 70:2624-2629 (1973); Reff et al, Nature, 226:1257-1260 (1970)). Certain signals, or “help”, are provided by Th cells in response to stimulation by Thymus-dependent (hereinafter TD) antigens. While some B lymphocyte help is mediated by soluble molecules released by Th cells (for instance lymphokines such as IL-4 and IL-5), activation of B cells also requires a contact-dependent interaction between B cells and Th cells. (Hirohata et al, J. Immunol., 140:3736-3744 (1988); Bartlett et al, J. Immunol., 143:1745-1765 (1989)). This indicates that B cell activation involves an obligatory interaction between cell surface molecules on B cells and Th cells. Such an interaction is further supported by the observation that isolated plasma membranes of activated T cells can provide helper functions necessary for B cell activation. (Brian, Proc. Natl. Acad. Sci. USA, 85:564-568 (1988); Hodgkin et al, J. Immunol., 145:2025-2034 (1990); Noelle et al, J. Immunol., 146:1118-1124 (1991)).
  • It is further known that in a contact-dependent process termed “T cell helper function”, CD4+ T lymphocytes direct the activation and differentiation of B lymphocytes and thereby regulate the humoral immune response by modulating the specificity, secretion and isotype-encoded functions of antibody molecules (Mitchell et al, J. Exp. Med., 128:821 (1968); Mitchison, Eur. J. Immunol., 1:68 (1971); White et al, J. Exp. Med., 14:664 (1978); Reinherz et al, Proc. Natl. Acad. Sci. USA, 74:4061 (1979); Janeway et al, Immunol. Rev., 101:39 (1988); O'Brien et al, J. Immunol., 141:3335 (1988); Rahemtulla et al, Nature, 353:180 (1991); and Grusby et al, Science, 253:1417 (1991)).
  • The process by which T cells help B cells to differentiate has been divided into two distinct phases; the inductive and effector phases (Vitetta et al, Adv. Immunol., 45:1 (1989); Noelle et al, Immunol. Today, 11:361 (1990)). In the inductive phase, resting T cells contact antigen-primed B cells and this association allows clonotypic T cell receptor (TCR)-CD4 complexes to interact with Ia/Ag complexes on B cells (Janeway et al, Immunol. Rev., 101:39 (1988); Katz et al, Proc. Natl. Acad. Sci., 70:2624 (1973); Zinkernagel, Adv. Exp. Med., 66:527 (1976); Sprent, J. Exp. Med., 147:1159 (1978); Sprent, Immunol. Rev., 42:158 (1978); Jones et al, Nature, 292:547 (1981); Julius et al, Eur. J. Immunol., 18:375 (1982); Chestnut et al, J. Immunol., 126:1575 (1981); and Rogozinski et al, J. Immunol., 126:735 (1984)). TCR/CD4 recognition of Ia/Ag results in the formation of stable T-B cognate pairs and bi-directional T and B cell activation (Sanders et al, J. Immunol., 137:2395 (1986); Snow et al, J. Immunol., 130:614 (1983); Krusemeier et al, J. Immunol., 140:367 (1988); Noelle et al, J. Immunol., 143:1807 (1989); Bartlett et al, J. Immunol., 143:1745 (1989); and Kupfer et al, Annu. Rev. Immunol., 7:309 (1987)). In the effector phase, activated T cells drive B cell differentiation by secreting lymphokines (Thompson et al, J. Immunol., 134:369 (1985)) and by contact-dependent stimuli (Noelle et al, J. Immunol., 143:1807 (1989); Clement et al, J. Immunol., 140:3736 (1984); Crow et al, J. Exp. Med., 164:1760 (1986); Brian, Proc. Natl. Acad. Sci., USA, 85:564 (1988); Hirohata et al, J. Immunol. 140:3736 (1988); Jover et al, Clin. Immunol. Immun., 53:90 (1989); Whalen et al, J. Immunol., 141:2230 (1988); Pollok et al, J. Immunol., 146:1633 (1991); and Bartlett et al, J. Immunol., 143:1745 (1990)), both of which are required for T cells to drive small resting B cells to terminally differentiate into Ig secreting cells (Clement et al, J. Immunol., 132:740 (1984); Martinez et al, Nature, 290:60 (1981); and Andersson et al, Proc. Natl. Acad. Sci., USA, 77:1612 (1980)).
  • Although the inductive phase of T cell help is Ag-dependent and MHC-restricted (Janeway et al, Immun. Rev., 101:34 (1988); Katz et al, Proc. Natl. Acad. Sci., USA, 10:2624 (1973); Zinkernagle, Adv. Exp. Med. Biol., 66:527 (1976)); the effector phase of T cell helper function can be Ag-independent and MHC-nonrestricted (Clement et al, J. Immunol., 132:740 (1984); Hirohata et al, J. Immunol., 140:3736 (1988); Whalen et al, J. Immunol., 143:1715 (1988)). An additional contrasting feature is that the inductive phase of T cell help often requires CD4 molecules and is inhibited by anti-CD4 mAb (Rogozinski et al, J. Immunol., 126:735 (1984)), whereas helper effector function does not require CD4 molecules (Friedman et al, Cell Immunol., 103:105 (1986)) and is not inhibited by anti-CD4 mabs (Brian, Proc. Natl. Acad. Sci., USA, 85:564 (1988); Hirohata et al, J. Immunol., 140:3736 (1988); Whalen et al, J. Immunol., 143:1745 (1988); and Tohma et al, J. Immunol., 146:2547 (1991)). The non-specific helper effector function is believed to be focused on specific B cell targets by the localized nature of the T-B cell interactions with antigen specific, cognate pairs (Bartlett et al, J. Immunol., 143:1745 (1989); Kupfer et al, J. Exp. Med., 165:1565 (1987) and Poo et al, Nature, 332:378 (1988)).
  • Although terminal B cell differentiation requires both contact- and lymphokine-mediated stimuli from T cells, intermediate stages of B cell differentiation can be induced by activated T cell surfaces in the absence of secreted factors (Crow et al, J. Exp. Med., 164:1760 (1986); Brian, Proc. Natl. Acad. Sci., USA, 85:564 (1988); Sekita et al, Eur. J. Immunol., 18:1405 (1988); Hodgkin et al, J. Immunol., 145:2025 (1990); Noelle et al, FASEB J, 5:2770 (1991)). These intermediate effects on B cells include induction of surface CD23 expression (Crow et al, Cell Immunol., 121:94 (1989)), enzymes associated with cell cycle progression (Pollok et al, J. Immunol., 146:1633 (1991)) and responsiveness to lymphokines (Noelle et al, FASEB J, 5:2770 (1989); Pollok et al, J. Immunol., 146:1633 (1991)). Recently some of the activation-induced T cell surface molecules that direct B cell activation have been identified. Additionally, functional studies have characterized some features of activation-induced T cell surface molecules that direct B cell activation. First, T cells acquire the ability to stimulate B cells 4-8 h following activation (Bartlett et al, J. Immunol., 145:3956 (1990) and Tohma et al, J. Immunol., 146:2544 (1991)). Second, the B cell stimulatory activity associated with the surfaces of activated T cells is preserved on paraformaldehyde fixed cells (Noelle et al, J. Immunol., 143:1807 (1989); Cros et al, J. Exp. Med., 164:1760 (1986); Pollok et al, J. Immunol., 146:1633 (1991); Tohma et al, J. Immunol., 146:2544 (1991); and Kubota et al, Immunol., 72:40 (1991)) and on purified membrane fragments (Hodgkin et al, J. Immunol., 145:2025 (1990) and Martinez et al, Nature, 290:60 (1981)). Third, the B cell stimulatory activity is sensitive to protease treatment (Noelle et al, J. Immunol., 143:1807 (1989); Sekita et al, Eur. J. Immunol., 18:1405 (1988); and Hodgkin et al, J. Immunol., 145:2025 (1990). Fourth, the process of acquiring these surface active structures following T cell activation is inhibited by cycloheximide (Tohma et al, J. Immunol., 196:2349 (1991) and Hodgkin et al, J. Immunol., 195:2025 (1990)).
  • A cell surface molecule, CD40, has been identified on immature and mature B lymphocytes which, when crosslinked by antibodies, induces B cell proliferation. Valle et al, Eur. J. Immunol., 19:1463-1467 (1989); Gordon et al, J. Immunol., 140:1425-1430 (1988); Gruder et al, J. Immunol., 142:4144-4152 (1989).
  • CD40 has been molecularly cloned and characterized (Stamenkovic et al, EMBO J., 8:1403-1410 (1989)).
  • CD40 is expressed on B cells, interdigitating dendritic cells, macrophages, follicular dendritic cells, and thymic epithelium (Clark, Tissue Antigens 36:33 (1990); Alderson et al, J. Exp. Med., 178:669 (1993); Galy et al, J. Immunol. 142:772 (1992)). Human CD40 is a type I membrane protein of 50 kDa and belongs to the nerve growth factor receptor family (Hollenbaugh et al, Immunol. Rev., 138:23 (1994)). Signaling through CD40 in the presence of IL-10 induces IgA, IgM and IgG production, indicating that isotype switching is regulated through these interactions. The interaction between CD40 and its ligand results in a primed state of the B cell, rendering it receptive to subsequent signals.
  • Also, a ligand for CD40, gp39 (also called CD40 ligand or CD40L) has recently been molecularly cloned and characterized (Armitage et al, Nature, 357:80-82 (1992); Lederman et al, J. Exp. Med., 175:1091-1101 (1992); Hollenbaugh et al, EMBO J., 11:4313-4319 (1992)). The gp39 protein is expressed on activated, but not resting, CD4+ Th cells. Spriggs et al, J. Exp. Med., 176:1543-1550 (1992); Lane et al, Eur. J. Immunol., 22:2573-2578 (1992); and Roy et al, J. Immunol., 151:1-14 (1993). Cells transfected with gp39 gene and expressing the gp39 protein on their surface can trigger B cell proliferation and, together with other stimulatory signals, can induce antibody production. Armitage et al, Nature, 357:80-82 (1992); and Hollenbaugh et al, EMBO J., 11:4313-4319 (1992). In particular, the ligand for CD40, gp39, has been identified for the mouse (Noelle et al, Proc. Natl. Acad. Sci. USA, 89:6550 (1992); Armitage et al, Nature, 357:80 (1992)) and for humans (Hollenbaugh et al, Embo. J. 11:4313 (1992); Spriggs et al, J. Exp. Met., 176:1543 (1992)). gp39 is a type II membrane protein and is part of a new gene super family which includes TNF-α, TNF-β and the ligands for FAS, CD27, CD30 and 4-1BB.
  • Expression of gp39 can be readily induced in vitro on CD4+ T cells using either anti-CD3 antibody or phorbol myristate acetate (PMA) plus ionomycin. Expression is rapid and transient, peaking at 6-8 hours and returning to near resting levels between 24 and 48 hours (Roy et al, J. Immunol., 151:2497 (1993)). In vivo, gp39 has been reported in humans to be present on CD4+ T cells in the mantle and centrocytic zones of lymphoid follicles and the periarteriolar lymphocyte sheath of the spleen, in association with CD40+ B cells (Lederman et al, J. Immunol., 149:3807 (1992)). gp39+ T cells produce IL-2, IL-4 and IFN-γ (Van der Eetwegh et al, J. Exp. Med., 178:1555 (1993)).
  • Unique insights into the novel role of gp39 in the regulation of humoral immunity have been provided by studies of a human disease, X-linked hyper-IgM syndrome (HIM). HIM is a profound, X-linked immunodeficiency typified by a loss in thymus dependent humoral immunity, the inability to produce IgG, IgA and IgE. Mutations in the gp39 gene were responsible for the expression of a non-functional gp39 protein and the inability of the helper T cells from HIM patients to activate B cells (Allen et al, Science, 259:990 (1993); Aruffo et al, Cell, 72:291 (1993); DiSanto et al, Nature, 361:541 (1993); Korthauer et al, Nature, 361:539 (1993)). These studies support the conclusion that early after T cell receptor engagement of the peptide/MHC class II complex, gp39 is induced on the cognate helper T cell, and the binding of gp39 to CD40 on the B cell induces the B cell to move into the cell cycle and differentiate to immunoglobulin (Ig) secretion and isotype switching.
  • Functional studies have shown that treatment of mice with anti-gp39 completely abolished the antibody response against thymus dependent antigens (SRBC and TNP-KLH), but not thymus independent antigens (TNP-Ficoll) (Foy et al, J. Exp. Med., 178:1567 (1993)). In addition, treatment with anti-gp39 prevented the development of collagen-induced arthritis (CIA) in mice injected with collagen (Durie et al, Science, 261:1328 (1993)). Finally, anti-gp39 prevented formation of memory B cells and germinal centers in mouse spleen (Foy et al, J. Exp. Med., 180:157 (1994)). Collectively, these data provide extensive evidence that the interaction between gp39 on T cells and CD40 on B cells is essential for antibody responses against thymus dependent antigens.
  • Recently, a number of murine models of autoimmune disease have been exploited to evaluate the potential therapeutic value of anti-gp39 administration on the development of disease. A brief discussion of the results of studies in these models are provided below:
  • Collagen-Induced Arthritis:
  • CIA is an animal model for the human autoimmune disease rheumatoid arthritis (RA) (Trenthorn et al, J. Exp. Med., 146:857 (1977)). This disease can be induced in many species by the administration of heterologous type II collagen (Courtenay et al, Nature, 283:665 (1980); Cathcart et al, Lab. Invest., 54:26 (1986)).
  • To study the effect anti-gp39 on the induction of CIA (Durie et al, Science, 261:1328 (1993)) male DBA1/J mice were injected intradermally with chick type II collagen emulsified in complete Freund's adjuvant at the base of the tail. A subsequent challenge was carried out 21 days later. Mice were then treated with the relevant control antibody or anti-gp39. Groups of mice treated with anti-gp39 showed no titers of anti-collagen antibodies compared to immunized, untreated control mice. Histological analysis indicated that mice treated with anti-gp39 antibody showed no signs of inflammation or any of the typical pathohistological manifestations of the disease observed in immunized animals. These results indicated that gp39-CD40 interactions are absolutely essential in the induction of CIA. If the initial cognate interaction between the T cell and B cell is not obtained, then the downstream processes, such as autoantibody formation and the resulting inflammatory responses, do not occur.
  • Recently it has been shown that gp39 is important in activating monocytes to produce TNF-α and IL-6 in the absence of GM-CSF, IL-3 and IFN-γ (Alderson et al, J. Exp. Med., 178:669 (1993)). TNF-α has been implicated in the CIA disease process (Thorbecke et al, Eur. J. Immunol., 89:7375 (1992) and in RA (DiGiovane et al, Ann. Rheum. Dis., 47:68 (1988); Chu et al, Arthrit. Rheum., 39:1125 (1991); Brennan et al, Eur. J. Immunol., 22:1907 (1992). Thus, inhibition of TNF-α by anti-gp39 may have profound anti-inflammatory effects in the joints of arthritic mice. Both inhibition of TNF-α and of T cell-B cell interactions by anti-gp39 may be contributory to manifestations of CIA.
  • Experimental Allergic Encephalomyelitis (EAE):
  • EAE is an experimental autoimmune disease of the central nervous system (CNS) (Zamvil et al, Ann. Rev. Immunol., 8:579 (1990) and is a disease model for the human autoimmune condition, multiple sclerosis (MS) (Alvord et al, “Experimental Allergic Model for Multiple Sclerosis,” NY 511 (1984)). It is readily induced in mammalian species by immunizations of myelin basic protein purified from the CNS or an encephalitogenic proteolipid (PLP). SJL/J mice are a susceptible strain of mice (H-2S) and, upon induction of EAE, these mice develop an acute paralytic disease and an acute cellular infiltrate is identifiable within the CNS.
  • Classen and co-workers (unpublished data) have studied the effects of anti-gp39 on the induction of EAE in SJL/J mice. They found that EAE development was completely suppressed in the anti-gp39 treated animals. In addition, anti-PLP antibody responses were delayed and reduced compared to those obtained for control animals.
  • EAE is an example of a cell-mediated autoimmune disease mediated via T cells, with no direct evidence for the requirement for autoantibodies in disease progression. Interference with the interaction between gp39 and CD40 prevents disease induction and the adoptive transfer of disease.
  • Chronic (c) and Acute (a) Graft-Versus-Host-Disease (GVHD):
  • Chronic and acute GVHD result from donor cells responding to host disparate MHC alleles. In cGVHD (H-2d->H-2bd), heightened polyclonal immunoglobulin production is due to the interaction of allospecific helper T cells and the host B cells. In vivo administration of anti-gp39 antibody blocked cGVHD-induced serum anti-DNA autoantibodies, IgE production, spontaneous immunoglobulin production in vitro, associated splenomegaly and the ability to transfer disease. Durie F. H. et al, J. Clin. Invest., 94:133 (1994). Antibody production remained inhibited for extended periods of time after termination of anti-gp39 administration. Anti-allogeneic cytotoxic T lymphocyte (CTL) responses induced in GVHD were also prevented by the in vivo administration of anti-gp39. These data suggest that CD40-gp39 interactions are critical in the generation of both forms of GVHD. The fact that CTL responses were inhibited and a brief treatment with anti-gp39 resulted in long-term prevention of disease suggest permanent alterations in the T cell compartment by the co-administration of allogeneic cells and anti-gp39 antibody.
  • Various research groups have reported the production of murine antibodies specific to gp39, which are disclosed to possess therapeutic utility as immunosuppressants. For example, WO 93/09812, published May 27, 1993, and assigned to Columbia University; EP 0,555,880, published Aug. 18, 1993, and PCT US/94/09872, filed Sep. 2, 1994 by Noelle et al and assigned to Dartmouth College, describe murine antibodies specific to gp39 and their use as therapeutics and immunosuppressants.
  • Also, Scaria et al, Gene Therapy, 4:611-617 (1997) report the use of an antibody to gp39 to inhibit humoral and cellular immune responses to a DNA (adenoviral/vector) However, while murine antibodies have applicability as therapeutic agents in humans, they are disadvantageous in some respects. Specifically, murine antibodies, because of the fact that they are of foreign species origin, may be immunogenic in humans. This often results in a neutralizing antibody response, which is particularly problematic if the antibodies are desired to be administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition. Also, because they contain murine constant domains they may not exhibit human effector functions.
  • In an effort to eliminate or reduce such problems, chimeric antibodies have been disclosed. Chimeric antibodies contain portions of two different antibodies, typically of two different species. Generally, such antibodies contain human constant and another species, typically murine variable regions. For example, some mouse/human chimeric antibodies have been reported which exhibit binding characteristics of the parental mouse antibody, and effector functions associated with the human constant region. See, e.g., Cabilly et al, U.S. Pat. No. 4,816,567; Shoemaker et al., U.S. Pat. No. 4,978,745; Beavers et al., U.S. Pat. No. 4,975,369; and Boss et al., U.S. Pat. No. 4,816,397, all of which are incorporated by reference herein. Generally, these chimeric antibodies are constructed by preparing a genomic gene library from DNA extracted from pre-existing murine hybridomas (Nishimura et al, Cancer Research, 47:999 (1987)). The library is then screened for variable region genes from both heavy and light chains exhibiting the correct antibody fragment rearrangement patterns. Alternatively, cDNA libraries are prepared from RNA extracted from the hybridomas and screened, or the variable regions are obtained by polymerase chain reaction. The cloned variable region genes are then ligated into an expression vector containing cloned cassettes of the appropriate heavy or light chain human constant region gene. The chimeric genes are then expressed in a cell line of choice, usually a murine myeloma line. Such chimeric antibodies have been used in human therapy.
  • In a commonly assigned application, Ser. No. 07/912,292, “Primatized,”™ antibodies are disclosed which contain human constant and Old World monkey variable regions. These Primatized™ antibodies are well tolerated in humans given their low or weak immunogenicity.
  • Also, humanized antibodies are known in the art. Ideally, “humanization” results in an antibody that is less immunogenic, with complete retention of the antigen-binding properties of the original molecule. In order to retain all the antigen-binding properties of the original antibody, the structure of its combining-site has to be faithfully reproduced in the “humanized” version. This can potentially be achieved by transplanting the combining site of the nonhuman antibody onto a human framework, either (a) by grafting the entire nonhuman variable domains onto human constant regions to generate a chimeric antibody (Morrison et al, Proc. Natl. Acad. Sci., USA, 81:6801 (1984); Morrison and Oi, Adv. Immunol., 44:65 (1988) (which preserves the ligand-binding properties, but which also retains the immunogenicity of the nonhuman variable domains); (b) by grafting only the nonhuman CDRs onto human framework and constant regions with or without retention of critical framework residues (Jones et al, Nature, 321:522 (1986); Verhoeyen et al, Science, 239:1539 (1988)); or (c) by transplanting the entire nonhuman variable domains (to preserve ligand-binding properties) but also “cloaking” them with a human-like surface through judicious replacement of exposed residues (to reduce antigenicity) (Padlan, Molec. Immunol., 28:489 (1991)).
  • Essentially, humanization by CDR grafting involves transplanting only the CDRs onto human fragment onto human framework and constant regions. Theoretically, this should substantially eliminate immunogenicity (except if allotypic or idiotypic differences exist). However, it has been reported that some framework residues of the original antibody also need to be preserved (Riechmann et al, Nature, 332:323 (1988); Queen et al, Proc. Natl. Acad. Sci. USA, 86:10,029 (1989)).
  • The framework residues which need to be preserved can be identified by computer modeling. Alternatively, critical framework residues may potentially be identified by comparing known antibody combining site structures (Padlan, Molec. Immun., 31(3):169-217 (1994)).
  • The residues which potentially affect antigen binding fall into several groups. The first group comprises residues that are contiguous with the combining site surface which could therefore make direct contact with antigens. They include the amino-terminal residues and those adjacent to the CDRs. The second group includes residues that could alter the structure or relative alignment of the CDRs either by contacting the CDRs or the opposite chains. The third group comprises amino acids with buried side chains that could influence the structural integrity of the variable domains. The residues in these groups are usually found in the same positions (Padlan, 1994 (Id.) according to the adopted numbering system (see Kabat et al, “Sequences of proteins of immunological interest, 5th ed., Pub. No. 91-3242, U.S. Dept. Health & Human Services, NIH, Bethesda, Md., 1991).
  • However, while humanized antibodies are desirable because of their potential low immunogenicity in humans, their production is unpredictable. For example, sequence modification of antibodies may result in substantial or even total loss of antigen binding function, or loss of binding specificity. Alternatively, “humanized antibodies” may still exhibit immunogenicity in humans, irrespective of sequence modification.
  • Thus, there still exists a significant need in the art for novel humanized antibodies to desired antigens. More specifically, there exists a need in the art for humanized antibodies specific to gp39, because of their potential as immunotherapeutic agents.
  • OBJECTS OF THE INVENTION
  • Toward this end, it is an object of the invention to provide humanized antibodies which are specific to human gp39.
  • More specifically, it is an object of the invention to provide humanized antibodies derived from murine antibodies to gp39 and in particular 24-31, a specific murine antibody which binds to human gp39.
  • It is also an object of the invention to provide pharmaceutical compositions containing humanized antibodies which are specific to human gp39.
  • It is a more specific object of the invention to provide pharmaceutical compositions containing humanized antibodies derived from 24-31, a murine antibody which specifically binds to human gp39.
  • It is another specific object of the invention to provide methods of using humanized antibodies to human gp39 for treatment of human disease conditions, which are treatable by modulation of gp39 expression and/or inhibition of the gp39/CD40 binding interaction including, e.g., autoimmune diseases such as systemic lupus erythematosus, rheumatoid arthritis, multiple sclerosis, idiopathic thrombocytopenic purpura (ITP), diabetes and non-autoimmune conditions such as graft-versus-host disease and transplantation.
  • It is still another object of the invention to provide nucleic acid sequences which encode for humanized antibodies to human gp39.
  • It is a more specific object of the invention to provide nucleic acid sequences which encode humanized antibodies derived from 24-31, a murine antibody which specifically binds to human gp39 antigen.
  • It is another object of the invention to provide vectors which provide for the expression of humanized antibodies to human gp39, in particular humanized antibodies derived from 24-31, a murine antibody which specifically binds to human gp39 antigen.
  • SUMMARY OF THE INVENTION
  • In its broadest embodiment, the present invention is directed to humanized antibodies which retain not less than about one-tenth and more preferably not lower than one-third the gp39 antigen binding affinity of the murine 24-31 antibody and/or which retain not less than about one-tenth and more preferably not less than about one-third the in vitro functional activity of the murine antibody 24-31, e.g., in B-cell assays which measure T-cell dependent antibody production. More particularly, the present humanized antibodies retain at least one-tenth and more preferably at least about one-third the half-maximal potency in in vitro functional activity in a B cell assay at a concentration of not more than three times the concentration of the 24-31 antibody.
  • The present invention is further directed to humanized antibodies which bind to the same epitope as the murine 24-31 antibody and/or which are capable of competing with the murine 24-31 antibody for inhibiting the binding of CD40 to gp39 and/or which contain the CDR's of the 24-31 antibody.
  • The present invention is more preferably directed to humanized antibodies derived from murine 24-31 which possess the humanized variable light sequences and/or humanized variable heavy sequences set forth below:
    (1) DIVMTQSPSFLSASVGDRVTITC KASQNVITAVA WYQQKPGKSP
    KLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSLQPEDFADYFC
    QQYNSYPYT FGGGTKLEIK;
    (2) DIVMTQSPDSLAVSLGERATINC KASQNVITAVA WYQQKPGQSP
    KLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSLQAEDVADYFC
    QQYNSYPYT FGGGTKLEIK;
    (3) DIVMTQSPSFMSTSVGDRVTITC KASQNVITAVA WYQQKPGKSP
    KLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSMQPEDFADYFC
    QQYNSYPYT FGGGTKLEIK;
    (4) DIVMTQSPDSMATSLGERVTINC KASQNVITAVA WYQQKPGQSP
    KLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSMQAEDVADYFC
    QQYNSYPYT FGGGTKLEIK
  • and a humanized variable heavy sequence selected from the following group:
    (1) EVQLQESGPGLVKPSETLSLTCTVSGDSIT NGFWI WIRKPPGNK
    LEYMG YISYSGSTYYNPSLKS RISISRDTSKNQFSLKLSSVTAA
    DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS;
    (2) EVQLQESGPGLVKPSQTLSLTCTVSGDSIT NGFWI WIRKHPGNK
    LEYMG YISYSGSTYYNPSLKS RISISRDTSKNQFSLKLSSVTAA
    DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS;
    (3) EVQLQESGPGLVKPSQTLSLTCAVSGDSIT NGFWI WIRKHPGNK
    LEYMG YISYSGSTYYNPSLKS RISISRDTSNNQFSLNLNSVTRA
    DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS;
    (4) EVQLQESGPGLVKPSETLSLTCAVYGDSIT NGFWI WIRKPPGNK
    LEYMG YISYSGSTYYNPSLKS RISISRDTSKNQFYLKLSSVTAA
    DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS

    as well as variants and equivalents thereof. Variants and equivalents thereof in the present invention are intended to embrace humanized immunoglobulin sequences wherein one or several of the amino acid residues in the above identified humanized variable heavy and/or variable light sequences are modified by substitution, addition and/or deletion in such manner that does not substantially effect gp39 antigen binding affinity. In particular, the present invention embraces variants and equivalents which contain conservative substitution mutations, i.e., the substitution of one or more amino acids by similar amino acids. For example, conservative substitution refers to the substitution of an amino acid within the same general class, e.g., an acidic amino acid, or a basic amino acid, a neutral amino acid by another amino acid within the same class. What is intended by a conservative amino acid substitution is well known in the art. Preferably, such variants and equivalents will retain not less than about one-tenth and more preferably not less than about one-third the gp39 antigen binding affinity as the parent murine 24-31 antibody and more preferably not less than about one-third the gp39 antigen binding affinity as the murine 24-31 antibody. Additionally, such variants and equivalents will preferably retain not lower than one-tenth and more preferably retain at least about one-third the in vitro functional activity of murine antibody 24-31, e.g., in B-cell assays which measure T-cell dependent antibody production. More preferably, these variants and equivalents will retain at least about one-third the in vitro functional activity of murine antibody 24-31, for example, in B-cell assays which measure T-cell dependent antibody production. More specifically, these antibodies will retain the half-maximal potency in in vitro functional activity in a B cell assay at a concentration of not more than about three times the concentration of the parent 24-31 antibody.
  • The present invention is further directed to nucleic acid sequences which encode for the expression of such humanized antibodies, as well as expression vectors which provide for the production of humanized antibodies in recombinant host cells. In the most preferred embodiments these DNA sequences will encode for the humanized variable heavy and/or humanized variable light sequences set forth below:
    (1) DIVMTQSPSFLSASVGDRVTITC KASQNVITAVA WYQQKPGKSP
    KLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSLQPEDFADYFC
    QQYNSYPYT FGGGTKLEIK;
    (2) DIVMTQSPDSLAVSLGERATINC KASQNVITAVA WYQQKPGQSP
    KLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSLQAEDVADYFC
    QQYNSYPYT FGGGTKLEIK;
    (3) DIVMTQSPSFMSTSVGDRVTITC KASQNVITAVA WYQQKPGKSP
    KLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSMQPEDFADYFC
    QQYNSYPYT FGGGTKLEIK;
    (4) DIVMTQSPDSMATSLGERVTINC KASQNVITAVA WYQQKPGQSP
    KLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSMQASDVADYFC
    QQYNSYPYT FGGGTKLEIK
  • and a humanized variable heavy sequence selected from the following group:
    (1) EVQLQESGPGLVKPSETLSLTCTVSGDSIT NGFWI WIRKPPGNK
    LEYMG YISYSGSTYYNPSLKS RISISRDTSKNQFSLKLSSVTAA
    DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS;
    (2) EVQLQESGPGLVKPSQTLSLTCTVSGDSIT NGFWI WIRKHPGNK
    LEYMG YISYSGSTYYNPSLKS RISISRDTSKNQFSLKLSSVTAA
    DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS;
    (3) EVQLQESGPGLVKPSQTLSLTCAVSGDSIT NGFWI WIRKHPGNK
    LEYMG YISYSGSTYYNPSLKS RISISRDTSNNQFSLNLNSVTRA
    DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS;
    (4) EVQLQESGPGLVKPSETLSLTCAVYGDSIT NGFWI WIRKPPGNK
    LEYMG YISYSGSTYYNPSLKS RISISRDTSKNQFYLKLSSVTAA
    DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS.
  • Moreover, the present invention also embraces equivalent and variants thereof as defined supra.
  • The present invention is further directed to the use of the above-identified humanized antibodies specific to gp39 as pharmaceuticals. The present invention is also directed to the use of the subject humanized anti-gp39 antibodies for treating diseases treatable by modulation of gp39 expression or by inhibition of the gp39/CD40 interaction. The present invention is more particularly directed to the use of humanized antibodies of the above-identified humanized antibodies specific to gp39 for the treatment of autoimmune disorders, for example, rheumatoid arthritis, multiple sclerosis, diabetes, systemic lupus erythematosus and ITP. The present invention is further directed to the use of the subject humanized antibodies to gp39 for the treatment of non-autoimmune disorders including graft-versus-host disease and for inhibiting graft rejection.
  • Also, the subject invention is further directed to usage of the subject humanized antibodies as immunosuppressants, in particular during gene or cellular therapy. The subject humanized antibodies should enhance the efficacy of gene therapy or cellular therapy by inhibiting adverse immunogenic reaction to vectors and cells used therein. For example, they may be used to inhibit humoral and cellular immune responses against viral vectors, e.g., retro-viral vectors, adenoviral vectors. Also, the use of such antibodies should enable such cells or vectors to be administered repeatedly, which will facilitate treatment of chronic diseases such as cancers and autoimmune diseases.
  • BRIEF DESCRIPTION OF THE FIGURES
  • FIG. 1 depicts the IDEC expression vector N5KG1 used to express humanized and chimeric antibodies derived from 24-31.
  • FIG. 2 a contains results of a B cell proliferation assay which contacts human PBLs with soluble gp39-CD8, recombinant human IL-4 and the murine 24-31 antibody or control murine IgG1 monoclonal antibody which demonstrate that 24-31 antibody inhibits B cell proliferation induced by gp39.
  • FIG. 2B contains results of B cell differentiation assay using mitomycin treated T cells activated with immobilized anti-CD3 cultured in the present of IGD+ B cells and different concentrations of the 24-31 antibody which demonstrate that 24-31 antibody inhibits T-cell dependent polyclonal antibody production by human B cells.
  • FIG. 3 contains FACS of non-transfected CHO cells and a gp39 transfectant.
  • FIG. 4 contains the amino acid sequence and DNA sequence corresponding to a preferred humanized variable light sequence (including the complementarity determining regions) referred to as VL#1 or preferred humanized variable light sequence (1).
  • FIG. 5 contains the amino acid and DNA sequence corresponding to a preferred humanized variable ligand sequence (including the complementarity determining regions) referred to as VL#2 or preferred humanized variable light sequence (2).
  • FIG. 6 contains the amino acid and DNA sequence corresponding to a preferred humanized variable heavy sequence (including the complementarity determining regions) referred to as VH#1 of preferred humanized variable heavy sequence (1).
  • FIG. 7 contains the amino acid and DNA sequence of the variable light sequence of 24-31 (non-humanized) FIG. 8 contains the amino acid and DNA sequence of the variable heavy sequence of 24-31 (non-humanized) FIG. 9 compares binding of murine 24-31, chimeric 24-31 and a humanized 24-31 antibody to gp39 expressing CHO cells.
  • FIG. 10 contains results of a competition assay comparing the binding of 24-31 (biotin) and humanized, chimeric and 24-31 to gp39 expressing CHO cells.
  • FIG. 11 contains results of an assay which measures effects of murine 24-31 and a humanized 24-31 antibody of the invention on human IgM production by B cells cultured in the presence of mitomycin C treated T cells.
  • FIG. 12 contains results of an assay comparing binding of two humanized antibodies of the present invention to gp39 expressing CHO cells.
  • FIG. 13 contains the Scatchard plot for murine 24-31.
  • FIG. 14 contains the Scatchard plot for humanized Version 1.
  • FIG. 15 contains the Scatchard plot for humanized Version 2.
  • DETAILED DESCRIPTION OF THE INVENTION
  • Prior to setting forth the invention, definitions of certain terms which are used in this disclosure are set forth below:
  • Humanized antibody—This will refer to an antibody derived from a non-human antibody, typically murine, that retains or substantially retains the antigen-binding properties of the parent antibody but which is less immunogenic in humans. This may be achieved by various methods including (a) grafting the entire non-human variable domains onto human constant regions to generate chimeric antibodies, (b) grafting only the non-human CDRs onto human framework and constant regions with or without retention of critical framework residues, or (c) transplanting the entire non-human variable domains, but “cloaking” them with a human-like section by replacement of surface residues. Such methods are disclosed in Jones et al, Morrison et al, Proc. Natl. Acad. Sci., 81:6851-6855 (1984); Morrison and Oi, Adv. Immunol., 44:65-92 (1988); Verhoeyen et al, Science, 239:1534-1536 (1988); Padlan, Molec. Immun., 28:489-498 (1991); Padlan, Molec. Immun., 31(3):169-217 (1994), all of which are incorporated by reference.
  • Complementarity Determining Region or CDR—The term CDR, as used herein, refers to amino acid sequences which together define the binding affinity and specificity of the natural Fv region of a native immunoglobulin binding site as delineated by Kabat et al (1991).
  • Framework Region—The term FR, as used herein, refers to amino acid sequences interposed between CDRs. These portions of the antibody serve to hold the CDRs in appropriate orientation (allows for CDRs to bind antigen).
  • Constant Region—The portion of the antibody molecule which confers effector functions. In the present invention, murine constant regions are substituted by human constant regions. The constant regions of the subject chimeric or humanized antibodies are derived from human immunoglobulins. The heavy chain constant region can be selected from any of the five isotypes: alpha, delta, epsilon, gamma or mu. Further, heavy chains of various subclasses (such as the IgG subclasses of heavy chains) are responsible for different effector functions and thus, by choosing the desired heavy chain constant region, chimeric antibodies with desired effector function can be produced. Preferred constant regions are gamma 1 (IgG1), gamma 3 (IgG3) and gamma 4 (IgG4). More preferred is an Fc region of the gamma 1 (IgG1) isotype. The light chain constant region can be of the kappa or lambda type, preferably of the kappa type.
  • Chimeric antibody—This is an antibody containing sequences derived from two different antibodies, which typically are of different species. Most typically chimeric antibodies comprise human and murine antibody fragments, generally human constant and murine variable regions.
  • Immunogenicity—A measure of the ability of a targeting protein or therapeutic moiety to elicit an immune response (humoral or cellular) when administered to a recipient. The present invention is concerned with the immunogenicity of the subject humanized antibodies or fragments thereof.
  • Humanized or chimeric antibody of reduced immunogenicity—This refers to an antibody or humanized antibody exhibiting reduced immunogenicity relative to the parent antibody, e.g., the 24-31 antibody.
  • Humanized antibody substantially retaining the binding properties of the parent antibody—This refers to a humanized or chimeric antibody which retains the ability to specifically bind the antigen recognized by the parent antibody used to produce such humanized or chimeric antibody. Humanized or chimeric antibodies which substantially retain the binding properties of 24-31 will bind to human gp39. Preferably the humanized or chimeric antibody will exhibit the same or substantially the same antigen-binding affinity and avidity as the parent antibody. Ideally, the affinity of the antibody will not be less than 10% of the parent antibody affinity, more preferably not less than about 30%, and most preferably the affinity will not be less than 50% of the parent antibody. Methods for assaying antigen-binding affinity are well known in the art and include half-maximal binding assays, competition assays, and Scatchard analysis. Suitable antigen binding assays are described in this application.
  • The present invention is directed to novel humanized monoclonal antibodies which bind human gp39 and their use as therapeutic agents. The present invention is further directed toward nucleic acid sequences which encode said humanized antibodies, and their expression in recombinant host cells.
  • More specifically, the present invention is directed toward humanized antibodies derived from murine antibody 24-31 which specifically binds to human gp39.
  • Murine antibody 24-31 is a murine antibody raised against human gp39 which functionally inactivates gp39 both in vitro and in vivo. Therefore, it possesses properties which render it potentially useful for treatment of diseases wherein gp39 inactivation and/or modulation or inhibition of the gp39/CD40 interaction is desirable. In particular, such diseases include autoimmune diseases such as, e.g., rheumatoid arthritis, multiple sclerosis, ITP, diabetes, and systemic lupus erythematosus as well as non-auto-immune diseases such as graft-versus-host disease and graft rejection.
  • However, while murine antibody 24-31 possesses functional properties which render it potentially suitable as a therapeutic agent, it possesses several potential disadvantages. Namely, because it is of murine origin it potentially will be immunogenic in humans. Also, because it contains murine constant sequences, it will likely not exhibit the full range of human effector functions and will probably be more rapidly cleared if administered to humans. While such disadvantages should not be problematic in the treatment of some disease conditions or persons, they pose substantial concern if the disease treated is of a chronic or recurrent nature. Examples of recurrent or chronic diseases include, e.g., autoimmune diseases, wherein the host continually or chronically exhibits an autoimmune reaction against self-antigens.
  • Therefore, in order to alleviate the disadvantages associated with murine antibody 24-31, namely potential immunogenicity in humans and decrease of human effector functions, the present inventors desired to produce improved, humanized derivatives of the murine 24-31 antibody. While this was the goal of the present invention, the desired result was not of a routine or predictable nature. Humanization of antibodies requires the careful selection of amino acid residues which are to be modified, and the judicious selection of residues which are to be substituted therefor. This is because modification of antibody variable regions, even those involving a few amino acid residues, may cause substantial deleterious effects on antigen binding. For example, humanized antibodies may exhibit substantially reduced antigen affinity and/or antigen-specificity in relation to the parent antibody.
  • As noted supra, different methods of humanization of antibodies, including murine antibodies have been reported in the literature. See, e.g., Padlan, Molec. Immunol., 31(3):169-217 (1994); Padlan, Molec. Immunol., 28:484-498 (1991); Morrison and Oi, Adv. Immunol., 44:65-92 (1988), all of which references are incorporated by reference in their entirety herein. These methods include in particular humanization by CDR grafting (Jones et al, Nature, 321:522-525 (1986); Verhoeyen et al, Science, 239:1534-1539 (1988); and the more tailored approach of Padlan, Molec. Immunol., 28:489 (1991) and Padlan, Molec. Immunol., 31:169 (1994) which involves the selection of non-essential framework amino acid residues and their modification by appropriate substitution mutation. These references are incorporated by reference in their entirety herein.
  • As noted, CDR grafting techniques, while successful in some instances, may substantially adversely affect the affinity of the resultant humanized antibodies. This is believed to occur because some framework residues affect or are essential for and at least affect antigen binding. Our technique; Padlan (1994) (Id.)) is more refined because we retain only those murine framework residues which we deem critical to the preservation of the antibody combining site while keeping the surface properties of the molecule as human as possible. Accordingly, this technique has the potential of producing humanized antibodies which retain the antigen-binding characteristics of the parent antibody. Because of this, this technique was selected by the present inventors as the means by which humanized antibodies derived from murine antibody 24-31 specific to human gp39 would potentially be obtained.
  • The cloning of the variable regions of 24-31 (described in detail in the examples infra) resulted in the identification of the VL and VH sequences utilized by the 24-31 antibody respectively shown in FIG. 7 and FIG. 8. After sequencing, the variable regions were then humanized. As noted, this was effected substantially according to the method of Padlan (1994) (Id.), incorporated by reference supra.
  • This method generally comprises replacement of the non-human framework by human framework residues, while retaining only those framework residues that we deem critical to the preservation of antigen binding properties. Ideally, this methodology will confer a human-like character on the surface of the xenogeneic antibody thus rendering it less immunogenic while retaining the interior and contacting residues which affect its antigen-binding properties.
  • More specifically, the 24-31 VK and VH sequences set forth in FIGS. 7 and 8 were humanized by comparison to human antibodies of reported sequence, which are referred to as “templates.”
  • Specifically, the 24-31 VK was humanized using as templates:
  • (a) For VL#1, the human V-Kappa subgroup I sequences, e.g., DEN and the like, as well as the germline 012 (see Cox et al, Eur. J. Immunol. 24:827-836 (1994)), and for VL#2, the human V-Kappa subgroup IV sequences, e.g., LEN. Such template sequences are known and are reported in Kabat et al (1991) (Id.) or GenBank.
  • The 24-31 VH #1 was humanized using as templates
  • (a) the human VH subgroup IV sequence, 58p2 and
  • (b) (GenBank Accession No.) Z18320 and the germline 3d75d (S. van der Maarel et al, J. Immunol., 150:2858-2868 (1993).
  • Such template variable heavy antibody sequences are also known and are reported in Kabat et al, “Sequences of Proteins of Immunological Interest,” 5th Ed., NIH (1991) and in GenBank.
  • The template human variable heavy and light sequences were selected based on a number of different criteria, including, in particular, high degree of sequence similarity with 24-31 overall, as well as similarity in the “important” residues, i.e., those which are believed to be comprised in the VL:VH interface; those which are in contact with the complementarity determining regions, or which are inwardly pointing. Also, the templates were selected so as to potentially preserve the electrostatic charge of the 24-31 Fv as much as possible, and also so as to preserve glycines, prolines and other specific amino acid residues which are believed to affect antigen binding.
  • This methodology resulted in the following preferred humanized VL and VH heavy sequences derived from the 24-31 antibody which are set forth below in Table 1 and Table 2. As discussed above, the invention further embraces equivalents and variants of these preferred humanized sequences, e.g., those containing one or more conservative amino acid substitutions which do not substantially affect gp39 binding. The complementarity determining regions are identified in FIGS. 7 and 8 which contain the entire variable heavy and light chain CDR sequences of the parent (non-humanized) 24-31 antibody.
    TABLE 1
    HUMANIZED 24-31 VL SEQUENCES
             10        20                    40                    60        70        80
    24-31 DIVMTQSQKFMSTSVGDRVSITC KASQNVITAVA WYQQKPGQSPKLLIY SASNRYT GVPDRFSGSGSGTDFTLTISNMQSEDLADYFC
                100
    QQYNSYPYT FGGGTKLEIK
    (1) DIVMTQSPSFLSASVGDRVTITC KASQNVITAVA WYQQKPGKSPKLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSLQPEDFADYFC
    QQYNSYPYT FGGGTKLEIK
    (2) DIVMTQSPDSLAVSLGERATINC KASQNVITAVA WYQQKPGQSPKLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSLQAEDVADYFC
    QQYNSYPYT FGGGTKLEIK
    (3) DIVMTQSPSFMSTSVGDRVTITC KASQNVITAVA WYQQKPGKSPKLLIY SASNRT GVPDRFSGSGSGTDFTLTISSMQPEDFADYFC
    QQYNSYPYT FGGGTKLEIK
    (4) DIVMTQSPDSMATSLGERVTINC KASQNVITAVA WYQQKPGQSPKLLIY SASNRYT GVPDRFSGSGSGTDFTLTISSMQAEDVADYFC
    QQYNSYPYT FGGGTKLEIK
  • TABLE 2
    HUMANIZED 24-31 VH SEQUENCES
             10        20        30         40                              70          82abc
    24-31 EVQLQESGPSLVKPSQTLSLTCSVTGDSIT NGFWI WIRKFPGNKLEYMG YISYSGSTYYNPSLKS RISITRDTSQNQFYLQLNSVTTE
        90                        110
    DTGTYYCAC RSYGRTPYYFDF WGQGTTLTVSS
    (1) EVQLQESGPGLVKPSETLSLTCTVSGDSIT NGFWI WIRKPPGNKLEYMG YISYSGSTYYNPSLKS RISISRDTSKNQFSLKLSSVTAA
    DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS
    (2) EVQLQESGPGLVKPSQTLSLTCTVSGDSIT NGFWI WIRKHPGNKLEYMG YISYSGSTYYNPSLKS RISISRDTSKNQFSLKLSSVTAA
    DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS
    (3) EVQLQESGPGLVKPSQTLSLTCAVSGDSIT NGFWI WIRKHPGNKLEYMG YISYSGSTYYNPSLKS RISISRDTSNNQFSLNLNSVTRA
    DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS
    (4) EVQLQESGPGLVKPSETLSLTCAVYGDSIT NGFWI WIRKPPGNKLEYMG YISYSGSTYYNPSLKS RISISRDTSKNQFYLKLSSVTAA
    DTGVYYCAC RSYGRTPYYFDF WGQGTTLTVSS
  • As can be seen therefrom, four preferred humanized framework sequences were designed for both the VH and VL chains. Therefore, there are 16 different possible humanized 24-31 antibodies which may be synthesized using the above-identified humanized VH and VL 24-31 sequences, excluding variants and equivalents containing conservative modifications.
  • Humanized 24-31 antibodies containing these humanized variable heavy and light sequences may be obtained by recombinant methods. It is expected that humanized sequences which contain any combination of the above preferred humanized variable sequences will result in humanized antibodies which bind human gp39. Moreover, based on these sequences, the order of preference using the numbering set forth in Table 1 and Table 2 is expected to be as follows:
  • (1) #1 VL with #1 VH (Version 1)
  • (2) #2 VL with #1 VH (Version 2)
  • (3) #1 VL with #2 VH (Version 3)
  • (4) #2 VL with #2 VH (Version 4)
  • The above-identified humanized VH and VL sequences may be further modified, e.g., by the introduction of one or more additional substitution modifications and also by the addition of other amino acids. Additional modifications will be selected which do not adversely affect antigen (gp39) binding. For example, the inventors contemplate further modification of the VH chain by substitution of one or more of residues 34, 43, 44 and 68 (according to Kabat numbering scheme) Kabat et al (1991) (Id.). Also, the inventors contemplate modification of residue 85 of the VL chain. Based on the structural features of the antibody combining site, it is believed that modification of such residues should also not adversely impact antigen binding. Moreover, it is expected that the introduction of one or more conservative amino acid substitutions should not adversely affect gp39 binding.
  • So as to better describe the subject humanized 24-31, VH and VL sequences, the preferred humanized framework sequences are also set forth in Table 3 below, which compares these sequences to the template human variable heavy and light framework sequences, i.e., human DEN VK1, Human o12/V36 germline, human LEN VKIV, human 58p2, human Z18320, and human 3d75d as well as to the unhumanized murine 24-31 VH and VL framework sequences.
    TABLE 3
    VK Framework Region Comparisons - Humanized Anti-gp39
    FR1 FR2
    Human 012/V3b DIQMTQSPSFLSASVGDRVTITC WYQQKPGKAPKLLIY
    germline
    Human DEN VKI ---------T------------- -------E---V---
    Murine 24-31 --V----QK-M-T------S--- -------QS------
    Padlan VL#1 --V-------------------- --------S------
    humanized
    FR3 FR4
    Human 012/V3b GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC
    Human DEN VKI -------------E---------SD------- FGQGTKLEIK
    Murine 24-31 ---D----------------NM-SE-L-D-F- --G-------
    Padlan VL#1 ---D------------------------D-F- --G-------
    FR1 FR2
    Human LEN VKIV DIVMTQSPDSLAVSLGERATINC WYQQKPGQPPKLLIY
    Murine 24-31 -------QKFMST-V-D-VS-T- --------S------
    Padlan VL#2 ----------------------- --------S------
    humanized
    FR3 FR4
    Human LEN VKIV GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC FGQGTKLEIK
    Murine 24-31 --------------------NM-S--L-D-F- --G-------
    Padlan VL#2 ----------------------------D-F- --G-------
    FR1
    Human 58p2 QVQLQESGPGLVKPSETLSLTCTVSGGSIS
    Murine 24-31 E---------S----Q------S-T-D--T
    Padlan VH#1 E-------------------------D--T
    humanized
    Human Z18320 ---------------Q--------------
    Genflank
    Human 3d75d ---------------Q--------------
    germline
    Padlan VH#2 E--------------Q----------D--T
    humanized
    FR2 FR3
    Human 58p2 WIRQPPGKGLEWIG RVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
    Murine 24-31 ---KF--NK--YM- -IS-TR---Q---Y-Q-N---TE--GT----C
    Padlan VH#1 ---K---NK--YM- -IS--R-------------------G-----C
    Human Z18320 -----A-------- --------------------------------
    Human 3d75d ----H--------- --------------------------------
    Padlan VH#2 ---KH--NK--YM- -IS--R-------------------G-----C
    Human 58p2 WGQGTMVTVSS
    Murine 24-31 -----TL----
    Padlan VH#1 -----TL----
    Human Z18320 -----------
    Padlan VH#2 -----TL----
  • In order to produce humanized antibodies, DNA sequences are synthesized which encode for the afore-identified humanized VL and VH sequences. As noted, taking into account these four humanized VL sequences, and four humanized VH sequences, there are 16 potential humanized antigen combining sites which may be synthesized. Also, there are even more potential humanized antigen combining sites taking into account the potential substitution of residues 34, 43, 44 and 68 of the humanized VH and residue 85 of the humanized VL by other amino acid residues and/or the potential incorporation of conservative substitution mutations. Two of the preferred humanized variable light sequences (1) and (2) and a preferred humanized variable heavy sequence (1) including the complementarity determining regions and corresponding DNA sequences are set forth in FIGS. 4, 5 and 6, respectively.
  • Methods for synthesizing DNA encoding for a protein of known sequence are well known in the art. Using such methods, DNA sequences which encode the subject humanized VL and VH sequences are synthesized, and then expressed in vector systems suitable for expression of recombinant antibodies. This may be effected in any vector system which provides for the subject humanized VL and VH sequences to be expressed as a fusion protein with human constant domain sequences and associate to produce functional (antigen binding) antibodies.
  • Expression vectors and host cells suitable for expression of recombinant antibodies and humanized antibodies in particular, are well known in the art.
  • The following references are representative of methods and vectors suitable for expression of recombinant immunoglobulins which are incorporated by reference herein: Weidle et al, Gene, 51:21-29 (1987); Dorai et al, J. Immunol., 13(12):4232-4241 (1987); De Waele et al, Eur. J. Biochem., 176:287-295 (1988); Colcher et al, Cancer Res., 49:1738-1745 (1989); Wood et al, J. Immunol., 145(a):3011-3016 (1990); Bulens et al, Eur. J. Biochem., 195:235-242 (1991); Beggington et al, Biol. Technology, 10:169 (1992); King et al, Biochem. J., 281:317-323 (1992); Page et al, Biol. Technology, 9:64 (1991); King et al, Biochem. J., 290:723-729 (1993); Chaudary et al, Nature, 339:394-397 (1989); Jones et al, Nature, 321:522-525 (1986); Morrison and Oi, Adv. Immunol., 44:65-92 (1988); Benhar et al, Proc. Natl. Acad. Sci. USA, 91:12051-12055 (1994); Singer et al, J. Immunol., 150:2844-2857 (1993); Cooto et al, Hybridoma, 13(3):215-219 (1994); Queen et al, Proc. Natl. Acad. Sci. USA, 86:10029-10033 (1989); Caron et al, Cancer Res., 32:6761-6767 (1992); Cotoma et al, J. Immunol. Meth., 152:89-109 (1992). Moreover, vectors suitable for expression of recombinant antibodies are commercially available.
  • Host cells known to be capable of expressing functional immunoglobulins include by way of example mammalian cells such as Chinese Hamster Ovary (CHO) cells, COS cells, myeloma cells, bacteria such as Escherichia coli, yeast cells such as Saccharomyces cerevisiae, among other host cells. Of these, CHO cells are used by many researchers given their ability to effectively express and secrete immunoglobulins.
  • Essentially, recombinant expression of humanized antibodies are effected by one of two general methods. In the first method, the host cells are transfected with a single vector which provides for the expression of both heavy and light variable sequences fused to selected constant regions. In the second method, host cells are transfected with two vectors, which respectively provide for expression of either the variable heavy or light sequence fused to selected constant regions.
  • Human constant domain sequences are well known in the art, and have been reported in the literature. Preferred human VL sequences includes the Kappa and lambda constant light sequences. Preferred human heavy constant sequences include human gamma 1, human gamma 2, human gamma 3, human gamma 4 and mutated versions thereof which provide for altered effect or function, e.g. enhanced in vivo half-life and reduced Fc receptor binding.
  • Preferred modifications of the human gamma 4 constant domain include P and/or E modifications, which respectively refer to the change of a leucine to a glutamic acid at position 236 and/or the change of a serine to a proline (Kabat numbering) at position 229 such as described in commonly assigned Attorney Docket No. 012712-165 filed on Sep. 6, 1995 and incorporated by reference in its entirety herein.
  • A particularly preferred vector system comprises the expression vectors described in commonly assigned U.S. Ser. No. 08/476,237 filed Jun. 7, 1995, Ser. No. 08/397,072, filed Jan. 25, 1995 and 07/912,122 filed Jul. 10, 1992, Ser. No. 07/886,281 filed Mar. 23, 1992, and Ser. No. 07/735,064 filed Jul. 25, 1991, all incorporated by reference in their entirety.
  • In particular, these applications describe vector systems for the production of recombinant antibodies, referred to as TCAE 5.2 and TCAE 6 which comprise the following:
  • 1) Four transcriptional cassettes in tandem order:
      • (a) a human immunoglobulin light chain constant region. In TCAE 5.2 this is the human immunoglobulin Kappa light chain constant region (Kabat numbering amino acids 108-214, allotype Km 3) and in TCAE 6 the human immunoglobulin light chain lambda constant region (Kabat numbering amino acids 108-215, genotype Oz minus, Mcg minus, Ke minus allotype).
      • (b) a human immunoglobulin heavy chain constant region; in both constructs the human immunoglobulin heavy chain is a gamma/constant region (Kabat numbering amino acids 114-478 allotype Gm1a, Gm12).
      • (c) DHFR; containing its own eukaryotic promoter and polyadenylation region; and
      • (d) NEO; also containing its own eukaryotic promoter and polyadenylation region.
  • 2) The human immunoglobulin light and heavy chain cassettes contain synthetic signal sequences for secretion of the immunoglobulin chains; and
  • 3) The human immunoglobulin light and heavy chain cassettes contain specific DNA links which allow for the insertion of light and heavy immunoglobulin variable regions which maintain the translational reading frame and do not alter the amino acids normally found in immunoglobulin chains.
  • These vectors are preferably utilized in CHO cells. The subject antibodies are preferably expressed in the above-described vector systems.
  • However, the subject humanized antibody sequences derived from the number 24-31 antibody may be expressed in any vector system which provides for the expression of functional antibodies, i.e., those which bind gp39 antigen.
  • In particular, the inventors elected to express the subject humanized VL and VH sequences, as well as the native (unmodified) VL and VH sequences derived from 24-31 in CHO cells using the N5KG1 expression vector which contains human Kappa and human gamma 1 constant regions. The N5KG1 expression vector is depicted schematically in FIG. 1. As hoped, the chimeric antibody derived from 24-31, when expressed in CHO cells binds gp39 (by demonstrated binding to CHO-gp39 transfectant). Also, several humanized anti-bodies of the invention derived from 24-31 when expressed using this vector system resulted in functional (gp39 binding) antibodies.
  • The present invention is further described through presentation of the following examples. These examples are offered by way of illustration and not by way of limitation.
  • EXAMPLE 1
  • Selection of 24-31 Antibody for Humanization.
  • Accumulating evidence in animal models indicates that anti-gp39 administration prevents a variety of autoimmune processes and interferes with allograft rejection. These results provide compelling evidence that antibodies to human gp39 may have significant therapeutic value in the management of autoimmune disease and the transplantation of allogeneic tissue and organs in humans. A monoclonal antibody (mAb) specific for human gp39 has been reported (Lederman et al, J. Immunol., 199:3817 (1992)), and its functional activity in blocking gp39-CD40 interactions in vitro has been evaluated. To gain greater insights into the functional impact of anti-gp39 antibodies on the human immune system, a panel of anti-human gp39 mAbs was generated. From this panel, one mAb appeared superior and was extensively tested for functional inactivation of gp39 in vitro and in vivo.
  • More specifically, a panel of 6 murine (all IgG1) anti-gp39 antibodies was generated by immunization with a soluble fusion protein of human gp39 (gp39-CD8), followed by challenge with activated human peripheral blood T cells. Flow cytometric analysis of human peripheral blood T cells demonstrated that the mAbs recognized a cell surface molecule expressed on activated (PMA/ionomycin), but not resting, CD3+ T cells, and that the pattern of reactivity was similar to that seen with a recombinant CD40 fusion protein (CD40-Ig) (data not shown). Immunoprecipitation of [35S] metabolically labeled activated human peripheral blood T cells revealed that each of the 6 mAbs precipitated a molecule of similar size (33 kDa) to that precipitated by CD40-Ig. Finally, binding of CD40-Ig to gp39 was blocked in the presence of the antibodies indicating recognition of the same molecule, further confirming their specificity. Although all 6 mAbs were capable of blocking gp39 function, one mAb, 24-31, was selected for extensive analysis.
  • EXAMPLE 2
  • T Cell-Dependent B Cell Proliferation and Differentiation (Ig Production) is Blocked by Anti-gp39.
  • A number of studies have provided evidence that signals delivered through CD40 by its ligand, gp39, induce B cell activation, proliferation, differentiation, and iso-type switching. To determine if the anti-gp39 24-31 mAb blocked gp39 function, B cells were cultured with a soluble fusion protein of gp39 (gp39-CD8) in the presence or absence of 24-31, and the B cell proliferative response was assessed by 3H-thymidine incorporation. The results, shown in FIG. 2A, demonstrate that gp39-CD8 induced vigorous proliferation of B cells. The presence of anti-gp39 24-31 mAb completely ablated B cell proliferation induced by gp39-CD8 at concentrations as low as 2.5 μg/ml. To determine whether 24-31 interfered with T cell-induced B cell differentiation, B cells were co-cultured with anti-CD3 activated T cells in the presence or absence of 24-31. Polyclonal IgM, IgG, and IgA production was assessed after 12 days. As shown in FIG. 2B, the addition of 24-31 inhibited polyclonal IgM, IgG, and IgA antibody production (90-99%). These results confirm previous reports establishing the requirement for gp39-CD40 interactions in T cell-dependent B cell differentiation (Nishioka et al, J. Immunol., 153:1027 (1994), and further demonstrate the use of newly characterized anti-human gp39 24-31 mAb in blocking gp39 function.
  • EXAMPLE 3 Anti-gp39 Blocks In Vivo Tetanus Toxoid Specific Antibody Production in SCID Mice Reconstituted with Human PBL.
  • Numerous studies have established that the human immune system can be studied in vivo under experimental conditions through the use of severe combined immunodeficiency (scid) mice engrafted with human peripheral blood lymphocytes (hu-PBL-scid mice) (Mosler et al, Nature, 335:256 (1988); McCune et al, Science, 241:1632 (1988). Long-term chimerism is achieved in scid mice by injection with human PBL, and antigen-specific secondary antibody responses are detected in hu-PBL-scid mice challenged in vivo with antigen (Carlsson et al, J. Immunol., 148:1065 (1992); Duchosal et al, Cell Immunol., 139:468 (1992)). This system was exploited to evaluate the immunosuppressive effects of in vivo anti-gp39 administration on the immune responses elicited by human T and B-cells.
  • Experiments, the results of which are contained in FIG. 2B, demonstrated that blockade of gp39 function by 24-31 inhibited T cell-dependent polyclonal Ig production by human B cells in vitro. To determine whether 24-31 could also inhibit antigen specific B cell antibody production in vivo, C.B-17 scid/scid mice injected i.p. with human PBL (hu-PBL-scid) and immunized with tetanus toxoid (TT) were treated with 24-31 or PBS, and the secondary (IgG) anti-TT antibody response was assessed. Immunization of hu-PBL-scid with TT resulted in detectable levels of IgG anti-TT antibody within 14 days post immunization in most animals (Table 4). However, treatment with anti-gp39 (24-31; 250 μg/day, twice weekly) completely ablated the secondary anti-TT antibody response in 9/10 mice examined, demonstrating that in vivo blockade of gp39 function also resulted in inhibition of antigen specific humoral responses.
    TABLE 4
    Ablation of the secondary anti-tetanus antibody response following
    engraftment of human PBL in C.B-17 scid/scid mice immunized with tetanus
    toxoid. *Four-six week old C.B-17-scid/scid mice were injected i.p. with
    20 × 106 human PBL and 0.25 ml tetanus toxoid.
    Anti-Tetanus Antibody (O.D. ± SE) §
    (Frequency of Mice Containing
    Recip- Anti-Tetanus Antibody)
    ient Treat- days post immunization
    Strain* ment¶ 7 d 14 d 21 d 28 d
    C.B-17 PBS <0.02 2.30 ± .042 .224 ± .040 .137 + .007
    scid/ (0/10) (7/10)* (8/10)** (4/10)
    scid
    anti- .162 <0.02 (0/10) <0.02 (0/10) <0.02 (0/10)
    gp39 (1/10)

    ¶Anti-gp39 24-31 or PBS (250 μg/injection) was administered i.p. twice weekly throughout the entire experiment.

    §The level of human anti-tetanus toxoid antibody in the serum was determined weekly by ELISA. All mice with serum levels of human anti-tetanus toxoid antibody > 0.100 O.D. at a 1:10 dilution were considered positive. Only positive mice were used in the calculation of the mean ± SE values included in the table. The level of human anti-tetanus toxoid in sera from pre-immune mice not immunized with tetanus toxoid was < 0.02 O.D. Data are presented as mean ± SE.

    *Significantly different (p = 0.222) than the anti-gp39 treated group.

    **Significantly different (p < 0.001) than the anti-gp39 treated group.
  • EXAMPLE 4
  • Anti-gp39 Treatment does not Inhibit the Antigen-Specific T Cell Proliferative Response of hu-PBL-scid Spleen Cells.
  • To determine whether treatment of hu-PBL-scid mice with anti-gp39 altered the responsiveness of antigen-specific T cells in vivo, the proliferative response of spleen cells from hu-PBL-scid mice immunized with TT and treated with 24-31 was assessed in vitro. Spleen cells from control or anti-gp39 treated hu-PBL-scid mice were cultured with TT or medium alone, and the proliferative response was assessed by 3H-thymidine incorporation after 6 days. Table 5 summarizes the results of one such experiment. Hu-PBL-scid mice treated with anti-gp39 responded similarly to in vitro stimulation with TT as did hu-PBL-scid mice which were untreated (5/10 vs. 3/10 responding mice). Experiments using NOD/LtSz-scid/scid mice as recipients yielded similar results, although anti-TT antibodies were undetectable in these mice (data not shown). These data demonstrate that treatment with anti-gp39 does not result in deletion or functional inactivation of antigen-specific T cells in hu-PBL-scid mice and support the contention that inhibition of TT specific antibody responses by anti-gp39 is due to blockade of gp39-CD40 interactions and subsequent B cell responses rather than T cell inactivation.
    TABLE 5
    Anti-gp39 treatment does not alter the anti-tetanus T cell proliferative
    response following engraftment of human PBL in C.B-17-scid/scid or
    NOD/LtSz-scid/scid mice immunized with tetanus toxoid. *Four-six week old
    C.B-17-scid/scid or NOD/LtSz-scid/scid mice were injected i.p. with
    20 × 106 human PBL and 0.25 ml tetanus toxoid.
    Frequency of Responding
    Recipient Strain* Treatment¶ Mice§
    C.B-17 scid/scid PBS 3/10
    anti-gp39 5/10
    NOD/LtSz-scid/scid PBS 5/10
    anti-gp39 6/10

    ¶Anti-gp39 24-31 or PBS (250 μg/injection) was administered i.p. twice weekly throughout the entire experiment.

    §Spleen cells from mice injected with human PBL and immunized with tetanus toxoid were cultured at a concentration of 1 × 105 cells/ml in the presence of media alone or tetanus toxoid (2.5 or 5.0 μg/ml). Proliferation was assessed by 3H-thymidine incorporation after 6 d. Stimulation indices were calculated by the following formula″ S.I. = cpm tetanus − cpm medium/cpm medium. S.I. of > than 2.0 was considered positive.
  • EXAMPLE 5
  • Generation of a gp39 CHO Transfectant Cell Line.
  • Recently, a CHO transfectant that constitutively expresses cell-surface gp39 was generated to use as a reagent for the humanized anti-gp39 24-31 binding studies proposed in this application. The full-length gp39 gene (Hollenbaugh et al, Immunol. Rev., 138:23 (1994)) was amplified by polymerase chain reaction (PCR) of phytohemag-glutinin-activated human PBL and cloned into IDEC's INPEP4 vector under the transcriptional control of the cytomegalo-virus (CMV) promoter and enhancer elements. A CHO transfectant was established and amplified in 50 nM methotrexate. The transfectant, 50D4, was shown to express cell-surface gp39 by ELISA (data not shown) and FACS analysis (FIG. 3).
  • EXAMPLE 6
  • High-Level Expression of Antibodies Using a CHO Expression System.
  • IDEC's proprietary NSKG1 expression vector is used in CHO cells for expression of the humanized anti-gp39 24-31 antibody. This vector is depicted schematically in FIG. 1. High-level expression of recombinant antibodies is consistently obtained in CHO cells using this vector and similar vectors. Using these vectors, a high percentage of G418 resistant clones, 5-10%, are found to express significant amounts of recombinant proteins (1-10 mg/l of antibody). These are usually single plasmid copy integrants, and can easily be amplified using methotrexate to obtain 30-100 pg/cell/day of secreted immunoglobulin. Table 6 lists the antibody levels obtained before and after gene amplification of 3 antibodies expressed in CHO cells utilizing this system.
    TABLE 6
    Antibody production levels using IDEC's
    CHO expression technology.
    after after
    before amplification amplification
    amplification in spinner in fermentor
    Antibody mg/l flask mg/l mg/l
    Anti-CD4 γ1 1-2 100-110 950
    Anti-CD4 γ4 3-4 125-150 N.D.
    Anti-CD20  5-10 200-300 650
  • EXAMPLE 7 Cloning of 24-31 Vk and VH DNA Sequences
  • The anti-gp39 24-31 Vk and VH gene segments were cloned and sequenced. Following analyses of their sequences, humanized versions of the V region gene segments were designed. The corresponding DNA sequences were synthesized and cloned into a high-level expression vector containing human constant region genes. A CHO transfectant producing the humanized 24-31 antibody is then established. To confirm that the humanized version of the anti-gp39 antibody retains its gp39 binding affinity, the relative affinities of the murine and humanized antibodies were compared in direct binding and competition assays. In addition, the ability of the humanized 24-31 to block CD40 binding to gp39 and to inhibit T cell-dependent antibody production is evaluated.
  • 1. Cloning of the 24-31 Vk and VH Gene Segments
  • a. Preparation of cDNA. PolyA+ mRNA was prepared from 2×106 cells each of the 24-31 hybridoma and the NS1 cell line, (Carroll et al, Mol. Immunol., 10:991 (1988)), the fusion partner used in the generation of the 24-31 hybridoma, utilizing an Invitrogen Corporation Micro-Fast Track™ mRNA isolation kit, according to the manufacturer's protocol. First strand cDNA was synthesized utilizing 50 pmoles oligo-dT and 5 units M-MLV reverse transcriptase (Promega) (Sambrook et al, Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory Press (1989)) followed by Sephadex G-25 chromatography.
  • b. PCR amplification Of Vk and VH cDNA. 24-31 and NS1 cDNA were amplified by PCR using a panel of 5′ primers specific for Vk or VH leader sequences in combination with 3′ constant region primers. The panel of 5′VH primers are identical to those described by Jones and Bendig (Bio/Technol., 9:88 (1991); Errata, Bio/Technol., 9:579 (1991)). The panel of 5′Vk primers (Jones et al, (Id.)) were modified to convert the Sal I cloning site recognition sequences (GTCGAC) into Bgl II recognition sequences (AGATCT) to facilitate the cloning of the amplified gene segments into IDEC's N5KG1 expression vector (See FIG. 1). The 3′ Vk and VH primers contain a Bsi WI cloning site sequence at amino acid positions 108-109 (numbering according to Kabat et al, “Sequences of Proteins of Immunological Interest,” 5th Ed., NIH (1991)) and a Nhe I cloning site sequence at positions 114-115, respectively, and have the following sequences: TGCAGCATCCGTACGTTTGATTCCAGCTT (Ck) and GGGGGTGTCGTGCTAGCTG (A/C)(G/A) GAGAC(G/A)GTGA (Cγ1). This primer panel has been previously used by the Assignee to amplify and clone the C2B8 anti-CD20 antibody (Nishioka et al, J. Immunol., 153:1027 (1994)) and numerous other mouse Vk and VH gene segments (data not shown).
  • In order to determine the correct primer pair for the amplification of the 24-31 Vk and VH gene segments, the 24-31 cDNA were amplified in 23 individual reactions containing one of the 11 5′Vk primers in combination with the CK primer or one of the 12 5′VH primers in combination with the Cγ1 primer. For comparison, NS1 cDNA was amplified using the same panel of primers. 1 μl cDNA (1/50 of the cDNA sample) was amplified in a 100 μl final volume containing 5 units Tag DNA polymerase (Perkin Elmer), 10 mM Tris-HCl, pH 8.3, 50 mM KCl, 1.5 mM MgCl2, 0.25 mM each of dCTP, dGTP, DATP, and TTP, 50 pmoles 3′ constant region primer, and 50 pmoles 5′ primer. The-amplification cycle consisted of denaturation for 1 minute at 95° C., annealing for 2 minutes at 50° C., and extension for 2 minutes at 72° C., repeated 34 times. The amplified products were analyzed by agarose gel electrophoresis. The 24-31 PCR reactions yielding a unique amplified product for Vk and for VH were repeated and the products from duplicate PCR reactions cloned. PCR amplified products are agarose gel-purified (Sambrook et al, Molecular Cloning: A Laboratory Manual, 2nd Ed. (1989)) and digested with Bgl II and Bsi WI (for Vk) or Sal I and Nhe I (for VH). The products are ligated (Ausabel et al, Current Protocols in Molecular Biology, Vol. 2, Greene Publ. Assoc. (1992)) sequentially into IDEC's vector, N5KG1.
  • Following transformation of E. coli XL1-blue cells (Stratagene), plasmid DNA was prepared, and the Vk and VH sequences obtained from the duplicate constructs (sequencing performed by Scripps Research Institute Core Facility, La Jolla, Calif.). The sequences of the endogenous light and heavy chains of the NS1 fusion partner are known (Carroll et al, Mol. Immunol., 10:991 (1988); Kabat et al, (1991) (Id.)) and were used to distinguish PCR products resulting from the amplification of the 24-31 versus the NS1 fusion partner V regions.
  • EXAMPLE 8
  • Synthesis of Gene Segments Encoding Humanized 24-31 V Regions.
  • Humanized versions containing the most preferred humanized 24-31 Vk and VH sequences identified in Tables 1 and 2 as humanized VL and VH (1) were synthesized. Specifically, four pairs of overlapping, complementary olionucleotides (oligos) encoding the above-identified humanized Vk or VH regions were synthesized (Midland Chemicals) and purified by denaturing polyacrylamide gel electrophoresis (Ausubel et al, Current Protocols in Molecular Biology, Vol. 2, Greene Publ. Assoc. (1992)). Each oligo is approximately 100 bases in length and overlap by 20 bases the adjacent complementary oligonucleotide. The Vk and VH 5′ oligos contain Bgl II and Sal I cloning sites and the 3′ oligos possess Bsi WI and Nhe I cloning sites, respectively. Each variable region gene segment was assembled from the synthetic oligos, diagrammed below, using the following procedure (summarized in Watson et al, Recombinant DNA, 2nd Ed., Scientif. Amer. Books, NY, N.Y. (1992)). Complementary oligo pairs (A+E, B+F, C+G, D+F) were kinased using 300 pmoles of each primer and T4 polynucleotide kinase (Promega) according to the manufacturer's protocol. The oligos were annealed by heating to 95° C. and slow cooling to room temperature. The annealed oligo pairs were ligated (A/E with B/F and C/G with D/H) utilizing 6 units T4 DNA ligase (New England Biolabs). After digestion with the appropriate 5′ or 3′ cloning site restriction endonuclease, the approximately 200 base pair DNA fragments were purified by electroelution following polyacrylamide gel electrophoresis (Sambrook et al, (Id.)). The synthetic gene fragments were then inserted into IDEC's proprietary high-level expression vector, N5KG1, under the transcriptional control of the CMV promoter and enhancer elements. The ligation reaction contains the 2 gel-purified fragments (A/E/B/F and C/G/D/H) and N5KG1 at a molar ratio of 100:100:1, respectively. After transformation of XL1-blue cells, plasmid DNA was prepared and the sequences of the synthetic gene segments confirmed. The resulting construct, h24-31, encodes the humanized 24-31 V region segments and human kappa and gamma 1 constant regions. As indicated, this antibody contains the humanized variable heavy and humanized-variable light sequences identified in Table 1 and Table 2 as the “(1)” sequences, which are predicted to provide for humanized antibody having optimal gp39 properties. In addition, a construct was generated which contains VL#2 in combination with VH#1 (version 2 of humanized 24-31). Similar constructs utilizing IDEC's proprietary vectors have been used for. high-level expression of IDEC's anti-CD20 (Reff et al, Blood, 83:425 (1994)) and anti-CD4 (Newman et al, Biol. Technology, 10:1455 (1992)) antibodies.
    A B C D
    5′ ————— ————— ————— ————— 3′
    ————— ————— ————— —————
    E F G H
  • EXAMPLE 9
  • 2. Production and Characterization of Humanized 24-31
  • a. Generation of CHO Transfectants Producing Humanized 24-31 (Version 1 and Version 2).
  • CHO transfectants expressing humanized 24-31 (version 1 or version 2) were generated by electroporation of 4×106 CHO cells with linearized h24-31 DNA (version 1 or version 2) followed by selection in G418. The cell culture supernatants from G418 resistant clones were assayed for immunoglobulin production by sandwich ELISA employing a goat anti-human kappa to capture the immunoglobulin. Immunoglobulin binding was measured by incubating with a horse radish peroxidase (HRP)-conjugated goat antibody specific for human IgG, followed by HRP substrate, 0.4 mg/ml O-Phenylene-diamine (OPD) in a citrate buffer (9-34 g/l C6H8O7, and 14.2 g/l Na2HPO4), pH 5.0, including 0.0175% H2O2. The plate was read in a Molecular DeviCes “Vmax, kinetic microplate reader” spectrophotometer at 490 nm.
  • EXAMPLE 10
  • b. Characterization of Humanized 24-31 (Version 1).
  • The humanized anti-gp39 24-31 antibody is evaluated initially for direct binding to cell surface gp39 expressed on 50D4, the gp39 CHO transfectant described in Example 5. Supernatants from the G418-resistant h24-31 CHO transfectants that produce immunoglobulin are tested for binding to 50D4 cells and, as negative control, to CHO cells. In this assay 50D4, 1×105 /well, are bound to the bottom of 96 well, poly-L-lysine coated polystyrene plates. The cells are fixed in 0.5% glutaraldehyde in phosphate buffered saline (PBS) for 15 minutes. Plates coated with CHO cells are generated similarly. The cell culture supernatants are added and antibody binding measured using a HRP-conjugated goat anti-human IgG, as described above.
  • Two assays are used to determine if the humanized 24-31 antibody retains its affinity to gp39 relative to the original murine 24-31 antibody, (i) half-maximal binding concentration and (ii) a competition assay using 50D4 cells. For this purpose the antibodies will be purified on protein A and the concentration of each antibody determined by ELISA by a comparison to isotype matched controls. Half-maximal binding (i) are determined by incubating humanized 24-31 with 50D4 cells at various concentrations from 2 μg/ml to 0.1 ng/ml. The concentration resulting in a half-maximal OD 490 reading, as described above, is compared with the half-maximal binding of murine 24-31. In the competition assay (ii) the humanized 24-31 antibody and the murine 24-31 antibody are mixed in various molar ratios ranging from 100:1 to 1:100, and their ability to compete for binding to 50D4 cells measured. Two sets are run, one where the binding of the humanized antibody will be measured using goat-anti-human IgG (anti-mouse IgG depleted)-HRP and one where the binding of murine antibody is measured using goat-anti-mouse IgG (anti-human IgG depleted)-HRP. Binding curves, one for the murine and one for the humanized antibody, based on molar ratios, are generated and their relative affinities calculated. These assays will confirm the anti-gp39 binding properties of the subject humanized antibodies derived from 24-31.
  • EXAMPLE 11
  • Blocking of CD40-Ig Binding to gp39 by Humanized 24-31.
  • After establishing that humanized anti-gp39 binds to gp39, an assay is effected to confirm that the humanized anti-gp39 retains its ability to block the binding of the ligand to its receptor. For this purpose, activated human peripheral blood T cells, or the gp39-transfected CHO cells, 50D4, are pretreated with graded concentrations of murine 24-31 or with humanized 24-31 for 15 minutes at 4° C. Following this preincubation, CD40-Ig-biotin is added and the binding determined by flow cytometry using PE-avidin. Concentrations of mAbs to achieve a 50% reduction in CD40-Ig binding are determined.
  • EXAMPLE 12
  • Blocking of B Cell Proliferation and Differentiation by Humanized 24-31.
  • To confirm that humanized 24-31 blocks gp39 function, B cells are cultured with a soluble fusion protein of gp39 (gp39-CD8) in the presence or absence of a range of doses of murine 24-31 or humanized 24-31. B cell proliferative response is assessed by 3H-thymidine incorporation as shown in FIG. 2A.
  • T cell dependent B cell differentiation (Ig production) is blocked by mAbs to gp39. To confirm that the subject humanized 24-31 antibodies are effective in blocking the function of native gp39 expressed on the surface of activated human T cells, the ability of the subject humanized 24-31 antibodies inhibit T cell-induced B cell differentiation is assessed. B cells are co-cultured with anti-CD3 activated T cells in the presence or absence of humanized 24-31 and murine 24-31. Polyclonal IgM, IgG, and IgA production is assessed after 12 days (see FIG. 2B). These results will confirm that humanized anti-gp39 can block CD40 binding and interfere with T-cell-dependent B cell activation via CD40.
  • EXAMPLE 13
  • Binding Capacity
  • This experiment was effected to determine the reactivity of the murine, chimeric, and humanized (version 1) 24-31 antibodies to the gp39 antigen relative to the concentration of antibody.
  • Protocol:
  • Plate Preparation
    • 1. Add 50 of poly-1-lysine to each well on the 96 well plate. Incubate for 30 minutes at room temperature. Flick plates to remove poly-1-lysine.
    • 2. Wash mgp39-CHO cells (Chinese hamster ovary cells expressing cell surface, membrane gp39) 3 times with HBSS by centrifuging at 1500 rpm for 5 minutes. Resuspend cells in HBSS to 2×106 cells ml.
    • 3. Add 50 μl of cell suspension to each well and centrifuge plates at 2000 rpm for 5 minutes.
    • 4. Add 50 μl/well of ice cold 0.5% glutaraldehyde and incubate for 15 minutes at room temperature.
    • 5. Flick plate and blot to remove excess glutaraldehyde. Add 150 μl/well of 100 mM glycine with 0.1% BSA and incubate for 30 minutes at room temperature. Plates can be used immediately or frozen at −20° C. for future use.
      Binding Assay
    • 1. Thaw plate and remove glycine buffer.
    • 2. Serially dilute, 1:2, the test antibodies in dilution buffer starting at 1 μg/ml. Transfer 50 μg/well of each dilution in duplicate. Incubate 2 hours at room temperature.
    • 3. Wash plate 10 times in flowing tap water.
    • 4. Add 50 μl/well of 1:2000 dilution of goat anti-human IgG HRP or goat anti-mouse IgG HRP. Incubate 1 hour at room temperature.
    • 5. Wash plate 10 times in flowing tap water.
    • 6. Add 50 μl/well of ABTS substrate and develop plate for 20-30 minutes. Read the plate at wavelength 405 mn with a background wavelength of 490 run.
    • 7. Plot graph of absorbance vs antibody concentration.
      Results and Conclusions:
  • The binding capacities for the three anti-gp39 antibodies (murine, chimeric and humanized version 1 of 24-31) relative to the concentration of the antibodies, were essentially superimposable (see FIG. 9). This is a good indication that these antibodies have similar binding capacities for human gp39, indicating that the humanized antibody has retained the gp39 binding affinity of murine 24-31.
  • EXAMPLE 14
  • Competition Between Biotin Labeled Murine 24-31 and Chimeric and Humanized Version 1 24-31
  • The ability of the chimeric and humanized (version 1) 24-31 antibodies to compete with the murine 24-31 for binding to mgp39-CHO cells basis was evaluated. The ability of the humanized 24-31 to compete with the murine 24-31 for binding to mgp39-CHO was used to evaluate whether in the humanized antibody the exchanges of the murine framework residues with their human counterparts resulted in a significant loss (≧3× decrease) of affinity.
  • Protocol:
  • Plate Preparation
    • 1. Add 50 of poly-1-lysine to each well on the 96 well plate. Incubate for 30 minutes at room temperature. Flick plates to remove poly-1-lysine.
    • 2. Wash mgp39-CHO cells 3 times with HBSS by centrifuging at 1500 rpm for 5 minutes. Resuspend cells in HBSS to 2×106 cells/ml.
    • 3. Add 50 μl of cell suspension to each well and centrifuge plates at 2000 rpm for 5 minutes.
    • 4. Add 50 μl/well of ice cold 0.5% glutaraldehyde and incubate for 15 minutes at room temperature.
    • 5. Flick plate and blot to remove excess glutaraldehyde. Add 150 μl/well of 100 mM glycine with 0.1% BSA and incubate for 30 minutes at room temperature. Plates can be used immediately or frozen at −20° C. for future use.
      Competition Assay
    • 1. Thaw plate and remove glycine buffer.
    • 2. Dilute mouse anti-gp39 biotin to 200 ng/ml in PBS with 1% BSA.
    • 3. Serially dilute test antibodies (mouse, chimeric, and humanized 24-31) 1:2 starting at 10 μg/ml in dilution buffer.
    • 4. Transfer 50 μl of diluted test antibodies and mouse anti-gp39 biotin into each well in duplicate. Several wells should contain 50 μl dilution buffer with the mouse anti-gp39 biotin as a maximal control group. Incubate 2 hours at room temperature.
    • 5. Wash plates 10 times in flowing tap water.
    • 6. Add 50 μl/well of 1:2000 dilution of streptavidin HRP and incubate 1 hour at room temperature.
    • 7. Wash plates 10 times in flowing tap water.
    • 8. Add 50 μl/well of ABTS substrate and develop plate for 20-30 minutes. Read the plate at wavelength 405 nm with a background wavelength of 490 nm.
    • 9. Percent inhibition is calculated using the average of the control wells.
      Results and Conclusions:
  • All three antibodies competed equally well with the biotin labeled 24-31 (see FIG. 10). The competition profiles are essentially superimposable at all concentrations, within the limitations of the assay. This demonstrates that the tested humanized antibody (version 1) retains its gp39 binding affinity.
  • EXAMPLE 15
  • Modulation of T Cell Dependent B Cell Differentiation
  • To confirm that the humanized 24-31 retains the in vitro functional activity of murine 24-31, the humanized 24-31 was compared to the murine 24-31 in a “Lipsky” assay. Donor peripheral blood mononuclear cells were separated into two fractions, a T and a B cell fraction. The T cells were first treated with mitomycin C, to prevent mitosis, and then activated with an anti-CD3 antibody. The B cells were added, together with either the murine or humanized (version 1) 24-31 antibodies. A positive control without antibody, and a negative control without B cells were included in the experiment. After a 10 day incubation, the supernatants were tested for the presence of human IgM.
  • Protocol:
    • 1. Coat a 96 well plate with 50 μl/well of sterile 4 μg/ml anti-CD3 antibody (diluted in 50 mM Tris, pH 9) for 2 hours at 37° C.
    • 2. Selectively purify T and B cells from a buffy coat using Lympho-Kwik reagents. Activate the T cells with 50 μg/ml mitomycin C per 5×106 cells for 30 minutes at 37° C.
    • 3. Wash plate wells several times with sterile HBSS or media to remove non-adherent antibody.
    • 4. Add 1×105 purified T cells (2×106/ml) to each well.
    • 5. Add 5×105 purified B cells (5×106/ml) to each well. Add 50 μl anti-gp39 antibody (10-0.1 μg/ml) to each well in quadruplicate. Control wells should include:
  • a) 0 antibody, b) 0 antibody, no T cells, and c) 0 antibody, no B cells.
    • 6. Incubate plate at 37° C./5% CO2 for 12 days.
    • 7. Access cell growth after 7 days using 3H thymidine or any other acceptable method on duplicate wells.
    • 8. After 12 days, collect supernatants from duplicate wells and perform ELISA assays to determine Ig production (IgM).
      Results and Conclusions:
  • The results show that the production of human IgM is inhibited 50% by the humanized 24-31 at a concentration below 0.01 μg/ml, similar to the inhibition level obtained with the murine 24-31 (see FIG. 11). The humanized antibody retained its ability to inhibit T cell dependent B cell differentiation (IgM production) in this experiment.
  • EXAMPLE 16
  • Evaluation of Humanized 24-31, Version 2
  • This experiment was conducted to determine whether humanized 24-31 version 2, as compared to version 1, has a similar gp39 binding capacity in a direct binding assay.
  • Protocol:
  • Same as in Example 13 above.
  • Results and Conclusions.
  • The results show that the binding capacity of the two 24-31 versions are essentially superimposable (see FIG. 12). This indicates that the two versions have comparable binding activity to gp39.
  • EXAMPLE 17
  • This experiment was conducted to measure the Kd of 24-31, and two humanized versions, 1 and 2.
  • Protocol:
  • A predetermined amount of each of the three antibodies (murine, version 1 or version 2 24-31) was labeled with 125I using IODO-BEADS® (Pierce). Antibody bound-125I was separated from free 125I by size separation on a Sephadex-G25/DEAE/Amberlite column.
  • Direct binding of the 125I-labeled antibody to murine gp39-CHO cells was tested in a dilution series, in order to determine both counts/pg and the appropriate working concentration (≅half-maximal binding concentration).
  • 125I-labeled antibody was mixed and incubated with non-labeled antibody in a dilution series. Based on the total amount of bound antibody and the amount of free antibody, a Scatchard plot was generated from a bound vs. bound-free graph. The total antibody concentration was based on a standard size of 75 kD for one active site.
  • The Kd was calculated by generating a “best fit” line. The inverse of the slope of the curve is the Kd. The correlation coefficient, r2, was also computed.
  • Results:
  • The Scatchard plots were analyzed. The Kd's from this analysis are: Version 2, Kd=14 nM; murine 24-31, Kd=8.51 nM; version 1, Kd=5.6. The results are depicted in FIGS. 13, 14 and 15, respectively. These results provide further evidence that the subject humanized antibodies bind the gp39 antigen similarly to 24-31.
  • Use
  • The humanized anti-gp39 antibodies of the present invention have potential in treating any disease condition wherein gp39 modulation and/or inhibition of the gp39-CD40 interaction is therapeutically beneficial. Moreover, the subject humanized anti-gp39 antibodies may be used in treatment of diseases wherein suppression of antibody responses to antigens are desirable. Such conditions include both autoimmune and non-autoimmune disorders.
  • The ability of anti-gp39 antibodies to prevent CD40 signaling in B cells is functionally translated into marked inhibition of T cell-dependent antibody responses in vivo. Therefore, autoimmune diseases which are mediated by auto-antibody production would be expected to benefit from anti-gp39 antibody therapy. Such diseases include systemic lupus erythematosus, idiopathic thrombocytopenic purpura, myasthenia gravis and a subpopulation of diabetic patients with anti-insulin and anti-insulin receptor antibodies. In addition, CD40 signaling in B cells and dendritic cells is essential for upregulation of co-signaling receptors such as B7.1 and B7.2 molecules. Blocking of this CD40 signaling by anti-gp39 antibodies interferes with antigen presentation to T cells, resulting in inhibition of T cell activation and T cell-mediated responses. The therapeutic efficacy of anti-gp39 antibodies in disease models such as CIA, EAE, NOD mice, GVHD and graft rejection further confirms the antibody's inhibitory effect on T cell-mediated responses. Based on this mechanism of action supported by the efficacy in animal models, the therapeutic potential of the subject humanized anti-gp39 antibodies extend to such diseases as RA, MS, diabetes, psoriasis, GVHD and graft rejection.
  • Specific conditions which are potentially treatable by administration of the subject humanized antibodies include the following:
  • Allergic bronchopulmonary aspergillosis; Autoimmune hemolytic anemia; Acanthosis nigricans; Allergic contact dermatitis; Addison's disease; Atopic dermatitis; Alopecia areata; Alopecia universalis; Amyloidosis; Anaphylactoid purpura; Anaphylactoid reaction; Aplastic anemia; Angioedema, hereditary; Angioedema, idiopathic; Ankylosing spondylitis; Arteritis, cranial; Arteritis, giant cell; Arteritis, Takayasu's; Arteritis, temporal; Asthma; Ataxia-telangiectasia; Autoimmune oophoritis; Autoimmune orchitis; Autoimmune polyendocrine failure; Behcet's disease; Berger's disease; Buerger's disease; Bullous pemphigus; Candidiasis, chronic mucocutaneous; Caplan's syndrome; Post-myocardial infarction syndrome; Post-pericardiotomy syndrome; Carditis; Celiac sprue; Chagas's disease; Chediak-Higashi syndrome; Churg-Strauss disease; Cogan's syndrome; Cold agglutinin disease; CREST syndrome; Crohn's disease; Cryoglobulinemia; Cryptogenic fibrosing alveolitis; Dermatitis herpetifomis; Dermatomyositis; Diabetes mellitus; Diamond-Blackfan syndrome; DiGeorge syndrome; Discoid lupus erythematosus; Eosinophilic fascitis; Episcleritis; Drythema elevatum diutinum; Erythema marginatum; Erythema multiforme; Erythema nodosum; Familial Mediterranean fever; Felty's syndrome; Fibrosis pulmonary; Glomerulonephritis, anaphylactoid; Glomerulonephritis, autoimmune; Glomerulonephritis, post-streptococcal; Glomerulonephritis, post-transplantation; Glomerulopathy, membranous; Goodpasture's syndrome; Graft-vs.-host disease; Granulocytopenia, immune-mediated; Granuloma annulare; Granulomatosis, allergic; Granulomatous myositis; Grave's disease; Hashimoto's thyroiditis; Hemolytic disease of the newborn; Hemochromatosis, idiopathic; Henoch-Schoenlein purpura; Hepatitis, chronic active and chronic progressive; Histiocytosis X; Hypereosinophilic syndrome; Idiopathic thrombocytopenic purpura; Job's syndrome; Juvenile dermatomyositis; Juvenile rheumatoid arthritis (Juvenile chronic arthritis); Kawasaki's disease; Keratitis; Keratoconjunctivitis sicca; Landry-Guillain-Barre-Strohl syndrome; Leprosy, lepromatous; Loeffler's syndrome; Lyell's syndrome; Lyme disease; Lymphomatoid granulomatosis; Mastocytosis, systemic; Mixed connective tissue disease; Mononeuritis multiplex; Muckle-Wells syndrome; Mucocutaneous lymph node syndrome; Mucocutaneous lymph node syndrome; Multicentric reticulohistiocytosis; Multiple sclerosis; Myasthenia gravis; Mycosis fungoides; Necrotizing vasculitis, systemic; Nephrotic syndrome; Overlap syndrome; Panniculitis; Paroxysmal cold hemoglobinuria; Paroxysmal nocturnal hemoglobinuria; Pemphigoid; Pemphigus; Pemphigus erythematosus; Pemphigus foliaceus; Pemphigus vulgaris; Pigeon breeder's disease; Pneumonitis, hypersensitivity; Polyarteritis nodosa; Polymyalgia rheumatica; Polymyositis; Polyneuritis, idiopathic; Portuguese familial polyneuropathies; Preeclampsia/eclampsia; Primary biliary cirrhosis; Progressive systemic sclerosis (Scleroderma); Psoriasis; Psoriatic arthritis; Pulmonary alveolar proteinosis; Pulmonary fibrosis, Raynaud's phenomenon/syndrome; Reidel's thyroiditis; Reiter's syndrome, Relapsing polychrondritis; Rheumatic fever; Rheumatoid arthritis; Sarcoidosis; Scleritis; Sclerosing cholangitis; Serum sickness; Sezary syndrome; Sjogren's syndrome; Stevens-Johnson syndrome; Still's disease; Subacute sclerosing panencephalitis; Sympathetic ophthalmia; Systemic lupus erythematosus; Transplant rejection; Ulcerative colitis; Undifferentiated connective tissue disease; Urticaria, chronic; Urticaria, cold; Uveitis; Vitiligo; Weber-Christian disease; Wegener's granulomatosis; Wiskott-Aldrich syndrome.
  • Of these, the preferred indications treatable or presentable by administration of anti-gp39 antibodies include autoimmune hemolytic anemia; aplastic anemia; arteritis, temporal; diabetes mellitus; Felty's syndrome; Goodpasture's syndrome; graft-vs-host disease; idiopathic thrombocytopenia pupura; myasthenia gravis; multiple sclerosis; polyarteritis nodosa; psoriasis; psoriatic arthritis; rheumatoid arthritis; systemic lupus erythematosus; asthma; allergic conditions; and transplant rejection.
  • The amount of antibody useful to produce a therapeutic effect can be determined by standard techniques well known to those of ordinary skill in the art. The antibodies will generally be provided by standard technique within a pharmaceutically acceptable buffer, and may be administered by any desired route. Because of the efficacy of the presently claimed antibodies and their tolerance by humans it is possible to administer these antibodies repetitively in order to combat various diseases or disease states within a human.
  • The subject anti-gp39 humanized antibodies (or fragments thereof) of this invention are also useful for inducing immunomodulation, e.g., inducing suppression of a human's or animal's immune system. This invention therefore relates to a method of prophylactically or therapeutically inducing immunomodulation in a human or other animal in need thereof by administering an effective, non-toxic amount of such an antibody of this invention to such human or other animal.
  • The fact that the antibodies of this invention have utility in inducing immunosuppression means that they are useful in the treatment or prevention of resistance to or rejection of transplanted organs or tissues (e.g., kidney, heart, lung, bone marrow, skin, cornea, etc.); the treatment or prevention of autoimmune, inflammatory, proliferative and hyperproliferative diseases, and of cutaneous manifestations of immunologically mediated diseases (e.g., rheumatoid arthritis, lupus erythematosus, systemic lupus erythematosus, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, type 1 diabetes, uveitis, nephrotic syndrome, psoriasis, atopical dermatitis, contact dermatitis and further eczematous dermatitides, seborrheic dermatitis, Lichen planus, Pemplugus, bullous pemphicjus, Epidermolysis bullosa, urticaria, angioedemas, vasculitides, erythema, cutaneous eosinophilias, Alopecia areata, etc.); the treatment of reversible obstructive airways disease, intestinal inflammations and allergies (e.g., Coeliac disease, proctitis, eosinophilia gastroenteritis, mastocytosis, Crohn's disease and ulcerative colitis) and food-related allergies (e.g., migraine, rhinitis and eczema). Also, the subject antibodies have potential utility for treatment of non-autoimmune conditions wherein immunomodulation is desirable, e.g., graft-versus-host disease (GVHD), transplant rejection, asthma, leukemia, lymphoma, among others.
  • Also, the subject antibodies can be used as immunosuppressants during cellular or gene therapy. This potentially will enable such cells or gene therapy constructs to be administered repeatedly, or at higher dosages without an adverse immunogenic response.
  • One skilled in the art would be able, by routine experimentation, to determine what an effective, non-toxic amount of antibody would be for the purpose of inducing immunosuppression. Generally, however, an effective dosage will be in the range of about 0.05 to 100 milligrams per kilogram body weight per day.
  • The antibodies of the invention may be administered to a human or other animal in accordance with the aforementioned methods of treatment in an amount sufficient to produce such effect to a therapeutic or prophylactic degree. Such antibodies of the invention can be administered to such human or other animal in a conventional dosage form prepared by combining the antibody of the invention with a conventional pharmaceutically acceptable carrier or diluent according to known techniques. It will be recognized by one of skill in the art that the form and character of the pharmaceutically acceptable carrier or diluent is dictated by the amount of active ingredient with which it is to be combined, the route of administration and other well-known variables.
  • The route of administration of the antibody (or fragment thereof) of the invention may be oral, parenteral, by inhalation or topical. The term parenteral as used herein includes intravenous, intramuscular, subcutaneous, rectal, vaginal or intraperitoneal administration. The subcutaneous and intramuscular forms of parenteral administration are generally preferred.
  • The daily parenteral and oral dosage regimens for employing compounds of the invention to prophylactically or therapeutically induce immunosuppression will generally be in the range of about 0.05 to 100, but preferably about 0.5 to 10, milligrams per kilogram body weight per day.
  • The antibody of the invention may also be administered by inhalation. By “inhalation” is meant intranasal and oral inhalation administration. Appropriate dosage forms for such administration, such as an aerosol formulation or a metered dose inhaler, may be prepared by conventional techniques. The preferred dosage amount of a compound of the invention to be employed is generally within the range of about 10 to 100 milligrams.
  • The antibody of the invention may also be administered topically. By topical administration is meant non-systemic administration and includes the application of an antibody (or fragment thereof) compound of the invention externally to the epidermis, to the buccal cavity and instillation of such an antibody into the ear, eye and nose, and where it does not significantly enter the blood stream. By systemic administration is meant oral, intravenous, intraperitoneal and intramuscular administration. The amount of an antibody required for therapeutic or prophylactic effect will, of course, vary with the antibody chosen, the nature and severity of the condition being treated and the animal undergoing treatment, and is ultimately at the discretion of the physician. A suitable topical dose of an antibody of the invention will generally be within the range of about 1 to 100 milligrams per kilogram body weight daily.
  • Formulations
  • While it is possible for an antibody or fragment thereof to be administered alone, it is preferable to present it as a pharmaceutical formulation. The active ingredient may comprise, for topical administration, from 0.001% to 10% w/w, e.g., from 1% to 2% by weight of the formulation, although it may comprise as much as 10% w/w but preferably not in excess of 5% w/w and more preferably from 0.1% to 1% w/w of the formulation.
  • The topical formulations of the present invention, comprise an active ingredient together with one or more acceptable carrier(s) therefor and optionally any other therapeutic ingredients(s) . The carrier(s) must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not deleterious to the recipient thereof.
  • Formulations suitable for topical administration include liquid or semi-liquid preparations suitable for penetration through the skin to the site of where treatment is required, such as liniments, lotions, creams, ointments or pastes, and drops suitable for administration to the eye, ear or nose.
  • Drops according to the present invention may comprise sterile aqueous or oily solutions or suspensions and may be prepared by dissolving the active ingredient in a suitable aqueous solution of a bactericidal and/or fungicidal agent and/or any other suitable preservative, and preferably including a surface active agent. The resulting solution may then be clarified by filtration, transferred to a suitable container which is then sealed and sterilized by autoclaving or maintaining at 90°-100° C. for half an hour. Alternatively, the solution may be sterilized by filtration and transferred to the container by an aseptic technique. Examples of bactericidal and fungicidal agents suitable for inclusion in the drops are phenylmercuric nitrate or acetate (0.002%), benzalkonium chloride (0.01%) and chlorhexidine acetate (0.01%). Suitable solvents for the preparation of an oily solution include glycerol, diluted alcohol and propylene glycol.
  • Lotions according to the present invention include those suitable for application to the skin or eye. An eye lotion may comprise a sterile aqueous solution optionally containing a bactericide and may be prepared by methods similar to those for the preparation of drops. Lotions or liniments for application to the skin may also include an agent to hasten drying and to cool the skin, such as an alcohol or acetone, and/or a moisturizer such as glycerol or an oil such as castor oil or arachis oil.
  • Creams, ointments or pastes according to the present invention are semi-solid formulations of the active ingredient for external application. They may be made by mixing the active ingredient in finely-divided or powdered form, alone or in solution or suspension in an aqueous or non-aqueous fluid, with the aid of suitable machinery, with a greasy or non-greasy basis. The basis may comprise hydrocarbons such as hard, soft or liquid paraffin, glycerol, beeswax, a metallic soap; a mucilage; an oil of natural origin such as almond, corn, arachis, castor or olive oil; wool fat or its derivatives, or a fatty acid such as stearic or oleic acid together with an alcohol such as propylene glycol or macrogels. The formulation may incorporate any suitable surface active agent such as an anionic, cationic or non-ionic surface active such as sorbitan esters or polyoxyethylene derivatives thereof. Suspending agents such as natural gums, cellulose derivatives or inorganic materials such as silicaceous silicas, and other ingredients such as lanolin, may also be included.
  • It will be recognized by one of skill in the art that the optimal quantity and spacing of individual dosages of an antibody or fragment thereof of the invention will be determined by the nature and extent of the condition being treated, the form, route and site of administration, and the particular animal being treated, and that such optimums can be determined by conventional techniques. It will also be appreciated by one of skill in the art that the optimal course of treatment, i.e., the number of doses of an antibody or fragment thereof of the invention given per day for a defined number of days, can be ascertained by those skilled in the art using conventional course of treatment determination tests.
  • Without further elaboration, it is believed that one skilled in the art can, using the preceding description, utilize the present invention to its fullest extent. The following are, therefore, to be construed as merely illustrative examples and not a limitation of the scope of the present invention in any way.
  • Capsule Composition
  • A pharmaceutical composition of this invention in the form of a capsule is prepared by filling a standard two-piece hard gelatin capsule with 50 mg. of an antibody or fragment thereof of the invention, in powdered form, 100 mg. of lactose, 32 mg. of talc and 8 mg. of magnesium stearate.
  • Injectable Parenteral Composition
  • A pharmaceutical composition of this invention in a form suitable for administration by injection is prepared by stirring 1.5 k by weight of an antibody or fragment thereof of the invention in 10 k by volume propylene glycol and water. The solution is sterilized by filtration.
  • Ointment Composition
  • Antibody or fragment thereof of the invention 1.0 g.
  • White soft paraffin to 100.0 g.
  • The antibody or fragment thereof of the invention is dispersed in a small volume of the vehicle to produce a smooth, homogeneous product. Collapsible metal tubes are then filled with the dispersion.
  • Topical Cream Composition
  • Antibody or fragment thereof of the invention 1.0 g.
  • Polawax GP 200 20.0 g.
  • Lanolin Anhydrous 2.0 g.
  • White Beeswax 2.5 g.
  • Methyl hydroxybenzoate 0.1 g.
  • Distilled Water to 100.0 g.
  • The polawax, beeswax and lanolin are heated together at 60° C. A solution of methyl hydroxybenzoate is added and homogenization is achieved using high speed stirring. The temperature is then allowed to fall to SOOC. The antibody or fragment thereof of the invention is then added and dispersed throughout, and the composition is allowed to cool with slow speed stirring.
  • Topical Lotion Composition
  • Antibody or fragment thereof of the invention 1.0 g.
  • Sorbitan Monolaurate 0.6 g. Polysorbate 20 0.6 g.
  • Cetostearyl Alcohol 1.2 9. Glycerin 6.0 g.
  • Methyl Hydroxybenzoate 0.2 g.
  • Purified Water B.P. to 100.00 ml. (B.P.=British Pharmacopeia)
  • The methyl hydroxybenzoate and glycerin are dissolved in 70 ml. of the water at 75° C. The sorbitan monolaurate, polysorbate 20 and cetostearyl alcohol are melted together at 75° C. and added to the aqueous solution. The resulting emulsion is homogenized, allowed to cool with continuous stirring and the antibody or fragment thereof of the invention is added as a suspension in the remaining water. The whole suspension is stirred until homogenized.
  • Eye Drop Composition
  • Antibody or fragment thereof of the invention 0.5 g.
  • Methyl Hydroxybenzoate 0.01 g.
  • Propyl Hydroxybenzoate 0.04 g.
  • Purified Water B.P. to 100.00 ml.
  • The methyl and propyl hydroxybenzoates are dissolved in 70 ml. purified water at 75° C. and the resulting solution is allowed to cool. The antibody or fragment thereof of the invention is then added, and the solution is sterilized by filtration through a membrane filter (0.022 Am pore size), and packed aseptically into suitable sterile containers.
  • Composition for Administration by Inhalation
  • For an aerosol container with a capacity of 15-20 ml: mix 10 mg. of an antibody or fragment thereof of the invention with 0.2-0.5 k of a lubricating agent, such as polysorbate 85 or oleic acid, and disperse such mixture in a propellant, such as freon, preferably in a combination of (1,2 dichlorotetrafluoroethane) and difluorochloromethane and put into an appropriate aerosol container adapted for either intranasal or oral inhalation administration. Composition for Administration by Inhalation For an aerosol container with a capacity of 15-20 ml: dissolve 10 mg. of an antibody or fragment thereof of the invention in ethanol (6-8 ml.), add 0.1-0.2 k of a lubricating agent, such as polysorbate 85 or oleic acid; and disperse such in a propellant, such as freon, preferably in combination of (1-2 dichlorotetrafluoroethane) and difluorochloromethane, and put into an appropriate aerosol container adapted for either intranasal or oral inhalation administration.
  • The antibodies and pharmaceutical compositions of the invention are particularly useful for parenteral administration, i.e., subcutaneously, intramuscularly or intravenously. The compositions for parenteral administration will commonly comprise a solution of an antibody or fragment thereof of the invention or a cocktail thereof dissolved in an acceptable carrier, preferably an aqueous carrier. A variety of aqueous carriers may be employed, e.g., water, buffered water, 0.4 k saline, 0.3% glycine, and the like. These solutions are sterile and generally free of particulate matter. These solutions may be sterilized by conventional, well-known sterilization techniques. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, etc. The concentration of the antibody or fragment thereof of the invention in such pharmaceutical formulation can vary widely, i.e., from less than about 0.5 k, usually at or at least about 1% to as much as 15 or 20% by weight, and will be selected primarily based on fluid volumes, viscosities, etc., according to the particular mode of administration selected.
  • Thus, a pharmaceutical composition of the invention for intramuscular injection could be prepared to contain 1 mL sterile buffered water, and 50 mg. of an antibody or fragment thereof of the invention. Similarly, a pharmaceutical composition of the invention for intravenous infusion could be made up to contain 250 ml. of sterile Ringer's solution, and 150 mg. of an antibody or fragment thereof of the invention. Actual methods for preparing parenterally administrable compositions are well-known or will be apparent to those skilled in the art, and are described in more detail in, e.g., Remington's Pharmaceutical Science, 15th ed., Mack Publishing Company, Easton, Pa., hereby incorporated by reference herein.
  • The antibodies (or fragments thereof) of the invention can be lyophilized for storage and reconstituted in a suitable carrier prior to use. This technique has been shown to be effective with conventional immune globulins and art-known lyophilization and reconstitution techniques can be employed.
  • Depending on the intended result, the pharmaceutical composition of the invention can be administered for prophylactic and/or therapeutic treatments. In therapeutic application, compositions are administered to a patient already suffering from a disease, in an amount sufficient to cure or at least partially arrest the disease and its complications. In prophylactic applications, compositions containing the present antibodies or a cocktail thereof are administered to a patient not already in a disease state to enhance the patient's resistance.
  • Single or multiple administrations of the pharmaceutical compositions can be carried out with dose levels and pattern being selected by the treating physician. In any event, the pharmaceutical composition of the invention should provide a quantity of the altered antibodies (or fragments thereof) of the invention sufficient to effectively treat the patient.
  • It should also be noted that the antibodies of this invention may be used for the design and synthesis of either peptide or non-peptide compounds (mimetics) which would be useful in the same therapy as the antibody. See, e.g., Saragovi et al, Science, 253:792-795 (1991).
  • From the foregoing, it will be appreciated that, although specific embodiments of the invention have been described herein for purposes of illustration, various modifications may be made without diverting from the scope of the invention. Accordingly, the invention is not limited by the appended claims.

Claims (11)

1-24. (canceled)
25. A method of treatment of a disease treatable by modulating gp39 expression or inhibiting the gp39/CD40 interaction which comprises administering a therapeutically effective amount of a humanized antibody which is capable of competing with the murine 24-31 antibody for inhibiting CD40 binding to gp39.
26. The method of claim 25, wherein said disease is an autoimmune disorder.
27. The method of claim 26, wherein said autoimmune disorder is selected from the group consisting of rheumatoid arthritis, psoriasis, multiple sclerosis, diabetes, systemic lupus erythematosus and ITP.
28. The method of claim 25, wherein the disease is a non-autoimmune disorder.
29. The method of claim 25, wherein the disease is graft-versus-host disease or graft rejection.
30. A method of suppressing humoral and/or cellular immune responses against cells or vectors administered during cell or gene therapy comprising further administering prior, during, or after gene therapy an amount of a humanized antibody derived from murine antibody 24-31. sufficient to suppress humoral and/or cellular immune responses against the cell or vector used during cell or gene therapy.
31. The method of claim 30, wherein the vector is a viral vector, a DNA or an antisense RNA.
32. The method of claim 30, wherein the viral vector is an adenovirus or retrovirus.
33. The method of claim 30, wherein said humanized antibody contains a sequence set forth in at least one of FIGS. 5-8.
34. An improved method of treatment which involves the transplantation of cells, tissues or organs of the same or different species into a subject in need of such treatment, wherein the improvement comprises administering a humanized antibody derived from murine antibody 24-31; prior, during, or after transplantation; in an amount sufficient to suppress immune responses against said transplanted cell, tissue or organ or to suppress immune responses elicited by the transplanted cell, tissue or organ against the host.
US11/370,898 1995-11-07 2006-03-09 Treating autoimmune diseases with humanized anti-CD401 antibodies Abandoned US20060153837A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US11/370,898 US20060153837A1 (en) 1995-11-07 2006-03-09 Treating autoimmune diseases with humanized anti-CD401 antibodies

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US08/554,840 US6001358A (en) 1995-11-07 1995-11-07 Humanized antibodies to human gp39, compositions containing thereof
US08/925,339 US6440418B1 (en) 1995-11-07 1997-09-08 Methods of treating autoimmune diseases with gp39-specific antibodies
US10/171,681 US7122187B2 (en) 1995-11-07 2002-06-17 Treating autoimmune diseases with humanized anti-CD40L antibody
US11/370,898 US20060153837A1 (en) 1995-11-07 2006-03-09 Treating autoimmune diseases with humanized anti-CD401 antibodies

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US10/171,681 Continuation US7122187B2 (en) 1995-11-07 2002-06-17 Treating autoimmune diseases with humanized anti-CD40L antibody

Publications (1)

Publication Number Publication Date
US20060153837A1 true US20060153837A1 (en) 2006-07-13

Family

ID=25451580

Family Applications (3)

Application Number Title Priority Date Filing Date
US08/925,339 Expired - Fee Related US6440418B1 (en) 1995-11-07 1997-09-08 Methods of treating autoimmune diseases with gp39-specific antibodies
US10/171,681 Expired - Fee Related US7122187B2 (en) 1995-11-07 2002-06-17 Treating autoimmune diseases with humanized anti-CD40L antibody
US11/370,898 Abandoned US20060153837A1 (en) 1995-11-07 2006-03-09 Treating autoimmune diseases with humanized anti-CD401 antibodies

Family Applications Before (2)

Application Number Title Priority Date Filing Date
US08/925,339 Expired - Fee Related US6440418B1 (en) 1995-11-07 1997-09-08 Methods of treating autoimmune diseases with gp39-specific antibodies
US10/171,681 Expired - Fee Related US7122187B2 (en) 1995-11-07 2002-06-17 Treating autoimmune diseases with humanized anti-CD40L antibody

Country Status (11)

Country Link
US (3) US6440418B1 (en)
EP (1) EP1011725A4 (en)
JP (1) JP2001515708A (en)
KR (1) KR100574591B1 (en)
CN (1) CN1278736A (en)
AU (1) AU740981B2 (en)
CA (1) CA2302752A1 (en)
IL (1) IL134888A0 (en)
NO (1) NO20001104L (en)
RU (1) RU2207878C2 (en)
WO (1) WO1999012566A1 (en)

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070059306A1 (en) * 2005-07-25 2007-03-15 Trubion Pharmaceuticals, Inc. B-cell reduction using CD37-specific and CD20-specific binding molecules
US20080279850A1 (en) * 2005-07-25 2008-11-13 Trubion Pharmaceuticals, Inc. B-Cell Reduction Using CD37-Specific and CD20-Specific Binding Molecules
US8333966B2 (en) 2008-04-11 2012-12-18 Emergent Product Development Seattle, Llc CD37 immunotherapeutics and uses thereof
US8409577B2 (en) 2006-06-12 2013-04-02 Emergent Product Development Seattle, Llc Single chain multivalent binding proteins with effector function
US8853366B2 (en) 2001-01-17 2014-10-07 Emergent Product Development Seattle, Llc Binding domain-immunoglobulin fusion proteins
US9005612B2 (en) 2001-01-17 2015-04-14 Emergent Product Development Seattle, Llc Binding domain-immunoglobulin fusion proteins
WO2017053469A2 (en) 2015-09-21 2017-03-30 Aptevo Research And Development Llc Cd3 binding polypeptides
WO2021146336A1 (en) 2020-01-13 2021-07-22 Aptevo Research And Development Llc Methods and compositions for preventing adsorption of therapeutic proteins to drug delivery system components
WO2021146328A1 (en) 2020-01-13 2021-07-22 Aptevo Research And Development Llc Formulations for protein therapeutics
WO2022246244A1 (en) 2021-05-21 2022-11-24 Aptevo Research And Development Llc Dosing regimens for protein therapeutics

Families Citing this family (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6440418B1 (en) * 1995-11-07 2002-08-27 Idec Pharmaceuticals Corporation Methods of treating autoimmune diseases with gp39-specific antibodies
US6001358A (en) 1995-11-07 1999-12-14 Idec Pharmaceuticals Corporation Humanized antibodies to human gp39, compositions containing thereof
NZ337072A (en) * 1997-01-10 2000-12-22 Biogen Inc use of an anti-CD40L compounds to inhibit the progression of nephritis, stabilize nephritis or reverse nephritis in a patient with an immune complex disease
CA2223225A1 (en) * 1997-11-28 1999-05-28 Canadian Red Cross Society Method for inhibiting in vivo immune response
US7163686B1 (en) * 1999-05-15 2007-01-16 The Regents Of The University Of California Protein A based binding domains with desirable activities
EP1101495A4 (en) * 1999-06-01 2003-05-07 Eisai Co Ltd Preventives for idiopathic thrombocytopenic purpura
JP3871503B2 (en) * 1999-08-30 2007-01-24 日本たばこ産業株式会社 Immune disease treatment
EP1839674A1 (en) * 1999-10-04 2007-10-03 Novartis Vaccines and Diagnostics, Inc. CD40 antagonist for treating psoriasis
DE60035057T2 (en) * 1999-10-04 2008-01-31 Novartis Vaccines and Diagnostics, Inc., Emeryville CD40 antagonist for the treatment of psoriasis
DE60037822D1 (en) * 1999-10-22 2008-03-06 Biogen Idec Inc USE OF A CD40: CD154 BINDING BREAKER FOR THE TREATMENT OF IMMUNOLOGICAL COMPLICATIONS OF THE EYE
GB0006398D0 (en) * 2000-03-16 2000-05-03 Novartis Ag Organic compounds
WO2001079555A2 (en) 2000-04-14 2001-10-25 Millennium Pharmaceuticals, Inc. Roles of jak/stat family members in tolerance induction
US7560534B2 (en) 2000-05-08 2009-07-14 Celldex Research Corporation Molecular conjugates comprising human monoclonal antibodies to dendritic cells
AU2001261585B2 (en) 2000-05-12 2006-08-31 Beth Israel Deaconess Medical Center, Inc. Compositions and methods for achieving immune suppression
WO2001094586A2 (en) * 2000-06-06 2001-12-13 Idec Pharmaceuticals Corporation Non-agonistic antibodies to human gp39, compositions containing, and therapeutic use thereof
AR039067A1 (en) * 2001-11-09 2005-02-09 Pfizer Prod Inc ANTIBODIES FOR CD40
JP3845735B2 (en) * 2002-04-03 2006-11-15 学校法人慶應義塾 A treatment for pemphigus comprising a CD40L antagonist as an active ingredient
US9259459B2 (en) * 2003-01-31 2016-02-16 Celldex Therapeutics Inc. Antibody vaccine conjugates and uses therefor
US9243064B2 (en) * 2003-01-31 2016-01-26 Celldex Therapeutics Inc. Antibody vaccine conjugates and uses therefor
RU2240134C1 (en) * 2003-02-17 2004-11-20 Козлов Владимир Александрович Method for treatment of patients with diabetes mellitus
US20050079234A1 (en) * 2003-08-27 2005-04-14 Chiang Yang Chi Compositions comprising herbs and method for immunomodulation
US7563443B2 (en) * 2004-09-17 2009-07-21 Domantis Limited Monovalent anti-CD40L antibody polypeptides and compositions thereof
KR101811965B1 (en) 2007-11-07 2017-12-22 셀덱스 쎄라퓨틱스, 인크. Antibodies that bind human dendritic and epithelial cell 205(dec-205)
EP2310405A4 (en) * 2008-07-11 2011-08-10 Phylogica Ltd Peptide inhibitors of cd40l signaling and uses therefor
AU2010222942B2 (en) * 2009-03-10 2013-01-10 Baylor Research Institute Anti-CD40 antibodies and uses thereof
EP2406288B1 (en) 2009-03-10 2016-12-14 Baylor Research Institute Antigen presenting cell targeted vaccines
WO2010126898A1 (en) * 2009-04-27 2010-11-04 The Trustees Of The University Of Pennsylvania Methods for reducing the level of alloantibodies in a subject
RU2439712C1 (en) * 2010-07-21 2012-01-10 Сергей Валентинович Логвинов Method of modelling autoimmune oophoritis
HRP20200744T1 (en) * 2011-12-22 2020-07-24 F. Hoffmann - La Roche Ag ORGANIZATION OF EXPRESSION VECTOR, NEW PROCEDURES FOR GENERATION OF CELL PRODUCTION AND THEIR USE FOR RECOMBINANT POLYPEPTIDE PRODUCTION
RU2015142815A (en) 2013-03-14 2017-04-12 Паркаш ГИЛЛ TREATMENT OF CANCER USING ANTIBODIES COMBINING WITH SURFACE GRP78
EP3094652B1 (en) 2014-01-13 2021-09-29 Baylor Research Institute Novel vaccines against hpv and hpv-related diseases
EA201890297A1 (en) 2015-07-14 2018-06-29 Иммьюнекст, Инк. ANTIBODY TO CD154, possessing improved characteristics of binding, function and safety, and its use in human immunotherapy
EA201890434A1 (en) 2015-08-05 2018-10-31 Янссен Байотек, Инк. ANTIBODIES TO CD154 AND METHODS OF THEIR APPLICATION
US10610585B2 (en) 2017-09-26 2020-04-07 Inserm (Institut National De La Sante Et De La Recherche Medicale) Methods and compositions for treating and preventing HIV

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816397A (en) * 1983-03-25 1989-03-28 Celltech, Limited Multichain polypeptides or proteins and processes for their production
US4816567A (en) * 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4975369A (en) * 1988-04-21 1990-12-04 Eli Lilly And Company Recombinant and chimeric KS1/4 antibodies directed against a human adenocarcinoma antigen
US4978745A (en) * 1987-11-23 1990-12-18 Centocor, Inc. Immunoreactive heterochain antibodies
US5683693A (en) * 1994-04-25 1997-11-04 Trustees Of Dartmouth College Method for inducing T cell unresponsiveness to a tissue or organ graft with anti-CD40 ligand antibody or soluble CD40
US5747771A (en) * 1995-04-13 1998-05-05 The Boc Group Plc Method and apparatus for forming blind slots including laser melting and gas vortex
US5833987A (en) * 1995-06-07 1998-11-10 Trustees Of Dartmouth College Treatment of T cell mediated autoimmune disorders
US5876718A (en) * 1993-09-02 1999-03-02 Trustees Of Dartmouth College Methods of inducing T cell non-responsiveness to transplanted tissues and of treating graft-versus-host-disease with anti-gp39 antibodies
US6001358A (en) * 1995-11-07 1999-12-14 Idec Pharmaceuticals Corporation Humanized antibodies to human gp39, compositions containing thereof
US6440418B1 (en) * 1995-11-07 2002-08-27 Idec Pharmaceuticals Corporation Methods of treating autoimmune diseases with gp39-specific antibodies

Family Cites Families (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5092585A (en) 1987-06-11 1992-03-03 Jones Arthur A Apparatus for testing and/or exercising the cervical muscles of the human body
IL162181A (en) 1988-12-28 2006-04-10 Pdl Biopharma Inc A method of producing humanized immunoglubulin, and polynucleotides encoding the same
DE69233482T2 (en) 1991-05-17 2006-01-12 Merck & Co., Inc. Method for reducing the immunogenicity of antibody variable domains
US6136310A (en) * 1991-07-25 2000-10-24 Idec Pharmaceuticals Corporation Recombinant anti-CD4 antibodies for human therapy
KR100283541B1 (en) 1991-10-25 2001-03-02 크리스토퍼 엘. 와이트, 스코트 지. 홀퀴스트, 스티븐 엘. 말라스카 New cytokines
US5474771A (en) 1991-11-15 1995-12-12 The Trustees Of Columbia University In The City Of New York Murine monoclonal antibody (5c8) recognizes a human glycoprotein on the surface of T-lymphocytes, compositions containing same
IL104684A0 (en) 1992-02-14 1993-06-10 Bristol Myers Squibb Co The cd40cr receptor and ligands therefor
WO1994004570A1 (en) 1992-08-21 1994-03-03 Schering Corporation Cd40 ligand, anti cd40 antibodies, and soluble cd40
US5540926A (en) 1992-09-04 1996-07-30 Bristol-Myers Squibb Company Soluble and its use in B cell stimulation
ATE179616T1 (en) 1993-09-02 1999-05-15 Dartmouth College METHOD FOR PROLONGED SUPPRESSION OF HUMORAL IMMUNITY
US5876950A (en) 1995-01-26 1999-03-02 Bristol-Myers Squibb Company Monoclonal antibodies specific for different epitopes of human GP39 and methods for their use in diagnosis and therapy
AU4352997A (en) 1996-08-30 1998-03-19 Genzyme Corporation Inhibition of primary and/or secondary immune response to repeat adenoviral vector administration using cd40l specific antibodies

Patent Citations (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816397A (en) * 1983-03-25 1989-03-28 Celltech, Limited Multichain polypeptides or proteins and processes for their production
US4816567A (en) * 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4978745A (en) * 1987-11-23 1990-12-18 Centocor, Inc. Immunoreactive heterochain antibodies
US4975369A (en) * 1988-04-21 1990-12-04 Eli Lilly And Company Recombinant and chimeric KS1/4 antibodies directed against a human adenocarcinoma antigen
US5876718A (en) * 1993-09-02 1999-03-02 Trustees Of Dartmouth College Methods of inducing T cell non-responsiveness to transplanted tissues and of treating graft-versus-host-disease with anti-gp39 antibodies
US5683693A (en) * 1994-04-25 1997-11-04 Trustees Of Dartmouth College Method for inducing T cell unresponsiveness to a tissue or organ graft with anti-CD40 ligand antibody or soluble CD40
US5902585A (en) * 1994-04-25 1999-05-11 University Of Massachusetts Medical Center Methods of inducing T cell unresponsiveness to donor tissue or organ in a recipient with GP39 antagonists
US5747771A (en) * 1995-04-13 1998-05-05 The Boc Group Plc Method and apparatus for forming blind slots including laser melting and gas vortex
US5833987A (en) * 1995-06-07 1998-11-10 Trustees Of Dartmouth College Treatment of T cell mediated autoimmune disorders
US6001358A (en) * 1995-11-07 1999-12-14 Idec Pharmaceuticals Corporation Humanized antibodies to human gp39, compositions containing thereof
US6440418B1 (en) * 1995-11-07 2002-08-27 Idec Pharmaceuticals Corporation Methods of treating autoimmune diseases with gp39-specific antibodies
US6506383B1 (en) * 1995-11-07 2003-01-14 Idec Pharmaceuticals Corporation Methods of suppressing immune responses to transplanted tissues and organs with gp39-specific antibodies

Cited By (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8853366B2 (en) 2001-01-17 2014-10-07 Emergent Product Development Seattle, Llc Binding domain-immunoglobulin fusion proteins
US9005612B2 (en) 2001-01-17 2015-04-14 Emergent Product Development Seattle, Llc Binding domain-immunoglobulin fusion proteins
US10307481B2 (en) 2005-07-25 2019-06-04 Aptevo Research And Development Llc CD37 immunotherapeutics and uses thereof
US20070059306A1 (en) * 2005-07-25 2007-03-15 Trubion Pharmaceuticals, Inc. B-cell reduction using CD37-specific and CD20-specific binding molecules
EP2298815A1 (en) 2005-07-25 2011-03-23 Trubion Pharmaceuticals, Inc. B-cell reduction using CD37-specific and CD20-specific binding molecules
US10143748B2 (en) 2005-07-25 2018-12-04 Aptevo Research And Development Llc B-cell reduction using CD37-specific and CD20-specific binding molecules
EP2586798A2 (en) 2005-07-25 2013-05-01 Emergent Product Development Seattle, LLC B-cell reduction using CD37-specific and CD20-specific binding molecules
EP2295080A2 (en) 2005-07-25 2011-03-16 Trubion Pharmaceuticals, Inc. B-cell reduction using CD37-specific and CD20-specific binding molecules
US20080279850A1 (en) * 2005-07-25 2008-11-13 Trubion Pharmaceuticals, Inc. B-Cell Reduction Using CD37-Specific and CD20-Specific Binding Molecules
US8409577B2 (en) 2006-06-12 2013-04-02 Emergent Product Development Seattle, Llc Single chain multivalent binding proteins with effector function
US9101609B2 (en) 2008-04-11 2015-08-11 Emergent Product Development Seattle, Llc CD37 immunotherapeutic and combination with bifunctional chemotherapeutic thereof
US8333966B2 (en) 2008-04-11 2012-12-18 Emergent Product Development Seattle, Llc CD37 immunotherapeutics and uses thereof
WO2017053469A2 (en) 2015-09-21 2017-03-30 Aptevo Research And Development Llc Cd3 binding polypeptides
US11352426B2 (en) 2015-09-21 2022-06-07 Aptevo Research And Development Llc CD3 binding polypeptides
WO2021146336A1 (en) 2020-01-13 2021-07-22 Aptevo Research And Development Llc Methods and compositions for preventing adsorption of therapeutic proteins to drug delivery system components
WO2021146328A1 (en) 2020-01-13 2021-07-22 Aptevo Research And Development Llc Formulations for protein therapeutics
WO2022246244A1 (en) 2021-05-21 2022-11-24 Aptevo Research And Development Llc Dosing regimens for protein therapeutics

Also Published As

Publication number Publication date
EP1011725A4 (en) 2005-03-16
JP2001515708A (en) 2001-09-25
KR20010023787A (en) 2001-03-26
AU9565298A (en) 1999-03-29
US20030170233A1 (en) 2003-09-11
CN1278736A (en) 2001-01-03
WO1999012566A9 (en) 1999-06-03
IL134888A0 (en) 2001-05-20
AU740981B2 (en) 2001-11-15
KR100574591B1 (en) 2006-04-28
US6440418B1 (en) 2002-08-27
US7122187B2 (en) 2006-10-17
NO20001104L (en) 2000-05-08
NO20001104D0 (en) 2000-03-03
EP1011725A1 (en) 2000-06-28
RU2207878C2 (en) 2003-07-10
WO1999012566A1 (en) 1999-03-18
CA2302752A1 (en) 1999-03-18

Similar Documents

Publication Publication Date Title
US6506383B1 (en) Methods of suppressing immune responses to transplanted tissues and organs with gp39-specific antibodies
US6440418B1 (en) Methods of treating autoimmune diseases with gp39-specific antibodies
WO1997017446A9 (en) HUMANIZED ANTIBODIES TO HUMAN gp39, COMPOSITIONS CONTAINING AND THERAPEUTIC USE THEREOF
US20060193856A1 (en) Aglycosyl anti-CD154 (CD40 ligand) antibodies and uses thereof
US20150141621A1 (en) Stabilized human igg4 antibodies
KR20130080856A (en) Silent fc variants of anti-cd40 antibodies
US7695940B2 (en) Gamma-1 and gamma-3 anti-human CD23 monoclonal antibodies and use thereof as therapeutics
US7262277B2 (en) Antagonistic anti-hFAS ligand human antibodies and fragments thereof
US20030012781A1 (en) Non-agonistic antibodies to human gp39, compositions containing, and therapeutic use thereof
AU2001275224B2 (en) Non-agonistic antibodies to human GP39, compositions containing, and therapeutic use thereof
AU2001275224A1 (en) Non-agonistic antibodies to human GP39, compositions containing, and therapeutic use thereof
CN1835976B (en) Aglycosyl anti-CD154 (CD40 ligand) antibody and use thereof
AU2011224032A1 (en) Aglycosyl Anti-CD154 (CD40 Ligand) Antibodies and Uses Thereof
HK1145690A (en) Aglycosyl anti-cd154 (cd40 ligand) antibodies and uses thereof

Legal Events

Date Code Title Description
STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION