US20050176622A1 - Secondary binding site of dipeptidyl peptidase IV (DPIV) - Google Patents
Secondary binding site of dipeptidyl peptidase IV (DPIV) Download PDFInfo
- Publication number
- US20050176622A1 US20050176622A1 US10/667,200 US66720003A US2005176622A1 US 20050176622 A1 US20050176622 A1 US 20050176622A1 US 66720003 A US66720003 A US 66720003A US 2005176622 A1 US2005176622 A1 US 2005176622A1
- Authority
- US
- United States
- Prior art keywords
- enzymes
- agonists
- glp
- inhibitors
- mimetics
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 230000027455 binding Effects 0.000 title claims abstract description 112
- 101000930822 Giardia intestinalis Dipeptidyl-peptidase 4 Proteins 0.000 title abstract description 21
- 102000016622 Dipeptidyl Peptidase 4 Human genes 0.000 title 2
- 102000004190 Enzymes Human genes 0.000 claims abstract description 145
- 108090000790 Enzymes Proteins 0.000 claims abstract description 145
- 150000001875 compounds Chemical class 0.000 claims abstract description 140
- 238000000034 method Methods 0.000 claims abstract description 54
- 238000011282 treatment Methods 0.000 claims abstract description 30
- 108090000623 proteins and genes Proteins 0.000 claims description 57
- 230000000694 effects Effects 0.000 claims description 56
- 230000003993 interaction Effects 0.000 claims description 55
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 claims description 54
- 206010012601 diabetes mellitus Diseases 0.000 claims description 49
- 102000004169 proteins and genes Human genes 0.000 claims description 49
- 239000003112 inhibitor Substances 0.000 claims description 48
- 108010004460 Gastric Inhibitory Polypeptide Proteins 0.000 claims description 45
- 102100039994 Gastric inhibitory polypeptide Human genes 0.000 claims description 43
- 102100040918 Pro-glucagon Human genes 0.000 claims description 31
- 125000002252 acyl group Chemical group 0.000 claims description 29
- 125000000539 amino acid group Chemical group 0.000 claims description 29
- 241000124008 Mammalia Species 0.000 claims description 28
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 28
- 229940125396 insulin Drugs 0.000 claims description 28
- 150000003839 salts Chemical class 0.000 claims description 28
- 108090001061 Insulin Proteins 0.000 claims description 27
- 102000004877 Insulin Human genes 0.000 claims description 26
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 claims description 23
- 208000002705 Glucose Intolerance Diseases 0.000 claims description 20
- 201000009104 prediabetes syndrome Diseases 0.000 claims description 20
- 239000000556 agonist Substances 0.000 claims description 18
- 102000002808 Pituitary adenylate cyclase-activating polypeptide Human genes 0.000 claims description 17
- 108010004684 Pituitary adenylate cyclase-activating polypeptide Proteins 0.000 claims description 17
- 201000010099 disease Diseases 0.000 claims description 17
- 239000008194 pharmaceutical composition Substances 0.000 claims description 16
- 108010011459 Exenatide Proteins 0.000 claims description 14
- 229960001519 exenatide Drugs 0.000 claims description 13
- 101800000221 Glucagon-like peptide 2 Proteins 0.000 claims description 12
- 206010020772 Hypertension Diseases 0.000 claims description 12
- TWSALRJGPBVBQU-PKQQPRCHSA-N glucagon-like peptide 2 Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O)[C@@H](C)CC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=CC=C1 TWSALRJGPBVBQU-PKQQPRCHSA-N 0.000 claims description 12
- 229940044601 receptor agonist Drugs 0.000 claims description 12
- 239000000018 receptor agonist Substances 0.000 claims description 12
- 208000035475 disorder Diseases 0.000 claims description 11
- 208000011580 syndromic disease Diseases 0.000 claims description 11
- 230000004968 inflammatory condition Effects 0.000 claims description 10
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Chemical compound OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims description 10
- JUFFVKRROAPVBI-PVOYSMBESA-N chembl1210015 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N[C@H]1[C@@H]([C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO[C@]3(O[C@@H](C[C@H](O)[C@H](O)CO)[C@H](NC(C)=O)[C@@H](O)C3)C(O)=O)O2)O)[C@@H](CO)O1)NC(C)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 JUFFVKRROAPVBI-PVOYSMBESA-N 0.000 claims description 9
- 208000017169 kidney disease Diseases 0.000 claims description 9
- 108091035707 Consensus sequence Proteins 0.000 claims description 8
- 206010028980 Neoplasm Diseases 0.000 claims description 8
- 201000001421 hyperglycemia Diseases 0.000 claims description 8
- 230000004060 metabolic process Effects 0.000 claims description 8
- 239000003937 drug carrier Substances 0.000 claims description 7
- 230000002526 effect on cardiovascular system Effects 0.000 claims description 7
- XUFXOAAUWZOOIT-SXARVLRPSA-N (2R,3R,4R,5S,6R)-5-[[(2R,3R,4R,5S,6R)-5-[[(2R,3R,4S,5S,6R)-3,4-dihydroxy-6-methyl-5-[[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)-1-cyclohex-2-enyl]amino]-2-oxanyl]oxy]-3,4-dihydroxy-6-(hydroxymethyl)-2-oxanyl]oxy]-6-(hydroxymethyl)oxane-2,3,4-triol Chemical compound O([C@H]1O[C@H](CO)[C@H]([C@@H]([C@H]1O)O)O[C@H]1O[C@@H]([C@H]([C@H](O)[C@H]1O)N[C@@H]1[C@@H]([C@@H](O)[C@H](O)C(CO)=C1)O)C)[C@@H]1[C@@H](CO)O[C@@H](O)[C@H](O)[C@H]1O XUFXOAAUWZOOIT-SXARVLRPSA-N 0.000 claims description 6
- 208000010444 Acidosis Diseases 0.000 claims description 6
- 208000019901 Anxiety disease Diseases 0.000 claims description 6
- 201000001320 Atherosclerosis Diseases 0.000 claims description 6
- 208000023275 Autoimmune disease Diseases 0.000 claims description 6
- 206010018473 Glycosuria Diseases 0.000 claims description 6
- 208000031226 Hyperlipidaemia Diseases 0.000 claims description 6
- 206010027417 Metabolic acidosis Diseases 0.000 claims description 6
- PVNIIMVLHYAWGP-UHFFFAOYSA-N Niacin Chemical compound OC(=O)C1=CC=CN=C1 PVNIIMVLHYAWGP-UHFFFAOYSA-N 0.000 claims description 6
- 102000023984 PPAR alpha Human genes 0.000 claims description 6
- 206010033645 Pancreatitis Diseases 0.000 claims description 6
- 206010036049 Polycystic ovaries Diseases 0.000 claims description 6
- 208000017442 Retinal disease Diseases 0.000 claims description 6
- 206010038923 Retinopathy Diseases 0.000 claims description 6
- 229960002632 acarbose Drugs 0.000 claims description 6
- XUFXOAAUWZOOIT-UHFFFAOYSA-N acarviostatin I01 Natural products OC1C(O)C(NC2C(C(O)C(O)C(CO)=C2)O)C(C)OC1OC(C(C1O)O)C(CO)OC1OC1C(CO)OC(O)C(O)C1O XUFXOAAUWZOOIT-UHFFFAOYSA-N 0.000 claims description 6
- 229940125708 antidiabetic agent Drugs 0.000 claims description 6
- 239000003472 antidiabetic agent Substances 0.000 claims description 6
- 230000036506 anxiety Effects 0.000 claims description 6
- 206010016256 fatigue Diseases 0.000 claims description 6
- 230000035780 glucosuria Effects 0.000 claims description 6
- 108010070727 peptide YY receptor Proteins 0.000 claims description 6
- 108091008725 peroxisome proliferator-activated receptors alpha Proteins 0.000 claims description 6
- 201000010065 polycystic ovary syndrome Diseases 0.000 claims description 6
- 208000004611 Abdominal Obesity Diseases 0.000 claims description 5
- 206010004446 Benign prostatic hyperplasia Diseases 0.000 claims description 5
- 102000014914 Carrier Proteins Human genes 0.000 claims description 5
- 206010065941 Central obesity Diseases 0.000 claims description 5
- 208000000094 Chronic Pain Diseases 0.000 claims description 5
- 206010009900 Colitis ulcerative Diseases 0.000 claims description 5
- 208000011231 Crohn disease Diseases 0.000 claims description 5
- 208000020401 Depressive disease Diseases 0.000 claims description 5
- 208000007342 Diabetic Nephropathies Diseases 0.000 claims description 5
- 208000032131 Diabetic Neuropathies Diseases 0.000 claims description 5
- 208000032928 Dyslipidaemia Diseases 0.000 claims description 5
- HTQBXNHDCUEHJF-XWLPCZSASA-N Exenatide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 HTQBXNHDCUEHJF-XWLPCZSASA-N 0.000 claims description 5
- 206010056438 Growth hormone deficiency Diseases 0.000 claims description 5
- 208000035150 Hypercholesterolemia Diseases 0.000 claims description 5
- 208000022559 Inflammatory bowel disease Diseases 0.000 claims description 5
- 208000017170 Lipid metabolism disease Diseases 0.000 claims description 5
- 206010027476 Metastases Diseases 0.000 claims description 5
- 208000001132 Osteoporosis Diseases 0.000 claims description 5
- 208000002193 Pain Diseases 0.000 claims description 5
- 108010088847 Peptide YY Proteins 0.000 claims description 5
- 102100029909 Peptide YY Human genes 0.000 claims description 5
- 208000004403 Prostatic Hyperplasia Diseases 0.000 claims description 5
- 208000005392 Spasm Diseases 0.000 claims description 5
- 201000006704 Ulcerative Colitis Diseases 0.000 claims description 5
- 108091008324 binding proteins Proteins 0.000 claims description 5
- 208000033679 diabetic kidney disease Diseases 0.000 claims description 5
- 206010015037 epilepsy Diseases 0.000 claims description 5
- 208000007565 gingivitis Diseases 0.000 claims description 5
- 201000010066 hyperandrogenism Diseases 0.000 claims description 5
- 208000006575 hypertriglyceridemia Diseases 0.000 claims description 5
- 208000002551 irritable bowel syndrome Diseases 0.000 claims description 5
- 150000002632 lipids Chemical class 0.000 claims description 5
- 230000009401 metastasis Effects 0.000 claims description 5
- XZWYZXLIPXDOLR-UHFFFAOYSA-N metformin Chemical compound CN(C)C(=N)NC(N)=N XZWYZXLIPXDOLR-UHFFFAOYSA-N 0.000 claims description 5
- 229960003105 metformin Drugs 0.000 claims description 5
- 230000004770 neurodegeneration Effects 0.000 claims description 5
- 208000015122 neurodegenerative disease Diseases 0.000 claims description 5
- 208000004235 neutropenia Diseases 0.000 claims description 5
- 208000030212 nutrition disease Diseases 0.000 claims description 5
- 230000002611 ovarian Effects 0.000 claims description 5
- 238000011321 prophylaxis Methods 0.000 claims description 5
- 208000037803 restenosis Diseases 0.000 claims description 5
- 201000000980 schizophrenia Diseases 0.000 claims description 5
- 208000017520 skin disease Diseases 0.000 claims description 5
- 208000019116 sleep disease Diseases 0.000 claims description 5
- 230000002792 vascular Effects 0.000 claims description 5
- 229940100389 Sulfonylurea Drugs 0.000 claims description 4
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 claims description 4
- MVQVNTPHUGQQHK-UHFFFAOYSA-N 3-pyridinemethanol Chemical compound OCC1=CC=CN=C1 MVQVNTPHUGQQHK-UHFFFAOYSA-N 0.000 claims description 3
- 229940077274 Alpha glucosidase inhibitor Drugs 0.000 claims description 3
- 229940123208 Biguanide Drugs 0.000 claims description 3
- 108010063919 Glucagon Receptors Proteins 0.000 claims description 3
- 102100040890 Glucagon receptor Human genes 0.000 claims description 3
- 108010024044 Glucagon-Like Peptide-2 Receptor Proteins 0.000 claims description 3
- 229940089838 Glucagon-like peptide 1 receptor agonist Drugs 0.000 claims description 3
- 102100032879 Glucagon-like peptide 2 receptor Human genes 0.000 claims description 3
- 229940121710 HMGCoA reductase inhibitor Drugs 0.000 claims description 3
- 229940122199 Insulin secretagogue Drugs 0.000 claims description 3
- 108010015181 PPAR delta Proteins 0.000 claims description 3
- 108010016731 PPAR gamma Proteins 0.000 claims description 3
- 102000003728 Peroxisome Proliferator-Activated Receptors Human genes 0.000 claims description 3
- 108090000029 Peroxisome Proliferator-Activated Receptors Proteins 0.000 claims description 3
- 102100038825 Peroxisome proliferator-activated receptor gamma Human genes 0.000 claims description 3
- 102000014743 Pituitary Adenylate Cyclase-Activating Polypeptide Receptors Human genes 0.000 claims description 3
- 108010064032 Pituitary Adenylate Cyclase-Activating Polypeptide Receptors Proteins 0.000 claims description 3
- 102000001494 Sterol O-Acyltransferase Human genes 0.000 claims description 3
- 108010054082 Sterol O-acyltransferase Proteins 0.000 claims description 3
- 239000002404 acyltransferase inhibitor Substances 0.000 claims description 3
- 239000003888 alpha glucosidase inhibitor Substances 0.000 claims description 3
- 229940121363 anti-inflammatory agent Drugs 0.000 claims description 3
- 239000002260 anti-inflammatory agent Substances 0.000 claims description 3
- 230000003579 anti-obesity Effects 0.000 claims description 3
- 239000003529 anticholesteremic agent Substances 0.000 claims description 3
- 229940127226 anticholesterol agent Drugs 0.000 claims description 3
- 239000003963 antioxidant agent Substances 0.000 claims description 3
- 150000004283 biguanides Chemical class 0.000 claims description 3
- 230000001906 cholesterol absorption Effects 0.000 claims description 3
- 230000009977 dual effect Effects 0.000 claims description 3
- 108010036598 gastric inhibitory polypeptide receptor Proteins 0.000 claims description 3
- 239000002471 hydroxymethylglutaryl coenzyme A reductase inhibitor Substances 0.000 claims description 3
- 229940121380 ileal bile acid transporter inhibitor Drugs 0.000 claims description 3
- 229960003512 nicotinic acid Drugs 0.000 claims description 3
- 235000001968 nicotinic acid Nutrition 0.000 claims description 3
- 239000011664 nicotinic acid Substances 0.000 claims description 3
- 229940096701 plain lipid modifying drug hmg coa reductase inhibitors Drugs 0.000 claims description 3
- 239000002464 receptor antagonist Substances 0.000 claims description 3
- 229940044551 receptor antagonist Drugs 0.000 claims description 3
- 239000003352 sequestering agent Substances 0.000 claims description 3
- CILIXQOJUNDIDU-ASQIGDHWSA-N teduglutide Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O)[C@@H](C)CC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=CC=C1 CILIXQOJUNDIDU-ASQIGDHWSA-N 0.000 claims description 3
- 108010073046 teduglutide Proteins 0.000 claims description 3
- 229960002444 teduglutide Drugs 0.000 claims description 3
- 101710198884 GATA-type zinc finger protein 1 Proteins 0.000 claims 4
- 102400000326 Glucagon-like peptide 2 Human genes 0.000 claims 4
- 208000030159 metabolic disease Diseases 0.000 claims 3
- 229960004111 buformin Drugs 0.000 claims 2
- XSEUMFJMFFMCIU-UHFFFAOYSA-N buformin Chemical compound CCCC\N=C(/N)N=C(N)N XSEUMFJMFFMCIU-UHFFFAOYSA-N 0.000 claims 2
- 238000011260 co-administration Methods 0.000 claims 2
- 229960003243 phenformin Drugs 0.000 claims 2
- ICFJFFQQTFMIBG-UHFFFAOYSA-N phenformin Chemical compound NC(=N)NC(=N)NCCC1=CC=CC=C1 ICFJFFQQTFMIBG-UHFFFAOYSA-N 0.000 claims 2
- 208000016097 disease of metabolism Diseases 0.000 claims 1
- 210000004877 mucosa Anatomy 0.000 claims 1
- 239000000758 substrate Substances 0.000 abstract description 126
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 abstract description 28
- 238000012216 screening Methods 0.000 abstract description 14
- 230000001404 mediated effect Effects 0.000 abstract description 9
- 101000908391 Homo sapiens Dipeptidyl peptidase 4 Proteins 0.000 abstract description 7
- 108010067722 Dipeptidyl Peptidase 4 Proteins 0.000 abstract description 5
- 229940088598 enzyme Drugs 0.000 description 133
- 108090000765 processed proteins & peptides Proteins 0.000 description 76
- 229940024606 amino acid Drugs 0.000 description 58
- 235000001014 amino acid Nutrition 0.000 description 57
- 239000003795 chemical substances by application Substances 0.000 description 57
- 235000002639 sodium chloride Nutrition 0.000 description 53
- 150000001413 amino acids Chemical class 0.000 description 52
- 235000018102 proteins Nutrition 0.000 description 43
- 125000000217 alkyl group Chemical group 0.000 description 41
- -1 N-(N′-substituted glycyl)-2-cyanopyrrolidines Chemical class 0.000 description 38
- 102000004196 processed proteins & peptides Human genes 0.000 description 35
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 31
- RWRDLPDLKQPQOW-UHFFFAOYSA-N tetrahydropyrrole Natural products C1CCNC1 RWRDLPDLKQPQOW-UHFFFAOYSA-N 0.000 description 28
- 229960004666 glucagon Drugs 0.000 description 26
- 102000051325 Glucagon Human genes 0.000 description 25
- 108060003199 Glucagon Proteins 0.000 description 25
- 210000004027 cell Anatomy 0.000 description 25
- 230000014509 gene expression Effects 0.000 description 25
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 description 25
- 229960001031 glucose Drugs 0.000 description 24
- 239000007787 solid Substances 0.000 description 24
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 23
- 239000008103 glucose Substances 0.000 description 23
- 230000005764 inhibitory process Effects 0.000 description 23
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 22
- 239000013078 crystal Substances 0.000 description 22
- 239000000203 mixture Substances 0.000 description 22
- 108010016626 Dipeptides Proteins 0.000 description 21
- 230000003197 catalytic effect Effects 0.000 description 21
- 239000003446 ligand Substances 0.000 description 21
- 102000009389 Prostaglandin D receptors Human genes 0.000 description 20
- 108050000258 Prostaglandin D receptors Proteins 0.000 description 20
- 238000003032 molecular docking Methods 0.000 description 20
- 101800000224 Glucagon-like peptide 1 Proteins 0.000 description 19
- 125000003118 aryl group Chemical group 0.000 description 19
- 239000000243 solution Substances 0.000 description 19
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 18
- 239000002253 acid Substances 0.000 description 18
- 239000000539 dimer Substances 0.000 description 18
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 17
- 238000003556 assay Methods 0.000 description 17
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 16
- 101001095266 Homo sapiens Prolyl endopeptidase Proteins 0.000 description 16
- 102000056251 Prolyl Oligopeptidases Human genes 0.000 description 16
- 125000000753 cycloalkyl group Chemical group 0.000 description 16
- 0 *BC[2H]C Chemical compound *BC[2H]C 0.000 description 15
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 15
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 15
- 125000003275 alpha amino acid group Chemical group 0.000 description 15
- 230000015572 biosynthetic process Effects 0.000 description 15
- 239000012636 effector Substances 0.000 description 15
- 125000001072 heteroaryl group Chemical group 0.000 description 15
- 230000007062 hydrolysis Effects 0.000 description 15
- 238000006460 hydrolysis reaction Methods 0.000 description 15
- 102000040430 polynucleotide Human genes 0.000 description 15
- 108091033319 polynucleotide Proteins 0.000 description 15
- 239000002157 polynucleotide Substances 0.000 description 15
- 238000012360 testing method Methods 0.000 description 15
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 14
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 14
- 238000006065 biodegradation reaction Methods 0.000 description 14
- 230000035772 mutation Effects 0.000 description 14
- 239000000047 product Substances 0.000 description 14
- 235000013930 proline Nutrition 0.000 description 14
- 239000000126 substance Substances 0.000 description 14
- 206010056997 Impaired fasting glucose Diseases 0.000 description 13
- 238000006243 chemical reaction Methods 0.000 description 13
- 230000013595 glycosylation Effects 0.000 description 13
- 238000006206 glycosylation reaction Methods 0.000 description 13
- 229910052739 hydrogen Inorganic materials 0.000 description 13
- 229910052760 oxygen Inorganic materials 0.000 description 13
- 210000002966 serum Anatomy 0.000 description 13
- 239000003826 tablet Substances 0.000 description 13
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 12
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 12
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 12
- 150000001408 amides Chemical class 0.000 description 12
- 210000004899 c-terminal region Anatomy 0.000 description 12
- 229910052757 nitrogen Inorganic materials 0.000 description 12
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 12
- 125000003342 alkenyl group Chemical group 0.000 description 11
- 125000003545 alkoxy group Chemical group 0.000 description 11
- 102000003779 Dipeptidyl-peptidases and tripeptidyl-peptidases Human genes 0.000 description 10
- 108090000194 Dipeptidyl-peptidases and tripeptidyl-peptidases Proteins 0.000 description 10
- 206010022489 Insulin Resistance Diseases 0.000 description 10
- 239000000872 buffer Substances 0.000 description 10
- 238000002474 experimental method Methods 0.000 description 10
- 230000002209 hydrophobic effect Effects 0.000 description 10
- 238000002360 preparation method Methods 0.000 description 10
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 9
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 9
- 108010038807 Oligopeptides Proteins 0.000 description 9
- 102000015636 Oligopeptides Human genes 0.000 description 9
- 102000035195 Peptidases Human genes 0.000 description 9
- 108091005804 Peptidases Proteins 0.000 description 9
- 108091023040 Transcription factor Proteins 0.000 description 9
- 102000040945 Transcription factor Human genes 0.000 description 9
- 125000004093 cyano group Chemical group *C#N 0.000 description 9
- 239000000499 gel Substances 0.000 description 9
- 239000001257 hydrogen Substances 0.000 description 9
- 210000003734 kidney Anatomy 0.000 description 9
- 230000007246 mechanism Effects 0.000 description 9
- 239000012528 membrane Substances 0.000 description 9
- 230000004048 modification Effects 0.000 description 9
- 238000012986 modification Methods 0.000 description 9
- 210000002381 plasma Anatomy 0.000 description 9
- 239000000651 prodrug Substances 0.000 description 9
- 229940002612 prodrug Drugs 0.000 description 9
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 8
- 241001465754 Metazoa Species 0.000 description 8
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 8
- 239000004480 active ingredient Substances 0.000 description 8
- 150000001412 amines Chemical class 0.000 description 8
- 239000002775 capsule Substances 0.000 description 8
- 125000000392 cycloalkenyl group Chemical group 0.000 description 8
- 238000006731 degradation reaction Methods 0.000 description 8
- 238000006471 dimerization reaction Methods 0.000 description 8
- 230000001105 regulatory effect Effects 0.000 description 8
- FSYKKLYZXJSNPZ-UHFFFAOYSA-N sarcosine Chemical compound C[NH2+]CC([O-])=O FSYKKLYZXJSNPZ-UHFFFAOYSA-N 0.000 description 8
- 235000004400 serine Nutrition 0.000 description 8
- 239000013598 vector Substances 0.000 description 8
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 7
- 125000004060 L-alloisoleucine group Chemical group [H]N([H])[C@]([H])(C(=O)[*])[C@@](C([H])([H])[H])([H])C(C([H])([H])[H])([H])[H] 0.000 description 7
- 102100023832 Prolyl endopeptidase FAP Human genes 0.000 description 7
- 239000004365 Protease Substances 0.000 description 7
- 108010076504 Protein Sorting Signals Proteins 0.000 description 7
- 125000004432 carbon atom Chemical group C* 0.000 description 7
- 230000015556 catabolic process Effects 0.000 description 7
- 238000006555 catalytic reaction Methods 0.000 description 7
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 7
- 239000007788 liquid Substances 0.000 description 7
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 7
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 description 7
- 239000000813 peptide hormone Substances 0.000 description 7
- 238000000746 purification Methods 0.000 description 7
- 229920006395 saturated elastomer Polymers 0.000 description 7
- 238000000926 separation method Methods 0.000 description 7
- 239000011780 sodium chloride Substances 0.000 description 7
- 239000002904 solvent Substances 0.000 description 7
- 125000000547 substituted alkyl group Chemical group 0.000 description 7
- 239000013603 viral vector Substances 0.000 description 7
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 6
- 108091070995 GRF family Proteins 0.000 description 6
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 6
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 6
- HXEACLLIILLPRG-YFKPBYRVSA-N L-pipecolic acid Chemical compound [O-]C(=O)[C@@H]1CCCC[NH2+]1 HXEACLLIILLPRG-YFKPBYRVSA-N 0.000 description 6
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 6
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 6
- 208000035180 MODY Diseases 0.000 description 6
- 101710151321 Melanostatin Proteins 0.000 description 6
- 102400000064 Neuropeptide Y Human genes 0.000 description 6
- 108010084214 Peptide PHI Proteins 0.000 description 6
- 239000000132 Peptide PHI Substances 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 239000011324 bead Substances 0.000 description 6
- 230000000975 bioactive effect Effects 0.000 description 6
- 125000002837 carbocyclic group Chemical group 0.000 description 6
- 239000000969 carrier Substances 0.000 description 6
- 210000000349 chromosome Anatomy 0.000 description 6
- 230000001419 dependent effect Effects 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 238000000855 fermentation Methods 0.000 description 6
- 230000004151 fermentation Effects 0.000 description 6
- 108010072257 fibroblast activation protein alpha Proteins 0.000 description 6
- 230000002068 genetic effect Effects 0.000 description 6
- 208000004104 gestational diabetes Diseases 0.000 description 6
- 125000005842 heteroatom Chemical group 0.000 description 6
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 6
- 238000001727 in vivo Methods 0.000 description 6
- HXEACLLIILLPRG-RXMQYKEDSA-N l-pipecolic acid Natural products OC(=O)[C@H]1CCCCN1 HXEACLLIILLPRG-RXMQYKEDSA-N 0.000 description 6
- 201000006950 maturity-onset diabetes of the young Diseases 0.000 description 6
- VAOCPAMSLUNLGC-UHFFFAOYSA-N metronidazole Chemical compound CC1=NC=C([N+]([O-])=O)N1CCO VAOCPAMSLUNLGC-UHFFFAOYSA-N 0.000 description 6
- 238000000329 molecular dynamics simulation Methods 0.000 description 6
- URPYMXQQVHTUDU-OFGSCBOVSA-N nucleopeptide y Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 URPYMXQQVHTUDU-OFGSCBOVSA-N 0.000 description 6
- 125000005740 oxycarbonyl group Chemical group [*:1]OC([*:2])=O 0.000 description 6
- YLBIOQUUAYXLJJ-WZUUGAJWSA-N peptide histidine methionine Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)C(C)C)[C@@H](C)O)C1=CC=C(O)C=C1 YLBIOQUUAYXLJJ-WZUUGAJWSA-N 0.000 description 6
- 239000012071 phase Substances 0.000 description 6
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 6
- 230000000291 postprandial effect Effects 0.000 description 6
- 102000005962 receptors Human genes 0.000 description 6
- 108020003175 receptors Proteins 0.000 description 6
- 239000000523 sample Substances 0.000 description 6
- 238000002741 site-directed mutagenesis Methods 0.000 description 6
- 229910052717 sulfur Inorganic materials 0.000 description 6
- 239000000725 suspension Substances 0.000 description 6
- 238000003786 synthesis reaction Methods 0.000 description 6
- 210000001519 tissue Anatomy 0.000 description 6
- 150000008574 D-amino acids Chemical class 0.000 description 5
- 101000999325 Homo sapiens Cobalamin binding intrinsic factor Proteins 0.000 description 5
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 5
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 5
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 5
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 5
- 241000235648 Pichia Species 0.000 description 5
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 5
- 230000004913 activation Effects 0.000 description 5
- 235000004279 alanine Nutrition 0.000 description 5
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 5
- 235000008206 alpha-amino acids Nutrition 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 235000003704 aspartic acid Nutrition 0.000 description 5
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 5
- 230000033228 biological regulation Effects 0.000 description 5
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 5
- 238000005119 centrifugation Methods 0.000 description 5
- 238000002425 crystallisation Methods 0.000 description 5
- 230000008025 crystallization Effects 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 235000019441 ethanol Nutrition 0.000 description 5
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 235000013922 glutamic acid Nutrition 0.000 description 5
- 239000004220 glutamic acid Substances 0.000 description 5
- 125000005843 halogen group Chemical group 0.000 description 5
- 125000000623 heterocyclic group Chemical group 0.000 description 5
- 238000013537 high throughput screening Methods 0.000 description 5
- 230000001771 impaired effect Effects 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 238000003780 insertion Methods 0.000 description 5
- 230000037431 insertion Effects 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 239000011159 matrix material Substances 0.000 description 5
- 238000012544 monitoring process Methods 0.000 description 5
- 238000007410 oral glucose tolerance test Methods 0.000 description 5
- 210000000056 organ Anatomy 0.000 description 5
- 239000006187 pill Substances 0.000 description 5
- 229920001184 polypeptide Polymers 0.000 description 5
- 239000000843 powder Substances 0.000 description 5
- 125000004076 pyridyl group Chemical group 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 230000002829 reductive effect Effects 0.000 description 5
- 108091008146 restriction endonucleases Proteins 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 4
- OGYGFUAIIOPWQD-UHFFFAOYSA-N 1,3-thiazolidine Chemical compound C1CSCN1 OGYGFUAIIOPWQD-UHFFFAOYSA-N 0.000 description 4
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 4
- 102000004862 Gastrin releasing peptide Human genes 0.000 description 4
- 108090001053 Gastrin releasing peptide Proteins 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- 239000000095 Growth Hormone-Releasing Hormone Substances 0.000 description 4
- 208000007976 Ketosis Diseases 0.000 description 4
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 4
- KSPIYJQBLVDRRI-UHFFFAOYSA-N N-methylisoleucine Chemical compound CCC(C)C(NC)C(O)=O KSPIYJQBLVDRRI-UHFFFAOYSA-N 0.000 description 4
- JCXJVPUVTGWSNB-UHFFFAOYSA-N Nitrogen dioxide Chemical compound O=[N]=O JCXJVPUVTGWSNB-UHFFFAOYSA-N 0.000 description 4
- 108010077895 Sarcosine Proteins 0.000 description 4
- 102100022831 Somatoliberin Human genes 0.000 description 4
- 101710142969 Somatoliberin Proteins 0.000 description 4
- 210000001744 T-lymphocyte Anatomy 0.000 description 4
- 150000007513 acids Chemical class 0.000 description 4
- 230000009471 action Effects 0.000 description 4
- 125000000304 alkynyl group Chemical group 0.000 description 4
- 235000009582 asparagine Nutrition 0.000 description 4
- 125000004429 atom Chemical group 0.000 description 4
- 210000000227 basophil cell of anterior lobe of hypophysis Anatomy 0.000 description 4
- 239000011230 binding agent Substances 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 4
- 238000004113 cell culture Methods 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 238000003776 cleavage reaction Methods 0.000 description 4
- 238000003745 diagnosis Methods 0.000 description 4
- 239000002552 dosage form Substances 0.000 description 4
- 239000012634 fragment Substances 0.000 description 4
- PUBCCFNQJQKCNC-XKNFJVFFSA-N gastrin-releasingpeptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)CNC(=O)[C@H](C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)C(C)C)[C@@H](C)O)C(C)C)[C@@H](C)O)C(C)C)C1=CNC=N1 PUBCCFNQJQKCNC-XKNFJVFFSA-N 0.000 description 4
- 230000004153 glucose metabolism Effects 0.000 description 4
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 4
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 4
- 239000003921 oil Substances 0.000 description 4
- 235000019198 oils Nutrition 0.000 description 4
- 238000006384 oligomerization reaction Methods 0.000 description 4
- 239000001301 oxygen Substances 0.000 description 4
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 4
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 4
- 235000019419 proteases Nutrition 0.000 description 4
- 125000006239 protecting group Chemical group 0.000 description 4
- 239000011541 reaction mixture Substances 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 230000002441 reversible effect Effects 0.000 description 4
- 229940043230 sarcosine Drugs 0.000 description 4
- 230000007017 scission Effects 0.000 description 4
- 230000003248 secreting effect Effects 0.000 description 4
- 238000004088 simulation Methods 0.000 description 4
- 150000003384 small molecules Chemical class 0.000 description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 238000010561 standard procedure Methods 0.000 description 4
- 239000000375 suspending agent Substances 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 230000009466 transformation Effects 0.000 description 4
- 235000002374 tyrosine Nutrition 0.000 description 4
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 3
- UTDVHCQTKWTQEA-UHFFFAOYSA-N 1-(2-aminoacetyl)-n-(4-methyl-2-oxochromen-7-yl)pyrrolidine-2-carboxamide Chemical compound C1=CC=2C(C)=CC(=O)OC=2C=C1NC(=O)C1CCCN1C(=O)CN UTDVHCQTKWTQEA-UHFFFAOYSA-N 0.000 description 3
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 description 3
- UFTCZKMBJOPXDM-UHFFFAOYSA-N 4-[[2-[[1-[[1-[[1-[[1-[[1-[[1-[[1-[[1-[[1-[[1-[[6-amino-1-[[5-amino-1-[[1-[[1-[[1-[[6-amino-1-[[6-amino-1-[[1-[[1-[[1-[[1-[[1-[[1-[[2-[[6-amino-1-[[1-[[1-[[6-amino-1-[[5-amino-1-[[1-[[1-[[6-amino-1-[[4-amino-1-[(1,6-diamino-1-oxohexan-2-yl)amino]-1,4-dioxobutan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-2-oxoethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-2-oxoethyl]amino]-3-[[2-[[2-amino-3-(1H-imidazol-4-yl)propanoyl]amino]-3-hydroxypropanoyl]amino]-4-oxobutanoic acid Chemical compound CCC(C)C(NC(=O)CNC(=O)C(CC(O)=O)NC(=O)C(CO)NC(=O)C(N)Cc1c[nH]cn1)C(=O)NC(Cc1ccccc1)C(=O)NC(C(C)O)C(=O)NC(CC(O)=O)C(=O)NC(CO)C(=O)NC(Cc1ccc(O)cc1)C(=O)NC(CO)C(=O)NC(CCCNC(N)=N)C(=O)NC(Cc1ccc(O)cc1)C(=O)NC(CCCNC(N)=N)C(=O)NC(CCCCN)C(=O)NC(CCC(N)=O)C(=O)NC(CCSC)C(=O)NC(C)C(=O)NC(C(C)C)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(Cc1ccc(O)cc1)C(=O)NC(CC(C)C)C(=O)NC(C)C(=O)NC(C)C(=O)NC(C(C)C)C(=O)NC(CC(C)C)C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CCCNC(N)=N)C(=O)NC(Cc1ccc(O)cc1)C(=O)NC(CCCCN)C(=O)NC(CCC(N)=O)C(=O)NC(CCCNC(N)=N)C(=O)NC(C(C)C)C(=O)NC(CCCCN)C(=O)NC(CC(N)=O)C(=O)NC(CCCCN)C(N)=O UFTCZKMBJOPXDM-UHFFFAOYSA-N 0.000 description 3
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 3
- 241000416162 Astragalus gummifer Species 0.000 description 3
- CSWXYCMUFSBCSU-QMIVBJSKSA-Q C/C=C(\C)CC(CO)N1C=C(/C(=C\C(CC)C/C=C(\C)CCCCCCC)C(O)O)C(C([O-])O)=C1.C=CC(C)CCCCCC/C(C)=C/C(C=C)/C(C)=C(/C=O)C1=CN(CC(=O)O)C=C1C(O)O.C=CCCC(CC)CCCC/C(C)=C/C/C(CC)=C(/CC[NH2+]C([NH3+])C[NH3+])C1=CN(CC(C)O)C=C1C(O)O.C=CCCCN1C=C(/C(=C\C(/C=C(\C)CCCCCC)C(C)C)CCNC(=O)C(=O)NC)C(C([O-])O)=C1 Chemical compound C/C=C(\C)CC(CO)N1C=C(/C(=C\C(CC)C/C=C(\C)CCCCCCC)C(O)O)C(C([O-])O)=C1.C=CC(C)CCCCCC/C(C)=C/C(C=C)/C(C)=C(/C=O)C1=CN(CC(=O)O)C=C1C(O)O.C=CCCC(CC)CCCC/C(C)=C/C/C(CC)=C(/CC[NH2+]C([NH3+])C[NH3+])C1=CN(CC(C)O)C=C1C(O)O.C=CCCCN1C=C(/C(=C\C(/C=C(\C)CCCCCC)C(C)C)CCNC(=O)C(=O)NC)C(C([O-])O)=C1 CSWXYCMUFSBCSU-QMIVBJSKSA-Q 0.000 description 3
- 241000701022 Cytomegalovirus Species 0.000 description 3
- 230000004568 DNA-binding Effects 0.000 description 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 108010070875 Human Immunodeficiency Virus tat Gene Products Proteins 0.000 description 3
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 3
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 3
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 3
- 240000007472 Leucaena leucocephala Species 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- AKCRVYNORCOYQT-YFKPBYRVSA-N N-methyl-L-valine Chemical compound CN[C@@H](C(C)C)C(O)=O AKCRVYNORCOYQT-YFKPBYRVSA-N 0.000 description 3
- 208000008589 Obesity Diseases 0.000 description 3
- 229920002684 Sepharose Polymers 0.000 description 3
- 229920002472 Starch Polymers 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 239000004473 Threonine Substances 0.000 description 3
- 229920001615 Tragacanth Polymers 0.000 description 3
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 3
- 239000007983 Tris buffer Substances 0.000 description 3
- 150000001298 alcohols Chemical class 0.000 description 3
- 150000001371 alpha-amino acids Chemical class 0.000 description 3
- QWCKQJZIFLGMSD-UHFFFAOYSA-N alpha-aminobutyric acid Chemical compound CCC(N)C(O)=O QWCKQJZIFLGMSD-UHFFFAOYSA-N 0.000 description 3
- 125000004103 aminoalkyl group Chemical group 0.000 description 3
- 238000010171 animal model Methods 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 235000009697 arginine Nutrition 0.000 description 3
- 150000001491 aromatic compounds Chemical class 0.000 description 3
- 229960001230 asparagine Drugs 0.000 description 3
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 3
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 description 3
- 125000005243 carbonyl alkyl group Chemical group 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- XVOYSCVBGLVSOL-UHFFFAOYSA-N cysteic acid Chemical compound OC(=O)C(N)CS(O)(=O)=O XVOYSCVBGLVSOL-UHFFFAOYSA-N 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 238000009826 distribution Methods 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 239000000284 extract Substances 0.000 description 3
- 125000000524 functional group Chemical group 0.000 description 3
- 230000009395 genetic defect Effects 0.000 description 3
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 3
- 235000004554 glutamine Nutrition 0.000 description 3
- 229910052736 halogen Inorganic materials 0.000 description 3
- 150000002367 halogens Chemical class 0.000 description 3
- 210000003494 hepatocyte Anatomy 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 3
- 235000014705 isoleucine Nutrition 0.000 description 3
- 229960000310 isoleucine Drugs 0.000 description 3
- 235000005772 leucine Nutrition 0.000 description 3
- 239000000314 lubricant Substances 0.000 description 3
- 235000018977 lysine Nutrition 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 229930182817 methionine Natural products 0.000 description 3
- 229920000609 methyl cellulose Polymers 0.000 description 3
- 239000001923 methylcellulose Substances 0.000 description 3
- 235000010981 methylcellulose Nutrition 0.000 description 3
- 229960002900 methylcellulose Drugs 0.000 description 3
- 239000000178 monomer Substances 0.000 description 3
- 235000020824 obesity Nutrition 0.000 description 3
- 125000005429 oxyalkyl group Chemical group 0.000 description 3
- 238000007911 parenteral administration Methods 0.000 description 3
- 239000010702 perfluoropolyether Substances 0.000 description 3
- 239000008363 phosphate buffer Substances 0.000 description 3
- UFTCZKMBJOPXDM-XXFCQBPRSA-N pituitary adenylate cyclase-activating polypeptide Chemical compound C([C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CN=CN1 UFTCZKMBJOPXDM-XXFCQBPRSA-N 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 230000008488 polyadenylation Effects 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 108010070701 procolipase Proteins 0.000 description 3
- 238000000159 protein binding assay Methods 0.000 description 3
- 230000006337 proteolytic cleavage Effects 0.000 description 3
- 150000003235 pyrrolidines Chemical class 0.000 description 3
- 125000000719 pyrrolidinyl group Chemical group 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 230000006641 stabilisation Effects 0.000 description 3
- 235000019698 starch Nutrition 0.000 description 3
- 238000006467 substitution reaction Methods 0.000 description 3
- 235000000346 sugar Nutrition 0.000 description 3
- 125000004001 thioalkyl group Chemical group 0.000 description 3
- 235000008521 threonine Nutrition 0.000 description 3
- 235000010487 tragacanth Nutrition 0.000 description 3
- 239000000196 tragacanth Substances 0.000 description 3
- 229940116362 tragacanth Drugs 0.000 description 3
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- 235000014393 valine Nutrition 0.000 description 3
- 239000004474 valine Substances 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- SAAQPSNNIOGFSQ-LURJTMIESA-N (2s)-2-(pyridin-4-ylamino)propanoic acid Chemical compound OC(=O)[C@H](C)NC1=CC=NC=C1 SAAQPSNNIOGFSQ-LURJTMIESA-N 0.000 description 2
- NPDBDJFLKKQMCM-SCSAIBSYSA-N (2s)-2-amino-3,3-dimethylbutanoic acid Chemical compound CC(C)(C)[C@H](N)C(O)=O NPDBDJFLKKQMCM-SCSAIBSYSA-N 0.000 description 2
- IMCMJLZQYAUSFW-IUCAKERBSA-N (2s,3s)-2-amino-3-methyl-1-pyrrolidin-1-ylpentan-1-one Chemical compound CC[C@H](C)[C@H](N)C(=O)N1CCCC1 IMCMJLZQYAUSFW-IUCAKERBSA-N 0.000 description 2
- 125000006552 (C3-C8) cycloalkyl group Chemical group 0.000 description 2
- 125000006763 (C3-C9) cycloalkyl group Chemical group 0.000 description 2
- JFMNKDRNEZZRBW-UHFFFAOYSA-N 1,2,3,4-tetrahydroisoquinoline-3-carboxamide Chemical class C1=CC=C2CNC(C(=O)N)CC2=C1 JFMNKDRNEZZRBW-UHFFFAOYSA-N 0.000 description 2
- YPTJKHVBDCRKNF-UHFFFAOYSA-N 2',6'-Dihydroxyacetophenone Chemical compound CC(=O)C1=C(O)C=CC=C1O YPTJKHVBDCRKNF-UHFFFAOYSA-N 0.000 description 2
- BLCJBICVQSYOIF-UHFFFAOYSA-N 2,2-diaminobutanoic acid Chemical compound CCC(N)(N)C(O)=O BLCJBICVQSYOIF-UHFFFAOYSA-N 0.000 description 2
- OMGHIGVFLOPEHJ-UHFFFAOYSA-N 2,5-dihydro-1h-pyrrol-1-ium-2-carboxylate Chemical compound OC(=O)C1NCC=C1 OMGHIGVFLOPEHJ-UHFFFAOYSA-N 0.000 description 2
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 2
- AUUIARVPJHGTSA-UHFFFAOYSA-N 3-(aminomethyl)chromen-2-one Chemical compound C1=CC=C2OC(=O)C(CN)=CC2=C1 AUUIARVPJHGTSA-UHFFFAOYSA-N 0.000 description 2
- ALYNCZNDIQEVRV-UHFFFAOYSA-N 4-aminobenzoic acid Chemical compound NC1=CC=C(C(O)=O)C=C1 ALYNCZNDIQEVRV-UHFFFAOYSA-N 0.000 description 2
- XWHHYOYVRVGJJY-QMMMGPOBSA-N 4-fluoro-L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(F)C=C1 XWHHYOYVRVGJJY-QMMMGPOBSA-N 0.000 description 2
- TYMLOMAKGOJONV-UHFFFAOYSA-N 4-nitroaniline Chemical compound NC1=CC=C([N+]([O-])=O)C=C1 TYMLOMAKGOJONV-UHFFFAOYSA-N 0.000 description 2
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 description 2
- ODHCTXKNWHHXJC-VKHMYHEASA-N 5-oxo-L-proline Chemical compound OC(=O)[C@@H]1CCC(=O)N1 ODHCTXKNWHHXJC-VKHMYHEASA-N 0.000 description 2
- ITZMJCSORYKOSI-AJNGGQMLSA-N APGPR Enterostatin Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N1[C@H](C(=O)N[C@@H](CCCN=C(N)N)C(O)=O)CCC1 ITZMJCSORYKOSI-AJNGGQMLSA-N 0.000 description 2
- 102000055025 Adenosine deaminases Human genes 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- 102100027936 Attractin Human genes 0.000 description 2
- 238000012935 Averaging Methods 0.000 description 2
- UAEPNZWRGJTJPN-UHFFFAOYSA-N CC1CCCCC1 Chemical compound CC1CCCCC1 UAEPNZWRGJTJPN-UHFFFAOYSA-N 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 208000024172 Cardiovascular disease Diseases 0.000 description 2
- YXFVVABEGXRONW-UHFFFAOYSA-N Cc1ccccc1 Chemical compound Cc1ccccc1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 102000006573 Chemokine CXCL12 Human genes 0.000 description 2
- 108010008951 Chemokine CXCL12 Proteins 0.000 description 2
- 241000965483 Darksidea zeta Species 0.000 description 2
- 102100020751 Dipeptidyl peptidase 2 Human genes 0.000 description 2
- 229940124213 Dipeptidyl peptidase 4 (DPP IV) inhibitor Drugs 0.000 description 2
- 241001504495 Erithacus Species 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- NIGWMJHCCYYCSF-UHFFFAOYSA-N Fenclonine Chemical compound OC(=O)C(N)CC1=CC=C(Cl)C=C1 NIGWMJHCCYYCSF-UHFFFAOYSA-N 0.000 description 2
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 108010024636 Glutathione Proteins 0.000 description 2
- 239000007995 HEPES buffer Substances 0.000 description 2
- LYCVKHSJGDMDLM-LURJTMIESA-N His-Gly Chemical compound OC(=O)CNC(=O)[C@@H](N)CC1=CN=CN1 LYCVKHSJGDMDLM-LURJTMIESA-N 0.000 description 2
- 101000967820 Homo sapiens Inactive dipeptidyl peptidase 10 Proteins 0.000 description 2
- 102100040449 Inactive dipeptidyl peptidase 10 Human genes 0.000 description 2
- 206010023379 Ketoacidosis Diseases 0.000 description 2
- 241000235058 Komagataella pastoris Species 0.000 description 2
- 150000008575 L-amino acids Chemical class 0.000 description 2
- JTTHKOPSMAVJFE-VIFPVBQESA-N L-homophenylalanine Chemical compound OC(=O)[C@@H](N)CCC1=CC=CC=C1 JTTHKOPSMAVJFE-VIFPVBQESA-N 0.000 description 2
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical compound OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 2
- QEFRNWWLZKMPFJ-ZXPFJRLXSA-N L-methionine (R)-S-oxide Chemical compound C[S@@](=O)CC[C@H]([NH3+])C([O-])=O QEFRNWWLZKMPFJ-ZXPFJRLXSA-N 0.000 description 2
- QEFRNWWLZKMPFJ-UHFFFAOYSA-N L-methionine sulphoxide Natural products CS(=O)CCC(N)C(O)=O QEFRNWWLZKMPFJ-UHFFFAOYSA-N 0.000 description 2
- SNDPXSYFESPGGJ-UHFFFAOYSA-N L-norVal-OH Natural products CCCC(N)C(O)=O SNDPXSYFESPGGJ-UHFFFAOYSA-N 0.000 description 2
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 2
- GHSJKUNUIHUPDF-BYPYZUCNSA-N L-thialysine Chemical compound NCCSC[C@H](N)C(O)=O GHSJKUNUIHUPDF-BYPYZUCNSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- IDGQXGPQOGUGIX-VIFPVBQESA-N O-BENZYL-l-SERINE Chemical compound OC(=O)[C@@H](N)COCC1=CC=CC=C1 IDGQXGPQOGUGIX-VIFPVBQESA-N 0.000 description 2
- BZQFBWGGLXLEPQ-UHFFFAOYSA-N O-phosphoserine Chemical compound OC(=O)C(N)COP(O)(O)=O BZQFBWGGLXLEPQ-UHFFFAOYSA-N 0.000 description 2
- 102000002512 Orexin Human genes 0.000 description 2
- CXOFVDLJLONNDW-UHFFFAOYSA-N Phenytoin Chemical compound N1C(=O)NC(=O)C1(C=1C=CC=CC=1)C1=CC=CC=C1 CXOFVDLJLONNDW-UHFFFAOYSA-N 0.000 description 2
- 208000004880 Polyuria Diseases 0.000 description 2
- 101710149951 Protein Tat Proteins 0.000 description 2
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 2
- ODHCTXKNWHHXJC-GSVOUGTGSA-N Pyroglutamic acid Natural products OC(=O)[C@H]1CCC(=O)N1 ODHCTXKNWHHXJC-GSVOUGTGSA-N 0.000 description 2
- 108700008625 Reporter Genes Proteins 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 102000012479 Serine Proteases Human genes 0.000 description 2
- 108010022999 Serine Proteases Proteins 0.000 description 2
- 108010090804 Streptavidin Proteins 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 108010027252 Trypsinogen Proteins 0.000 description 2
- 102000018690 Trypsinogen Human genes 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- NHXZRXLFOBFMDM-AVGNSLFASA-N Val-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)C(C)C NHXZRXLFOBFMDM-AVGNSLFASA-N 0.000 description 2
- ROSDSFDQCJNGOL-UHFFFAOYSA-N [H]N(C)C Chemical compound [H]N(C)C ROSDSFDQCJNGOL-UHFFFAOYSA-N 0.000 description 2
- 230000005856 abnormality Effects 0.000 description 2
- 229940081735 acetylcellulose Drugs 0.000 description 2
- ODHCTXKNWHHXJC-UHFFFAOYSA-N acide pyroglutamique Natural products OC(=O)C1CCC(=O)N1 ODHCTXKNWHHXJC-UHFFFAOYSA-N 0.000 description 2
- 230000010933 acylation Effects 0.000 description 2
- 238000005917 acylation reaction Methods 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- 235000010419 agar Nutrition 0.000 description 2
- 125000004183 alkoxy alkyl group Chemical group 0.000 description 2
- 230000003281 allosteric effect Effects 0.000 description 2
- 150000001370 alpha-amino acid derivatives Chemical class 0.000 description 2
- 238000005571 anion exchange chromatography Methods 0.000 description 2
- 230000002547 anomalous effect Effects 0.000 description 2
- RWZYAGGXGHYGMB-UHFFFAOYSA-N anthranilic acid Chemical compound NC1=CC=CC=C1C(O)=O RWZYAGGXGHYGMB-UHFFFAOYSA-N 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 239000007900 aqueous suspension Substances 0.000 description 2
- 239000012300 argon atmosphere Substances 0.000 description 2
- 230000004888 barrier function Effects 0.000 description 2
- 230000006399 behavior Effects 0.000 description 2
- 230000006287 biotinylation Effects 0.000 description 2
- 238000007413 biotinylation Methods 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 229910052794 bromium Inorganic materials 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 238000005515 capillary zone electrophoresis Methods 0.000 description 2
- 230000003915 cell function Effects 0.000 description 2
- 229920002301 cellulose acetate Polymers 0.000 description 2
- IAWMQYIXAKXMGI-GIJPRFPSSA-N chembl501240 Chemical compound C([C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(N)=O)C1=CN=CN1 IAWMQYIXAKXMGI-GIJPRFPSSA-N 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 229910052801 chlorine Inorganic materials 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 239000003086 colorant Substances 0.000 description 2
- 230000002860 competitive effect Effects 0.000 description 2
- 230000009918 complex formation Effects 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 230000007812 deficiency Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- YSMODUONRAFBET-UHFFFAOYSA-N delta-DL-hydroxylysine Natural products NCC(O)CCC(N)C(O)=O YSMODUONRAFBET-UHFFFAOYSA-N 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 239000003603 dipeptidyl peptidase IV inhibitor Substances 0.000 description 2
- ZUOUZKKEUPVFJK-UHFFFAOYSA-N diphenyl Chemical compound C1=CC=CC=C1C1=CC=CC=C1 ZUOUZKKEUPVFJK-UHFFFAOYSA-N 0.000 description 2
- 108010054813 diprotin B Proteins 0.000 description 2
- 239000002270 dispersing agent Substances 0.000 description 2
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 2
- 238000009510 drug design Methods 0.000 description 2
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000012055 enteric layer Substances 0.000 description 2
- 238000001952 enzyme assay Methods 0.000 description 2
- 150000002148 esters Chemical class 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 235000003599 food sweetener Nutrition 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 210000004907 gland Anatomy 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 229960003180 glutathione Drugs 0.000 description 2
- 230000002641 glycemic effect Effects 0.000 description 2
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 108010036413 histidylglycine Proteins 0.000 description 2
- 238000000265 homogenisation Methods 0.000 description 2
- 150000004677 hydrates Chemical class 0.000 description 2
- 125000001165 hydrophobic group Chemical group 0.000 description 2
- 229960002591 hydroxyproline Drugs 0.000 description 2
- 125000001841 imino group Chemical group [H]N=* 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 229910052740 iodine Inorganic materials 0.000 description 2
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 2
- 230000004140 ketosis Effects 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 235000019359 magnesium stearate Nutrition 0.000 description 2
- 238000007726 management method Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- 210000000110 microvilli Anatomy 0.000 description 2
- 150000007522 mineralic acids Chemical class 0.000 description 2
- 229920001206 natural gum Polymers 0.000 description 2
- 239000006225 natural substrate Substances 0.000 description 2
- 108060005714 orexin Proteins 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 230000003647 oxidation Effects 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 230000035778 pathophysiological process Effects 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N phenol group Chemical group C1(=CC=CC=C1)O ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- XHXFXVLFKHQFAL-UHFFFAOYSA-N phosphoryl trichloride Chemical compound ClP(Cl)(Cl)=O XHXFXVLFKHQFAL-UHFFFAOYSA-N 0.000 description 2
- 206010036067 polydipsia Diseases 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 239000011148 porous material Substances 0.000 description 2
- 238000011533 pre-incubation Methods 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 230000035935 pregnancy Effects 0.000 description 2
- 238000002953 preparative HPLC Methods 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 230000002797 proteolythic effect Effects 0.000 description 2
- NGVDGCNFYWLIFO-UHFFFAOYSA-N pyridoxal 5'-phosphate Chemical compound CC1=NC=C(COP(O)(O)=O)C(C=O)=C1O NGVDGCNFYWLIFO-UHFFFAOYSA-N 0.000 description 2
- QJRYYOWARFCJQZ-UHFFFAOYSA-N pyrrolidine-1-carbonitrile Chemical compound N#CN1CCCC1 QJRYYOWARFCJQZ-UHFFFAOYSA-N 0.000 description 2
- 230000001850 reproductive effect Effects 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 125000006413 ring segment Chemical group 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 2
- 229910000162 sodium phosphate Inorganic materials 0.000 description 2
- 235000011008 sodium phosphates Nutrition 0.000 description 2
- 239000012453 solvate Substances 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 125000001424 substituent group Chemical group 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-L sulfate group Chemical group S(=O)(=O)([O-])[O-] QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 239000003765 sweetening agent Substances 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 2
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 2
- 208000035408 type 1 diabetes mellitus 1 Diseases 0.000 description 2
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 238000000108 ultra-filtration Methods 0.000 description 2
- 239000002691 unilamellar liposome Substances 0.000 description 2
- SYOKIDBDQMKNDQ-XWTIBIIYSA-N vildagliptin Chemical compound C1C(O)(C2)CC(C3)CC1CC32NCC(=O)N1CCC[C@H]1C#N SYOKIDBDQMKNDQ-XWTIBIIYSA-N 0.000 description 2
- 230000004580 weight loss Effects 0.000 description 2
- AHBLWCWWXZJIIR-UHFFFAOYSA-N (1-cyclohexyl-3,3-dimethyl-1-oxobutan-2-yl)azanium;chloride Chemical compound [Cl-].CC(C)(C)C([NH3+])C(=O)C1CCCCC1 AHBLWCWWXZJIIR-UHFFFAOYSA-N 0.000 description 1
- OIFZBOXCSQOOQR-UHFFFAOYSA-N (1-cyclopentyl-3,3-dimethyl-1-oxobutan-2-yl)azanium;chloride Chemical compound [Cl-].CC(C)(C)C([NH3+])C(=O)C1CCCC1 OIFZBOXCSQOOQR-UHFFFAOYSA-N 0.000 description 1
- NGHKPFDSWWVQRM-UHFFFAOYSA-N (1-cyclopentyl-3-methyl-1-oxobutan-2-yl)azanium;chloride Chemical compound [Cl-].CC(C)C([NH3+])C(=O)C1CCCC1 NGHKPFDSWWVQRM-UHFFFAOYSA-N 0.000 description 1
- QOMLWUOJCBLHPI-UHFFFAOYSA-N (1-cyclopentyl-3-methyl-1-oxopentan-2-yl)azanium;chloride Chemical compound [Cl-].CCC(C)C([NH3+])C(=O)C1CCCC1 QOMLWUOJCBLHPI-UHFFFAOYSA-N 0.000 description 1
- QDZOEBFLNHCSSF-PFFBOGFISA-N (2S)-2-[[(2R)-2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-1-[(2R)-2-amino-5-carbamimidamidopentanoyl]pyrrolidine-2-carbonyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-N-[(2R)-1-[[(2S)-1-[[(2R)-1-[[(2S)-1-[[(2S)-1-amino-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]pentanediamide Chemical compound C([C@@H](C(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](N)CCCNC(N)=N)C1=CC=CC=C1 QDZOEBFLNHCSSF-PFFBOGFISA-N 0.000 description 1
- JNTMAZFVYNDPLB-PEDHHIEDSA-N (2S,3S)-2-[[[(2S)-1-[(2S,3S)-2-amino-3-methyl-1-oxopentyl]-2-pyrrolidinyl]-oxomethyl]amino]-3-methylpentanoic acid Chemical compound CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(O)=O JNTMAZFVYNDPLB-PEDHHIEDSA-N 0.000 description 1
- JJVXHDTWVIPRBZ-VKHMYHEASA-N (2r)-2-[carboxy(methyl)amino]-3-sulfanylpropanoic acid Chemical compound OC(=O)N(C)[C@@H](CS)C(O)=O JJVXHDTWVIPRBZ-VKHMYHEASA-N 0.000 description 1
- FDKWRPBBCBCIGA-REOHCLBHSA-N (2r)-2-azaniumyl-3-$l^{1}-selanylpropanoate Chemical compound [Se]C[C@H](N)C(O)=O FDKWRPBBCBCIGA-REOHCLBHSA-N 0.000 description 1
- CMIBUZBMZCBCAT-HZPDHXFCSA-N (2r,3r)-2,3-bis[(4-methylbenzoyl)oxy]butanedioic acid Chemical compound C1=CC(C)=CC=C1C(=O)O[C@@H](C(O)=O)[C@H](C(O)=O)OC(=O)C1=CC=C(C)C=C1 CMIBUZBMZCBCAT-HZPDHXFCSA-N 0.000 description 1
- CCKKROBXZIZREN-DTWKUNHWSA-N (2r,3r)-3-phenylazetidine-2-carboxylic acid Chemical compound OC(=O)[C@@H]1NC[C@H]1C1=CC=CC=C1 CCKKROBXZIZREN-DTWKUNHWSA-N 0.000 description 1
- XGNBIYXILDDDQR-DTWKUNHWSA-N (2s)-1-[(2s)-2-amino-3,3-dimethylbutanoyl]pyrrolidine-2-carbonitrile Chemical compound CC(C)(C)[C@H](N)C(=O)N1CCC[C@H]1C#N XGNBIYXILDDDQR-DTWKUNHWSA-N 0.000 description 1
- PQFUJTFHVDWNOF-STQMWFEESA-N (2s)-1-[(2s)-2-amino-3-(4-iodophenyl)propanoyl]pyrrolidine-2-carbonitrile Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C#N)C1=CC=C(I)C=C1 PQFUJTFHVDWNOF-STQMWFEESA-N 0.000 description 1
- FQRURPFZTFUXEZ-MRVPVSSYSA-N (2s)-2,3,3,3-tetrafluoro-2-(n-fluoroanilino)propanoic acid Chemical compound OC(=O)[C@](F)(C(F)(F)F)N(F)C1=CC=CC=C1 FQRURPFZTFUXEZ-MRVPVSSYSA-N 0.000 description 1
- BVAUMRCGVHUWOZ-ZETCQYMHSA-N (2s)-2-(cyclohexylazaniumyl)propanoate Chemical compound OC(=O)[C@H](C)NC1CCCCC1 BVAUMRCGVHUWOZ-ZETCQYMHSA-N 0.000 description 1
- SAUDSWFPPKSVMK-LBPRGKRZSA-N (2s)-2-(n-phenylanilino)propanoic acid Chemical compound C=1C=CC=CC=1N([C@@H](C)C(O)=O)C1=CC=CC=C1 SAUDSWFPPKSVMK-LBPRGKRZSA-N 0.000 description 1
- WTKYBFQVZPCGAO-LURJTMIESA-N (2s)-2-(pyridin-3-ylamino)propanoic acid Chemical compound OC(=O)[C@H](C)NC1=CC=CN=C1 WTKYBFQVZPCGAO-LURJTMIESA-N 0.000 description 1
- MRTPISKDZDHEQI-YFKPBYRVSA-N (2s)-2-(tert-butylamino)propanoic acid Chemical compound OC(=O)[C@H](C)NC(C)(C)C MRTPISKDZDHEQI-YFKPBYRVSA-N 0.000 description 1
- PEMUHKUIQHFMTH-QMMMGPOBSA-N (2s)-2-amino-3-(4-bromophenyl)propanoic acid Chemical compound OC(=O)[C@@H](N)CC1=CC=C(Br)C=C1 PEMUHKUIQHFMTH-QMMMGPOBSA-N 0.000 description 1
- DQLHSFUMICQIMB-VIFPVBQESA-N (2s)-2-amino-3-(4-methylphenyl)propanoic acid Chemical compound CC1=CC=C(C[C@H](N)C(O)=O)C=C1 DQLHSFUMICQIMB-VIFPVBQESA-N 0.000 description 1
- FYMNTAQFDTZISY-QMMMGPOBSA-N (2s)-2-amino-3-[4-(diaminomethylideneamino)phenyl]propanoic acid Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N=C(N)N)C=C1 FYMNTAQFDTZISY-QMMMGPOBSA-N 0.000 description 1
- PDRJLZDUOULRHE-ZETCQYMHSA-N (2s)-2-amino-3-pyridin-2-ylpropanoic acid Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=N1 PDRJLZDUOULRHE-ZETCQYMHSA-N 0.000 description 1
- XHAJSSKNZHGORJ-SAJNASKISA-N (2s)-2-amino-n-[(2s)-1-[(2s)-2-(1,3-benzothiazole-2-carbonyl)pyrrolidin-1-yl]-3-methyl-1-oxobutan-2-yl]propanamide;2,2,2-trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)C1=NC2=CC=CC=C2S1 XHAJSSKNZHGORJ-SAJNASKISA-N 0.000 description 1
- GEIXJNSDCIKYHU-IXDGSTSKSA-N (2s)-2-amino-n-[(2s)-1-[(2s)-2-[2-[(2,6-dichlorophenyl)methylsulfanyl]acetyl]pyrrolidin-1-yl]-3-methyl-1-oxobutan-2-yl]propanamide Chemical compound C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)CSCC1=C(Cl)C=CC=C1Cl GEIXJNSDCIKYHU-IXDGSTSKSA-N 0.000 description 1
- AYEVWCRIXBNNME-LFELFHSZSA-N (2s)-2-amino-n-[(2s)-3-methyl-1-oxo-1-[(2s)-2-(1,3-thiazole-2-carbonyl)pyrrolidin-1-yl]butan-2-yl]propanamide;2,2,2-trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)C1=NC=CS1 AYEVWCRIXBNNME-LFELFHSZSA-N 0.000 description 1
- QFKUSGBKEGSBMQ-XJPBFQKESA-N (2s)-2-amino-n-[(2s)-3-methyl-1-oxo-1-[(2s)-2-(pyridine-2-carbonyl)pyrrolidin-1-yl]butan-2-yl]propanamide;2,2,2-trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)C1=CC=CC=N1 QFKUSGBKEGSBMQ-XJPBFQKESA-N 0.000 description 1
- ZRGFWRVNUPJBTR-JGAZGGJJSA-N (2s)-2-amino-n-[2-[(2s)-2-(1,3-benzothiazole-2-carbonyl)pyrrolidin-1-yl]-2-oxoethyl]propanamide;2,2,2-trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.C[C@H](N)C(=O)NCC(=O)N1CCC[C@H]1C(=O)C1=NC2=CC=CC=C2S1 ZRGFWRVNUPJBTR-JGAZGGJJSA-N 0.000 description 1
- FSJGGDNXBAWPGS-VKHMYHEASA-N (2s)-5-amino-2-(carboxyamino)-5-oxopentanoic acid Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(O)=O FSJGGDNXBAWPGS-VKHMYHEASA-N 0.000 description 1
- VCODUTUPBPSXRA-LBRAPMIBSA-N (2s)-n-[(2s)-1-[(2s)-2-acetylpyrrolidin-1-yl]-3-methyl-1-oxobutan-2-yl]-2-aminopropanamide;hydrobromide Chemical compound Br.C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(C)=O VCODUTUPBPSXRA-LBRAPMIBSA-N 0.000 description 1
- LOGFVTREOLYCPF-KXNHARMFSA-N (2s,3r)-2-[[(2r)-1-[(2s)-2,6-diaminohexanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxybutanoic acid Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H]1CCCN1C(=O)[C@@H](N)CCCCN LOGFVTREOLYCPF-KXNHARMFSA-N 0.000 description 1
- ARNUPLMOASAEAN-ASLNEKEESA-N (2s,3s)-2-amino-3-methyl-1-(1,3-thiazolidin-2-yl)pentan-1-one Chemical compound CC[C@H](C)[C@H](N)C(=O)C1NCCS1 ARNUPLMOASAEAN-ASLNEKEESA-N 0.000 description 1
- LJRDOKAZOAKLDU-UDXJMMFXSA-N (2s,3s,4r,5r,6r)-5-amino-2-(aminomethyl)-6-[(2r,3s,4r,5s)-5-[(1r,2r,3s,5r,6s)-3,5-diamino-2-[(2s,3r,4r,5s,6r)-3-amino-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-hydroxycyclohexyl]oxy-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl]oxyoxane-3,4-diol;sulfuric ac Chemical compound OS(O)(=O)=O.N[C@@H]1[C@@H](O)[C@H](O)[C@H](CN)O[C@@H]1O[C@H]1[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](N)C[C@@H](N)[C@@H]2O)O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)N)O[C@@H]1CO LJRDOKAZOAKLDU-UDXJMMFXSA-N 0.000 description 1
- RICKQPKTSOSCOF-HKUYNNGSSA-N (3s)-2-[(2s)-2-amino-3-(1h-indol-3-yl)propanoyl]-3,4-dihydro-1h-isoquinoline-3-carboxylic acid Chemical compound C1C2=CC=CC=C2C[C@@H](C(O)=O)N1C(=O)[C@@H](N)CC1=CNC2=CC=CC=C12 RICKQPKTSOSCOF-HKUYNNGSSA-N 0.000 description 1
- FAAZAHIRCXGFFM-ZETCQYMHSA-N (4s)-4-amino-5-oxo-5-pyrrolidin-1-ylpentanamide Chemical compound NC(=O)CC[C@H](N)C(=O)N1CCCC1 FAAZAHIRCXGFFM-ZETCQYMHSA-N 0.000 description 1
- 125000002861 (C1-C4) alkanoyl group Chemical group 0.000 description 1
- 125000006823 (C1-C6) acyl group Chemical group 0.000 description 1
- 125000004191 (C1-C6) alkoxy group Chemical group 0.000 description 1
- 125000006652 (C3-C12) cycloalkyl group Chemical group 0.000 description 1
- OXFGRWIKQDSSLY-UHFFFAOYSA-N 1,2,3,4-tetrahydroisoquinolin-2-ium-1-carboxylate Chemical compound C1=CC=C2C(C(=O)O)NCCC2=C1 OXFGRWIKQDSSLY-UHFFFAOYSA-N 0.000 description 1
- 238000001644 13C nuclear magnetic resonance spectroscopy Methods 0.000 description 1
- 238000005160 1H NMR spectroscopy Methods 0.000 description 1
- MAEDLSNGVQYGPK-UHFFFAOYSA-N 2,2-diaminoacetic acid Chemical compound NC(N)C(O)=O MAEDLSNGVQYGPK-UHFFFAOYSA-N 0.000 description 1
- MKFDYOISVJDNKS-UHFFFAOYSA-N 2-(2,3-dihydro-1h-inden-1-ylamino)acetic acid Chemical compound C1=CC=C2C(NCC(=O)O)CCC2=C1 MKFDYOISVJDNKS-UHFFFAOYSA-N 0.000 description 1
- OUWIVCMEYBVEHT-UHFFFAOYSA-N 2-(cyclohexylamino)-1-cyclopentylethanone;hydrochloride Chemical compound [Cl-].C1CCCC1C(=O)C[NH2+]C1CCCCC1 OUWIVCMEYBVEHT-UHFFFAOYSA-N 0.000 description 1
- IHBAVXVTGLANPI-QMMMGPOBSA-N 2-amino-3-methyl-1-pyrrolidin-1-yl-butan-1-one Chemical compound CC(C)[C@H](N)C(=O)N1CCCC1 IHBAVXVTGLANPI-QMMMGPOBSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- JINGUCXQUOKWKH-UHFFFAOYSA-N 2-aminodecanoic acid Chemical compound CCCCCCCCC(N)C(O)=O JINGUCXQUOKWKH-UHFFFAOYSA-N 0.000 description 1
- QUBNFZFTFXTLKH-UHFFFAOYSA-N 2-aminododecanoic acid Chemical compound CCCCCCCCCCC(N)C(O)=O QUBNFZFTFXTLKH-UHFFFAOYSA-N 0.000 description 1
- AKVBCGQVQXPRLD-UHFFFAOYSA-N 2-aminooctanoic acid Chemical compound CCCCCCC(N)C(O)=O AKVBCGQVQXPRLD-UHFFFAOYSA-N 0.000 description 1
- HASUJDLTAYUWCO-UHFFFAOYSA-N 2-aminoundecanoic acid Chemical compound CCCCCCCCCC(N)C(O)=O HASUJDLTAYUWCO-UHFFFAOYSA-N 0.000 description 1
- CDULPPOISZOUTK-UHFFFAOYSA-N 2-azaniumyl-3,4-dihydro-1h-naphthalene-2-carboxylate Chemical compound C1=CC=C2CC(N)(C(O)=O)CCC2=C1 CDULPPOISZOUTK-UHFFFAOYSA-N 0.000 description 1
- CVZZNRXMDCOHBG-UHFFFAOYSA-N 2-azaniumyl-3-(2-chlorophenyl)propanoate Chemical compound OC(=O)C(N)CC1=CC=CC=C1Cl CVZZNRXMDCOHBG-UHFFFAOYSA-N 0.000 description 1
- OFYAYGJCPXRNBL-UHFFFAOYSA-N 2-azaniumyl-3-naphthalen-1-ylpropanoate Chemical compound C1=CC=C2C(CC(N)C(O)=O)=CC=CC2=C1 OFYAYGJCPXRNBL-UHFFFAOYSA-N 0.000 description 1
- AJHPGXZOIAYYDW-UHFFFAOYSA-N 3-(2-cyanophenyl)-2-[(2-methylpropan-2-yl)oxycarbonylamino]propanoic acid Chemical compound CC(C)(C)OC(=O)NC(C(O)=O)CC1=CC=CC=C1C#N AJHPGXZOIAYYDW-UHFFFAOYSA-N 0.000 description 1
- PECYZEOJVXMISF-UHFFFAOYSA-N 3-aminoalanine Chemical compound [NH3+]CC(N)C([O-])=O PECYZEOJVXMISF-UHFFFAOYSA-N 0.000 description 1
- JJDJLFDGCUYZMN-QMMMGPOBSA-N 3-chloro-L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC(Cl)=C1 JJDJLFDGCUYZMN-QMMMGPOBSA-N 0.000 description 1
- BXRLWGXPSRYJDZ-UHFFFAOYSA-N 3-cyanoalanine Chemical compound OC(=O)C(N)CC#N BXRLWGXPSRYJDZ-UHFFFAOYSA-N 0.000 description 1
- SDCMHPPKMQZPPJ-UHFFFAOYSA-N 3-phenyl-4h-quinazoline Chemical compound C1=NC2=CC=CC=C2CN1C1=CC=CC=C1 SDCMHPPKMQZPPJ-UHFFFAOYSA-N 0.000 description 1
- ZDANNTCOEBVONU-UHFFFAOYSA-N 4-amino-3-methyl-1h-pyrrole-2-carboxylic acid Chemical compound CC=1C(N)=CNC=1C(O)=O ZDANNTCOEBVONU-UHFFFAOYSA-N 0.000 description 1
- CMUHFUGDYMFHEI-QMMMGPOBSA-N 4-amino-L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N)C=C1 CMUHFUGDYMFHEI-QMMMGPOBSA-N 0.000 description 1
- SHINASQYHDCLEU-UHFFFAOYSA-N 4-aminopyrrolidine-2-carboxylic acid Chemical compound NC1CNC(C(O)=O)C1 SHINASQYHDCLEU-UHFFFAOYSA-N 0.000 description 1
- GTVVZTAFGPQSPC-UHFFFAOYSA-N 4-nitrophenylalanine Chemical compound OC(=O)C(N)CC1=CC=C([N+]([O-])=O)C=C1 GTVVZTAFGPQSPC-UHFFFAOYSA-N 0.000 description 1
- HFXAFXVXPMUQCQ-BYPYZUCNSA-N 4-oxo-L-proline Chemical compound OC(=O)[C@@H]1CC(=O)CN1 HFXAFXVXPMUQCQ-BYPYZUCNSA-N 0.000 description 1
- JHHOFXBPLJDHOR-UHFFFAOYSA-N 4-phenylpyrrolidin-1-ium-2-carboxylate Chemical compound C1NC(C(=O)O)CC1C1=CC=CC=C1 JHHOFXBPLJDHOR-UHFFFAOYSA-N 0.000 description 1
- SMWADGDVGCZIGK-UHFFFAOYSA-N 5-phenylpyrrolidin-1-ium-2-carboxylate Chemical compound N1C(C(=O)O)CCC1C1=CC=CC=C1 SMWADGDVGCZIGK-UHFFFAOYSA-N 0.000 description 1
- VFFZWMWTUSXDCB-ZDUSSCGKSA-N 6-[2-[[2-[(2s)-2-cyanopyrrolidin-1-yl]-2-oxoethyl]amino]ethylamino]pyridine-3-carbonitrile Chemical compound N1([C@@H](CCC1)C#N)C(=O)CNCCNC1=CC=C(C#N)C=N1 VFFZWMWTUSXDCB-ZDUSSCGKSA-N 0.000 description 1
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical compound NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 1
- OLUWXTFAPJJWPL-YFKPBYRVSA-N 6-hydroxy-l-norleucine Chemical compound OC(=O)[C@@H](N)CCCCO OLUWXTFAPJJWPL-YFKPBYRVSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- 230000005730 ADP ribosylation Effects 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 206010000599 Acromegaly Diseases 0.000 description 1
- HRPVXLWXLXDGHG-UHFFFAOYSA-N Acrylamide Chemical compound NC(=O)C=C HRPVXLWXLXDGHG-UHFFFAOYSA-N 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 102000004400 Aminopeptidases Human genes 0.000 description 1
- 108090000915 Aminopeptidases Proteins 0.000 description 1
- 108010039627 Aprotinin Proteins 0.000 description 1
- FFMIYIMKQIMDPK-BQBZGAKWSA-N Asn-His Chemical group NC(=O)C[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 FFMIYIMKQIMDPK-BQBZGAKWSA-N 0.000 description 1
- 206010003594 Ataxia telangiectasia Diseases 0.000 description 1
- 101710134735 Attractin Proteins 0.000 description 1
- 208000035404 Autolysis Diseases 0.000 description 1
- 210000002237 B-cell of pancreatic islet Anatomy 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- GUBGYTABKSRVRQ-DCSYEGIMSA-N Beta-Lactose Chemical compound OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-DCSYEGIMSA-N 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 238000009010 Bradford assay Methods 0.000 description 1
- 101800004538 Bradykinin Proteins 0.000 description 1
- 102400000967 Bradykinin Human genes 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- YNXLOPYTAAFMTN-SBUIBGKBSA-N C([C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)C1=CC=C(O)C=C1 Chemical compound C([C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)C1=CC=C(O)C=C1 YNXLOPYTAAFMTN-SBUIBGKBSA-N 0.000 description 1
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 1
- 101710155857 C-C motif chemokine 2 Proteins 0.000 description 1
- 102100032367 C-C motif chemokine 5 Human genes 0.000 description 1
- 102100032366 C-C motif chemokine 7 Human genes 0.000 description 1
- 101710155834 C-C motif chemokine 7 Proteins 0.000 description 1
- 102100034871 C-C motif chemokine 8 Human genes 0.000 description 1
- 101710155833 C-C motif chemokine 8 Proteins 0.000 description 1
- 102100036153 C-X-C motif chemokine 6 Human genes 0.000 description 1
- 101710085504 C-X-C motif chemokine 6 Proteins 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- OBMZMSLWNNWEJA-XNCRXQDQSA-N C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 Chemical compound C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 OBMZMSLWNNWEJA-XNCRXQDQSA-N 0.000 description 1
- 125000006374 C2-C10 alkenyl group Chemical group 0.000 description 1
- 125000000882 C2-C6 alkenyl group Chemical group 0.000 description 1
- 125000003601 C2-C6 alkynyl group Chemical group 0.000 description 1
- BMILLJORICKAPA-TXOOBNKBSA-N CC(=O)/C=C(\C)N(C)C.CN(C)C.CN=C(C)C Chemical compound CC(=O)/C=C(\C)N(C)C.CN(C)C.CN=C(C)C BMILLJORICKAPA-TXOOBNKBSA-N 0.000 description 1
- GDOPTJXRTPNYNR-UHFFFAOYSA-N CC1CCCC1 Chemical compound CC1CCCC1 GDOPTJXRTPNYNR-UHFFFAOYSA-N 0.000 description 1
- GETQZCLCWQTVFV-UHFFFAOYSA-N CN(C)C Chemical compound CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 1
- 101100533230 Caenorhabditis elegans ser-2 gene Proteins 0.000 description 1
- 102000003846 Carbonic anhydrases Human genes 0.000 description 1
- 108090000209 Carbonic anhydrases Proteins 0.000 description 1
- 206010057248 Cell death Diseases 0.000 description 1
- 108010055166 Chemokine CCL5 Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 101800001982 Cholecystokinin Proteins 0.000 description 1
- 102100025841 Cholecystokinin Human genes 0.000 description 1
- 102000011022 Chorionic Gonadotropin Human genes 0.000 description 1
- 108010062540 Chorionic Gonadotropin Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 208000003606 Congenital Rubella Syndrome Diseases 0.000 description 1
- 206010010619 Congenital rubella infection Diseases 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 108010067110 Corticotropin-Like Intermediate Lobe Peptide Proteins 0.000 description 1
- 201000003883 Cystic fibrosis Diseases 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FDKWRPBBCBCIGA-UWTATZPHSA-N D-Selenocysteine Natural products [Se]C[C@@H](N)C(O)=O FDKWRPBBCBCIGA-UWTATZPHSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-UHFFFAOYSA-N D-alpha-Ala Natural products CC([NH3+])C([O-])=O QNAYBMKLOCPYGJ-UHFFFAOYSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- JDMUPRLRUUMCTL-VIFPVBQESA-N D-pantetheine 4'-phosphate Chemical compound OP(=O)(O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCS JDMUPRLRUUMCTL-VIFPVBQESA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- UQBOJOOOTLPNST-UHFFFAOYSA-N Dehydroalanine Chemical compound NC(=C)C(O)=O UQBOJOOOTLPNST-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 1
- 102100036966 Dipeptidyl aminopeptidase-like protein 6 Human genes 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 102100023688 Eotaxin Human genes 0.000 description 1
- 101710139422 Eotaxin Proteins 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 102100037362 Fibronectin Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 102000004961 Furin Human genes 0.000 description 1
- 108090001126 Furin Proteins 0.000 description 1
- 102100039556 Galectin-4 Human genes 0.000 description 1
- 101710115997 Gamma-tubulin complex component 2 Proteins 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- KOSRFJWDECSPRO-WDSKDSINSA-N Glu-Glu Chemical group OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(O)=O KOSRFJWDECSPRO-WDSKDSINSA-N 0.000 description 1
- 206010018404 Glucagonoma Diseases 0.000 description 1
- 108010021582 Glucokinase Proteins 0.000 description 1
- 206010018429 Glucose tolerance impaired Diseases 0.000 description 1
- 102000003958 Glutamate Carboxypeptidase II Human genes 0.000 description 1
- 108090000369 Glutamate Carboxypeptidase II Proteins 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- QXZGBUJJYSLZLT-UHFFFAOYSA-N H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH Natural products NC(N)=NCCCC(N)C(=O)N1CCCC1C(=O)N1C(C(=O)NCC(=O)NC(CC=2C=CC=CC=2)C(=O)NC(CO)C(=O)N2C(CCC2)C(=O)NC(CC=2C=CC=CC=2)C(=O)NC(CCCN=C(N)N)C(O)=O)CCC1 QXZGBUJJYSLZLT-UHFFFAOYSA-N 0.000 description 1
- 208000018565 Hemochromatosis Diseases 0.000 description 1
- 108010086512 Hepatocyte Nuclear Factor 1 Proteins 0.000 description 1
- 102000006754 Hepatocyte Nuclear Factor 1 Human genes 0.000 description 1
- 102000012046 Hepatocyte Nuclear Factor 1-beta Human genes 0.000 description 1
- 108010061414 Hepatocyte Nuclear Factor 1-beta Proteins 0.000 description 1
- 102100022057 Hepatocyte nuclear factor 1-alpha Human genes 0.000 description 1
- FRJIAZKQGSCKPQ-FSPLSTOPSA-N His-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CN=CN1 FRJIAZKQGSCKPQ-FSPLSTOPSA-N 0.000 description 1
- KRBMQYPTDYSENE-BQBZGAKWSA-N His-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CNC=N1 KRBMQYPTDYSENE-BQBZGAKWSA-N 0.000 description 1
- WRPDZHJNLYNFFT-GEVIPFJHSA-N His-Thr Chemical compound C[C@@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)N)O WRPDZHJNLYNFFT-GEVIPFJHSA-N 0.000 description 1
- VLDVBZICYBVQHB-IUCAKERBSA-N His-Val Chemical compound CC(C)[C@@H](C([O-])=O)NC(=O)[C@@H]([NH3+])CC1=CN=CN1 VLDVBZICYBVQHB-IUCAKERBSA-N 0.000 description 1
- 108091006054 His-tagged proteins Proteins 0.000 description 1
- 101000697936 Homo sapiens Attractin Proteins 0.000 description 1
- 101000804935 Homo sapiens Dipeptidyl aminopeptidase-like protein 6 Proteins 0.000 description 1
- 101000608765 Homo sapiens Galectin-4 Proteins 0.000 description 1
- 101001045751 Homo sapiens Hepatocyte nuclear factor 1-alpha Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 208000023105 Huntington disease Diseases 0.000 description 1
- 102000004157 Hydrolases Human genes 0.000 description 1
- 108090000604 Hydrolases Proteins 0.000 description 1
- LCWXJXMHJVIJFK-UHFFFAOYSA-N Hydroxylysine Natural products NCC(O)CC(N)CC(O)=O LCWXJXMHJVIJFK-UHFFFAOYSA-N 0.000 description 1
- 206010020850 Hyperthyroidism Diseases 0.000 description 1
- 102000038460 IGF Type 2 Receptor Human genes 0.000 description 1
- 108010031792 IGF Type 2 Receptor Proteins 0.000 description 1
- 101150031639 IV gene Proteins 0.000 description 1
- MLSUZXHSNRBDCI-CYDGBPFRSA-N Ile-Pro-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)O)N MLSUZXHSNRBDCI-CYDGBPFRSA-N 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 108010001127 Insulin Receptor Proteins 0.000 description 1
- 102000003746 Insulin Receptor Human genes 0.000 description 1
- 229940122355 Insulin sensitizer Drugs 0.000 description 1
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 1
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 1
- 102000003777 Interleukin-1 beta Human genes 0.000 description 1
- 108090000193 Interleukin-1 beta Proteins 0.000 description 1
- 102100020873 Interleukin-2 Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108010041872 Islet Amyloid Polypeptide Proteins 0.000 description 1
- 102000036770 Islet Amyloid Polypeptide Human genes 0.000 description 1
- SNDPXSYFESPGGJ-BYPYZUCNSA-N L-2-aminopentanoic acid Chemical compound CCC[C@H](N)C(O)=O SNDPXSYFESPGGJ-BYPYZUCNSA-N 0.000 description 1
- QUOGESRFPZDMMT-UHFFFAOYSA-N L-Homoarginine Natural products OC(=O)C(N)CCCCNC(N)=N QUOGESRFPZDMMT-UHFFFAOYSA-N 0.000 description 1
- LOOZZTFGSTZNRX-VIFPVBQESA-N L-Homotyrosine Chemical compound OC(=O)[C@@H](N)CCC1=CC=C(O)C=C1 LOOZZTFGSTZNRX-VIFPVBQESA-N 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical compound OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 1
- RHGKLRLOHDJJDR-BYPYZUCNSA-N L-citrulline Chemical compound NC(=O)NCCC[C@H]([NH3+])C([O-])=O RHGKLRLOHDJJDR-BYPYZUCNSA-N 0.000 description 1
- QUOGESRFPZDMMT-YFKPBYRVSA-N L-homoarginine Chemical compound OC(=O)[C@@H](N)CCCCNC(N)=N QUOGESRFPZDMMT-YFKPBYRVSA-N 0.000 description 1
- VLJNHYLEOZPXFW-BYPYZUCNSA-N L-prolinamide Chemical compound NC(=O)[C@@H]1CCCN1 VLJNHYLEOZPXFW-BYPYZUCNSA-N 0.000 description 1
- DGYHPLMPMRKMPD-UHFFFAOYSA-N L-propargyl glycine Natural products OC(=O)C(N)CC#C DGYHPLMPMRKMPD-UHFFFAOYSA-N 0.000 description 1
- DZLNHFMRPBPULJ-VKHMYHEASA-N L-thioproline Chemical compound OC(=O)[C@@H]1CSCN1 DZLNHFMRPBPULJ-VKHMYHEASA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 206010049287 Lipodystrophy acquired Diseases 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 108020005196 Mitochondrial DNA Proteins 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 206010068871 Myotonic dystrophy Diseases 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-BKJPEWSUSA-N N-acetyl-D-hexosamine Chemical class CC(=O)NC1C(O)O[C@H](CO)C(O)C1O OVRNDRQMDRJTHS-BKJPEWSUSA-N 0.000 description 1
- SQVRNKJHWKZAKO-PFQGKNLYSA-N N-acetyl-beta-neuraminic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-PFQGKNLYSA-N 0.000 description 1
- SUHQNCLNRUAGOO-UHFFFAOYSA-N N-glycoloyl-neuraminic acid Natural products OCC(O)C(O)C(O)C(NC(=O)CO)C(O)CC(=O)C(O)=O SUHQNCLNRUAGOO-UHFFFAOYSA-N 0.000 description 1
- FDJKUWYYUZCUJX-UHFFFAOYSA-N N-glycolyl-beta-neuraminic acid Natural products OCC(O)C(O)C1OC(O)(C(O)=O)CC(O)C1NC(=O)CO FDJKUWYYUZCUJX-UHFFFAOYSA-N 0.000 description 1
- FDJKUWYYUZCUJX-KVNVFURPSA-N N-glycolylneuraminic acid Chemical compound OC[C@H](O)[C@H](O)[C@@H]1O[C@](O)(C(O)=O)C[C@H](O)[C@H]1NC(=O)CO FDJKUWYYUZCUJX-KVNVFURPSA-N 0.000 description 1
- AMFCMZMIVCHFEL-UHFFFAOYSA-N NC(=O)CCC(N)C(=O)N1CCCC1.NC(=O)CCC(N)C(=O)N1CCSC1 Chemical compound NC(=O)CCC(N)C(=O)N1CCCC1.NC(=O)CCC(N)C(=O)N1CCSC1 AMFCMZMIVCHFEL-UHFFFAOYSA-N 0.000 description 1
- RHGKLRLOHDJJDR-UHFFFAOYSA-N Ndelta-carbamoyl-DL-ornithine Natural products OC(=O)C(N)CCCNC(N)=O RHGKLRLOHDJJDR-UHFFFAOYSA-N 0.000 description 1
- 206010029164 Nephrotic syndrome Diseases 0.000 description 1
- 108090000189 Neuropeptides Proteins 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- REYJJPSVUYRZGE-UHFFFAOYSA-N Octadecylamine Chemical compound CCCCCCCCCCCCCCCCCCN REYJJPSVUYRZGE-UHFFFAOYSA-N 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 229910018828 PO3H2 Inorganic materials 0.000 description 1
- 229910019213 POCl3 Inorganic materials 0.000 description 1
- 102100041030 Pancreas/duodenum homeobox protein 1 Human genes 0.000 description 1
- 101710144033 Pancreas/duodenum homeobox protein 1 Proteins 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 101710176384 Peptide 1 Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 102000046014 Peptide Transporter 1 Human genes 0.000 description 1
- FZBGMXYQPACKNC-HJWJTTGWSA-N Phe-Pro-Ile Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(O)=O FZBGMXYQPACKNC-HJWJTTGWSA-N 0.000 description 1
- 102000045595 Phosphoprotein Phosphatases Human genes 0.000 description 1
- 108700019535 Phosphoprotein Phosphatases Proteins 0.000 description 1
- 102000013566 Plasminogen Human genes 0.000 description 1
- 108010051456 Plasminogen Proteins 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 102000003946 Prolactin Human genes 0.000 description 1
- 108010057464 Prolactin Proteins 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 101000999323 Rattus norvegicus Cobalamin binding intrinsic factor Proteins 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 108091006594 SLC15A1 Proteins 0.000 description 1
- 229910006069 SO3H Inorganic materials 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 241000239226 Scorpiones Species 0.000 description 1
- 108010086019 Secretin Proteins 0.000 description 1
- 102100037505 Secretin Human genes 0.000 description 1
- GZGFSPWOMUKKCV-NAKRPEOUSA-N Ser-Pro-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CO GZGFSPWOMUKKCV-NAKRPEOUSA-N 0.000 description 1
- 229920001800 Shellac Polymers 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical compound [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- BCKXLBQYZLBQEK-KVVVOXFISA-M Sodium oleate Chemical compound [Na+].CCCCCCCC\C=C/CCCCCCCC([O-])=O BCKXLBQYZLBQEK-KVVVOXFISA-M 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 108010023197 Streptokinase Proteins 0.000 description 1
- 102400000096 Substance P Human genes 0.000 description 1
- 101800003906 Substance P Proteins 0.000 description 1
- 239000012505 Superdex™ Substances 0.000 description 1
- 239000012317 TBTU Substances 0.000 description 1
- VTMGKRABARCZAX-OSUNSFLBSA-N Thr-Pro-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)[C@@H](C)O VTMGKRABARCZAX-OSUNSFLBSA-N 0.000 description 1
- 102000003938 Thromboxane Receptors Human genes 0.000 description 1
- 108090000300 Thromboxane Receptors Proteins 0.000 description 1
- AUYYCJSJGJYCDS-LBPRGKRZSA-N Thyrolar Chemical class IC1=CC(C[C@H](N)C(O)=O)=CC(I)=C1OC1=CC=C(O)C(I)=C1 AUYYCJSJGJYCDS-LBPRGKRZSA-N 0.000 description 1
- GYDJEQRTZSCIOI-UHFFFAOYSA-N Tranexamic acid Chemical compound NCC1CCC(C(O)=O)CC1 GYDJEQRTZSCIOI-UHFFFAOYSA-N 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- VCGOTJGGBXEBFO-FDARSICLSA-N Trp-Pro-Ile Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(O)=O VCGOTJGGBXEBFO-FDARSICLSA-N 0.000 description 1
- 208000026928 Turner syndrome Diseases 0.000 description 1
- USLVEJAHTBLSIL-CYDGBPFRSA-N Val-Pro-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)C(C)C USLVEJAHTBLSIL-CYDGBPFRSA-N 0.000 description 1
- QSPOLEBZTMESFY-SRVKXCTJSA-N Val-Pro-Val Chemical compound CC(C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(O)=O QSPOLEBZTMESFY-SRVKXCTJSA-N 0.000 description 1
- 206010047513 Vision blurred Diseases 0.000 description 1
- 239000003875 Wang resin Substances 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- GEAXDQGWIUNDBZ-NPLJWMOXSA-N [2-[(2s)-1-[(2s)-2-[[(2s)-2-aminopropanoyl]amino]-3-methylbutanoyl]pyrrolidin-2-yl]-2-oxoethyl] acetate;hydrobromide Chemical compound Br.C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)COC(C)=O GEAXDQGWIUNDBZ-NPLJWMOXSA-N 0.000 description 1
- NERFNHBZJXXFGY-UHFFFAOYSA-N [4-[(4-methylphenyl)methoxy]phenyl]methanol Chemical compound C1=CC(C)=CC=C1COC1=CC=C(CO)C=C1 NERFNHBZJXXFGY-UHFFFAOYSA-N 0.000 description 1
- CIUQDSCDWFSTQR-UHFFFAOYSA-N [C]1=CC=CC=C1 Chemical class [C]1=CC=CC=C1 CIUQDSCDWFSTQR-UHFFFAOYSA-N 0.000 description 1
- CLZISMQKJZCZDN-UHFFFAOYSA-N [benzotriazol-1-yloxy(dimethylamino)methylidene]-dimethylazanium Chemical compound C1=CC=C2N(OC(N(C)C)=[N+](C)C)N=NC2=C1 CLZISMQKJZCZDN-UHFFFAOYSA-N 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 150000008065 acid anhydrides Chemical class 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 210000000577 adipose tissue Anatomy 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 206010001323 adrenal adenoma Diseases 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 229940023476 agar Drugs 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 208000014594 aldosterone-producing adenoma with seizures and neurological abnormalities Diseases 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- VZSTVUJXUYNIOQ-UHFFFAOYSA-N alpha-amino-gamma-cyanobutanoic acid Chemical compound OC(=O)C(N)CCC#N VZSTVUJXUYNIOQ-UHFFFAOYSA-N 0.000 description 1
- XXXHSQBVHSJQKS-UHFFFAOYSA-N amino benzoate Chemical compound NOC(=O)C1=CC=CC=C1 XXXHSQBVHSJQKS-UHFFFAOYSA-N 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 229960004050 aminobenzoic acid Drugs 0.000 description 1
- QCTBMLYLENLHLA-UHFFFAOYSA-N aminomethylbenzoic acid Chemical compound NCC1=CC=C(C(O)=O)C=C1 QCTBMLYLENLHLA-UHFFFAOYSA-N 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 239000003708 ampul Substances 0.000 description 1
- 239000012491 analyte Substances 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 125000005577 anthracene group Chemical group 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 229960004405 aprotinin Drugs 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 150000001508 asparagines Chemical class 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-L aspartate group Chemical group N[C@@H](CC(=O)[O-])C(=O)[O-] CKLJMWTZIZZHCS-REOHCLBHSA-L 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 229940090047 auto-injector Drugs 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 230000006470 autoimmune attack Effects 0.000 description 1
- 238000005452 bending Methods 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 239000000440 bentonite Substances 0.000 description 1
- 229910000278 bentonite Inorganic materials 0.000 description 1
- 229940092782 bentonite Drugs 0.000 description 1
- 235000012216 bentonite Nutrition 0.000 description 1
- SVPXDRXYRYOSEX-UHFFFAOYSA-N bentoquatam Chemical compound O.O=[Si]=O.O=[Al]O[Al]=O SVPXDRXYRYOSEX-UHFFFAOYSA-N 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid group Chemical group C(C1=CC=CC=C1)(=O)O WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 1
- 238000005574 benzylation reaction Methods 0.000 description 1
- 238000005976 benzyloxycarbonylation reaction Methods 0.000 description 1
- 229940125388 beta agonist Drugs 0.000 description 1
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 1
- 229940000635 beta-alanine Drugs 0.000 description 1
- 108010065875 beta-casomorphins Proteins 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000013060 biological fluid Substances 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 239000004305 biphenyl Substances 0.000 description 1
- 235000010290 biphenyl Nutrition 0.000 description 1
- JCZLABDVDPYLRZ-AWEZNQCLSA-N biphenylalanine Chemical compound C1=CC(C[C@H](N)C(O)=O)=CC=C1C1=CC=CC=C1 JCZLABDVDPYLRZ-AWEZNQCLSA-N 0.000 description 1
- OWMVSZAMULFTJU-UHFFFAOYSA-N bis-tris Chemical compound OCCN(CCO)C(CO)(CO)CO OWMVSZAMULFTJU-UHFFFAOYSA-N 0.000 description 1
- 229920001400 block copolymer Polymers 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- QXZGBUJJYSLZLT-FDISYFBBSA-N bradykinin Chemical compound NC(=N)NCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(=O)NCC(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CO)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)CCC1 QXZGBUJJYSLZLT-FDISYFBBSA-N 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 239000012267 brine Substances 0.000 description 1
- 210000000465 brunner gland Anatomy 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 239000007894 caplet Substances 0.000 description 1
- KLOIYEQEVSIOOO-UHFFFAOYSA-N carbocromen Chemical compound CC1=C(CCN(CC)CC)C(=O)OC2=CC(OCC(=O)OCC)=CC=C21 KLOIYEQEVSIOOO-UHFFFAOYSA-N 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 230000021523 carboxylation Effects 0.000 description 1
- 238000006473 carboxylation reaction Methods 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 1
- 238000000423 cell based assay Methods 0.000 description 1
- 230000008568 cell cell communication Effects 0.000 description 1
- 229960000541 cetyl alcohol Drugs 0.000 description 1
- 238000004296 chiral HPLC Methods 0.000 description 1
- 229940107137 cholecystokinin Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 229940015047 chorionic gonadotropin Drugs 0.000 description 1
- 238000013375 chromatographic separation Methods 0.000 description 1
- 208000020832 chronic kidney disease Diseases 0.000 description 1
- PMMYEEVYMWASQN-IMJSIDKUSA-N cis-4-Hydroxy-L-proline Chemical compound O[C@@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-IMJSIDKUSA-N 0.000 description 1
- 235000013477 citrulline Nutrition 0.000 description 1
- 229960002173 citrulline Drugs 0.000 description 1
- ZYDMZKPAPSZILB-XDGGXQJNSA-N clilp Chemical compound C([C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)C1N(CCC1)C(=O)[C@@H](N)CCCNC(N)=N)C(C)C)C(C)C)C1=CC=CC=C1 ZYDMZKPAPSZILB-XDGGXQJNSA-N 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 239000003240 coconut oil Substances 0.000 description 1
- 235000019864 coconut oil Nutrition 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 238000005094 computer simulation Methods 0.000 description 1
- 108091036078 conserved sequence Proteins 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- NKLPQNGYXWVELD-UHFFFAOYSA-M coomassie brilliant blue Chemical compound [Na+].C1=CC(OCC)=CC=C1NC1=CC=C(C(=C2C=CC(C=C2)=[N+](CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=2C=CC(=CC=2)N(CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=C1 NKLPQNGYXWVELD-UHFFFAOYSA-M 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 239000002385 cottonseed oil Substances 0.000 description 1
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 1
- HCAJEUSONLESMK-UHFFFAOYSA-N cyclohexylsulfamic acid Chemical compound OS(=O)(=O)NC1CCCCC1 HCAJEUSONLESMK-UHFFFAOYSA-N 0.000 description 1
- CSURFXBOHQPUPW-UHFFFAOYSA-N cyclopentyl(1,2,3,4-tetrahydroisoquinolin-2-ium-3-yl)methanone;chloride Chemical compound [Cl-].C1C2=CC=CC=C2C[NH2+]C1C(=O)C1CCCC1 CSURFXBOHQPUPW-UHFFFAOYSA-N 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 238000013480 data collection Methods 0.000 description 1
- 230000020176 deacylation Effects 0.000 description 1
- 238000005947 deacylation reaction Methods 0.000 description 1
- 230000006240 deamidation Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- GHVNFZFCNZKVNT-UHFFFAOYSA-N decanoic acid Chemical class CCCCCCCCCC(O)=O GHVNFZFCNZKVNT-UHFFFAOYSA-N 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 238000010511 deprotection reaction Methods 0.000 description 1
- 239000007933 dermal patch Substances 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- GDLBFKVLRPITMI-UHFFFAOYSA-N diazoxide Chemical compound ClC1=CC=C2NC(C)=NS(=O)(=O)C2=C1 GDLBFKVLRPITMI-UHFFFAOYSA-N 0.000 description 1
- 229960004042 diazoxide Drugs 0.000 description 1
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 1
- 229940038472 dicalcium phosphate Drugs 0.000 description 1
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 1
- VILAVOFMIJHSJA-UHFFFAOYSA-N dicarbon monoxide Chemical compound [C]=C=O VILAVOFMIJHSJA-UHFFFAOYSA-N 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 229940064790 dilantin Drugs 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 108090000212 dipeptidyl peptidase II Proteins 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 208000002173 dizziness Diseases 0.000 description 1
- 210000001198 duodenum Anatomy 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 239000008157 edible vegetable oil Substances 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 208000028208 end stage renal disease Diseases 0.000 description 1
- 201000000523 end stage renal failure Diseases 0.000 description 1
- 208000030172 endocrine system disease Diseases 0.000 description 1
- 108010015198 endomorphin 2 Proteins 0.000 description 1
- XIJHWXXXIMEHKW-LJWNLINESA-N endomorphin-2 Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)C1=CC=C(O)C=C1 XIJHWXXXIMEHKW-LJWNLINESA-N 0.000 description 1
- 239000002702 enteric coating Substances 0.000 description 1
- 238000009585 enzyme analysis Methods 0.000 description 1
- 239000002532 enzyme inhibitor Substances 0.000 description 1
- 210000000918 epididymis Anatomy 0.000 description 1
- 201000010063 epididymitis Diseases 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- YSMODUONRAFBET-UHNVWZDZSA-N erythro-5-hydroxy-L-lysine Chemical compound NC[C@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-UHNVWZDZSA-N 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 229940093499 ethyl acetate Drugs 0.000 description 1
- 235000019439 ethyl acetate Nutrition 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- SSAAJZQUEUTACT-MDBKHZGBSA-N exendin 2 Chemical compound C([C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(N)=O)C1=CN=CN1 SSAAJZQUEUTACT-MDBKHZGBSA-N 0.000 description 1
- 108010015174 exendin 3 Proteins 0.000 description 1
- LMHMJYMCGJNXRS-IOPUOMRJSA-N exendin-3 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@H](C)O)[C@H](C)O)C(C)C)C1=CC=CC=C1 LMHMJYMCGJNXRS-IOPUOMRJSA-N 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 210000003020 exocrine pancreas Anatomy 0.000 description 1
- 235000020937 fasting conditions Nutrition 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- 235000019634 flavors Nutrition 0.000 description 1
- 235000020375 flavoured syrup Nutrition 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 230000022244 formylation Effects 0.000 description 1
- 238000006170 formylation reaction Methods 0.000 description 1
- 238000001640 fractional crystallisation Methods 0.000 description 1
- 239000012458 free base Substances 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 239000007897 gelcap Substances 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 230000006130 geranylgeranylation Effects 0.000 description 1
- 206010061989 glomerulosclerosis Diseases 0.000 description 1
- 230000009229 glucose formation Effects 0.000 description 1
- 230000014101 glucose homeostasis Effects 0.000 description 1
- 238000007446 glucose tolerance test Methods 0.000 description 1
- 230000004190 glucose uptake Effects 0.000 description 1
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 description 1
- 230000035430 glutathionylation Effects 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 108091005608 glycosylated proteins Proteins 0.000 description 1
- 102000035122 glycosylated proteins Human genes 0.000 description 1
- YMAWOPBAYDPSLA-UHFFFAOYSA-N glycylglycine Chemical compound [NH3+]CC(=O)NCC([O-])=O YMAWOPBAYDPSLA-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 238000003875 gradient-accelerated spectroscopy Methods 0.000 description 1
- 239000003979 granulating agent Substances 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 108010028997 heliodermin Proteins 0.000 description 1
- 108010069764 helospectin I Proteins 0.000 description 1
- HTMVMVKJOPFRMK-OYZAELBCSA-N helospectin i Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=C(O)C=C1 HTMVMVKJOPFRMK-OYZAELBCSA-N 0.000 description 1
- 150000002391 heterocyclic compounds Chemical class 0.000 description 1
- 150000008273 hexosamines Chemical class 0.000 description 1
- 150000002402 hexoses Chemical class 0.000 description 1
- 108010040030 histidinoalanine Proteins 0.000 description 1
- 108010085325 histidylproline Proteins 0.000 description 1
- 108010018006 histidylserine Proteins 0.000 description 1
- 239000008240 homogeneous mixture Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 1
- ZHUXMBYIONRQQX-UHFFFAOYSA-N hydroxidodioxidocarbon(.) Chemical group [O]C(O)=O ZHUXMBYIONRQQX-UHFFFAOYSA-N 0.000 description 1
- QJHBJHUKURJDLG-UHFFFAOYSA-N hydroxy-L-lysine Natural products NCCCCC(NO)C(O)=O QJHBJHUKURJDLG-UHFFFAOYSA-N 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 125000004029 hydroxymethyl group Chemical group [H]OC([H])([H])* 0.000 description 1
- 230000001631 hypertensive effect Effects 0.000 description 1
- 239000012729 immediate-release (IR) formulation Substances 0.000 description 1
- 230000003100 immobilizing effect Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- QNRXNRGSOJZINA-UHFFFAOYSA-N indoline-2-carboxylic acid Chemical compound C1=CC=C2NC(C(=O)O)CC2=C1 QNRXNRGSOJZINA-UHFFFAOYSA-N 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- ZPNFWUPYTFPOJU-LPYSRVMUSA-N iniprol Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@H]2CSSC[C@H]3C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC=4C=CC=CC=4)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]2N(CCC2)C(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N2[C@@H](CCC2)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)N3)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](C(=O)N1)C(C)C)[C@@H](C)O)[C@@H](C)CC)=O)[C@@H](C)CC)C1=CC=C(O)C=C1 ZPNFWUPYTFPOJU-LPYSRVMUSA-N 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 238000012482 interaction analysis Methods 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 230000031146 intracellular signal transduction Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 210000004153 islets of langerhan Anatomy 0.000 description 1
- 238000001155 isoelectric focusing Methods 0.000 description 1
- FZWBNHMXJMCXLU-BLAUPYHCSA-N isomaltotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)O1 FZWBNHMXJMCXLU-BLAUPYHCSA-N 0.000 description 1
- SRJOCJYGOFTFLH-UHFFFAOYSA-N isonipecotic acid Chemical compound OC(=O)C1CCNCC1 SRJOCJYGOFTFLH-UHFFFAOYSA-N 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 229950003188 isovaleryl diethylamide Drugs 0.000 description 1
- GCHPUFAZSONQIV-UHFFFAOYSA-N isovaline Chemical compound CCC(C)(N)C(O)=O GCHPUFAZSONQIV-UHFFFAOYSA-N 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 238000004989 laser desorption mass spectroscopy Methods 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 238000012417 linear regression Methods 0.000 description 1
- 208000006132 lipodystrophy Diseases 0.000 description 1
- AGBQKNBQESQNJD-UHFFFAOYSA-N lipoic acid Chemical compound OC(=O)CCCCC1CCSS1 AGBQKNBQESQNJD-UHFFFAOYSA-N 0.000 description 1
- 235000019136 lipoic acid Nutrition 0.000 description 1
- 230000004130 lipolysis Effects 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- VWHRYODZTDMVSS-QMMMGPOBSA-N m-fluoro-L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC(F)=C1 VWHRYODZTDMVSS-QMMMGPOBSA-N 0.000 description 1
- 201000001247 maturity-onset diabetes of the young type 2 Diseases 0.000 description 1
- 201000001250 maturity-onset diabetes of the young type 3 Diseases 0.000 description 1
- AEUKDPKXTPNBNY-XEYRWQBLSA-N mcp 2 Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)C1=CC=CC=C1 AEUKDPKXTPNBNY-XEYRWQBLSA-N 0.000 description 1
- 210000002752 melanocyte Anatomy 0.000 description 1
- 150000002730 mercury Chemical class 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000012452 mother liquor Substances 0.000 description 1
- 210000003550 mucous cell Anatomy 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 210000000651 myofibroblast Anatomy 0.000 description 1
- VBEGHXKAFSLLGE-UHFFFAOYSA-N n-phenylnitramide Chemical compound [O-][N+](=O)NC1=CC=CC=C1 VBEGHXKAFSLLGE-UHFFFAOYSA-N 0.000 description 1
- 125000001624 naphthyl group Chemical group 0.000 description 1
- 230000009826 neoplastic cell growth Effects 0.000 description 1
- 201000009925 nephrosclerosis Diseases 0.000 description 1
- 210000004498 neuroglial cell Anatomy 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000002981 neuropathic effect Effects 0.000 description 1
- 201000001119 neuropathy Diseases 0.000 description 1
- 230000007823 neuropathy Effects 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 125000004433 nitrogen atom Chemical group N* 0.000 description 1
- 235000020925 non fasting Nutrition 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 239000012038 nucleophile Substances 0.000 description 1
- 230000000269 nucleophilic effect Effects 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- CQYBNXGHMBNGCG-RNJXMRFFSA-N octahydroindole-2-carboxylic acid Chemical compound C1CCC[C@H]2N[C@H](C(=O)O)C[C@@H]21 CQYBNXGHMBNGCG-RNJXMRFFSA-N 0.000 description 1
- 239000012053 oil suspension Substances 0.000 description 1
- PBLZLIFKVPJDCO-UHFFFAOYSA-N omega-Aminododecanoic acid Natural products NCCCCCCCCCCCC(O)=O PBLZLIFKVPJDCO-UHFFFAOYSA-N 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 229940127234 oral contraceptive Drugs 0.000 description 1
- 239000003539 oral contraceptive agent Substances 0.000 description 1
- 239000006186 oral dosage form Substances 0.000 description 1
- OFNHNCAUVYOTPM-IIIOAANCSA-N orexin-a Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H]1NC(=O)[C@H](CO)NC(=O)[C@@H]2CSSC[C@@H](C(=O)N[C@H](C(N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N2)[C@@H](C)O)=O)CSSC1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H]1NC(=O)CC1)C1=CNC=N1 OFNHNCAUVYOTPM-IIIOAANCSA-N 0.000 description 1
- OHOWSYIKESXDMN-WMQZXSDYSA-N orexin-b Chemical compound C([C@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](N)CCSC)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCN=C(N)N)C(N)=O)C1=CNC=N1 OHOWSYIKESXDMN-WMQZXSDYSA-N 0.000 description 1
- 239000012044 organic layer Substances 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 210000003101 oviduct Anatomy 0.000 description 1
- 230000020477 pH reduction Effects 0.000 description 1
- 125000001312 palmitoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 230000026792 palmitoylation Effects 0.000 description 1
- TVIDEEHSOPHZBR-AWEZNQCLSA-N para-(benzoyl)-phenylalanine Chemical compound C1=CC(C[C@H](N)C(O)=O)=CC=C1C(=O)C1=CC=CC=C1 TVIDEEHSOPHZBR-AWEZNQCLSA-N 0.000 description 1
- 239000003182 parenteral nutrition solution Substances 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 230000000149 penetrating effect Effects 0.000 description 1
- 229960001639 penicillamine Drugs 0.000 description 1
- XDRYMKDFEDOLFX-UHFFFAOYSA-N pentamidine Chemical compound C1=CC(C(=N)N)=CC=C1OCCCCCOC1=CC=C(C(N)=N)C=C1 XDRYMKDFEDOLFX-UHFFFAOYSA-N 0.000 description 1
- 229960004448 pentamidine Drugs 0.000 description 1
- 150000002972 pentoses Chemical class 0.000 description 1
- 238000005897 peptide coupling reaction Methods 0.000 description 1
- 108010082406 peptide permease Proteins 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- 208000033808 peripheral neuropathy Diseases 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 239000008024 pharmaceutical diluent Substances 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 239000002831 pharmacologic agent Substances 0.000 description 1
- 229960002036 phenytoin Drugs 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- 150000008105 phosphatidylcholines Chemical class 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- DCWXELXMIBXGTH-UHFFFAOYSA-N phosphotyrosine Chemical compound OC(=O)C(N)CC1=CC=C(OP(O)(O)=O)C=C1 DCWXELXMIBXGTH-UHFFFAOYSA-N 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 230000007180 physiological regulation Effects 0.000 description 1
- 210000004694 pigment cell Anatomy 0.000 description 1
- 125000003386 piperidinyl group Chemical group 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000002985 plastic film Substances 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 229920001610 polycaprolactone Polymers 0.000 description 1
- 229920002721 polycyanoacrylate Polymers 0.000 description 1
- 229920006324 polyoxymethylene Polymers 0.000 description 1
- CHKVPAROMQMJNQ-UHFFFAOYSA-M potassium bisulfate Chemical compound [K+].OS([O-])(=O)=O CHKVPAROMQMJNQ-UHFFFAOYSA-M 0.000 description 1
- 229910000343 potassium bisulfate Inorganic materials 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000004237 preparative chromatography Methods 0.000 description 1
- GCYXWQUSHADNBF-AAEALURTSA-N preproglucagon 78-108 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 GCYXWQUSHADNBF-AAEALURTSA-N 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 229940097325 prolactin Drugs 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 108010066823 proline dipeptidase Proteins 0.000 description 1
- 108700005622 proline transport Proteins 0.000 description 1
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 235000019624 protein content Nutrition 0.000 description 1
- 230000006920 protein precipitation Effects 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 1
- 235000007682 pyridoxal 5'-phosphate Nutrition 0.000 description 1
- 239000011589 pyridoxal 5'-phosphate Substances 0.000 description 1
- 229960001327 pyridoxal phosphate Drugs 0.000 description 1
- CLKZWXHKFXZIMA-UHFFFAOYSA-N pyrinuron Chemical compound C1=CC([N+](=O)[O-])=CC=C1NC(=O)NCC1=CC=CN=C1 CLKZWXHKFXZIMA-UHFFFAOYSA-N 0.000 description 1
- 238000003908 quality control method Methods 0.000 description 1
- 238000009790 rate-determining step (RDS) Methods 0.000 description 1
- 239000000376 reactant Substances 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 239000012146 running buffer Substances 0.000 description 1
- 238000003345 scintillation counting Methods 0.000 description 1
- 238000007423 screening assay Methods 0.000 description 1
- 229960002101 secretin Drugs 0.000 description 1
- OWMZNFCDEHGFEP-NFBCVYDUSA-N secretin human Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(N)=O)[C@@H](C)O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)C1=CC=CC=C1 OWMZNFCDEHGFEP-NFBCVYDUSA-N 0.000 description 1
- 235000016491 selenocysteine Nutrition 0.000 description 1
- 229940055619 selenocysteine Drugs 0.000 description 1
- ZKZBPNGNEQAJSX-UHFFFAOYSA-N selenocysteine Natural products [SeH]CC(N)C(O)=O ZKZBPNGNEQAJSX-UHFFFAOYSA-N 0.000 description 1
- 230000028043 self proteolysis Effects 0.000 description 1
- 210000001625 seminal vesicle Anatomy 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 239000004208 shellac Substances 0.000 description 1
- ZLGIYFNHBLSMPS-ATJNOEHPSA-N shellac Chemical compound OCCCCCC(O)C(O)CCCCCCCC(O)=O.C1C23[C@H](C(O)=O)CCC2[C@](C)(CO)[C@@H]1C(C(O)=O)=C[C@@H]3O ZLGIYFNHBLSMPS-ATJNOEHPSA-N 0.000 description 1
- 229940113147 shellac Drugs 0.000 description 1
- 235000013874 shellac Nutrition 0.000 description 1
- 238000007086 side reaction Methods 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 238000002922 simulated annealing Methods 0.000 description 1
- IZTQOLKUZKXIRV-YRVFCXMDSA-N sincalide Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](N)CC(O)=O)C1=CC=C(OS(O)(=O)=O)C=C1 IZTQOLKUZKXIRV-YRVFCXMDSA-N 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- WXMKPNITSTVMEF-UHFFFAOYSA-M sodium benzoate Chemical compound [Na+].[O-]C(=O)C1=CC=CC=C1 WXMKPNITSTVMEF-UHFFFAOYSA-M 0.000 description 1
- 239000004299 sodium benzoate Substances 0.000 description 1
- 235000010234 sodium benzoate Nutrition 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- RYYKJJJTJZKILX-UHFFFAOYSA-M sodium octadecanoate Chemical compound [Na+].CCCCCCCCCCCCCCCCCC([O-])=O RYYKJJJTJZKILX-UHFFFAOYSA-M 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000006104 solid solution Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 229940032147 starch Drugs 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229960005202 streptokinase Drugs 0.000 description 1
- 125000003107 substituted aryl group Chemical group 0.000 description 1
- 125000000020 sulfo group Chemical group O=S(=O)([*])O[H] 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 238000009121 systemic therapy Methods 0.000 description 1
- 210000000538 tail Anatomy 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 239000013076 target substance Substances 0.000 description 1
- 229960001367 tartaric acid Drugs 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- NQRYJNQNLNOLGT-UHFFFAOYSA-N tetrahydropyridine hydrochloride Natural products C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 1
- 150000003536 tetrazoles Chemical class 0.000 description 1
- 239000003451 thiazide diuretic agent Substances 0.000 description 1
- 229960002663 thioctic acid Drugs 0.000 description 1
- 230000034005 thiol-disulfide exchange Effects 0.000 description 1
- 238000003161 three-hybrid assay Methods 0.000 description 1
- 239000005495 thyroid hormone Substances 0.000 description 1
- 229940036555 thyroid hormone Drugs 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000037317 transdermal delivery Effects 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 230000008733 trauma Effects 0.000 description 1
- 108010020182 tricorn protease Proteins 0.000 description 1
- 238000005583 trifluoroacetylation reaction Methods 0.000 description 1
- 238000003160 two-hybrid assay Methods 0.000 description 1
- 238000010396 two-hybrid screening Methods 0.000 description 1
- 238000000825 ultraviolet detection Methods 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 230000002227 vasoactive effect Effects 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 201000010653 vesiculitis Diseases 0.000 description 1
- 208000016261 weight loss Diseases 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 230000029663 wound healing Effects 0.000 description 1
- 239000000230 xanthan gum Substances 0.000 description 1
- 229920001285 xanthan gum Polymers 0.000 description 1
- 235000010493 xanthan gum Nutrition 0.000 description 1
- 229940082509 xanthan gum Drugs 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 229930195724 β-lactose Natural products 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
- A61K31/401—Proline; Derivatives thereof, e.g. captopril
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/34—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase
- C12Q1/37—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase involving peptidase or proteinase
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/04—Screening involving studying the effect of compounds C directly on molecule A (e.g. C are potential ligands for a receptor A, or potential substrates for an enzyme A)
Definitions
- the present application relates to the secondary binding site of dipeptidyl peptidase IV, its relationship with any type of substrates and to the modulation of substrate specificity of dipeptidyl peptidase IV (DP IV, synonym: DPP IV, CD26, EC 3.4.14.5).
- the application relates further to compounds that bind to the secondary binding site of DP IV and their use to modulate the substrate specificity of DP IV.
- the present invention provides a method for treating DP IV mediated disorders, selected from but not restricted to, impaired glucose tolerance, glucosuria, lipid disorders, dyslipidemia, hyperlipidaemia, hypertriglyceridemia, hypercholesterolemia, low HDL levels, high LDL levels, metabolic acidosis, hyperglycemia, diabetes mellitus, diabetic neuropathy and nephropathy and of sequelae caused by diabetes mellitus in mammals, metabolism-related hypertension and cardiovascular sequelae caused by hypertension in mammals, for the prophylaxis or treatment of skin diseases and diseases of the mucosae, autoimmune diseases and inflammatory conditions, and for the treatment of psychosomatic, neuropsychiatric and depressive illnesses, such as anxiety, depression, sleep disorders, chronic fatigue, schizophrenia, epilepsy, nutritional disorders, spasm and chronic pain, atherosclerosis and its sequelae, vascular restenosis, irritable bowel syndrome, inflammatory bowel disease, including Crohn's disease and ulcerative colitis, other inflammatory
- the present application also provides a screening method for the identification of agents, which bind to the secondary binding site of dipeptidyl peptidase IV.
- DP IV The exopeptidase dipeptidyl peptidase IV (DP IV, CD26, EC 3.4.14.5) is involved in a number of physiological regulation processes.
- DP IV is a peptidase which can change the activity of a number of peptide hormones, neuropeptides and chemokines in a very specific manner (Mentlein, Reg. Pep. 85, pp. 9-24 (1999) while on the other hand the DP IV protein molecule exerts protein-protein interactions, so mediating the regulation of intracellular signaling cascades.
- a growing number of peptide substrates containing proline, alanine or serine in the penultimate position are identified as substrates of DP IV in vitro and in vivo.
- Bioactive peptides which are substrates for DP IV and members of such regulation cascades are, among others, NPY, GIP, GLP-1, glucagons, VIP and PACAP. Furthermore, many DP IV-inhibitors belonging to different structural classes are known.
- DP IV-Inhibitors may be useful for the treatment of impaired glucose tolerance and diabetes mellitus (International Patent Application, Publication Number WO 99/61431, Pederson R A et al, Diabetes. 1998 Aug; 47(8):1253-8 and Pauly R P et al, Metabolism 1999 Mar; 48(3):385-9).
- WO 99/61431 discloses DP IV-Inhibitors comprising an amino acid residue and a thiazolidine or pyrrolidine group, and salts thereof, especially L-threo-isoleucyl thiazolidine, L-allo-isoleucyl thiazolidine, L-threo-isoleucyl pyrrolidine, L-allo-isoleucyl thiazolidine, L-allo-isoleucyl pyrrolidine, and salts thereof.
- low molecular weight dipeptidyl peptidase IV inhibitors are agents such as tetrahydroisoquinolin-3-carboxamide derivatives, N-substituted 2-cyanopyroles and pyrrolidines, N-(N′-substituted glycyl)-2-cyanopyrrolidines, N-(substituted glycyl)-thiazolidines, N-(substituted glycyl)-4-cyanothiazolidines, amino-acyl-borono-prolyl-inhibitors, cyclopropyl-fused pyrrolidines and heterocyclic compounds.
- agents such as tetrahydroisoquinolin-3-carboxamide derivatives, N-substituted 2-cyanopyroles and pyrrolidines, N-(N′-substituted glycyl)-2-cyanopyrrolidines, N-(substituted glyc
- Inhibitors of dipeptidyl peptidase IV are described in U.S. Pat. No. 6,380,398, U.S. Pat. No. 6,011,155; U.S. Pat. No. 6,107,317; U.S. Pat. No. 6,110,949; U.S. Pat. No. 6,124,305; U.S. Pat. No.
- active site as used in the claims and in the description is generally known to a person skilled in the art and means the catalytical site or region of DP IV and/or DP IV-like enzymes, which is responsible for the cleavage or biodegredation of the natural substrates of these enzymes.
- secondary binding site means a site or region of DP IV and/or DP V-like enzymes, which is different from the active site, e.g. a) a receptor site or b) a substrate recognition site or c) a regulatory site or allosteric site.
- the secondary binding site can a) affect the receptor function of DP IV and/or DP IV-like enzymes or b) affect the catalytic activity of DP IV and/or DP IV-like enzymes, especially the selectivity and/or specificity of these enzymes toward their substrates.
- Some secondary binding sites are complementary to the structure of the substrate of the enzymes, co-enzymes, co-factors and other compounds, which are involved in the activity and function of the enzyme.
- the enzymes may even have one or more secondary binding sites.
- the secondary binding site is an element of the enzyme distinct from the catalytic site with a different form of regulation than the competition between substrates and inhibitors at the catalytic site (Darnell, J., Lodish, H. and Baltimore, D. 1990, Molecular Cell Biology 2 nd Edition, Scientific American Books, New York, page 63).
- DP IV and/or DP IV-like enzymes means DP IV or DP IV-like enzymes or both.
- activity modifying means both the modification of the enzymatic activity as well as the modification of the selectivity or specificity of DP IV and/or DP IV-like enzymes. Especially preferred is the modification of the selectivity or specificity of DP IV and/or DP IV-like enzymes toward their natural substrates.
- “Effectors”, as that term is used herein, are defined as molecules or ligands that interact with a secondary binding site of DP IV and/or DP IV-like enzymes, thereby changing their catalytical behaviour in vitro and/or in vivo. Effectors can increase or decrease the catalytical activity of the enzymes. Examples of effectors are activators or inhibitors. The effectors as used herein do not act at the active sites of enzymes, but at at least one secondary binding site, e.g. a regulatory site, or an allosteric site. The term “effectors” is used herein synonymously with “agent” or “compound”.
- DP IV-inhibitor is generally known to a person skilled in the art and means enzyme inhibitors, which interact with the active site or catalytical site of DP IV or DP IV-like enzymes or DP IV and/or DP IV-like enzymes and inhibit the catalytical activity of these enzymes.
- effectors encompasses one single effector or two or more effectors together. Preferred is the use of two effectors. Especially preferred is the use of one single effector.
- Constants associated with diabetes mellitus itself include hyperglycaemia, insulin resistance, including acquired insulin resistance and obesity. Further conditions associated with diabetes mellitus itself include hypertension and cardiovascular disease, especially atherosclerosis and conditions associated with insulin resistance. Conditions associated with insulin resistance include polycystic ovarian syndrome and steroid induced insulin resistance and gestational diabetes.
- “Complications associated with diabetes mellitus” includes renal disease, especially renal disease associated with Type 2 diabetes, neuropathy and retinopathy.
- Renal diseases associated with Type 2 diabetes include nephropathy, glomerulonephritis, glomerular sclerosis, nephrotic syndrome, hypertensive nephrosclerosis and end stage renal disease.
- Diabetes mellitus is preferably Type 2 diabetes.
- Clinical diabetes may be divided into four general subclasses, including (1) type 1 (caused by beta cell destruction and characterized by absolute insulin deficiency) (2) type 2 (characterized by insulin resistance and relative insulin deficiency (3) other specific types of diabetes (associated with various identifiable clinical conditions or syndromes) and (4) gestational diabetes mellitus.
- type 1 caused by beta cell destruction and characterized by absolute insulin deficiency
- type 2 characterized by insulin resistance and relative insulin deficiency
- other specific types of diabetes associated with various identifiable clinical conditions or syndromes
- gestational diabetes mellitus two conditions—impaired glucose tolerance and impaired fasting glucose—refer to a metabolic state intermediate between normal glucose homeostasis and overt diabetes. These conditions significantly increase the later risk of diabetes mellitus and may in some instances be part of its natural history. It should be noted that patients with any form of diabetes might require insulin treatment at some point. For this reason the previously used terms insulin-dependent diabetes (for type I diabetes mellitus) and non-insulin-dependent diabetes (for type 2) have been
- Diabetes is currently classified as follows:
- diabetes appears abrubtly (i.e., over days and weeks) in previously healthy non-obese children or young adults; in older age groups it may have a more gradual onset.
- the typical patient often appears ill, has marked symptoms (e.g., polyuria, polydipsia, polyhagia, and weight loss), and may demonstrate ketoacidosis.
- Type 1 diabetes is believed to have a long a symptomatic p reclinical stage often lasting years, during which pancreatic beta cells are gradually destroyed by an autoimmune attack that is influenced by HLA and other genetic factors, as well as the environment. Initially, insulin therapy is essential to restore metabolism toward normal.
- type 1 diabetes is an autoimmune disease. This syndrome accounts for lese than 10% of diabetes in United States.
- Type 2 diabetes by far the most common form of the disease, is found in over 90% of the diabetic patient population. These patients retain a significant level of endogenous insulin secretory capacity. However, insulin levels are low relative to the magnitude of insulin resistance and ambient glucose levels. Type 2 patients are not dependent on insulin for immediate survival and ketosis rarely develops, except under conditions of great physical stress. Nevertheless, these patients may require insulin therapy to control hyperlgycemia. Type 2 diabetes typically appears after the age of 40 years, has a high rate of genetic penetrance unrelated to HLA genes, and is associated with obesity. The clinical features of type 2 diabetes may be mild (fatigue, weakness, dizziness, blurred vision, or other non-specific complaints may dominate the picture) or may be tolerated for many years before the patient seeks medical attention. Moreover, if the level of hyperglycemia is insufficient to produce symptoms, the disease may become evident only after complications develop.
- MODY encompasses several genetic defects of beta cell function, among which mutations at several genetic loci on different chromosomes have been identified.
- diabetes mellitus The distinction between the various subclasses of diabetes mellitus is usually made on clinical grounds. However, a small subgroup of patients are difficult to classify, that is, they display features common to both type 1 and 2 diabetes. Such patients are commonly non-obese and have reduced insulin secretory capacity that is not sufficient to make them ketosis prone. Many initially respond to oral agents but, with time , require insulin. Some appear to have a slowly evolving form of type 1 diabetes, whereas others defy easy categorization.
- gestational diabetes describes women with impaired glucose tolereance that appears or is first detected during pregnancy. Gestational diabetes usually appears in the 2 nd or 3 rd trimester, a time when pregnancy-associated insulin antagonistic hormones peak. After delivery, glucose tolerance generally (but not always) reverts to normal.
- the diagnosis of diabetes is usually straightforward when the classic symptoms of polyuria, polydipsia, and weight loss are present. All that is required is a random plasma glucose measurement from venous blood that is 200 mg/dL or greater. If diabetes is suspected but not confirmed by a random glucose determination, the screening test of choice is overnight fasting plasma glucose level. The diagnosis is established if fasting is equal to or greater than 126 mg/dL on at least two separate occasions.
- Impaired glucose tolerance (IGT) and impaired fasting glucose (IFG) are terms applied to individuals who have glucose levels that are higher than normal, (under fed or fasting conditions, respectively) but lower than those accepted as diagnostic for diabetes mellitus. Both conditions are associated with an increased risk for cardiovascular disease, but do not produce the classic symptoms or the microvascular and neuropathic complications associated with diabetes mellitus. In a subgroup of patients (about 25 to 30%), however, type 2 diabetes eventually develops.
- Impaired Glucose Metabolism is defined by blood glucose levels that are above the normal range but are high enough to meet the diagnostic criteria for type 2 diabetes mellitus. The incidence of IGM varies from country to country, but usually occurs 2-3 time more frequently than overt diabetes. Until recently, individuals with IGM were felt to be pre-diabetics, but data from several epidemiological studies argue that subjects with IGM are heterogeneous with respect to their risk of diabetes and their risk of cardiovascular morbidity and mortality. The data suggest that subjects with IGM , in particular, those with impaired glucose tolerance (IGT), do not always develop diabetes, but whether they are diabetic or not, they are, nonetheless, at high risk for cardiovascular morbidity and mortality.
- IGM impaired glucose tolerance
- IGT Impaired Glucose tolerance
- IFG impaired fasting glucose
- IFG/IGT both abnormalities
- Insulin resistance is not primarily due to a diminished number of insulin receptors but to a post-insulin receptor binding defect that is not yet understood. This resistance to insulin responsiveness results in insufficient insulin activation of glucose uptake, oxidation and storage in muscle and inadequate insulin repression of lipolysis in adipose tissue and of glucose production and secretion in the liver.
- subject refers to an animal, preferably a mammal, most preferably a human, who has been the object of treatment, observation or experiment.
- terapéuticaally effective amount means that amount of active compound or pharmaceutical agent that elicits the biological or medicinal response in a tissue system, animal or human, being sought by a researcher, veterinarian, medical doctor or other clinician, which includes alleviation of the symptoms of the disease or disorder being treated.
- the term “pharmaceutically acceptable” embraces both human and veterinary use: for example the term “pharmaceutically acceptable” embraces a veterinarily acceptable compound or a compound acceptable in human medicine a health care.
- acyl can denote a C1-20 acyl residue, preferably a C1-8 acyl residue and especially preferred a C1-4 acyl residue
- cycloalkyl can denote a C3-12 cycloalkyl residue, preferably a C4, C5 or C6 cycloalkyl residue
- carbocyclic can denote a C3-12 carbocyclic residue, preferably a C4, C5 or C6 carbocyclic residue.
- Heteroaryl is defined as an aryl residue, wherein 1 to 4, and more preferably 1, 2 or 3 ring atoms are replaced by heteroatoms like N, S or O.
- Heterocyclic is defined as a cycloalkyl residue, wherein 1, 2 or 3 ring atoms are replaced by heteroatoms like N, S or O.
- “Peptides” are selected from dipeptides to decapeptides, preferred are dipeptides, tripeptides, tetrapeptides and pentapeptides. The amino acids for the formation of the “peptides” can be selected from those listed above.
- alkyl can denote a C 1-50 alkyl group, preferably a C 6-30 alkyl group, especially a C 8-12 alkyl group; for example, an alkyl group may be a methyl, ethyl, propyl, isopropyl or butyl group.
- alk for example in the expression “alkoxy”, and the expression “alkan”, for example in the expression “alkanoyl”, are defined as for “alkyl”; aromatic compounds are preferably substituted or optionally unsubstituted phenyl, benzyl, naphthyl, biphenyl or anthracene groups, which preferably have at least 8 C atoms;
- alkenyl can denote a C 2-10 alkenyl group, preferably a C 2-6 alkenyl group, which has the double bond(s) at any desired location and may be substituted or unsubstituted;
- alkynyl can denote a C 2-10 alkynyl group, preferably a C 2-6 alkynyl group, which has the triple bond(s) at any desired location and may be substituted or unsubstituted;
- substituted or substituent can denote any desired substitution by one or more, preferably one or two, alkyl
- the inventors of the present application unexpectedly show, that the biodegradation of different substrates, which bind to the same catalytic domain of DP IV and/or DP IV-like enzymes, can be modulated in an unexpected very specific manner.
- the invention provides a method to identify the site in the DP IV protein or in DP IV-like enzymes or in both, DP IV and DP IV-like enzymes which is responsible for the modulation of the substrate specificity of DP IV and also provides new compounds, which regulate the substrate specificity of DP IV and which are useful for the treatment of, for example, impaired glucose tolerance, glucosuria, lipid disorders, dyslipidemia, hyperlipidaemia, hypertriglyceridemia, hypercholesterolemia, low HDL levels, high LDL levels, metabolic acidosis, hyperglycemia, diabetes mellitus, diabetic neuropathy and nephropathy and of sequelae caused by diabetes mellitus in mammals, metabolism-related hypertension and cardiovascular sequelae caused by hypertension in mammals, for the prophylaxis or treatment of skin diseases and diseases of the mucosae, autoimmune diseases and inflammatory conditions, and for the treatment of psychosomatic, neuropsychiatric and depressive illnesses, such as anxiety, depression, sleep disorders, chronic fatigue,
- Target diseases for DP IV-inhibition Target disease Development stage
- AIDS cell culture mechanism not fully understood Autoimmune cell culture and animal high doses necessary diseases models
- Rheumatoid animal models Arthritis Multiple sclerosis animal experiments
- Psoriasis cell culture and animal experiments Graft rejection animal experiments Wound healing Anxiety effective in animal models Diabetes type II Phase II studies
- Cancer cell culture, animal models DP IV and FAP are involved Obesity animal experiments NPY, GLP-1 and orexine mediated
- the problem of the invention is solved by using a prolyl oligopeptidase (POP) based computer-generated model of DP IV and of the crystal structure of DP IV for the identification of secondary binding sites of DP IV and by providing specific compounds, which bind to at least one secondary binding site and are able to modify very differently and/or specifically the DP IV-catalyzed truncation of substrates of DP IV and DP IV-like enzymes, e.g. bioactive peptides.
- POP prolyl oligopeptidase
- FIG. 1 shows a plot of the distribution of the backbone dihedral angles of the complete model of human DP IV. There are no residues in disallowed regions, but some residues are located in only generously allowed areas. Most of them represent residues in loops at the surface of the propeller domain.
- the plot statistics is a measure for the plot quality.
- the plot statistics for FIG. 1 is as follows: Residues in most favoured regions 435 62.8% Residues in additionally allowed regions 226 32.6% Residues in generously allowed regions 32 4.6% Residues in disallowed regions 0 0.0% Number of non-glycine and non-proline residues 693 100.0% Number of end-residues (excl. Gly and Pro) 1 Number of glycine residues (shown as triangles) 43 Number of proline residues 29 Total number of residues 766
- FIG. 2 shows the analysis of the quality of the model of human DP IV with regard to some essential stereo-chemical parameters.
- the plot statistics is as follows: No. of Comparison band Values widths Stereochemical No. of Parameter Typical Band from parameter data points value value width mean a. %-tage residues in 693 63.9 83.8 10.0 ⁇ 2.0 WORSE A, B, L b. Omega angle 765 4.7 6.0 3.0 ⁇ 0.4 Inside standard deviation c. Bad contacts/100 19 2.5 4.2 10.0 ⁇ 0.2 Inside residues d. Zeta angle standard 723 3.5 3.1 1.6 0.3 Inside deviation e. H-bond energy 389 0.9 0.8 0.2 0.5 Inside standard deviation f. Overall G-factor 766 ⁇ 0.6 ⁇ 0.4 0.3 ⁇ 0.5 Inside
- FIG. 3 shows the computer-assisted structure model of DP IV and the ADA-binding site (indicated by the arrows and amino acid residue numbers);
- FIG. 4 shows the active site of DP IV docked with the active site DP IV-inhibitor isoleucyl pyrrolidine (Ile-Pyr) (dark gray);
- FIG. 5 shows the interaction of Lys-Z-nitro-pyrrolidine with the active site of DP IV
- FIG. 6 shows the tetrahedral intermediate of Asp-Pro-pNA bound to DP IV
- FIG. 7 shows the interaction of the HIV-tat(1-9) protein with DP IV
- FIG. 8 shows the docking of the N-terminal nonapeptide of the tromboxane receptor
- FIG. 9 shows the 3D-structure model of the interaction between GIP (black thread) and human DP IV;
- FIG. 10 shows the docking arrangement of GIP (black) to the active site of DP IV;
- FIG. 11 shows the molecular dynamic simulation based model of the tertiary structure of GIP (middle part), bound to DP IV. Important amino acid residues from the enzyme are shown in light gray, those from GIP are shown in black, respectively;
- FIG. 12 shows the docking of VIP (black) to the active site of DP IV
- FIG. 13 shows the docking of the C-terminal part of VIP to DP IV
- FIG. 14 shows the docking of glucagon (black) to the active site of DP IV
- FIG. 15 shows the molecular dynamic simulation based model of the hexapeptide TFTSDY, bound to the secondary binding site of DP IV. Important amino acid residues from the enzyme are light gray, those from the hexapeptide are marked in dark gray, respectively;
- FIG. 16 shows the prolongation of the half-lifes of GIP, Glucagon, PACAP-27 and PACAP-38 by the hexapeptide TFTSDY in a DP IV (porcine and recombinant human) catalyzed peptide truncation test;
- FIG. 17 shows the DP IV-catalyzed hydrolysis of RANTES1-15 with (black solid triangle or broken line) or without TFTSDY (black solid square or straight line);
- FIG. 18 shows the DP IV-catalyzed hydrolysis of GIP with (black solid triangle) or without TFTSDY (black solid square);
- FIG. 19 shows the DP IV-catalyzed hydrolysis of glucagon with (black solid circle) or without TFTSDY (black solid triangle);
- FIG. 20 shows a plot of the distribution of the backbone dihedral angles of the complete model of porcine DP IV. All residues are in most favored and additional allowed regions. The plot statistics is as follows: Residues in most favoured regions (A, B, L) 457 66.0% Residues in additional allowed regions (a, b, l, p) 235 34.0% Residues in generously allowed regions ( ⁇ a, ⁇ b, ⁇ l, ⁇ p) 0 0.0% Residues in disallowed regions 0 0.0% Number of non-glycine and non-proline residues 692 100.0% Number of end-residues (excl. Gly and Pro) 2 Number of glycine residues (shown as triangles) 44 Number of proline residues 31 Total number of residues 769
- FIG. 21 shows the analysis of the quality of the model of porcine DP IV with regard to some essential stereo-chemical parameters of the main chain.
- the plot statistics is as follows: No. of Comparison band No. of Values widths data Parameter Typical Band from Stereochemical parameter points value value width mean a. %-tage residues in A, B, L 692 66.0 83.8 10.0 ⁇ 1.8 WORSE b. Omega angle standard 765 8.5 6.0 3.0 0.8 Inside deviation c. Bad contacts/100 residues 2 0.3 4.2 10.0 ⁇ 0.4 Inside d. Zeta angle standard deviation 725 2.1 3.1 1.6 ⁇ 0.6 Inside e. H-bond energy standard 400 0.8 0.8 0.2 ⁇ 0.1 Inside deviation f. Overall G-factor 769 ⁇ 0.4 ⁇ 0.4 0.3 ⁇ 0.1 Inside
- FIG. 22 shows the analysis of the quality of the model of porcine DP IV with regard to some essential stereo-chemical parameters of the side chains.
- the plot statistics is as follows: No. of band No. of Comparison Values widths data Parameter Typical from Stereochemical parameter points value value
- Band width mean a. Chi-1 gauche minus 156 16.2 18.1 6.5 ⁇ 0.3 Inside standard deviation b. Chi-1 trans standard 218 17.9 19.0 5.3 ⁇ 0.2 Inside deviation c. Chi-1 gauche plus standard 279 17.6 17.5 4.9 0.0 Inside deviation d. Chi-1 pooled standard 653 18.0 18.2 4.8 0.0 Inside deviation e. Chi-2 trans standard 144 16.3 20.4 5.0 ⁇ 0.8 Inside deviation
- FIG. 23 shows soluble DP IV from prorcine kidney, which forms a 2-2-2 symmetric assembly as dimer of dimers.
- the view is along one two-fold axis. Potential glycosylation sites are indicated as grey spheres, black spheres are the sites modified in the crystal structure.
- the transmembrane helices and their orientation to the membrane were modeled to illustrate how tetramerization of DP IV can mediate cell-cell contacts. The figure was prepared by using the program MOLSCRIPT and RASTER3D.
- FIG. 24 shows a topology diagram illustrating the domain structure of porcine kidney DP IV.
- Blade IV of the propeller is involved in both the dimer contact (IV A-IV B: L235-P255, together with the highlighted C-terminal three secondary structure elements F713-C762) and the tetramerization of DP IV (IV A-IV C and IV B-IV C, not shown).
- FIG. 25 shows oligomerization interfaces.
- A Detailed view perpendicular to the dimer two-fold axis. The experimental electron density after phase extension to 2.0 ⁇ resolution is superimposed on key residues mediating the contact.
- B View along the two-fold axis on the tetramerization interface. Blades IV of each subunit align to form an eight-bladed antiparallel ⁇ sheet. The highlighted Leu294 and Val341 are involved in ADA binding. The figure was prepared using BOBSCRIPT, MOLSCRIPT and RASTER3D.
- FIG. 26 shows substrate recognition by procine kidney DP IV.
- A The peptidomimetic active-site inhibitor p-Iodo-Phe-Pyr-CN is bound to active site. The accessible surface is indicated and cut-open (dark gray area at the top of the figure) for better visibility.
- B Schematic representation of the active site access in tricom and DP IV. The figure was prepared by using the programs MAIN , MOLSCRIPT, GRASP and RASTER3D.
- FIG. 27 shows the DP IV-catalyzed hydrolysis of GIP 1-42 with (black solid squares) or without the heptapeptide H-Ser-D-Glu-Thr-Gly-D-Val-D-Lys-D-Val-OH (black solid triangles).
- the inventors of the present application unexpectedly show, that the biodegradation of substrates, which bind to the same catalytic domain of DP IV, can be modulated very specifically.
- One aspect of the invention is to identify the site in the DP IV protein, which is responsible for the modulation of the substrate specificity and selectivity of DP IV and DP IV-like enzymes and to provide new compounds, which regulate the substrate selectivity and/or activity of DP IV and DP IV-like enzymes and which are useful for the treatment of, for example, impaired glucose tolerance, glucosuria, lipid disorders, dyslipidemia, hyperlipidaemia, hypertriglyceridemia, hypercholesterolemia, low HDL levels, high LDL levels, metabolic acidosis, hyperglycemia, diabetes mellitus, diabetic neuropathy and nephropathy and of sequelae caused by diabetes mellitus in mammals, metabolism-related hypertension and cardiovascular sequelae caused by hypertension in mammals, for the prophylaxis or treatment of skin diseases and diseases of the mucosae, autoimmune diseases and inflammatory conditions, and for the treatment of psychosomatic, neuropsychiatric and depressive illnesses, such as anxiety, depression, sleep disorders, chronic fatigue,
- DP IV is inhibited by compounds mimicking the N-terminal dipeptide part of a DP IV-substrate.
- compounds interacting with DP IV-binding sites far distant from the catalytic center are capable to differentiate the degradation of different substrates, e.g. peptide substrates, or even discriminate DP IV-catalyzed hydrolysis completely.
- the substrate properties of the peptides of the growth hormone releasing factor (GRF) family against DP IV were examined.
- the GRF family consists of the following peptide hormones:
- the resulting K m -values were independent from the amino acid in the P 1 -position. That means that the binding of substrates to DP IV is not mainly affected by the P 1 -residue rather than by secondary interactions between substrate and DP IV protein.
- GIP 1-30 and GIP 1-6 are: GIP 1-30: YAEGTFISDYSIAMAKIHQQAFVNWLLAQK GIP 1-6: YAEGTF
- a hexapeptide derived from a consensus sequence of the amino acid sequences of GRF-family peptides was synthesized and its influence on the substrate specificity of DP IV was measured.
- the selected consensus sequence corresponds to glucagon 5-10 , comprising the amino acid sequence TFTSDY.
- hexapeptides TFTSDY and TFTDDY were found to be instable in biological fluids, e.g. humen serum or human plasma and/or they were rapidly degraded by proteolytic enzymes in the serum or plasma. Therefore, and in another embodiment of the present invention, a heptapeptide of the sequence H-Ser-D-Glu-Thr-Gly-D-Val-D-Lys-D-Val-OH was synthesized. This heptapeptide is not enzymatically degraded in human serum or plasma and is stable in these fluids. A stabilization of the heptapeptide was especially achieved by the incorporation of D-amino acids in the molecule. It was further shown to be very effective in improving the substrate specificity of DP IV compared to control experiments without the heptapeptide.
- the existence of a secondary binding site was proven, e.g. using a set of dipeptide compounds, coupled to a chromogenic (p-nitroaniline, pNA) or fluorogenic (aminomethylcoumarine, AMC) group.
- the dipeptides His-Pro, His-Ala, His-Ser, His-Val, His-Gly, and His-Thr represent the first two amino acids from the N-terminus of the following peptide hormones: GIP, GLP-1, GLP-2, PACAP, VIP, PHM and glucagon.
- the peptide hormones GIP, GLP-1, GLP-2, PACAP, VIP, PHM and glucagon are substrates of DP IV.
- DP IV hydrolizes these peptide hormones and the respective N-terminal dipeptides are released. In contrast, the dipeptides are much slower released, when they are coupled to the chromogenic (p-nitroaniline, pNA) or fluorogenic (aminomethylcoumarine, AMC) group. Secondary interactions of the peptide hormones GIP, GLP-1, GLP-2, PACAP, VIP, PHM and glucagon far from the DP IV active site must exist as a prerequisite for substrate recognition.
- Prolyl oligopeptidase (POP) based computer-generated models of human DP IV and porcine DP IV and the crystal structure of porcine DP IV were used according to the present invention to predict enzyme-substrate-interactions and to identify the interaction site in the DP IV protein structure.
- the model of DP IV used herein is in a state where the overall fold is correct and highly useful for the explanation of experimental results and to allow predictions of recommendations for positions of site directed mutagenesis, development of ligands based on the identified second binding site or selective ligands to bind at the closer active site.
- a region was identified in the DP IV-protein, which is responsible for the interaction with a hexapeptide, e.g. TFTSDY or TFTDDY, or more suitably, a degadation resistent heptapeptide, e.g. H-Ser-D-Glu-Thr-Gly-D-Val-D-Lys-D-Val-OH.
- a degadation resistent heptapeptide e.g. H-Ser-D-Glu-Thr-Gly-D-Val-D-Lys-D-Val-OH.
- the most important amino acids for the formation of the secondary binding site on DP IV for the GRF family of peptide hormones were found to be but are not restricted to L90, E 91, T 152, W154, W157, R310, Y330, R318, Y416, S460, K463, E464 and R560.
- the sequence and 1.8 ⁇ crystal structure of native DP IV prepared from porcine kidney were determined.
- the crystal structure reveals a 2-2-2 symmetric tetrameric assembly which depends on the natively glycosylated ⁇ -propeller blade IV.
- the crystal structure indicates that tetramerization of DP IV is a key mechanism to regulate its interaction with other components.
- Each subunit comprises two structural domains, the N-terminal eight-bladed ⁇ -propeller with open Velcro topology and the C-terminal ⁇ / ⁇ -hydrolase domain. Analogy with the structurally related POP and tricom protease suggests that substrates access the buried active site through the ⁇ -propeller tunnel while products leave the active site through a separate side exit.
- a dipeptide mimicking inhibitor complexed to the active site discloses key determinants for substrate recognition, including a Glu-Glu motif which distinguishes DP IV as an aminopeptidase and an oxyanion trap which binds and activates the P 2 -carbonyl oxygen necessary for efficient post-proline cleavage.
- porcine DP IV was refined by using the program CNS with current R-values of 21.7% (working set) and 24.9% (test set) and deviations from ideality of 0.008 ⁇ (bond length) and 1.4 degree (angle deviation).
- the monomer comprises an N-terminal ⁇ -propeller domain (Arg54-Asn497) followed by the catalytic domain Gln508-Pro766.
- the crystal structure reveals a dimer of DP IV dimers in the crystallographic unit cell obeying a 222 symmetry with all axes intersecting, FIG. 23 .
- the dimer interface is dominated by hydrophobic interactions, with a central and well shielded aromatic stacking involving Trp734 and Phe713 of both monomers.
- the hydrophobic contacts are complemented by polar interactions such as Asp729 with His754 and His757, FIG. 25A .
- the Gln731(O ⁇ 1)-Gln731(N ⁇ 2) contact resembles a subtle (atomic) break of the exact two-fold symmetry within the dimer. The residues critical to the dimerization are strictly conserved throughout all species.
- the dimer-dimer interface has a more hydrophilic character.
- the strands Asn279-Gln286 of each DP IV-dimer form an antiparallel ⁇ -sheet, thus extending propeller blade IV to an eight-stranded antiparallel sheet, FIG. 25B .
- An additional contribution to the tetrameric assembly in our crystals arises from the outer strands of blade V.
- the residues contributing to the dimer-dimer contact are similar over different species, albeit especially in rodents not strictly identical. More importantly, there are no insertions or deletions in the outer ⁇ strands of blade IV with a contact area of 570 ⁇ 2 per monomer.
- Asn279 is located at the tetramerization interface and is glycosylated ( FIGS. 23, 25B ).
- glycosylation of Asn279 might provide one missing regulatory link which was proposed to control the assembly of a 900 kDa oligomer (Lambeir, A. M., Pereira, J. F. D., Chacon, P., Vermeulen, G., Heremans, K., Devreese, B., VanBeeumen, J., Demeester, I. & Scharpe, S. (1997) Biochim. Biophys. Acta 1340, 215-226.).
- the ⁇ -propeller The N-terminal ⁇ -propeller domain contains eight blades with four antiparallel strands each.
- the first and the last blade of a ⁇ -propeller is clamped together either covalently by disulfide bond formation (four-bladed ⁇ -propellers) or by strand exchange between the first and last blade (five to eight-bladed propellers). So far there are three exceptions to this closed propeller topology rule, namely the seven bladed ⁇ -propeller of POP (Fülöp, V., Bocskei, Z. & Polgár, L.
- the ⁇ 8-propeller of DP IV can also be classified as an open Velcro-type topology, because no segment C-terminal to blade VIII interacts with the first propeller blade.
- the interaction of the first strand within blade I is limited to Thr59-Ile63 while its N-terminal extension Phe53-Tyr58 tightens up the propeller structure by interacting with the immediate C-terminal extension to the fourth strand of blade VIII (Glu499-Met503).
- a similar, yet shorter, external clamp has been described for the ⁇ 7-propeller of the tricorn protease (Brandstetter, H., Kim, J. -S., Groll, M. & Huber, R. (2001) Nature 414, 466-469.).
- Cys649-Cys762 all disulfide bonds are located in the ⁇ propeller domain where they form intra-blade stabilizing crosslinks exclusively, FIG. 24 .
- Cys339 in the human sequence is replaced by Ser339 in the porcine sequence which causes the absence of the disulfide bond connecting strand 3 and 4 of blade V (Cys328-Cys339 in human DP IV), although the backbone conformation of the strands would readily allow a disulfide bond to be formed.
- all glycosylation sites but Asn685 are located on the ⁇ -propeller. Five of in total 10 potential glycosylation sites cluster at the top surface side oriented away from the catalytic domain.
- the shape of the DP IV- ⁇ 8-propeller is asymmetric where blades VI, VII, VIII, I, and blades II, III, IV, V form more compact subdomains, respectively ( FIGS. 23, 25B ).
- the structural division of the ⁇ -propeller fits physico-chemical data which indicated a three domain organization of DP IV (Lambeir, A. M., Pereira, J. F. D., Chacon, P., Vermeulen, G., Heremans, K., Devreese, B., VanBeeumen, J., Demeester, I. & Scharpe, S. (1997) Biochim. Biophys.
- the ellipsoidal tunnel through the propeller is continuously open. At the solvent exposed opening, its diameter measures 9 ⁇ and 15 ⁇ from blade IV to VIII and from blade II to VI, respectively.
- the tunnel widens towards the catalytic domain with opening diameters of 15 ⁇ and 25 ⁇ between the same pairs of propeller blades. By its dimensions, the tunnel allows for direct passage of an extended peptide, but not for a folded ⁇ -helix.
- the Catalytic domain is located at the C-terminus of DP IV and spans residues Gln509 to Pro766. It adopts a typical ⁇ / ⁇ -hydrolase fold with a central 8 stranded ⁇ sheet, where only the second strand Thr522-Pro531 deviates from the otherwise parallel strand polarity, FIG. 23 .
- the ⁇ -sheet exerts a significant twist of more than 90 degrees, in line with observations on related ⁇ / ⁇ -hydrolases.
- Cys649-Cys762 crosslinks the C-terminal helix Met746-Ser764 with the sixth strand of the ⁇ -sheet (Lys648-Ala654), thus stabilizing its tertiary arrangement.
- the ⁇ -sheet is sandwiched by several a-helices, including helix Tyr631-Ala642 immediately succeeding the catalytic Ser630.
- Ser630 is embedded in the surrounding secondary structure framework where it participates both in the preceding strand 4 (Arg623-Trp629) as well as in the following helix Tyr631-Ala642. This causes a strained backbone conformation of the active site Ser630.
- the sequential and three-dimensional arrangement of the catalytic residues Ser630, His740, Asp708 corresponds to that of related ⁇ / ⁇ -hydrolases.
- the oxyanion hole is formed by the amide Tyr631 and the hydroxyl O ⁇ of Tyr547 and serves to recognize and activate the carbonyl oxygen of the P 1 -residue. It is occupied by a water molecule in the uninhibited structure.
- the structure of a dipeptid mimetic, the iodinated Phe-cyanopyrrolidide inhibitor in complex with DP IV was determined ( FIG. 26A ).
- the active site nucleophile forms a covalent bond with the scissile carbonyl carbon of the cyanopyrrolidine of the inhibitor.
- the bending of the linkage indicates the formation of a stable carbaminic acid adduct.
- the pyrrolidine ring is accommodated by a hydrophobic pocket formed by side chains of Tyr666, Tyr662, Val711, Val656 and Trp659. While this environment is almost perfectly suited for the imino acid proline as P 1 -residue, the hydroxyl O ⁇ of Tyr662 would be correctly positioned to interact with the normal amide nitrogen of an amino acid in P 1 .
- the inhibitor also unambiguously maps the S 2 -site.
- the P 2 -carbonyl oxygen gets trapped in an electrostatic sink formed by the side chains of Arg125 and Asn710.
- Glu205 and Glu206 and to a lesser extent the carbonyl oxygen of Glu205, interact with the free amino terminus of the P 2 -residue, thus determining the dipeptidyl “amino”-peptidase activity of the enzyme.
- the ⁇ -propeller which provides essential determinants for P 2 -recognition, namely Arg125, which is positioned on the hairpin loop between strands 2 and 3 of blade II and Glu205-Glu206, positioned on a short helical insertion within strand 1 of the ⁇ propeller blade IV.
- Ample space is available to accommodate voluminous side chains such as Tyr or Trp in P 2 , FIG. 26A .
- the phenyl ring of the P 2 -residue is iodated rather than hydroxylated. It forms an ionic interaction with Arg358, FIG. 26A .
- the ⁇ -propeller domain covers the active site and thereby restricts the substrate access to it.
- There are two possible routes to the active site namely through the tunnel of the ⁇ -propeller and through a side opening. Similar as the propeller tunnel, the shape of the side entrance is oval with dimensions of 15 ⁇ and 22 ⁇ .
- the side opening to the active site is generated by the kinked blade arrangement of blade I and II, FIG. 23 . In POP, blades I and II are arranged more regularly and there is no side opening to the active site chamber.
- the distance from the protein surface to the active site measures 20 ⁇ and 37 ⁇ through the side opening and the propeller tunnel, respectively.
- both routes give active site access to unfolded peptidic substrates, but the side entrance is significantly shorter and less winded. Once the substrate has been cleaved, two products have to leave the active site chamber. Clearly, the product exit route differs from the entrance to the active site.
- DP IV is known as a cell-cell communication molecule.
- soluble dimers can assemble to form a homotetramer, as observed in the crystal structure described above. The tetramer assembles to enclose a large cavity. Since tetramerization of DP IV depends on the correctly glycosylated propeller blade IV, glycosylation could function as a quality control unit.
- Dimerization is mediated by the three C-terminal secondary structure elements positioned on the catalytic domain, and a finger like insertion motif within strand 2 and 3 of propeller blade IV.
- DP IV is known to form heterodimers with fibroblast activation protein ⁇ (FAP ⁇ , seprase). Like DP IV (FAP ⁇ ), FAP ⁇ lacks an N-terminal extension as found in POP. Moreover, the essential elements of the DP IV-dimerization motif are also present in FAP ⁇ , including the extension of strand 2 and 3 of propeller blade IV.
- dimerization is not required to complete the active site architecture of DP IV, as for example in the case of tricorn (Brandstetter, H., Kim, J. -S., Groll, M. & Huber, R. (2001) Nature 414, 466-469.). Instead, dimerization and tetramerization will affect interaction with other components, including proteolytic substrates and ADA and mediate cell-cell contacts. Moreover, dimerization of DP IV is likely to enhance the receptor-ligand affinity by bivalent interaction. Finally, it is likely that dimerization is critical for signal transduction into the cell.
- the hydrophobic S 1 -pocket visualizes that proline is perfectly suited as a P 1 -residue, although it will also fit other small uncharged residues such as alanine or serine.
- the S 1 -site implements a mechanism to adapt to both imino and amino acids in P 1 -position.
- the hydroxyl O ⁇ of Tyr662 is able to form a hydrogen bond with the P 1 -amide nitrogen and thus optimally presents the substrate for catalysis.
- the proper orientation of proline in P 1 -position is achieved by its side chain interaction in addition to the binding to the oxyanion pocket.
- the hydroxyl of Tyr662 can slightly reorient to form a hydrogen bond with the side chain O ⁇ 1 of Asn710, FIG. 26A .
- the recognition of the P 2 -residue is dictated by main chain interactions with two prominent anchor sites, namely Glu205-Glu206 which form a twin-single salt bridge with the free amino terminus of the P 2 -residue; and Arg125 together with N ⁇ 2 of Asn710 which stabilize and activate the P 2 -carbonyl oxygen.
- the Glu205-Glu2O6 motif is highly conserved in the DP IV gene family and it has been shown by site directed mutagenesis to be essential for enzymatic activity.
- ⁇ -propeller architecture The tunnel through the eight-bladed ⁇ -propeller widens from the surface towards the active site of DP IV.
- Tricom protease is a serine protease with low but significant structural homology to the family of ⁇ / ⁇ -hydrolases. This similarity suggests that the ⁇ 8-propeller provides substrate access to and the side opening product release from the DP IV active site.
- This tricom-derived model is able to explain the high substrate selectivity critical for DP IV-function to activate or inactivate regulatory peptides.
- DP IV binds adenosine deaminase (ADA) to the T-cell surface, thereby preventing the cell from adenosine mediated inhibition of proliferation.
- DP IV-ADA complex formation is presumably hydrophobically driven, as the complex dissociates at very low ionic strength.
- Leu294 and Val341 were identified as two ADA binding sites (Abbott, C. A., McCaughan, G. W., Levy, M. T., Church, W. B. & Gorrell, M. D. (1999) Eur. J Biochem. 226, 798-810.).
- Leu294 and Val341 are positioned at the outer strand of the tetramerization blade IV and blade V, respectively. Therefore, ADA-binding will interfere with tetramerization. Similarly, the glycosylation of Asn279 (Asn281 in the human sequence) is likely to influence ADA-binding. This teaches that tetramerization of DP IV and proper glycosylation of Asn279 serve as major control mechanism for ADA-binding
- DP IV as a target for drug design.
- the inhibitor structure used to establish the crystal structure of DP IV in the present invention identified important recognition elements at DP IV's active site and represents an excellent starting point for rational design of active site directed inhibitors.
- DP IV's involvement in a great variety of physiological processes poses a high challenge to avoid unwanted side effects for any DP IV drug development program.
- Active site directed DP IV inhibitors will interfere with the complete DP IV proteolytic activity and might even interfere with structurally related members of the ⁇ - ⁇ hydrolase family.
- a secondary binding site in the DP IV protein and/or DP IV-like enzymes is identified. More preferred, the existence of this secondary binding site can be used to influence the selectivity of the DP IV-catalyzed biodegradation of DP IV-substrates, e.g. alanine (GIP), proline (GRP) or serine (glucagon) substrates, dependent on the amino acid residue in the PI position and dependent on the tertiary structure of the DP IV-substrates.
- DP IV-substrates, the biodegradation whereof shall be regulated according to the invention with compounds, which bind to the secondary binding site, are serine substrates.
- DP V-substrates have a chain length of more than 5 amino acid residues, more preferably more than 10 amino acid residues. Most preferred are substrates with more than 15 amino acid residues up to 70 amino acid residues.
- compounds for the modulation of DP IV-catalyzed biodegradation of DP IV-substrates which compounds bind to the secondary binding site of DP IV or DP IV-like enzymes.
- Such compounds are e.g. selected from the compounds of the formulas a)-d):
- the present invention provides agents, which bind to both the active site and the secondary binding site of DP IV and DP IV-like enzymes and thereby simultaneously modulate the enzyme activity and substrate specificity of DP IV or DP V-like enzymes.
- DP IV is present in a wide variety of mammalian organs and tissues e.g. the intestinal brush-border ( Gutschmidt S . et al., “In situ”—measurements of protein contents in the brush border region along rat jejunal villi and their correlations with four enzyme activities. Histochemistry 1981, 72 (3), 467-79), exocrine epithelia, hepatocytes, renal tubuli, endothelia, myofibroblasts (Feller A. C. et al., A monoclonal antibody detecting dipeptidylpeptidase IV in human tissue. Virchows Arch. A. Pathol. Anat. Histopathol.
- Serum high molecular weight dipeptidyl peptidase IV (CD26) is similar to a novel antigen DPPT-L released from activated T cells. J. Immunol. 1996, 156 (5): 1714-21). It is also a goal of the present invention to minimize possible side effects of currently available DP IV-inhibitors by the control and management of the DP IV substrate specificity for the selective treatment of a DP IV mediated disease.
- DP IV was originally believed to be the only membrane-bound enzyme specific for proline as the penultimate residue at the amino-terminus of the polypeptide chain.
- DP IV-like enzymes which are identified so far, are e.g.
- fibroblast activation protein ⁇ dipeptidyl peptidase IV ⁇ , dipeptidyl aminopeptidase-like protein, N-acetylated ⁇ -linked acidic dipeptidase, quiescent cell proline dipeptidase, dipeptidyl peptidase II, attractin and dipeptidyl peptidase IV related protein (DPP 8), DPL1 (DPX, DP6), DPP 9 and DPL2 (DPP 10) are described in the review articles by Sedo & Malik (Sedo & Malik, Dipeptidyl peptidase IV-like molecules: homologous proteins or homologous activities?
- Another preferred embodiment of the present invention comprises screening methods for agents which bind to the secondary binding site and/or modulate the selectivity and/or the activity of DP IV and/or DP IV-like enzymes.
- An agent according to the invention preferably binds to at least one secondary binding site of the DPIV or DP IV-like enzyme proteins.
- the screening method for agents of the secondary binding site comprises the following steps:
- the agents selected by the above described screening method can work by regulating (increasing or decreasing) the biodegradation of at least one substrate of DP IV or the DP IV-like enzyme, preferably by the prolongation of the half-life of such substrate, most preferably by the inhibition of the biodegradation of such substrate.
- DP IV or DP IV-like enzymes as used in the screening method described above mean purified DP IV or DP IV-like enzymes from mammals, selected from but not restricted to human, monkey, mouse, rat etc., or DPIV or DP IV-like enzyme containing cells and cell lines from mammals, selected from but not restricted to human, monkey, mouse, rat etc., or DP IV or DP IV-like enzyme containing cell extracts or body liquids e.g. liver extracts, blood plasma samples, blood serum samples, brain extracts etc., from such mammals.
- an agent increases the selectivity and/or activity of DP IV or DP IV-like enzymes towards substrates by at least about 10, preferably about 50, more preferably about 75, 90 or 100% relative to the absence of the agent. More preferably, an agent increases the selectivity and/or activity of DP IV or DP IV-like enzymes towards specific substrates by at least about 10, preferably about 50, more preferably about 75, 90 or 100% and prolongs the half live of the substrates in the serum or in the plasma of a mammal at least about 1 fold, preferably about 2fold, more preferably about 3fold, 4fold or higher relative to the absence of the agent.
- an agent increases the selectivity and/or activity of DP IV or DP IV-like enzymes in such a way that the half live of at least one substrate in the serum or in the plasma of a mammal is increased at least about 1fold, preferably about 2fold, more preferably about 3fold, 4fold or higher, most preferably complete inhibition of the degradation of such a substrate is achieved, relative to the absence of the agent.
- the agents modulate the interaction between DP IV or DP IV-like enzymes and binding proteins thereof.
- Binding proteins are proteins that bind other proteins in a non-covalent manner and thereby modulate their activity or serve as carriers of these proteins.
- Binding proteins of DP IV identified so far include adenosine deaminase, two proteins of HIV, transactivator protein (tat) and the gp120 envelope protein, CD45, a membrane located tyrosine phosphatase, extracellular matrix proteins, such as collagen and fibronectin, plasminogen and streptokinase, mannose 6-phosphat/insulin-like growth factor II receptor, the isoform NH3 of the Na + /H + exchanger from renal microvilly membranes and the thromboxane A2 receptor.
- the selectivity and/or activity modifying effectors block the product release site of DP IV and/or DP IV-like enzymes.
- selectivity and/or activity modifying effectors which prevent the tetramerization of DP IV and/or DP IV-like enzymes at the cell surface between a soluble DP IV dimer pair or dimers located on the surface of two different cells in a mammal.
- Agents can be pharmacological agents already known in the art or can be compounds previously unknown to have any pharmacological activity.
- the compounds can be naturally occurring or designed in the laboratory. They can be isolated from microorganisms, animals, or plants, and can be produced recombinantly, or synthesized by chemical methods in the art. If desired, agents can be obtained using any of the numerous combinatorial library methods known in the art, including but not limited to, biological libraries, spatially addressable parallel solid phase or solution phase libraries, synthetic library methods requiring deconvolution, the “one-bead-one-compound” library method, and synthetic library methods using affinity chromatography selection.
- the biological library approach is limited to polypeptide libraries, while the other four approaches are applicable to polypeptide, non-peptide oligomer, or small molecule libraries of compounds. See Lam, Anticancer Drug Des., 12, 145, 1997.
- Agents can be screened for the ability to bind to DP IV or DP IV-like enzymes or to affect DP IV or DP IV-like enzyme activity using high throughput screening.
- high throughput screening many discrete compounds can be tested in parallel so that large numbers of agents can be quickly screened.
- the most widely established techniques utilize 96-well microtiter plates. The well of the microtiter plates typically require assay volumes that range from 50 to 500 ⁇ l.
- many instruments, materials, pipettors, robotics, plate washers, and plate readers are commercially available to fit the 96-well format.
- Free format assays or assays that have no physical barrier between samples, can be used.
- an assay using pigment cells (melanocytes) in a simple homogeneous assay for combinatorial peptide libraries is described by Jayawickreme et al., Proc. Natl. Acad. Sci. USA 19, 161418 (1994).
- Chelsky “Strategies for Screening Combinatorial Libraries: Novel and Traditional Approaches,” reported at the First Annual conference of The Society for Biomolecular Screening in Philadelphia, Pa. (Nov. 710, 1995). Chelsky placed a simple homogenous enzyme assay for carbonic anhydrase inside an agarose gel such that the enzyme in the gel would cause a color change throughout the gel. Thereafter, beads carrying combinatorial compounds were partially released by UV LIGHT. Compounds that inhibited the enzyme were observed as local zones of inhibition having less color change.
- test samples are placed in a porous matrix.
- One or more assay components are then placed within, on top of, or at the bottom of a matrix such as a gel, a plastic sheet, a filter, or other form of easily manipulated solid support.
- a matrix such as a gel, a plastic sheet, a filter, or other form of easily manipulated solid support.
- the agent is preferably a small molecule which binds to and occupies, the secondary binding site of DP IV or DP IV-like enzymes, such that normal biological activity is changed or prevented.
- small molecules include, but are not limited to, small peptides or peptide like molecules.
- either the agent of DP IV or the DP IV-like enzyme can comprise a detectable label, such as a fluorescent, radioisotopic, chemiluminescent, or the enzyme is labeled, such as horseradish peroxidase, alkaline phosphatase, or luciferase.
- Detection of an agent, which is bound to DP IV or the DP IV-like enzyme can then be accomplished, for example, by direct counting of radioemmission, by scintillation counting, or by determining conversion of an appropriate substrate to a detectable product.
- binding of an agent to DP IV or a DP IV-like enzyme can be determined without labelling either of the interactants.
- a microphysiometer can be used to detect binding of an agent with DP IV or a DP IV-like enzyme.
- a microphysiometer e.g., CytosensorTM
- a microphysiometer is an analytical instrument that measures the rate at which a cell acidifies its environment using a light-addressable potentiometric sensor (LAPS). Changes in this acidification rate can be used as an indicator of the interaction between an agent and DP IV or a DP IV-like enzyme (McConnel et al., Science 257, 19061912, 1992).
- BIA Biomolecular Interaction Analysis
- DP IV or a DP IV-like enzyme can be used as a “bait protein” in a two hybrid assay or three-hybrid assay (see, e.g. U.S. Pat. No. 5,283,317; Zervos et al., Cell 72, 223232, 1993; Madura 920924, 193; Iwabuchi et al., Oncogene 8, 16931696, 1993; and Brent WO94/10300), to identify other proteins which bind to or interact with the DP IV or the DP IV-like enzyme and modulate its activity.
- the assay utilizes two different DNA constructs.
- a polynucleotide encoding DP IV or a DP IV-like enzyme can be fused to a polynucleotide encoding the DNA binding domain of a known transcription factor (e.g. GAL4).
- a DNA sequence that encodes an unidentified protein (“prey” or “sample”) can be fused to a polynucleotide that c odes for the activation domain of the known transcription factor.
- the DNA binding and activation domains of the transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g. LacZ), which is operably linked to a transcriptional regulatory site responsive to the transcription factor. Expression of the reporter gene can be detected, and cell colonies containing the functional transcription factor can be isolated and used to obtain the DNA sequence encoding the protein which interacts with the dipeptidyl-peptidase IV-like enzyme polypeptide.
- a reporter gene e.g. LacZ
- either DP IV or DP IV-like enzyme or the agent can be bound to a solid support.
- Suitable solid supports include, but are not limited to, glass or plastic slices, tissue culture plates, microtiter wells, tubes, silicon chips, or particles such as beads (including, but not limited to latex, polysterene, or glass beads).
- Any method known in the art can be used to attach DP IV or the DP IV-like enzyme or agent to a solid support, including use of covalent and non-covalent linkages, passive absorption, or pairs of binding moieties attached respectively to the polypeptide or agent and the solid support.
- Agents are preferably bound to the solid support in an array, so that the location of individual test compounds can be tracked. Binding of a test compound to a DP IV or a DP IV-like enzyme can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels include microtiter plates, test tubes, and microcentrifuge tubes.
- the DP IV or DP IV-like enzyme is a fusion protein comprising a domain that allows the DP IV or DP IV-like enzyme to be bound to a solid support.
- glutathione-S-transferase fusion proteins can be absorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, Mo.) or glutathione derivatized microtiter plates, which are then combined with the agent and the non-absorbed DP IV or DP IV-like enzyme; the mixture is then incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtiter plate wells are washed to remove any unbound components. Binding of the interactants can be determined either directly or indirectly, as described above. Alternatively, the complexes can be dissociated from the solid support before binding is determined.
- DP IV or a DP IV-like enzyme or an agent can be immobilized utilizing conjugation of biotin and streptavidin.
- Biotinylated DP IV or DP IV-like enzymes or agents can be prepared from biotin-NHS-(N-hydroxysuccinimide) using techniques well known in the art (e.g. biotinylation kit, Pierce Chemicals, Rockford, Ill.) and immobilized in the wells of streptavidin-coated 96 well plates (Pierce chemical).
- antibodies which specifically bind to DP IV, a DP IV-like enzyme or an agent, but which do not interfere with a desired binding site, such as secondary binding site or the active site of DP IV or the DP IV-like enzyme, can be derivatized to the wells of the plate. Unbound targets or proteins can be trapped in the wells by antibody conjugation.
- Examples for commercial available antibodies against DP IV or CD26 are for instance: Species Company Clone (antigen) Application Host Coulter Ta1 human IF, FACS Mouse Ba5 human FACS Biozol TA59 human ICH* (Endogen) Pharmingen M-A216 human IF, FACS Mouse Biotrend 13.4 rat ICH, IF Mouse M-T099 human ICH, IF Mouse 134-2C2 human IF, FACS Mouse LT-27 human IF, FACS Mouse Biozol MRCOX-61 rat FC Mouse Biozol 236.3 rat IF, IPrep, IHstaining Mouse Research 202.36 human IF Mouse Diagnostics Research 134-2C2 human T-cell signaling, HIV Mouse Diagnostics infection
- Methods for detecting such complexes include immunodetection of complexes using antibodies which specifically bind to DP IV or DP IV-like enzymes or the agent, enzyme linked assays which rely on detecting an activity of the DP IV or the DP IV-like enzyme, and SDS gel electrophoresis under non-reducing conditions.
- Screening for agents which bind to DP IV or a DP IV-like enzyme also can be carried out in an intact cell.
- Any cell which comprises DP IV or a DP IV-like enzyme can be used in a cell-based assay system.
- DP IV or a DP IV-like enzyme can be naturally occurring in the cell or can be introduced using techniques such as those described above. Binding of the agents to DP IV or a DP IV-like enzyme is determined as described above.
- Agents can be tested for the ability to increase or decrease the activity of a mammalian DP IV or DP IV-like enzyme.
- DP IV activity can be measured, for example, as described in U.S. Pat. No. 5,601,986 and, specific for the present invention, in examples 1 to 3.
- a screening method for the identification and determination of one or more secondary binding sites on DP IV and/or DP IV-like enzymes is provided.
- the screening method for secondary binding site(s) of DP IV and/or DP IV-like enzymes comprises the following steps:
- Consensus sequences are highly conserved sequence segments.
- Preferred according to the invention are consensus sequences with the length of 3 to 20 amino acids, more preferred of 5 to 12 amino acids, most preferred 5 to 7 amino acids.
- the agents, which bind to the secondary binding site can be used alone or in combination with DP IV-inhibitors for the treatment of any type of DP IV mediated disorders, selected but not restricted to, impaired glucose tolerance, glucosuria, lipid disorders, dyslipidemia, hyperlipidaemia, hypertriglyceridemia, hypercholesterolemia, low HDL levels, high LDL levels, metabolic acidosis, hyperglycemia, diabetes mellitus, diabetic neuropathy and nephropathy and of sequelae caused by diabetes mellitus in mammals, metabolism-related hypertension and cardiovascular sequelae caused by hypertension in mammals, for the prophylaxis or treatment of skin diseases and diseases of the mucosae, autoimmune diseases and inflammatory conditions, and for the treatment of psychosomatic, neuropsychiatric and depressive illnesses, such as anxiety, depression, sleep disorders, chronic fatigue, schizophrenia, epilepsy, nutritional disorders,
- psychosomatic, neuropsychiatric and depressive illnesses such as anxiety, depression, sleep disorders, chronic fatigue, schizophrenia
- Agents such as N-(N′-substituted glycyl)-2-cyanopyrrolidines, L-threo-isoleucyl thiazolidine (P32/98), L-allo-isoleucyl thiazolidine, L-threo-isoleucyl pyrrolidine, and L-allo-isoleucyl pyrrolidine have been developed which inhibit the enzymatic activity of DP IV and are described in U.S. Pat. No.
- low molecular weight dipeptidyl peptidase IV inhibitors are agents such as tetrahydroisoquinolin-3-carboxamide derivatives, N-substituted 2-cyanopyroles and—pyrrolidines, N-(N′-substituted glycyl)-2-cyanopyrrolidines, N-(substituted glycyl)-thiazolidines, N-(substituted glycyl)-4-cyanothiazolidines, amino-acyl-borono-prolyl-inhibitors and cyclopropyl-fused pyrrolidines.
- Inhibitors of dipeptidyl peptidase IV are described in U.S. Pat.
- DP IV-inhibitors such as valine pyrrolidide (Novo Nordisk), NVP-DPP728A (1-[[[2-[ ⁇ 5-cyanopyridin-2-yl ⁇ amino]ethyl]amino]acetyl]-2-cyano-(S)-pyrrolidine) (Novartis) as disclosed by Hughes et al., Biochemistry, 38 (36), 11597-11603, 1999, LAF-237 (1-[(3-hydroxy-adamant-1-ylamino)-acetyl]-pyrrolidine-2(S)-carbonitrile); disclosed by Hughes et al., Meeting of the American Diabetes Association 2002, Abstract no.
- TSL-225 tryptophyl-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid
- Yamada et. al. Bioorg. & Med. Chem. Lett. 8 (1998), 1537-1540
- 2-cyanopyrrolidides and 4-cyanopyrrolidides as disclosed by Asworth et al., Bioorg. & Med. Chem. Lett., 6, No.
- the present invention relates to the use of agents, which bind to the secondary binding site(s) of DP IV or DP IV-like enzymes in combination with dipeptide-like compounds and compounds analogous to dipeptide compounds that are formed from an amino acid and a thiazolidine or pyrrolidine group, and salts thereof, referred to hereinafter as dipeptide-like compounds.
- agents which bind to the secondary binding site(s) of DP IV or DP IV-like enzymes in combination with dipeptide-like compounds and compounds analogous to dipeptide compounds that are formed from an amino acid and a thiazolidine or pyrrolidine group, and salts thereof, referred to hereinafter as dipeptide-like compounds.
- the amino acid and the thiazolidine or pyrrolidine group are bonded with an amide bond.
- dipeptide-like compounds in which the amino acid is preferably selected from a natural amino acid, such as, for example, leucine, valine, glutamine, glutamic acid, proline, isoleucine, asparagines and aspartic acid.
- a natural amino acid such as, for example, leucine, valine, glutamine, glutamic acid, proline, isoleucine, asparagines and aspartic acid.
- the dipeptide-like compounds used according to the invention exhibit at a concentration (of dipeptide compounds) of 10 ⁇ M, a reduction in the activity of plasma dipeptidyl peptidase IV or DP IV-analogous enzyme activities of at least 10%, especially of at least 40%. Frequently a reduction in activity of at least 60% or at least 70% is also required. Preferred agents may also exhibit a reduction in activity of a maximum of 20% or 30%.
- Preferred compounds are N-valyl prolyl, O-benzoyl hydroxylamine, a lanyl pyrrolidine, isoleucyl thiazolidine like L-allo-isoleucyl thiazolidine, L-threo-isoleucyl pyrrolidine and salts thereof, especially the fumaric salts, and L-allo-isoleucyl pyrrolidine and salts thereof.
- Especially preferred compounds are glutaminyl pyrrolidine and glutaminyl thiazolidine of formulas 1 and 2:
- the salts of the dipeptide-like compounds can be present in a molar ratio of dipeptide (-analogous) component to salt component of 1:1 or 2:1.
- a salt is, for example, (Ile-Thia) 2 fumaric acid.
- the present invention provides the use of agents binding to the secondary binding site(s) of DP IV or DP IV-like enzymes in combination with substrate-like peptide compounds of formula 3 useful for competitive modulation of dipeptidyl peptidase IV catalysis: wherein
- A, B, C, D and E are independently any amino acid moieties including proteinogenic amino acids, non-proteinogenic amino acids, L-amino acids and D-amino acids and wherein E and/or D may be absent.
- amino acids which can be used in the present invention are: L and D-amino acids, N-methyl-amino-acids; allo- and threo-forms of Ile and Thr, which can, e.g. be ⁇ -, ⁇ - or ⁇ -amino acids, whereof ⁇ -amino acids are preferred.
- amino acids examples include aspartic acid (Asp), glutamic acid (Glu), arginine (Arg), lysine (Lys), histidine (His), glycine (Gly), serine (Ser) and cysteine (Cys), threonine (Thr), asparagine (Asn), glutamine (Gln), tyrosine (Tyr), alanine (Ala), proline (Pro), valine (Val), isoleucine (Ile), leucine (Leu), methionine (Met), phenylalanine (Phe), tryptophan (Trp), hydroxyproline (Hyp), beta-alanine (beta-Ala), 2-amino octanoic acid (Aoa), azetidine-(2)-carboxylic acid (Ace), pipecolic acid (Pip), 3-amino propionic, 4-amino butyric and so forth, alpha-
- ⁇ -amino acids are e.g.: 5-Ara (aminoraleric acid), 6-Ahx (aminohexanoic acid), 8-Aoc (aminooctanoic aicd), 9-Anc (aminovanoic aicd), 10-Adc (aminodecanoic acid), 11-Aun (aminoundecanoic acid), 12-Ado (aminododecanoic acid).
- amino acids are: indanylglycine (Igl), indoline-2-carboxylic acid (Idc), octahydroindole-2-carboxylic acid (Oic), diaminopropionic acid (Dpr), diaminobutyric acid (Dbu), naphtylalanine (1-Nal), (2-Nal), 4-aminophenylalanin (Phe(4-NH 2 )), 4-benzoylphenylalanine (Bpa), diphenylalanine (Dip), 4-bromophenylalanine (Phe(4-Br)), 2-chlorophenylalanine (Phe(2-C1)), 3-chlorophenylalanine (Phe(3-C1)), 4-chlorophenylalanine (Phe(4-C1)), 3,4-chlorophenylalanine (Phe (3,4-C1 2 )), 3- fluorophenylalanine (Phe(3-F
- amino acid substitutions for those encoded in the genetic code can also be included in peptide compounds within the scope of the invention and can be classified within this general scheme.
- Proteinogenic amino acids are defined as natural protein-derived ⁇ -amino acids. Non-proteinogenic amino acids are defined as all other amino acids, which are not building blocks of common natural proteins.
- the resulting peptides may be synthesized as the free C-terminal acid or as the C-terminal amide form.
- the free acid peptides or the amides may be varied by side chain modifications.
- Such side chain modifications include for instance, but are not restricted to, homoserine formation, pyroglutamic acid formation, disulphide bond formation, deamidation of asparagine or glutamine residues, methylation, t-butylation, t-butyloxycarbonylation, 4-methylbenzylation, thioanysilation, thiocresylation, benzyloxyrnethylation, 4-nitrophenylation, benzyloxycarbonylation, 2-nitrobencoylation, 2-nitrosulphenylation, 4-toluenesulphonylation, pentafluorophenylation, diphenylmethylation, 2-chlorobenzyloxycarbonylation, 2,4,5-trichlorophenylation, 2-bromobenzyloxycarbonylation
- the amino acid moieties A, B, C, D, and E are respectively attached to the adjacent moiety by amide bonds in a usual manner according to standard nomenclature so that the amino-terminus (N-terminus) of the amino acids (peptide) is drawn on the left and the carboxyl-terminus of the amino acids (peptide) is drawn on the right. (C-terminus).
- known peptide substrates of the proline-specific serine protease dipeptidyl peptidase IV in vitro are the tripeptides Diprotin A (Ile-Pro-Ile), Diprotin B (Val-Pro-Leu) and Diprotin C (Val-Pro-Ile).
- the compounds disclosed herein above and below act as substrates of dipeptidyl peptidase IV in vivo in a mammal and, in pharmacological doses, improve insulin sensitivity and islet signaling and alleviate pathological abnormalities of the metabolism of mammals such as glucosuria, hyperlipidaemia, metabolic acidosis and diabetes mellitus by competitive catalysis.
- Ser(Bzl) and Ser(P) are defined as benzyl-serine and phosphoryl-serine, respectively.
- Tyr(P) is defined as phosphoryl-tyrosine.
- peptidylketones of formula 4 and pharmaceutically acceptable salts thereof, wherein:
- A is selected from the following structures: wherein
- X is selected from: H, OR 2 , SR 2 , NR 2 R 3 , N + R 2 R 3 R 4 , wherein:
- X is selected from: wherein
- Z is selected from H, or a branched or straight chain alkyl residue from C 1 -C 9 , a branched or straight chain alkenyl residue from C 2 -C 9 , a cycloalkyl residue from C 3 -C 8 , a cycloalkenyl residue from C 5 -C 7 , an aryl or heteroaryl residue, or a side chain selected from all side chains of all natural amino acids or derivatives thereof.
- X is preferably selected from: H, OR 2 , SR 2 , NR 2 R 3 , wherein:
- X is preferably selected from: wherein
- Z is selected from H, or a branched or straight chain alkyl residue from C 1 -C 9 , preferably C 2 -C 6 , a branched or straight chain alkenyl residue from C 2 -C 9 , a cycloalkyl residue from C 3 -C 8 , a cycloalkenyl residue from C 5 -C 7 , an aryl or heteroaryl residue, or a side chain selected from all side chains of all natural amino acids or derivatives thereof
- X is preferably selected from: H, OR 2 , SR 2 , wherein:
- X is preferably selected from: wherein
- Z is selected from H, or a branched or straight chain alkyl residue from C 1 -C 9 , preferably C 2 -C 6 , a branched or straight chain alkenyl residue from C 2 -C 9 , a cycloalkyl residue from C 3 -C 8 , a cycloalkenyl residue from C 5 -C 7 , an aryl or heteroaryl residue, or a side chain selected from all side chains of all natural amino acids or derivatives thereof.
- X is preferably selected from: wherein
- Z is selected from H, or a branched or straight chain alkyl residue from C 3 -C 5 , a branched or straight chain alkenyl residue from C 2 -C 9 , a cycloalkyl residue from C 5 -C 7 , a cycloalkenyl residue from C 5 -C 7 , an aryl or heteroaryl residue, or a side chain selected from all side chains of all natural amino acids or derivatives thereof.
- the acyl groups are C 1 -C 6 -acyl groups.
- alk(yl) groups are C 1 -C 6 -alk(yl) groups, which may be branched or unbranched.
- the alkoxy groups are C 1 -C 6 -alkoxy groups.
- aryl residues are C 5 -C 12 aryl residues that have optionally fused rings.
- cycloalkyl residues are C 3 -C 8 -Cycloalkyl residues.
- heteroaryl residues are C 4 -C 11 aryl residues that have optionally fused rings and, in at least one ring, additionally from 1 to 4 preferably 1 or 2 hetero atoms, such as O, N and/or S.
- peptide residues are corresponding residues containing from 2 to 50 amino acids.
- the heterocyclic residues are C 2 -C 7 -cycloalkyl radicals that additionally have from 1 to 4, preferably 1 or 2 hetero atoms, such as O, N and/or S.
- the carboxy groups are C 1 -C 6 carboxy groups, which may be branched or unbranched.
- the oxycarbonyl groups are groups of the formula —O—(CH 2 ) 1-6 COOH.
- the amino acids can be any natural or synthetic amino acid, preferably natural alpha amino acids.
- Preferred compounds of formula (4) are 2-Methylcarbonyl-1-N-[(L)-Alanyl-(L)-Valinyl]-(2S)-pyrrolidine hydrobromide; 2-Methyl)carbonyl-1-N-[(L)-Valinyl-(L)-Prolyl-(L)-Valinyl]-(2S)-pyrrolidine hydrobromide; 2-[(Acetyl-oxy-methyl)carbonyl]-1-N-[(L)-Alanyl-(L)-Valinyl]-(2S)-pyrrolidine hydrobromide; 2-[Benzoyl-oxy-methyl)carbonyl]-1-N-[ ⁇ (L)-Alanyl ⁇ -(L)-Valinyl]-(2S)-pyrrolidine hydrobromide; 2- ⁇ [(2,6-Dichlorbenzyl)thiomethyl]carbonyl ⁇ -1-N-[ ⁇ (L)-Alanyl ⁇ -(L
- compounds of formula (5) including all stereoisomers and pharmaceutical acceptable salts thereof can be used in combination with agents binding to the secondary binding site(s) of DP IV or DP IV-like enzymes: B—(CH—R 1 ) n —C( ⁇ X 2 )—D (5) wherein
- X 2 stands for O, NR 6 , N + (R 7 ) 2 , or S,
- D contains preferably at most two, further preferred at most one hetero atom in the ring.
- D stands for optionally substituted C 4 -C 7 cycloalkyl, preferably C 4 -C 6 cycloalkyl, optionally substituted C 4 -C 7 cycloalkenyl, or optionally substituted (hetero)cycloalkyl of the formulae wherein the residues are as defined above, or that is, a five-membered ring containing one or two double bonds in the ring, wherein the residues are as defined above, wherein the residues are as defined above, wherein the residues are as defined above, that is a six-membered ring containing one or two double bonds in the ring, wherein the residues are as defined above, wherein the residues are as defined above.
- B has the following formula: wherein the residues are as defined above.
- B has the following formula: wherein the residues are as defined above.
- the problem to be solved was moreover, to provide compounds that can be used, in combination with agents binding to the secondary binding site(s) of DP IV or DP IV-like enzymes, for targeted influencing of locally limited patho-physiological and physiological processes.
- the problem of the invention especially consists in obtaining locally limited and highly specific inhibition of DP IV or DP IV-analogous activity for the purpose of targeted intervention in the regulation of the activity of locally active substrates.
- A is an amino acid having at least one functional group in the side chain
- B is a chemical compound covalently bound to at least one functional group of the side chain of A
- C is a thiazolidine, pyrrolidine, cyanopyrrolidine, hydroxyproline, dehydroproline or piperidine group amide-bonded to A.
- compositions comprising at least one compound of the general formula (6) and at least one customary adjuvant appropriate for the site of action.
- A is an ⁇ -amino acid, especially a natural ⁇ -amino acid having one, two or more functional groups in the side chain, preferably threonine, tyrosine, serine, arginine, lysine, aspartic acid, glutamic acid or cysteine.
- B is an oligopeptide having a chain length of up to 20 amino acids, a polyethylene glycol having a molar mass of up to 20 000 g/mol, an optionally substituted organic amine, amide, alcohol, acid or aromatic compound having from 8 to 50 C atoms.
- the compounds of formula (6) can still bind to the active centre of the enzyme dipeptidyl peptidase IV and analogous enzymes but are no longer actively transported by the peptide transporter PepT1.
- the resulting reduced or greatly restricted transportability of the compounds according to the invention leads to local or site directed inhibition of DP IV and DP IV-like enzyme activity.
- Preferred compounds of formula (6) are compounds, wherein the oligopeptides have chain lengths of from 3 to 15, especially from 4 to 10, amino acids, and/or the polyethylene glycols have molar masses of at least 250 g/mol, preferably of at least 1500 g/mol and up to 15 000 g/mol, and/or the optionally substituted organic amines, amides, alcohols, acids or aromatic compounds have at least 12 C atoms and preferably up to 30 C atoms.
- the compounds of the present invention can be converted into and used as acid addition salts, especially pharmaceutically acceptable acid addition salts.
- the pharmaceutically acceptable salt generally takes a form in which an amino acids basic side chain is protonated with an inorganic or organic acid.
- Representative organic or inorganic acids include hydrochloric, hydrobromic, perchloric, sulfuric, nitric, phosphoric, acetic, propionic, glycolic, lactic, succinic, maleic, fumaric, malic, tartaric, citric, benzoic, mandelic, methanesulfonic, hydroxyethanesulfonic, benzenesulfonic, oxalic, pamoic, 2-naphthalenesulfonic, p-toulenesulfonic, cyclohexanesulfamic, salicylic, saccharinic or trifluoroacetic acid. All pharmaceutically acceptable acid addition salt forms of the compounds of formulas (1) to (6) are intended to be embraced by the
- the present invention further includes within its scope prodrugs of the compounds of formulas (1) to (6).
- prodrugs will be functional derivatives of the compounds which are readily convertible in vivo into the desired therapeutically active compound.
- the present invention shall encompass the treatment of the various disorders described with prodrug versions of one or more of the claimed compounds, which convert to the above specified compound in vivo after administration to the subject.
- Conventional procedures for the selection and preparation of suitable prodrug derivatives are described, for example, in “Design of Prodrugs”, ed. H. Bundgaard, Elsevier, 1985 and the patent applications DE 198 28 113 and DE 198 28 114, which are fully incorporated herein by reference.
- the compounds or prodrugs according to this invention may accordingly exist as enantiomers. Where the compounds or prodrugs possess two or more chiral centers, they may additionally exist as diastereomers. It is to be understood that all such isomers and mixtures thereof are encompassed within the scope of the present invention. Furthermore, some of the crystalline forms of the compounds or prodrugs may exist as polymorphs and as such are intended to be included in the present invention. In addition, some of the compounds may form solvates with water (i.e. hydrates) or common organic solvents, and such solvates are also intended to be encompassed within the scope of this invention.
- the compounds, including their salts, can also be obtained in the form of their hydrates, or include other solvents used for their crystallization.
- the compounds capable of binding to the secondary binding site of DP IV and/or DP IV-like enzymes of the present invention can be used in combination with at least one antidiabetic agent selected from the group consisting of:
- the viral vector is encompassed by a mammalian cell.
- a further preferred embodiment of the present invention comprises the compounds capable of binding to the secondary binding site of DP IV or DP IV-like enzymes in combination with a gene therapeutic expression system for GLP-1 and/or GIP according to any one of the embodiments of the present invention mentioned above wherein
- the present invention provides formulations for agents binding to the secondary binding site of DP IV or DP IV-like enzymes allone or in combination with DP IV-inhibitors, e.g. the compounds of formulas (1) to (6), and their corresponding pharmaceutically acceptable prodrugs and acid addition salt forms, in pharmaceutical compositions. 7
- one or more compounds capable of binding to the secondary binding site and/or DP IV-inhibitors or salts thereof of the invention can be used as the active ingredient(s).
- the active ingredient(s) is intimately admixed with a pharmaceutical carrier according to conventional pharmaceutical compounding techniques, which carrier may take a wide variety of forms depending of the form of preparation desired for administration, e.g., oral or parenteral such as intramuscular.
- a pharmaceutical carrier may take a wide variety of forms depending of the form of preparation desired for administration, e.g., oral or parenteral such as intramuscular.
- any of the usual pharmaceutical media may be employed.
- suitable carriers and additives include water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents and the like;
- suitable carriers and additives include starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like. Because of their ease in administration, tablets and capsules represent the most advantageous oral dosage unit form, in which case solid pharmaceutical carriers are obviously employed. If desired, tablets may be sugar coated or enteric coated by standard techniques.
- the carrier will usually comprise sterile water, through other ingredients, for example, for purposes such as aiding solubility or for preservation, may be included.
- Injectable suspensions may also prepared, in which case appropriate liquid carriers, suspending agents and the like may be employed.
- the pharmaceutical compositions herein will contain, per dosage unit, e.g., tablet, capsule, powder, injection, teaspoonful and the like, an amount of the active ingredient(s) necessary to deliver an effective dose as described above.
- compositions herein will contain, per dosage unit, e.g., tablet, capsule, powder, injection, suppository, teaspoonful and the like, from about 0.03 mg to 100 mg/kg (preferred 0.1-30 mg/kg) and may be given at a dosage of from about 0.1-300 mg/kg per day (preferred 1-50 mg/kg per day) of each active ingredient or combination thereof
- dosages may be varied depending upon the requirement of the patients, the severity of the condition being treated and the compound being employed. The use of either daily administration or post-periodic dosing may be employed.
- compositions are in unit dosage forms from such as tablets, pills, capsules, powders, granules, sterile parenteral solutions or suspensions, metered aerosol or liquid sprays, drops, ampoules, autoinjector devices or suppositories; for oral parenteral, intranasal, sublingual or rectal administration, or for administration by inhalation or insufflation.
- the composition may be presented in a form suitable for once-weekly or once-monthly administration; for example, an insoluble salt of the active compound, such as the decanoate salt, may be adapted to provide a depot preparation for intramuscular injection.
- a pharmaceutical carrier e.g.
- a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a pharmaceutically acceptable salt thereof.
- preformulation compositions as homogeneous, it is meant that the active ingredient is dispersed evenly throughout the composition so that the composition may be readily subdivided into equally effective dosage forms such as tablets, pills and capsules.
- This solid preformulation composition is then subdivided into unit dosage forms of the type described above containing from 0.1 to about 500 mg of each active ingredient or combinations thereof of the present invention.
- the tablets or pills of the compositions of the present invention can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action.
- the tablet or pill can comprise an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former.
- the two components can be separated by an enteric layer which serves to resist disintegration in the stomach and permits the inner component to pass intact into the duodenum or to be delayed in release.
- enteric layers or coatings such materials including a number of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.
- Suitable dispersing or suspending agents for aqueous suspensions include synthetic and natural gums such as tragacanth, acacia, alginate, dextran, sodium carboxymethylcellulose, methylcellulose, polyvinylpyrrolidone or gelatin.
- the processes for the preparation of the compounds according to the invention give rise to mixture of stereoisomers
- these isomers may be separated by conventional techniques such as preparative chromatography.
- the compounds may be prepared in racemic form, or individual enantiomers may be prepared either by enantiospecific synthesis or by resolution.
- the compounds may, for example, be resolved into their components enantiomers by standard techniques, such as the formation of diastereomeric pairs by salt formation with an optically active acid, such as ( ⁇ )-di-p-toluoyl-d-tartaric acid and/or (+)-di-p-toluoyl-1-tartaric acid followed by fractional crystallization and regeneration of the free base.
- the compounds may also resolved by formation of diastereomeric esters or amides, followed by chromatographic separation and removal of the chiral auxiliary. Alternatively, the compounds may be resolved using a chiral HPLC column.
- any of the processes for preparation of the compounds of the present invention it may be necessary and/or desirable to protect sensitive or reactive groups on any of the molecules concerned. This may be achieved by means of conventional protecting groups, such as those described in Protective Groups in Organic Chemistry , ed. J. F. W. McOmie, Plenum Press, 1973; and T. W. Greene & P. G. M. Wuts, Protective Groups in Organic Synthesis , John Wiley & Sons, 1991.
- the protecting groups may be removed at a convenient subsequent stage using conventional methods known from the art.
- the method of treating conditions modulated by the dipeptidyl peptidase IV or dipeptidyl peptidase IV-like enzymes described in the present invention may also be carried out using a pharmaceutical composition comprising any compound or any combination of the compounds as defined herein and a pharmaceutically acceptable carrier.
- the pharmaceutical composition may contain between about 0.01 mg and 100 mg, preferably about 5 to 50 mg, of each compound, and may be constituted into any form suitable for the mode of administration selected.
- Carriers include necessary and inert pharmaceutical excipients, including, but not limited to, binders, suspending agents, lubricants, flavorants, sweeteners, preservatives, dyes, and coatings.
- compositions suitable for oral administration include solid forms, such as pills, tablets, caplets, capsules (each including immediate release, timed release and sustained release formulations), granules, and powders, and liquid forms, such as solutions, syrups, elixirs, emulsions, and suspensions.
- forms useful for parenteral administration include sterile solutions, emulsions and suspensions.
- compounds of the present invention may be administered in a single daily dose, or the total daily dosage may be administered in divided doses of two, three or four times daily.
- compounds for the present invention can be administered in intranasal form via topical use of suitable intranasal vehicles, or via transdermal skin patches well known to those of ordinary skill in that art.
- the dosage administration will, of course, be continuous rather than intermittent throughout the dosage regimen.
- the active drug component can be combined with an oral, non-toxic pharmaceutically acceptable inert carrier such as ethanol, glycerol, water and the like.
- suitable binders include, without limitation, starch, gelatin, natural sugars such as glucose or betalactose, corn sweeteners, natural and synthetic gums such as acacia, tragacanth or sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, sodium chloride and the like.
- Disintegrators include, without limitation, starch, methyl cellulose, agar, bentonite, xanthan gum and the like.
- liquid forms in suitable flavored suspending or dispersing agents such as the synthetic and natural gums, for example, tragacanth, acacia, methyl-cellulose and the like.
- suitable suspending or dispersing agents such as the synthetic and natural gums, for example, tragacanth, acacia, methyl-cellulose and the like.
- tragacanth for example, tragacanth, acacia, methyl-cellulose and the like.
- methyl-cellulose methyl-cellulose and the like.
- suitable suspending or dispersing agents such as the synthetic and natural gums, for example, tragacanth, acacia, methyl-cellulose and the like.
- sterile suspensions and solutions are desired.
- Isotonic preparations which generally contain suitable preservatives are employed when intravenous administration is desired.
- the compounds of the present invention can also be administered in the form of liposome delivery systems, such as small unilamellar vesicles, large unilamellar vesicles, and multilamellar vesicles.
- Liposomes can be formed from a variety of phospholipids, such as cholesterol, stearylamine or phosphatidylcholines.
- Compounds of the present invention may also be delivered by the use of monoclonal antibodies as individual carriers to which the compound molecules are coupled.
- the compounds of the present invention may also be coupled with soluble polymers as targetable drug carriers.
- Such polymers can include polyvinylpyrrolidone, pyran copolymer, polyhydroxypropylmethacrylamidephenol, polyhydroxyethylaspartamid-ephenol, or polyethyl eneoxidepolyllysine substituted with palmitoyl residue.
- the compounds of the present invention may be coupled to a class of biodegradable polymers useful in achieving controlled release of a drug, for example, polyactic acid, polyepsilon caprolactone, polyhydroxy butyeric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanoacrylates and cross-linked or amphipathic block copolymers of hydrogels.
- biodegradable polymers useful in achieving controlled release of a drug, for example, polyactic acid, polyepsilon caprolactone, polyhydroxy butyeric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanoacrylates and cross-linked or amphipathic block copolymers of hydrogels.
- Compounds of this invention may be administered in any of the foregoing compositions and according to dosage regimens established in the art whenever treatment of the addressed disorders is required.
- the daily dosage of the products may be varied over a wide range from 0.01 to 1.000 mg per mammal per day.
- the compositions are preferably provided in the form of tablets containing, 0.01, 0.05, 0.1, 0.5, 1.0, 2.5, 5.0, 10.0, 15.0, 25.0, 50.0, 100, 150, 200, 250 and 500 milligrams of each active ingredient or combinations thereof for the symptomatic adjustment of the dosage to the patient to be treated.
- An effective amount of the drug is ordinarily supplied at a dosage level of from about 0.1 mg/kg to about 300 mg/kg of body weight per day.
- the range is from about 1 to about 50 mg/kg of body weight per day.
- the compounds may be administered on a regimen of 1 to 4 times per day.
- Optimal dosages to be administered may be readily determined by those skilled in the art, and will vary with the particular compound used, the mode of administration, the strength of the preparation, the mode of administration, and the advancement of disease condition. In addition, factors associated with the particular patient being treated, including patient age, weight, diet and time of administration, will result in the need to adjust dosages.
- Matrix-assisted laser-desorption ionization time of flight mass spectrometry (MALDI-TOF MS) experiments were carried out at 30° C. at pH 7.6 in 0.1 M Tris/HCl (Sigma-Aldrich, Deisenhofen, Germany) buffer with 25 ⁇ M peptide solution.
- the degradation fate of peptides was measured by monitoring the signal intensity of the pseudomolecular ion peaks of parent peptides and N-terminal shorted peptides versus time when incubated with 40 mU procine DP IV, recombinant human DP IV or serum DP IV activity.
- the enzyme was preincubated with hexapeptide TFTSDY or TFTDDY or the heptapeptide H-Ser-D-Glu-Thr-Gly-D-Val-D-Lys-D-Val-OH (15 min, 30° C., 0,016M, 1:1 with DP IV, the concentration of the hexapeptide or the heptapeptide in the reaction mixture was 160 ⁇ M).
- concentration of the hexapeptide or the heptapeptide in the reaction mixture was 160 ⁇ M.
- As control served the preincubation of DP IV with 0.01M Tris-buffer (Sigma-Aldrich, Deisenhofen, Germany).
- the mass spectrometer employed was a Hewlett-Packard G2025 model with a linear time of flight analyzer; samples (4 ⁇ L) were mixed 1:1 v/v with matrix (44 mg diammonium-hydrogen-citrate and 30 mg 2′,6′-dihydroxyacetophenone in 1 ml aqueous solution containing 50% acetonitrile and 0.05% trifluoroacetic acid; Sigma-Aldrich), transferred to a probe tip and immediately evaporated using the Hewlett-Packard G2024A (Hewlett-Packard, Waldbronn, Germany) sample preparation vacuum chamber. 250 single laser-shot spectra were accumulated. This method of monitoring biodegradation has been validated and allows the general comparison of half-degradation times (t 1/2 ) under various conditions.
- K i In order to measure the inhibition constant K i a photometric assay was used The peptides were measured as competitors of the standard substrate GP-4-Nitroanilide. Three different substrate concentrations (0.4 mM to 0.05 mM) were combined with 8 different competitor concentrations (0.5 mM to 2 ⁇ M). The reaction was started by addition of 3.5 nM DP IV. Experiments were carried out under standard conditions: 30° C. in pH 7.6 40 mM HEPES (Sigma-Aldrich) buffer. Nitroaniline production was monitored using a HTS 7000+ microplate reader (PerkinElmer, Uberlingen, Germany). The K i -values were calculated via non-linear regression using the enzyme kinetic program Grafit 4.016 (Erithacus Ltd, UK).
- DP IV and the test compounds were preincubated and the reaction was started by adding the enzyme/hexapeptide mixture to substrate/buffer mix.
- the control reaction mixture consisted of buffer, enzyme and substrate. From the curves of the first order exponential the initial rate (v i ) for the control and the reversible inhibited reaction was calculated.
- the reaction mixture contained 50 ⁇ l Gly-Gly (100 mM as standard), 50 ⁇ M substrate solved in 0.01 M sodium phosphat buffer (pH 7.6) and 10 ⁇ l DP IV (40 mU/ml) stored at 30° C. Six substrate concentrations varying from 1 ⁇ M to 60 ⁇ M were measured. As running buffer 0.1 M sodium phosphat buffer, pH 2.5 was used. A sample from the reaction mixture was injected with 0.5 psi over 5 s at predefined time points. Separation was carried out in a capillary with 50 ⁇ M inner diameter and 20 cm effective length. The following separation parameters were used: Separation voltage: 16 kV Separation time: 12 min Separation temperature: 25° C. Detection wave length: 200 nm
- the maximal rate was calculated by plotting product concentration versus time.
- the K m -value was calculated transferrng the data in the Michaelis-Menten-equation (GraFit 4.0.16, Erithacus Ltd., UK).
- P. pastoris strain X-33 and the vector pPIC ⁇ C were purchased from Invitrogen (USA).
- E. coli XL-10 cells were provided from Stratagene (USA).
- the DP IV encoding region ( ⁇ 1-36) plus his 6 -tag contained in a pcDNA-3.1 vector was amplified using primers DP IV-21 (TCATCGATGCATCATCATCATCATCAT) and DP IV-22 (TAGGTACCGCTAAGGTAAAGAGAAAC) while implementing the restriction sites for KpnI and BspD1.
- This fragment was digested with the restriction enzymes KpnI and BspD1 as well as the vector pPCR-ScriptCam (Stratagene, USA), afterwards vector and PCR product were ligated and transformed into the E. coli -strain XL-10. Insertion and orientation was confirmed applying restriction enzyme analysis and partial sequencing.
- the vector pPIC ⁇ C containing the DP IV-variants was linearized using the restriction enzyme Sac I. Transformation was carried out with an electroporation system from BioRad (Germany) according to the Invitrogen Pichia expression kit manual.
- YPD, BMMY, and BMGY for shake flask expression were prepared as described in the Invitrogen Pichia expression kit manual using reagents obtained from Difco. Media for fermentation were composed as described in the Invitrogen Pichia fermentation process guidelines using chemicals purchased from Sigma (Deisenhofen, Germany).
- the clone displaying the highest DP IV activity was used to inoculate 5 ml of BMGY. After 16-18 h of growth at 250 rpm and 28° C. 1 ml of the culture was used to start a 200 ml BMGY flask shake preculture. The cells were grown for 16-18 h at 28° C. A 21 fermentation was started with the 200 ml inoculum according to the Invitrogen Pichia fermentation process guidelines.
- Expression medium was centrifuged at 40,000*g for 20 minutes to pellet the yeast cells. The supernatant was filtered to remove any residual solids using a 45 ⁇ M cellulose acetate filter from Satorius (Germany). Medium was adjusted to pH 7,6 while adding 300 mM NaCl and 50 mM sodium phosphate buffer.
- Affinity chromatography was carried out at 4° C. with a Ni-NTA sepharose column (Qiagen, Germany). The column was pre-equilibrated with 300 mM NaCl, 50 mM NaH 2 PO 4 -buffer pH 7,6. The enzyme was eluted with 250 mM imidazole. DP IV assay and SDS-PAGE monitored the purification process. The fractions with the highest DP IV content was further concentrated by ultra-filtration in an Amicon apparatus (cut off 10 kDa) to 0,5 ml.
- the 0.5 ml ultra-filtrate were applied to a Superdex 200 HiLoad 26/60 column (Pharmacia, Upsalla, Sweden) with a flow rate at 0.25 ml /min using a 300 mM NaCl, 50 mM NaH 2 PO 4 -buffer pH 7,6 at 4° C.
- the purification process was monitored via SDS-PAGE and activity assay.
- Proteins were analysed by SDS-PAGE using 12% separating gels with 3% stacking gel. Gels were stained applying Coomassie brilliant blue R-250.
- Protein concentrations were determined using the BioRad (Germany) Bradford assay kit according to the instructions of the manufacturer.
- Glucagon, GIP and the GIP analogs were synthesized with an automated synthesizer SYMPHONY (RAININ) using a modified Fmoc-protocol. Cycles were modified by using double couplings from the 15 th amino acid from the C-terminus of the peptide with five-fold excess of Fmoc-amino acids and coupling reagent. The peptide couplings were performed by TBTU/NMM-activation using a 0.23 mmol substituted NovaSyn TGR-resin or the corresponding preloaded Wang-resin at 25 ⁇ mol scale. The cleavage from the resin was carried out by a cleavage-cocktail consisting of 94.5% TFA, 2.5% water, 2.5% EDT and 1% TIS.
- prolyl oligopeptidase The structure of prolyl oligopeptidase (Fülöbp, V., et al. (1998) Prolyl Oligopeptidase: An unusual ⁇ -propeller domain regulates proteolysis. Cell 94, 161-170) (Brookhaven Protein Data Bank entry: 1 qfm) was used as a target to model the structure of DP IV.
- COMPOSER (Blundell, T. L.; Sibanda, B. L.; Sternberg, M. J. E.; Thornton, J. M. Knowledge-based prediction of protein structures and the design of novel molecules. Nature 1987, 326, 347-352; Blundell, T. L.; Carney, D.; Gardner, S.; Hayes, F.; Howlin, B.; Hubbard, T.; Overington, J.; Singh, D. A.; Sibanda, B. L.; Sutcliffe, M. Knowledge-based protein modelling and design. Eur. J. Biochem.
- the modeling procedure consisted of the following steps: structurally conserved regions (SCRs) were identified and a framework of conserved regions was defined as mean positions of structurally equivalent C ⁇ -atoms.
- Structurally variable regions SVRs, loops
- Loops which could not be formed with this procedure were added manually to complete the structure.
- the conformations of these loops (mainly in the propeller domain) were determined by simulated annealing techniques in heating the temperature to 700 K and subsequently cooling to 100 K by fixing the remaining part of the structure. This procedure was repeated 30 times.
- Small molecule ligands such as substrates of the type Xaa-Pro-p-Nitroanilide were docked with the “automatic” docking program GOLD (C. Bissantz, G. Folkers, D. Rognan; J. Med. Chem. 43, 4759-4767, 2000) to the catalytically active site of DP IV to inspect and analyze the principal correctness of the tertiary structure.
- Ligands such as GIP or glucagon and longer peptides of the GRF family were docked by application of molecular dynamics simulations. These simulations were started to form a random conformation of these compounds, manual positioned at the outer side of the pore formed by the propeller domain.
- the S2-binding site in DP IV must be responsible for the recognition of the protonated and positively charged N-terminus of DP IV ligands and preferred interactions of hydrophobic residues such as Val or Ile.
- the model shows that the side chain of Glu668 is able to form a salt bridge to the N-terminus of ligands.
- the recognition of the side chains is realized by interactions with the side chains of two other tyrosine residues (Y211 and Y330) and explains the preferred hydrophobic P2-residues of inhibitors.
- Lys(Z-nitro)-Pyrrolidine which carries not a completely hydrophobic P2-side chain
- DP IV-inhibitor Lys(Z-nitro)-Pyrrolidine
- FIG. 5 Another DP IV-inhibitor, Lys(Z-nitro)-Pyrrolidine, which carries not a completely hydrophobic P2-side chain, was also docked to DP IV. The result is represented in FIG. 5 . In the most stable docking arrangement a scorpion like conformation of the Lys-Z-nitro group can be observed, which finally leads to the formation of a strong hydrogen bond to R453. This additional interaction in comparison to usual dipeptide related ligands explains the high affinity and action of this compound.
- the mode of interaction of substrates to DP IV is shown in FIG. 6 .
- the substrates dock exactly in the following conformation: A hydrogen bond is formed between the N-H group and the carbonyl group (torsional angle ⁇ 2 ⁇ 80°) of the first amino acid residue (C7-conformation) and the N-terminal amino group is turned out of a ⁇ 1 torsion of 180° to about 120°.
- the scissile bond or better plane of the peptide bond to be cleaved is in a perpendicular orientation to the active serine side chain (S630) and allows the reactive attack of the serine to the peptide bond.
- the aspartate side chain forms a hydrogen bond to the phenolic OH-group of Y547. This strong interaction prevents the cleaved dipeptide to move out of the binding site and thus shifts the thermodynamic equilibrium and the activation barrier somewhat to the tetrahedral intermediate site and consequently the acylation rate is considerably reduced and becomes rate limiting.
- N-terminal nonapeptide of the HIV-tat protein shows inhibitory effects to DP IV. Docking studies of this compound were done with the complete DP IV model as described above. The resulting most stable binding arrangement is shown in FIG. 7 .
- FIG. 8 Another similar peptide that was used for docking studies is the N-terminal nonapeptide of the tromboxane receptor ( FIG. 8 ). Similar interactions as seen for HIV-tat were detected. Additionally important is the hydrophobic interaction between W2 and I742.
- oligopeptides such as GIP, VIP, glucagon and others are hydrolysed by DP IV and therefore it is clear, that these substrates are docking to DP IV and reaching the active site.
- Extensive docking investigations by means of molecular dynamics simulations were done using the old model. From these studies the amino acid sequences of the hexapeptides, TFTSDY and TFTDDY and the degradation stabilized heptapeptide H-Ser-D-Glu-Thr-Gly-D-Val-D-Lys-D-Val-OH were derived and its ability to protect oligopeptide substrates from their interaction with a secondary binding site.
- GIP is able to reach the active site of DP IV, but the C-terminal tail is still at the surface of the propeller domain.
- DP IV was purified from porcine kidney. Approximately 2 kg cortex was removed from pig kidneys and cut in small pieces. This tissue material was washed with 0.9% NaCl solution overnight at 4° C. to remove remaining blood. The washed cortex was homogenized using an ultraturrax. During homogenization an equal amount of a 0.02 M sucrose solution containing 0.2% Triton X-100 was added. After homogenization the DP IV-protein was released from the membrane by an 18 h autolysis step at 30° C. Insoluble particles were removed by centrifugation at 15900 ⁇ g for 30 min.
- a preparative size exclusion chromatography was used as second purification step. 15 ml of the DP IV-containing solution were applied to a Sepharose 6B (Pharmacia) column (100 cm ⁇ 2.6 cm) and eluted with the phosphate buffer, pH 6.8. The pooled fractions from 3 runs were further purified by anion exchange chromatography on a DEAE-Sephacel (Pharmacia) column (17 cm ⁇ 2.5 cm). For binding the 25 mM phosphate buffer pH 6.8 was used and DP IV was eluted with a salt gradient from 39 mM to 150 mM NaCl in 5 column volumes. The final separation step was a high resolution anion exchange chromatography on a Uno Q column (6 ml, BioRad).
- the DP IV-containing fraction was diluted with an equal volume of H 2 O and applied to the column using a 25 mM Bis-Tris buffer pH 6.8. Elution was performed with a NaCl gradient from 0 to 60 mM. Final purification of the naturally glycosylated protein to homogeneity was achieved by preparative isoelectric focusing using the Rotofor system (BioRad). One run of the above procedure yields roughly 60 mg of total protein, purified by a factor of approximately 280 and exhibiting a specific activity of always above 42 U/mg.
- Boc-p-Iodo-Phe-Pro-NH 2 Triethylamine (163.8 ml, 1.17 mmol) was added to a solution of H-ProNH 2 *HCl (118.5 mg, 0.782 mmol) in dry DMF (10 ml). Boc-p-Iodo-Phe-OSu (0.42 g, 0.86 mmol) was added in one portion and the mixture stirred for 16 h under an argon atmosphere. The solvent was evaporated and the residue treated in a standard way, i.e. the residue was partitioned between ethylacetate (60 ml) and 0.3N KHSO 4 solution (10 ml). The organic layer was further washed with saturated NaCHO 3 solution (10 ml), water (10 ml)and brine (5 ml). The solution was dried and evaporated at reduced pressure.
- Boc-p-Iodo-Phe-Pyr-CN Imidazole (38.96 mg, 0.572 mmol) was added to a solution of Boc-p-Iodo-Phe-Pro-NH 2 in dry pyridine (5 ml) under an argon atmosphere. The solution was cooled to ⁇ 35° C., before the dropwise addition of POCl 3 (0.105 ml, 1.13 mmol). The reaction was stirred at ⁇ 30° C.—to ⁇ 20° C. for 60 min.
- Triclinic crystals were obtained at room temperature within several days by mixing equal volumes of protein at concentration of 20 mg/ml with the reservoir solution (20-22% PEG2K, 0.1 M ammonium sulfate, and 0.1 M Tris/HCl pH 8.0) using the sitting drop vapor diffusion method.
- the crystals were very sensitive towards manual handling and oxygen. Opening of the crystallization vials led to protein precipitation which was only partly reversible.
- PFPE perfluoropolyether
- Crystals were mounted on an in-house rotating anode. Crystals initially diffracted very weakly, typically below 10 ⁇ . The humidity was then ramped down from 96.5% to 86.5% using a gradient of 0.5% (150 s) ⁇ 1 which induced a phase transition in the crystalline lattice order reflected by a dramatically improved diffraction pattern. At an optimal relative humidity crystals were flash frozen in the cold nitrogen stream and transported to the synchrotron for data collection. For ligand complex studies, DP IV-crystals were soaked with the inhibitor prior to the crystal transformation procedure. Data were processed and scaled using DENZO and SCALEPACK (Otwinowski, Z. & Minor, W. (1997) in Meth. Enzym., eds. Carter, C. W. J. & Sweet, R. M. (Academic Press, Vol. 276, pp. 307-326.).
- the structure was determined by multiple wavelength anomalous dispersion (MAD) using a mercury derivative and subsequent non-crystallographic symmetry (NCS) electron density averaging. Briefly, local two-fold axes were determined by using the program GLRF (Tong, L. & Rossmann, M. G. (1990) Acta Cryst. A46, 783-792.). Next, a local Harker section perpendicular to the molecular dimer axis was cut out of the three-dimensional anomalous Patterson map using the program MAIN (Turk, D. (1992) in Chemistry (Technische Universitat, München.), averaged along the orthogonal local two-fold axes, and subsequently input to RSPS (Knight, S. D.
Abstract
Description
- This application claims priority of U.S. patent application Ser. No. 10/246,817, filed Sep. 18, 2002 and also claims priority of U.S. Provisional Patent Application Ser. No. 60/443,417 filed Jan. 29, 2003 both of which are incorporated herein by reference in their entirety.
- The present application relates to the secondary binding site of dipeptidyl peptidase IV, its relationship with any type of substrates and to the modulation of substrate specificity of dipeptidyl peptidase IV (DP IV, synonym: DPP IV, CD26, EC 3.4.14.5).
- The application relates further to compounds that bind to the secondary binding site of DP IV and their use to modulate the substrate specificity of DP IV.
- Furthermore, the present invention provides a method for treating DP IV mediated disorders, selected from but not restricted to, impaired glucose tolerance, glucosuria, lipid disorders, dyslipidemia, hyperlipidaemia, hypertriglyceridemia, hypercholesterolemia, low HDL levels, high LDL levels, metabolic acidosis, hyperglycemia, diabetes mellitus, diabetic neuropathy and nephropathy and of sequelae caused by diabetes mellitus in mammals, metabolism-related hypertension and cardiovascular sequelae caused by hypertension in mammals, for the prophylaxis or treatment of skin diseases and diseases of the mucosae, autoimmune diseases and inflammatory conditions, and for the treatment of psychosomatic, neuropsychiatric and depressive illnesses, such as anxiety, depression, sleep disorders, chronic fatigue, schizophrenia, epilepsy, nutritional disorders, spasm and chronic pain, atherosclerosis and its sequelae, vascular restenosis, irritable bowel syndrome, inflammatory bowel disease, including Crohn's disease and ulcerative colitis, other inflammatory conditions, pancreatitis, abdominal obesity, neurodegenerative disease, retinopathy, nephropathy, Syndrome X, ovarian hyperandrogenism (polycystic ovarian syndrome), growth hormone deficiency, neutropenia, tumor metastasis, benign prostatic hypertrophy, gingivitis, osteoporosis, and other conditions, in mammals.
- The present application also provides a screening method for the identification of agents, which bind to the secondary binding site of dipeptidyl peptidase IV.
- Further on, a screening method for the identification and determination of one or more secondary binding sites of DP IV-like enzymes is provided.
- The exopeptidase dipeptidyl peptidase IV (DP IV, CD26, EC 3.4.14.5) is involved in a number of physiological regulation processes. On the one hand, DP IV is a peptidase which can change the activity of a number of peptide hormones, neuropeptides and chemokines in a very specific manner (Mentlein, Reg. Pep. 85, pp. 9-24 (1999) while on the other hand the DP IV protein molecule exerts protein-protein interactions, so mediating the regulation of intracellular signaling cascades. A growing number of peptide substrates containing proline, alanine or serine in the penultimate position are identified as substrates of DP IV in vitro and in vivo. Bioactive peptides which are substrates for DP IV and members of such regulation cascades are, among others, NPY, GIP, GLP-1, glucagons, VIP and PACAP. Furthermore, many DP IV-inhibitors belonging to different structural classes are known.
- It is known that DP IV-Inhibitors may be useful for the treatment of impaired glucose tolerance and diabetes mellitus (International Patent Application, Publication Number WO 99/61431, Pederson R A et al, Diabetes. 1998 Aug; 47(8):1253-8 and Pauly R P et al, Metabolism 1999 Mar; 48(3):385-9). In particular WO 99/61431 discloses DP IV-Inhibitors comprising an amino acid residue and a thiazolidine or pyrrolidine group, and salts thereof, especially L-threo-isoleucyl thiazolidine, L-allo-isoleucyl thiazolidine, L-threo-isoleucyl pyrrolidine, L-allo-isoleucyl thiazolidine, L-allo-isoleucyl pyrrolidine, and salts thereof.
- Further examples of low molecular weight dipeptidyl peptidase IV inhibitors are agents such as tetrahydroisoquinolin-3-carboxamide derivatives, N-substituted 2-cyanopyroles and pyrrolidines, N-(N′-substituted glycyl)-2-cyanopyrrolidines, N-(substituted glycyl)-thiazolidines, N-(substituted glycyl)-4-cyanothiazolidines, amino-acyl-borono-prolyl-inhibitors, cyclopropyl-fused pyrrolidines and heterocyclic compounds. Inhibitors of dipeptidyl peptidase IV are described in U.S. Pat. No. 6,380,398, U.S. Pat. No. 6,011,155; U.S. Pat. No. 6,107,317; U.S. Pat. No. 6,110,949; U.S. Pat. No. 6,124,305; U.S. Pat. No. 6,172,081; WO 95/15309, WO 99/61431, WO 99/67278, WO 99/67279, DE 198 34 591, WO 97/40832, DE 196 16 486
C 2, WO 98/19998, WO 00/07617, WO 99/38501, WO 99/46272, WO 99/38501, WO 01/68603, WO 01/40180, WO 01/81337, WO 01/81304, WO 01/55105, WO 02/02560 and WO 02/14271, WO 02/04610, WO 02/051836, WO 02/068420, WO 02/076450; WO 02/083128, WO 02/38541, WO 03/000180, WO 03/000181, WO 03/000250, WO 03/002530, WO 03/002531, WO 03/002553,WO 03/002593, WO 03/004496, WO 03/004498, WO 03/024965, WO 03/024942, WO 03/035067, WO 03/037327, WO 03/035057, WO 03/045977, WO 03/055881, WO 03/68748, WO 03/68757, WO 03/057666, WO 03057144, WO 03/040174 and WO 03/033524, the teachings of which are herein incorporated by reference in their entirety, especially concerning these inhibitors, their definition, uses and their production. - Definitions
- The term “active site” as used in the claims and in the description is generally known to a person skilled in the art and means the catalytical site or region of DP IV and/or DP IV-like enzymes, which is responsible for the cleavage or biodegredation of the natural substrates of these enzymes.
- The term “secondary binding site” as used in the claims and in the description means a site or region of DP IV and/or DP V-like enzymes, which is different from the active site, e.g. a) a receptor site or b) a substrate recognition site or c) a regulatory site or allosteric site. The secondary binding site can a) affect the receptor function of DP IV and/or DP IV-like enzymes or b) affect the catalytic activity of DP IV and/or DP IV-like enzymes, especially the selectivity and/or specificity of these enzymes toward their substrates. Some secondary binding sites are complementary to the structure of the substrate of the enzymes, co-enzymes, co-factors and other compounds, which are involved in the activity and function of the enzyme. The enzymes may even have one or more secondary binding sites.
- The secondary binding site is an element of the enzyme distinct from the catalytic site with a different form of regulation than the competition between substrates and inhibitors at the catalytic site (Darnell, J., Lodish, H. and Baltimore, D. 1990, Molecular Cell Biology 2nd Edition, Scientific American Books, New York, page 63).
- The term “DP IV and/or DP IV-like enzymes” means DP IV or DP IV-like enzymes or both.
- The term “activity modifying” as used in the claims and in the description means both the modification of the enzymatic activity as well as the modification of the selectivity or specificity of DP IV and/or DP IV-like enzymes. Especially preferred is the modification of the selectivity or specificity of DP IV and/or DP IV-like enzymes toward their natural substrates.
- “Effectors”, as that term is used herein, are defined as molecules or ligands that interact with a secondary binding site of DP IV and/or DP IV-like enzymes, thereby changing their catalytical behaviour in vitro and/or in vivo. Effectors can increase or decrease the catalytical activity of the enzymes. Examples of effectors are activators or inhibitors. The effectors as used herein do not act at the active sites of enzymes, but at at least one secondary binding site, e.g. a regulatory site, or an allosteric site. The term “effectors” is used herein synonymously with “agent” or “compound”.
- The term “DP IV-inhibitor” is generally known to a person skilled in the art and means enzyme inhibitors, which interact with the active site or catalytical site of DP IV or DP IV-like enzymes or DP IV and/or DP IV-like enzymes and inhibit the catalytical activity of these enzymes.
- The “use of effectors” encompasses one single effector or two or more effectors together. Preferred is the use of two effectors. Especially preferred is the use of one single effector.
- “Conditions associated with diabetes mellitus” itself include hyperglycaemia, insulin resistance, including acquired insulin resistance and obesity. Further conditions associated with diabetes mellitus itself include hypertension and cardiovascular disease, especially atherosclerosis and conditions associated with insulin resistance. Conditions associated with insulin resistance include polycystic ovarian syndrome and steroid induced insulin resistance and gestational diabetes.
- “Complications associated with diabetes mellitus” includes renal disease, especially renal disease associated with
Type 2 diabetes, neuropathy and retinopathy. - Renal diseases associated with
Type 2 diabetes include nephropathy, glomerulonephritis, glomerular sclerosis, nephrotic syndrome, hypertensive nephrosclerosis and end stage renal disease. - Diabetes mellitus is preferably
Type 2 diabetes. - Classification of Diabetes
- Clinical diabetes may be divided into four general subclasses, including (1) type 1 (caused by beta cell destruction and characterized by absolute insulin deficiency) (2) type 2 (characterized by insulin resistance and relative insulin deficiency (3) other specific types of diabetes (associated with various identifiable clinical conditions or syndromes) and (4) gestational diabetes mellitus. In addition to these clinical categories, two conditions—impaired glucose tolerance and impaired fasting glucose—refer to a metabolic state intermediate between normal glucose homeostasis and overt diabetes. These conditions significantly increase the later risk of diabetes mellitus and may in some instances be part of its natural history. It should be noted that patients with any form of diabetes might require insulin treatment at some point. For this reason the previously used terms insulin-dependent diabetes (for type I diabetes mellitus) and non-insulin-dependent diabetes (for type 2) have been eliminated.
- Diabetes is currently classified as follows:
- Clinical Diabetes
-
-
- 1.
Type 1 diabetes, formerly called insulin-dependent diabetes mellitus (IDDM) or “juvenile-onset diabetes” - 2.
Type 2 diabetes, formerly called non-insulin-dependent diabetes (NIDDM) or “adult-onset diabetes” - 3. Other specific types
- a) Genetic defects of β-cell function (e.g., maturity-onset diabetes of the young [MODY] types 1-3 and point mutations in mitochondrial DNA)
- b) Genetic defects in insulin action
- c) Disease of the exocrine pancreas (e.g., pancreatitis, trauma, pancreatectomy, neoplasia, cystic fibrosis, hemochromatosis, fibrocalculous pancreatopathy).
- d) Endocrinopathies (e.g. acromegaly, Cusing's syndrome, hyperthyroidism, pheochromocytoma, glucagonoma, somatostinoma, aldosteronoma)
- e) Drug or chemical induced (e.g., glucocorticosteroids, thiazides, diazoxide, pentamidine, vacor, thyroid hormone, phenytoin [Dilantin], β-agonists, oral contraceptives)
- f) Infections (e.g., congenital rubella, cytomegalovirus)
- g) Uncommon forms of immune-mediated diabetes (e.g., “stiff-man”, syndrome, anti-insulin receptor antibodies)
- h) Other genetic syndromes (e.g., Down, Klinefelter's, Turner's syndrome, Huntington's disease, myotonic dystrophy, lipodystrophy, ataxia-telangiectasia)
- 4. Gestational diabetes mellitus
Risk Categories - 1. Impaired fasting glucose
- 2. Impaired glucose tolerance
Type 1 Diabetes Mellitus
- 1.
- Patients with this disorder have little or no insulin secretory capacity and depend on exogenous insulin to prevent metabolic decompensation (e.g., ketoacidosis) and death.
- Commonly but not always, diabetes appears abrubtly (i.e., over days and weeks) in previously healthy non-obese children or young adults; in older age groups it may have a more gradual onset. At the time of initial evaluation the typical patient often appears ill, has marked symptoms (e.g., polyuria, polydipsia, polyhagia, and weight loss), and may demonstrate ketoacidosis.
Type 1 diabetes is believed to have a long a symptomatic p reclinical stage often lasting years, during which pancreatic beta cells are gradually destroyed by an autoimmune attack that is influenced by HLA and other genetic factors, as well as the environment. Initially, insulin therapy is essential to restore metabolism toward normal. However, a so-called honeymoon period may follow and last weeks or moths, during which time smaller doses of insulin are required because of partial recovery of beta cell function and reversal of insulin resistance caused by acute illness. Thereafter, insulin secretory capacity is gradually lost (over several years). The association oftype 1 diabetes with specific immune response (HLA) genes and the presence of antibodies to islet cells and their constituents provides strong support for the theory that type 1 diabetes is an autoimmune disease. This syndrome accounts for lese than 10% of diabetes in United States. -
Type 2 Diabetes Mellitus -
Type 2, by far the most common form of the disease, is found in over 90% of the diabetic patient population. These patients retain a significant level of endogenous insulin secretory capacity. However, insulin levels are low relative to the magnitude of insulin resistance and ambient glucose levels.Type 2 patients are not dependent on insulin for immediate survival and ketosis rarely develops, except under conditions of great physical stress. Nevertheless, these patients may require insulin therapy to control hyperlgycemia.Type 2 diabetes typically appears after the age of 40 years, has a high rate of genetic penetrance unrelated to HLA genes, and is associated with obesity. The clinical features oftype 2 diabetes may be mild (fatigue, weakness, dizziness, blurred vision, or other non-specific complaints may dominate the picture) or may be tolerated for many years before the patient seeks medical attention. Moreover, if the level of hyperglycemia is insufficient to produce symptoms, the disease may become evident only after complications develop. - Other Specific Types of Diabetes
- This category encompasses a variety of diabetic syndromes attributed to a specific disease, drug, or condition. Genetic research has provided new insights into pathogenesis of MODY, which was formerly included as a form of
type 2 diabetes. MODY encompasses several genetic defects of beta cell function, among which mutations at several genetic loci on different chromosomes have been identified. The most common forms—MODY type 3—is associated with a mutation for a transcription factor encoded on chromosome 12 named hepatocyte nuclear 1α (HNF 1, also known as TCF1) and—MODY type 2 is associated with mutations of the glucokinase gene (on chromosome 7) Mutations of the HNF-4α gene (on chromosome 20) are responsible fortype 1 of MODY. Each of these conditions is inherited in an autosomal dominant pattern. Two new rare forms of MODY are associated with mutations of the HNF-1β (on chromosome 17) and an insulin gene transcription factor termed PDX-1 or 1DX-1 (on chromosome 13). - The distinction between the various subclasses of diabetes mellitus is usually made on clinical grounds. However, a small subgroup of patients are difficult to classify, that is, they display features common to both
type type 1 diabetes, whereas others defy easy categorization. - Gestational Diabetes
- The term gestational diabetes describes women with impaired glucose tolereance that appears or is first detected during pregnancy. Gestational diabetes usually appears in the 2nd or 3rd trimester, a time when pregnancy-associated insulin antagonistic hormones peak. After delivery, glucose tolerance generally (but not always) reverts to normal.
- Diagnosis
- The diagnosis of diabetes is usually straightforward when the classic symptoms of polyuria, polydipsia, and weight loss are present. All that is required is a random plasma glucose measurement from venous blood that is 200 mg/dL or greater. If diabetes is suspected but not confirmed by a random glucose determination, the screening test of choice is overnight fasting plasma glucose level. The diagnosis is established if fasting is equal to or greater than 126 mg/dL on at least two separate occasions.
- Related Conditions
- Impaired Glucose Tolerance and Impaired Fasting Glucose
- Impaired glucose tolerance (IGT) and impaired fasting glucose (IFG) are terms applied to individuals who have glucose levels that are higher than normal, (under fed or fasting conditions, respectively) but lower than those accepted as diagnostic for diabetes mellitus. Both conditions are associated with an increased risk for cardiovascular disease, but do not produce the classic symptoms or the microvascular and neuropathic complications associated with diabetes mellitus. In a subgroup of patients (about 25 to 30%), however,
type 2 diabetes eventually develops. - Impaired Glucose Metabolism
- Impaired Glucose Metabolism (IGM) is defined by blood glucose levels that are above the normal range but are high enough to meet the diagnostic criteria for
type 2 diabetes mellitus. The incidence of IGM varies from country to country, but usually occurs 2-3 time more frequently than overt diabetes. Until recently, individuals with IGM were felt to be pre-diabetics, but data from several epidemiological studies argue that subjects with IGM are heterogeneous with respect to their risk of diabetes and their risk of cardiovascular morbidity and mortality. The data suggest that subjects with IGM , in particular, those with impaired glucose tolerance (IGT), do not always develop diabetes, but whether they are diabetic or not, they are, nonetheless, at high risk for cardiovascular morbidity and mortality. Among subjects with IGM, about 58% have Impaired Glucose tolerance (IGT), another 29% have impaired fasting glucose (IFG), and 13% have both abnormalities (IFG/IGT). As discussed above, IGT is characterized by elevated post-prandial (post-meal) hyperglycemia while IFG has been defined by the ADA (American Diabetes Association) on the basis of fasting glycemic values. - The categories of (a) normal glucose tolerance (NGT), (b) impaired glucose metabolism (IGM) and (c)
overt type 2 diabetes mellitus are periodically revised and adopted by the Expert Committee of the American Diabetes Association (ADA). The actual values as defined in “Report of the Expert Committee on the Diagnosis and Classification of Diabetes Mellitus. Diabetes Care (26) 1, 2003, 5-20” and “The Diabetes Ready-Reference Guide for Health Care Professionals, 2000, published by the American Diabetes Association” are: -
- a) Normal Glucose Tolerance (NGT)=fasting glucose level <6.1 mmol/L or less than 110 mg/dl and a 2 h post-prandial glucose level of <7.8 mmol/L or <140 mg/dl.
- b) Impaired Glucose Metabolism (IGM) is impaired fasting glucose (IFG) defined as IFG=fasting glucose level of 6.1-7.0 mmol/L or 110-126 mg/dl and/or impaired glucose tolerance (IGT)=a 2 h post-prandial glucose level (75 g OGTT) of 7.8-11.1 mmol/L or 140-200 mg/dl).
- c)
Type 2 diabetes=fasting glucose of greater than 7 mmol/L or 126 mg/dl or a 2 h post-prandial glucose level (75 g OGTT) of greater than 11.1 mmol/L or 200 mg/dl.
- These criteria were defined using the WHO recommended conditions for administration of an oral glucose tolerance test (75
g 0 GTT) i. e., the oral administration of a glucose load containing the equivalent of 75 g of anhydrous glucose dissolved in water with a blood sample taken 2 hours later to analyze to post-prandial glucose. Other OGTT test conditions have confirmed the associated risks of the IGT and IFG categories including: 1) using 50 g glucose instead of 75 g, 2) using a casual (non-fasting) glucose sample as the analyte, and 3) analysing the post-prandial glucose at 1 hour rather than 2 hours post-glucose load. Under all of these conditions, the glycemic categories defined above have been linked to the increased risks described below, but the standardized OGTT is preferred in order to minimize variations in test results. - Insulin resistance is not primarily due to a diminished number of insulin receptors but to a post-insulin receptor binding defect that is not yet understood. This resistance to insulin responsiveness results in insufficient insulin activation of glucose uptake, oxidation and storage in muscle and inadequate insulin repression of lipolysis in adipose tissue and of glucose production and secretion in the liver.
- The term “subject” as used herein, refers to an animal, preferably a mammal, most preferably a human, who has been the object of treatment, observation or experiment.
- The term “therapeutically effective amount” as used herein, means that amount of active compound or pharmaceutical agent that elicits the biological or medicinal response in a tissue system, animal or human, being sought by a researcher, veterinarian, medical doctor or other clinician, which includes alleviation of the symptoms of the disease or disorder being treated.
- As used herein, the term “pharmaceutically acceptable” embraces both human and veterinary use: for example the term “pharmaceutically acceptable” embraces a veterinarily acceptable compound or a compound acceptable in human medicine a health care.
- Throughout the description and the claims the expression “acyl” can denote a C1-20 acyl residue, preferably a C1-8 acyl residue and especially preferred a C1-4 acyl residue; “cycloalkyl” can denote a C3-12 cycloalkyl residue, preferably a C4, C5 or C6 cycloalkyl residue; and “carbocyclic” can denote a C3-12 carbocyclic residue, preferably a C4, C5 or C6 carbocyclic residue. “Heteroaryl” is defined as an aryl residue, wherein 1 to 4, and more preferably 1, 2 or 3 ring atoms are replaced by heteroatoms like N, S or O. “Heterocyclic” is defined as a cycloalkyl residue, wherein 1, 2 or 3 ring atoms are replaced by heteroatoms like N, S or O. “Peptides” are selected from dipeptides to decapeptides, preferred are dipeptides, tripeptides, tetrapeptides and pentapeptides. The amino acids for the formation of the “peptides” can be selected from those listed above.
- Throughout the description and the claims the expression “alkyl” can denote a C1-50 alkyl group, preferably a C6-30 alkyl group, especially a C8-12 alkyl group; for example, an alkyl group may be a methyl, ethyl, propyl, isopropyl or butyl group. The expression “alk”, for example in the expression “alkoxy”, and the expression “alkan”, for example in the expression “alkanoyl”, are defined as for “alkyl”; aromatic compounds are preferably substituted or optionally unsubstituted phenyl, benzyl, naphthyl, biphenyl or anthracene groups, which preferably have at least 8 C atoms; the expression “alkenyl” can denote a C2-10 alkenyl group, preferably a C2-6 alkenyl group, which has the double bond(s) at any desired location and may be substituted or unsubstituted; the expression “alkynyl” can denote a C2-10 alkynyl group, preferably a C2-6 alkynyl group, which has the triple bond(s) at any desired location and may be substituted or unsubstituted; the expression “substituted” or substituent can denote any desired substitution by one or more, preferably one or two, alkyl, alkenyl, alkynyl, mono- or multi-valent acyl, alkanoyl, alkoxyalkanoyl or alkoxyalkyl groups; the afore-mentioned substituents may in turn have one or more (but preferably zero) alkyl, alkenyl, alkynyl, mono- or multi-valent acyl, alkanoyl, alkoxyalkanoyl or alkoxyalkyl groups as side groups; organic amines, amides, alcohols or acids, each having from 8 to 50 C atoms, preferably from 10 to 20 C atoms, can have the formulae (alkyl)2N- or alkyl-NH-, —CO—N(alkyl)2 or —CO—NH(alkyl), -alkyl-OH or -alkyl-COOH.
- The inventors of the present application unexpectedly show, that the biodegradation of different substrates, which bind to the same catalytic domain of DP IV and/or DP IV-like enzymes, can be modulated in an unexpected very specific manner.
- The invention provides a method to identify the site in the DP IV protein or in DP IV-like enzymes or in both, DP IV and DP IV-like enzymes which is responsible for the modulation of the substrate specificity of DP IV and also provides new compounds, which regulate the substrate specificity of DP IV and which are useful for the treatment of, for example, impaired glucose tolerance, glucosuria, lipid disorders, dyslipidemia, hyperlipidaemia, hypertriglyceridemia, hypercholesterolemia, low HDL levels, high LDL levels, metabolic acidosis, hyperglycemia, diabetes mellitus, diabetic neuropathy and nephropathy and of sequelae caused by diabetes mellitus in mammals, metabolism-related hypertension and cardiovascular sequelae caused by hypertension in mammals, for the prophylaxis or treatment of skin diseases and diseases of the mucosae, autoimmune diseases and inflammatory conditions, and for the treatment of psychosomatic, neuropsychiatric and depressive illnesses, such as anxiety, depression, sleep disorders, chronic fatigue, schizophrenia, epilepsy, nutritional disorders, spasm and chronic pain, atherosclerosis and its sequelae, vascular restenosis, irritable bowel syndrome, inflammatory bowel disease, including Crohn's disease and ulcerative colitis, other inflammatory conditions, pancreatitis, abdominal obesity, neurodegenerative disease, retinopathy, nephropathy, Syndrome X, ovarian hyperandrogenism (polycystic ovarian syndrome), growth hormone deficiency, neutropenia, tumor metastasis, benign prostatic hypertrophy, gingivitis, osteoporosis, and other conditions, in mammals.
- Other Potential target diseases and the actual stage of research are summarized in table 1.
TABLE 1 Target diseases for DP IV-inhibition Target disease Development stage Comments AIDS cell culture mechanism not fully understood Autoimmune cell culture and animal high doses necessary diseases models Rheumatoid animal models Arthritis Multiple sclerosis animal experiments Psoriasis cell culture and animal experiments Graft rejection animal experiments Wound healing Anxiety effective in animal models Diabetes type II Phase II studies Cancer cell culture, animal models DP IV and FAP are involved Obesity animal experiments NPY, GLP-1 and orexine mediated - The problem of the invention is solved by using a prolyl oligopeptidase (POP) based computer-generated model of DP IV and of the crystal structure of DP IV for the identification of secondary binding sites of DP IV and by providing specific compounds, which bind to at least one secondary binding site and are able to modify very differently and/or specifically the DP IV-catalyzed truncation of substrates of DP IV and DP IV-like enzymes, e.g. bioactive peptides. The overall result is a significant increase of substrate dependent DP IV-selectivity by such compounds and thereby minimization of side reactions with other substrates and as such of potential side effects after complete inhibition of DP IV-activity.
- Further understanding of these and other aspects of the instant invention may be had by reference to the figures wherein:
-
FIG. 1 shows a plot of the distribution of the backbone dihedral angles of the complete model of human DP IV. There are no residues in disallowed regions, but some residues are located in only generously allowed areas. Most of them represent residues in loops at the surface of the propeller domain. - The plot statistics is a measure for the plot quality. The plot statistics for
FIG. 1 is as follows:Residues in most favoured regions 435 62.8% Residues in additionally allowed regions 226 32.6% Residues in generously allowed regions 32 4.6% Residues in disallowed regions 0 0.0% Number of non-glycine and non-proline residues 693 100.0% Number of end-residues (excl. Gly and Pro) 1 Number of glycine residues (shown as triangles) 43 Number of proline residues 29 Total number of residues 766 -
FIG. 2 shows the analysis of the quality of the model of human DP IV with regard to some essential stereo-chemical parameters. The plot statistics is as follows:No. of Comparison band Values widths Stereochemical No. of Parameter Typical Band from parameter data points value value width mean a. %-tage residues in 693 63.9 83.8 10.0 −2.0 WORSE A, B, L b. Omega angle 765 4.7 6.0 3.0 −0.4 Inside standard deviation c. Bad contacts/100 19 2.5 4.2 10.0 −0.2 Inside residues d. Zeta angle standard 723 3.5 3.1 1.6 0.3 Inside deviation e. H-bond energy 389 0.9 0.8 0.2 0.5 Inside standard deviation f. Overall G-factor 766 −0.6 −0.4 0.3 −0.5 Inside -
FIG. 3 shows the computer-assisted structure model of DP IV and the ADA-binding site (indicated by the arrows and amino acid residue numbers); -
FIG. 4 shows the active site of DP IV docked with the active site DP IV-inhibitor isoleucyl pyrrolidine (Ile-Pyr) (dark gray); -
FIG. 5 shows the interaction of Lys-Z-nitro-pyrrolidine with the active site of DP IV; -
FIG. 6 shows the tetrahedral intermediate of Asp-Pro-pNA bound to DP IV; -
FIG. 7 shows the interaction of the HIV-tat(1-9) protein with DP IV; -
FIG. 8 shows the docking of the N-terminal nonapeptide of the tromboxane receptor; -
FIG. 9 shows the 3D-structure model of the interaction between GIP (black thread) and human DP IV; -
FIG. 10 shows the docking arrangement of GIP (black) to the active site of DP IV; -
FIG. 11 shows the molecular dynamic simulation based model of the tertiary structure of GIP (middle part), bound to DP IV. Important amino acid residues from the enzyme are shown in light gray, those from GIP are shown in black, respectively; -
FIG. 12 shows the docking of VIP (black) to the active site of DP IV; -
FIG. 13 shows the docking of the C-terminal part of VIP to DP IV; -
FIG. 14 shows the docking of glucagon (black) to the active site of DP IV; -
FIG. 15 shows the molecular dynamic simulation based model of the hexapeptide TFTSDY, bound to the secondary binding site of DP IV. Important amino acid residues from the enzyme are light gray, those from the hexapeptide are marked in dark gray, respectively; -
FIG. 16 shows the prolongation of the half-lifes of GIP, Glucagon, PACAP-27 and PACAP-38 by the hexapeptide TFTSDY in a DP IV (porcine and recombinant human) catalyzed peptide truncation test; -
FIG. 17 shows the DP IV-catalyzed hydrolysis of RANTES1-15 with (black solid triangle or broken line) or without TFTSDY (black solid square or straight line); -
FIG. 18 shows the DP IV-catalyzed hydrolysis of GIP with (black solid triangle) or without TFTSDY (black solid square); -
FIG. 19 shows the DP IV-catalyzed hydrolysis of glucagon with (black solid circle) or without TFTSDY (black solid triangle); -
FIG. 20 shows a plot of the distribution of the backbone dihedral angles of the complete model of porcine DP IV. All residues are in most favored and additional allowed regions. The plot statistics is as follows:Residues in most favoured regions (A, B, L) 457 66.0% Residues in additional allowed regions (a, b, l, p) 235 34.0% Residues in generously allowed regions (˜a, ˜b, ˜l, ˜p) 0 0.0% Residues in disallowed regions 0 0.0% Number of non-glycine and non-proline residues 692 100.0% Number of end-residues (excl. Gly and Pro) 2 Number of glycine residues (shown as triangles) 44 Number of proline residues 31 Total number of residues 769 -
FIG. 21 shows the analysis of the quality of the model of porcine DP IV with regard to some essential stereo-chemical parameters of the main chain. The plot statistics is as follows:No. of Comparison band No. of Values widths data Parameter Typical Band from Stereochemical parameter points value value width mean a. %-tage residues in A, B, L 692 66.0 83.8 10.0 −1.8 WORSE b. Omega angle standard 765 8.5 6.0 3.0 0.8 Inside deviation c. Bad contacts/100 residues 2 0.3 4.2 10.0 −0.4 Inside d. Zeta angle standard deviation 725 2.1 3.1 1.6 −0.6 Inside e. H-bond energy standard 400 0.8 0.8 0.2 −0.1 Inside deviation f. Overall G-factor 769 −0.4 −0.4 0.3 −0.1 Inside -
FIG. 22 shows the analysis of the quality of the model of porcine DP IV with regard to some essential stereo-chemical parameters of the side chains. The plot statistics is as follows:No. of band No. of Comparison Values widths data Parameter Typical from Stereochemical parameter points value value Band width mean a. Chi-1 gauche minus 156 16.2 18.1 6.5 −0.3 Inside standard deviation b. Chi-1 trans standard 218 17.9 19.0 5.3 −0.2 Inside deviation c. Chi-1 gauche plus standard 279 17.6 17.5 4.9 0.0 Inside deviation d. Chi-1 pooled standard 653 18.0 18.2 4.8 0.0 Inside deviation e. Chi-2 trans standard 144 16.3 20.4 5.0 −0.8 Inside deviation -
FIG. 23 shows soluble DP IV from prorcine kidney, which forms a 2-2-2 symmetric assembly as dimer of dimers. The view is along one two-fold axis. Potential glycosylation sites are indicated as grey spheres, black spheres are the sites modified in the crystal structure. The transmembrane helices and their orientation to the membrane were modeled to illustrate how tetramerization of DP IV can mediate cell-cell contacts. The figure was prepared by using the program MOLSCRIPT and RASTER3D. -
FIG. 24 shows a topology diagram illustrating the domain structure of porcine kidney DP IV. Blade IV of the propeller is involved in both the dimer contact (IV A-IV B: L235-P255, together with the highlighted C-terminal three secondary structure elements F713-C762) and the tetramerization of DP IV (IV A-IV C and IV B-IV C, not shown). -
FIG. 25 shows oligomerization interfaces. (A) Detailed view perpendicular to the dimer two-fold axis. The experimental electron density after phase extension to 2.0 Å resolution is superimposed on key residues mediating the contact. (B) View along the two-fold axis on the tetramerization interface. Blades IV of each subunit align to form an eight-bladed antiparallel β sheet. The highlighted Leu294 and Val341 are involved in ADA binding. The figure was prepared using BOBSCRIPT, MOLSCRIPT and RASTER3D. -
FIG. 26 shows substrate recognition by procine kidney DP IV. (A) The peptidomimetic active-site inhibitor p-Iodo-Phe-Pyr-CN is bound to active site. The accessible surface is indicated and cut-open (dark gray area at the top of the figure) for better visibility. (B) Schematic representation of the active site access in tricom and DP IV. The figure was prepared by using the programs MAIN , MOLSCRIPT, GRASP and RASTER3D. -
FIG. 27 shows the DP IV-catalyzed hydrolysis of GIP1-42 with (black solid squares) or without the heptapeptide H-Ser-D-Glu-Thr-Gly-D-Val-D-Lys-D-Val-OH (black solid triangles). - The inventors of the present application unexpectedly show, that the biodegradation of substrates, which bind to the same catalytic domain of DP IV, can be modulated very specifically.
- One aspect of the invention is to identify the site in the DP IV protein, which is responsible for the modulation of the substrate specificity and selectivity of DP IV and DP IV-like enzymes and to provide new compounds, which regulate the substrate selectivity and/or activity of DP IV and DP IV-like enzymes and which are useful for the treatment of, for example, impaired glucose tolerance, glucosuria, lipid disorders, dyslipidemia, hyperlipidaemia, hypertriglyceridemia, hypercholesterolemia, low HDL levels, high LDL levels, metabolic acidosis, hyperglycemia, diabetes mellitus, diabetic neuropathy and nephropathy and of sequelae caused by diabetes mellitus in mammals, metabolism-related hypertension and cardiovascular sequelae caused by hypertension in mammals, for the prophylaxis or treatment of skin diseases and diseases of the mucosae, autoimmune diseases and inflammatory conditions, and for the treatment of psychosomatic, neuropsychiatric and depressive illnesses, such as anxiety, depression, sleep disorders, chronic fatigue, schizophrenia, epilepsy, nutritional disorders, spasm and chronic pain, atherosclerosis and its sequelae, vascular restenosis, irritable bowel syndrome, inflammatory bowel disease, including Crohn's disease and ulcerative colitis, other inflammatory conditions, pancreatitis, abdominal obesity, neurodegenerative disease, retinopathy, nephropathy, Syndrome X, ovarian hyperandrogenism (polycystic ovarian syndrome), growth hormone deficiency, neutropenia, tumor metastasis, benign prostatic hypertrophy, gingivitis, osteoporosis, and other conditions.
- Usually, DP IV is inhibited by compounds mimicking the N-terminal dipeptide part of a DP IV-substrate. This leads to potent compounds which are inhibitors of DP IV and DP IV-like enzymes and inhibit at sufficient concentrations (e.g. 5× Ki-dose) the DP IV-catalyzed hydrolysis of small chromogenic or higher molecular weight peptide substrates. In the present invention it is demonstrated that compounds interacting with DP IV-binding sites far distant from the catalytic center are capable to differentiate the degradation of different substrates, e.g. peptide substrates, or even discriminate DP IV-catalyzed hydrolysis completely.
- The substrate properties of the peptides of the growth hormone releasing factor (GRF) family against DP IV were examined.
- The GRF family consists of the following peptide hormones:
-
- Gastrin-releasing peptide (GRP)
- Enterostatin
- Peptide histidine methionine (PHM)
- Cholecystokinin
- Glucagon-like peptide-2 (GLP-2)
- Glucose-dependent insulinotropic polypeptide (GIP)
- Glucagon-like peptide-1 (GLP-1)
- Growth-hormone releasing factor (GRF)
- Pituitary-adenylate cyclase activating polypeptide (PACAP (27 und 38))
- Vasoactive intestinale peptide (VIP)
- Exendin-1
- Exendin-2
- Exendin-3
- Exendin-4
- Secretin
- Glucagon
- In particular, the capability of purified DP IV from human, from porcine kidney, of recombinant human DP IV and the DP IV activity of the human serum to truncate the peptides of the GRF family were analyzed. The half-life of the peptides were determined using matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS) whereas the kinetic constants Km and kcat/Km were calculated using capillary zone electrophoresis. All peptides were hydrolyzed by porcine DP IV, recombinant human DP IV or DP IV activity of the human serum. The resulting Km-values were independent from the amino acid in the P1-position. That means that the binding of substrates to DP IV is not mainly affected by the P1-residue rather than by secondary interactions between substrate and DP IV protein.
- The same surprising phenomenon of different substrate properties was shown with GIP-fragments of different chain lengths. V2GIP( 1-6) and G2GIP( 1-6) were not hydrolyzed by DP IV. V2GIP(1-30) and G2GIP(1-30) were accepted as substrates and both S2GIP(1-6) and S2GIP(1-30) were truncated by DP IV (Table 2). These findings prove the existence of a secondary binding site in the DP IV protein, which is responsible for substrate recognition and which modulates the biodegradation of substrates and, therefore forms the basis for the management of substrate selectivity and specificity of DP IV and/or DP IV-like enzymes.
TABLE 2 Truncation half life of various bioactive peptides which are substrates for DP IV substance half-life [min] GIP1-30 2.68 S2GIP1-30 137.14 V2GIP1-30 298.04 G2GIP1-30 150.02 GIP1-6 <7.5 S2GIP1-6 79.04 V2GIP1-6 no degradation G2GIP1-6 no degradation - The amino acid sequences of natural GIP1-30 and GIP1-6 are:
GIP1-30: YAEGTFISDYSIAMAKIHQQAFVNWLLAQK GIP1-6: YAEGTF - To identify the secondary binding site, a hexapeptide derived from a consensus sequence of the amino acid sequences of GRF-family peptides was synthesized and its influence on the substrate specificity of DP IV was measured. The selected consensus sequence corresponds to glucagon5-10, comprising the amino acid sequence TFTSDY. As expected this peptide had only weak influence on the GP-4-Nitroanilide hydrolysis (Ki=0.71 mM).
- In support of the results achieved with the GRF family peptides, the truncation half-lifes of GIP, GLP-1, NPY, glucagon or PACAP by DP IV were also changed after preincubation with 160 μM TFTSDY (Table 3). No differences could be detected between incubation of Rantes1-15 and DP IV with or without the hexapeptide TFTSDY (Table 3). The latter finding shows that the peptide Rantes1-15 is too short to reach the secondary binding site and therefore TFTSDY has no effect on its hydrolysis rate. The half-lives of GIP and glucagon in presence of DP IV were prolonged by TFTSDY, the strongest influence had TFTSDY on the DP IV-catalyzed truncation of glucagon.
- Further, a modified variant of the hexapeptide TFTSDY, TFTDDY was synthesized, studied for docking in the DP IV 3D structural model and tested for its regulatory efficacy to modulate substrate specificity of DP IV.
TABLE 1 Inhibitory effect of TFTSDY on DP IV-catalyzed peptide truncation expressed in Ki-values Ki [μM] peptide rec. human DP IV porcine DP IV PACAP-27 26.7 n.d. PACAP-38 2.8 n.d. GIP 14.0 65.9 glucagon 3.7 6.8 RANTES1-15 n.d. 12307.7 GLP-1 n.d. 13.7 NPY n.d. 17.2
n.d.—not determined
- The hexapeptides TFTSDY and TFTDDY were found to be instable in biological fluids, e.g. humen serum or human plasma and/or they were rapidly degraded by proteolytic enzymes in the serum or plasma. Therefore, and in another embodiment of the present invention, a heptapeptide of the sequence
H-Ser-D-Glu-Thr-Gly-D-Val-D-Lys-D-Val-OH
was synthesized. This heptapeptide is not enzymatically degraded in human serum or plasma and is stable in these fluids. A stabilization of the heptapeptide was especially achieved by the incorporation of D-amino acids in the molecule. It was further shown to be very effective in improving the substrate specificity of DP IV compared to control experiments without the heptapeptide. - The existence of a secondary binding site was proven, e.g. using a set of dipeptide compounds, coupled to a chromogenic (p-nitroaniline, pNA) or fluorogenic (aminomethylcoumarine, AMC) group. The dipeptides His-Pro, His-Ala, His-Ser, His-Val, His-Gly, and His-Thr represent the first two amino acids from the N-terminus of the following peptide hormones: GIP, GLP-1, GLP-2, PACAP, VIP, PHM and glucagon. The peptide hormones GIP, GLP-1, GLP-2, PACAP, VIP, PHM and glucagon are substrates of DP IV. DP IV hydrolizes these peptide hormones and the respective N-terminal dipeptides are released. In contrast, the dipeptides are much slower released, when they are coupled to the chromogenic (p-nitroaniline, pNA) or fluorogenic (aminomethylcoumarine, AMC) group. Secondary interactions of the peptide hormones GIP, GLP-1, GLP-2, PACAP, VIP, PHM and glucagon far from the DP IV active site must exist as a prerequisite for substrate recognition. Data supporting the existence of a secondary binding site of DP IV are shown in table 4 below
TABLE 4 DP IV-catalyzed hydrolysis of His-Ser-, His-Gly and His-Val-dipeptides compared to the full-lenght substrates glucagon and NPY. Compound Km [M] His-Ser-AMC 2.1 * 10−2 Glucagon 3.8 * 10−6 His1-Ser2-NPY 6.8 * 10−5 His-Gly-AMC 4.1 * 10−4 [Gly]2-glucagon 2.2 * 10−5 His-Val-AMC 1.9 * 10−2
The Prolyl Oligopeptidase (POP) Based Computer-Generated Models of Human DP IV - Prolyl oligopeptidase (POP) based computer-generated models of human DP IV and porcine DP IV and the crystal structure of porcine DP IV were used according to the present invention to predict enzyme-substrate-interactions and to identify the interaction site in the DP IV protein structure.
- Since the sequence homology between DP IV and the template POP is not very high, standard methods for homology modeling such as the application of COMPOSER gave only very crude preliminary models which needed a lot of manual modification and improvements. These improvements were made by inspection of the conformation and spatial position of each of the 766 amino acid residues with regard to forming sheets or helices and favored intra-residual interactions such as hydrogen bonds, salt bridges and hydrophobic interactions as well. All modifications made were examined by using PROCHECK, which allows the analysis of the stereochemical quality of the model (dihedral angles in favored areas of a Ramachandran Plot, see
FIG. 1 for human DP IV andFIG. 20 for porcine DP IV), bond angles and bond length, hydrogen bonds (seeFIG. 2 for human DP IV andFIGS. 21 and 22 for porcine DP IV), and by PROSA which analyzes its energy in comparison to native folded proteins. All these residues show that some residues are located in unfavorable areas but all belong to loop regions of the propeller domain which is not of essential importance for docking studies and predictions of new ligands. - In summary of this part, the model of DP IV used herein is in a state where the overall fold is correct and highly useful for the explanation of experimental results and to allow predictions of recommendations for positions of site directed mutagenesis, development of ligands based on the identified second binding site or selective ligands to bind at the closer active site.
- In order to identify essential amino acids for the secondary interaction independently from the active site, site-directed mutageneses were performed using human DP IV cDNA. The mutation sites were: W629A and R560A. The characterization of these mutants showed that both mutations have no influence on the enzyme catalyzed hydrolysis of GP-4-nitroanilide and the kinetic parameters of short and/or low molecular weight inhibitors, which are directed to the active site of DP IV (see table 5). Another mutated enzyme variant, R310A, was expressed as inactive protein. This mutation resulted in the appearance of three DP IV fragments. Based on the computer generated model was shown that an intramolecular salt bridge is formed between R310 and D332 and that this intramolecular salt bridge is crucial for the formation and stabilization of the DP V tertiary protein structure.
TABLE 5 Kinetic characterization of DP IV-catalyzed substrate hydrolysis by mutants of DP IV in the secondary binding site Test Km Ki kcat kcat/Km Mutation compound [M] [M] [s−1] [M−1 * s−1] mu 15 DP IV Gly-Ser-AMC Not hydrolyzed mu 15 DP IV Gly-Pro-AMC 4.66E−05 1.00E+06 2.15E+10 mu 15 DP IV V2GIP(1-4)* no inhibition mu 15 DP IV S2GIP(1-6)* no inhibition mu 15 DP IV Glucagon (1-14)* no inhibition mu 15 DP IV Leu-hia-Fum* 6.81E−08 mu 15 DP IV TFTSDY* no inhibition mu 15 DP IV PACAP(1-38)* 3.67E−05 mu 15 DP IV Transp 01* 7.69E−08 mu 15 DP IV YAESTF amide* 1.14E−06 mu 16 DP IV Gly-Ser-AMC Not hydrolyzed mu 16 DP IV Gly-Pro-AMC 5.02E−05 1.44E+06 2.86E+10 mu 16 DP IV V2GIP(1-4)* no inhibition mu 16 DP IV S2GIP(1-6)* no inhibition mu 16 DP IV Glucagon (1-14)* no inhibition mu 16 DP IV PACAP(1-38)* 3.21E−05 mu 16 DP IV Transp 01* 8.55E−08 mu 16 DP IV YAESTF amide* 1.06E−06 mu 16 DP IV TFTSDY* no inhibition mu 16 DP IV Leu-Thia Fum* 6.57E−08 rh wt DP IV Gly-Ser-AMC 4.4E−04 rh wt DP IV Gly-Pro-AMC 3.53E−05 1.66E+06 4.7E+10 rh wt DP IV V2GIP(1-4)* no inhibition rh wt DP IV S2GIP(1-6)* no inhibition rh wt DP IV Glucagon (1-14)* no inhibition rh wt DP IV PACAP(1-27)* 2.28E−04 1.13E−04 rh wt DP IV PACAP(1-38)* 3.83E−05 rh wt DP IV Transp 01* 5.08E−08 rh wt DP IV YAESTF amide* 3.51E−08 rh wt DP IV TFTSDY* no inhibition rh wt DP IV Leu-Thia Fum* 4.26E−05 6.58E−08 p wt DP IV Leu-Thia-Fum* 5.98E−05 7.29E−08 p wt DP IV PACAP(1-27)* 1.22E−04 5.43E−05
*The Ki-values were determined in competition of the test compound to the standard substrate GP-4NA (see examples). No inhibition means that the compound doesn't influence the DP IV-catalyzed hydrolysis of the standard substrate GP-4NA.
- Definitions in table 5:
mu 15recombinant human DP IV, mutation R560A mu 16 recombinant human DP IV, mutation W629A rh wt recombinant human DP IV, wild type p wt porcine kidney DP IV, wild type Transp 01 RRLSYSRRRF-E-Thia - In the present invention a region was identified in the DP IV-protein, which is responsible for the interaction with a hexapeptide, e.g. TFTSDY or TFTDDY, or more suitably, a degadation resistent heptapeptide, e.g. H-Ser-D-Glu-Thr-Gly-D-Val-D-Lys-D-Val-OH. The most important amino acids for the formation of the secondary binding site on DP IV for the GRF family of peptide hormones were found to be but are not restricted to L90, E 91, T 152, W154, W157, R310, Y330, R318, Y416, S460, K463, E464 and R560.
- The Cyrstal Structure of DP IV
- In a further embodiment of the present invention, the sequence and 1.8 Å crystal structure of native DP IV prepared from porcine kidney were determined. The crystal structure reveals a 2-2-2 symmetric tetrameric assembly which depends on the natively glycosylated β-propeller blade IV. The crystal structure indicates that tetramerization of DP IV is a key mechanism to regulate its interaction with other components. Each subunit comprises two structural domains, the N-terminal eight-bladed β-propeller with open Velcro topology and the C-terminal α/β-hydrolase domain. Analogy with the structurally related POP and tricom protease suggests that substrates access the buried active site through the β-propeller tunnel while products leave the active site through a separate side exit. A dipeptide mimicking inhibitor complexed to the active site discloses key determinants for substrate recognition, including a Glu-Glu motif which distinguishes DP IV as an aminopeptidase and an oxyanion trap which binds and activates the P2-carbonyl oxygen necessary for efficient post-proline cleavage.
- Sequence of the Porcine DP IV
- Sequence comparison of the porcine DP IV with the human and other mammalian DP IV-sequences reveals a very high degree of sequence conservation. In particular, there is not a single sequence insertion or deletion between the porcine and the human sequence. The overall sequence identity between these two species is 88%. (and 92% within the catalytic domain). Noteworthy, Ser339 in the porcine sequence substitutes for Cys339 in the human sequence, causing the absence of an extra disulfide bond (Cys328-Cys339) in human DP IV. In comparison to the human sequence the potential glycosylation site at Asn520 is lost because of an Asn-His exchange. On the other hand there is an additional potential glycosylation site at Asn179 which is not found in the human sequence. Interestingly, the glycosylation site at Asn279 is found at Asn281 in the human sequence.
- Recently, the structure of human DP IV was published (PDB entry code 1N1M) (Rasmussen H. B., Branner, S., Wiberg, F. C., Wagtmann, N. (2002) http://www.nature.com/naturestructuralbiology, published online 16 Dec. 2002.) The model of porcine DP IV according to the present invention was refined by using the program CNS with current R-values of 21.7% (working set) and 24.9% (test set) and deviations from ideality of 0.008 Å (bond length) and 1.4 degree (angle deviation).
- Overall Structure and Subunit Assembly
- The monomer comprises an N-terminal β-propeller domain (Arg54-Asn497) followed by the catalytic domain Gln508-Pro766. Notably, the crystal structure reveals a dimer of DP IV dimers in the crystallographic unit cell obeying a 222 symmetry with all axes intersecting,
FIG. 23 . The by far more extensive dimer contact is predominantly mediated by residues of the catalytic domain with a contact area of 2270 Å2 versus the dimer-to-tetramer interface of 2×570 Å2=1140 Å2. The dimer interface is dominated by hydrophobic interactions, with a central and well shielded aromatic stacking involving Trp734 and Phe713 of both monomers. The hydrophobic contacts are complemented by polar interactions such as Asp729 with His754 and His757,FIG. 25A . Notably, the Gln731(Oε1)-Gln731(Nε2) contact resembles a subtle (atomic) break of the exact two-fold symmetry within the dimer. The residues critical to the dimerization are strictly conserved throughout all species. - The dimer-dimer interface has a more hydrophilic character. In its center, the strands Asn279-Gln286 of each DP IV-dimer form an antiparallel β-sheet, thus extending propeller blade IV to an eight-stranded antiparallel sheet,
FIG. 25B . An additional contribution to the tetrameric assembly in our crystals arises from the outer strands of blade V. The residues contributing to the dimer-dimer contact are similar over different species, albeit especially in rodents not strictly identical. More importantly, there are no insertions or deletions in the outer β strands of blade IV with a contact area of 570 Å2 per monomer. Significantly, Asn279 is located at the tetramerization interface and is glycosylated (FIGS. 23, 25B ). Thus, glycosylation of Asn279 might provide one missing regulatory link which was proposed to control the assembly of a 900 kDa oligomer (Lambeir, A. M., Pereira, J. F. D., Chacon, P., Vermeulen, G., Heremans, K., Devreese, B., VanBeeumen, J., Demeester, I. & Scharpe, S. (1997) Biochim. Biophys. Acta 1340, 215-226.). - Subdomain Structure
- The β-propeller. The N-terminal β-propeller domain contains eight blades with four antiparallel strands each. Typically for β propeller structures, the first and the last blade of a β-propeller is clamped together either covalently by disulfide bond formation (four-bladed β-propellers) or by strand exchange between the first and last blade (five to eight-bladed propellers). So far there are three exceptions to this closed propeller topology rule, namely the seven bladed β-propeller of POP (Fülöp, V., Bocskei, Z. & Polgár, L. (1998) Cell 94, 161-170.), the seven and the six bladed propellers of the tricom protease (Brandstetter, H., Kim, J. -S., Groll, M. & Huber, R. (2001) Nature 414, 466-469.), and the five bladed propeller of α-L-arabinase 43A (Nurizzo, D., Turkenburg, J. P., Charnock, S. J., Roberts, S. M., Dodson, E. J., McKie, V. A., Taylor, E. J., Gilbert, H. J. & Davies, G. J. (2002) Nature Struct. Biol. 9, 665-668.). The β8-propeller of DP IV can also be classified as an open Velcro-type topology, because no segment C-terminal to blade VIII interacts with the first propeller blade. Interestingly, however, the interaction of the first strand within blade I is limited to Thr59-Ile63 while its N-terminal extension Phe53-Tyr58 tightens up the propeller structure by interacting with the immediate C-terminal extension to the fourth strand of blade VIII (Glu499-Met503). A similar, yet shorter, external clamp has been described for the δ7-propeller of the tricorn protease (Brandstetter, H., Kim, J. -S., Groll, M. & Huber, R. (2001) Nature 414, 466-469.).
- With the exception of Cys649-Cys762 all disulfide bonds are located in the β propeller domain where they form intra-blade stabilizing crosslinks exclusively,
FIG. 24 . Cys339 in the human sequence is replaced by Ser339 in the porcine sequence which causes the absence of the disulfidebond connecting strand loops connecting strand loop connecting strand FIGS. 23, 24 . Intriguingly, out of these five potential glycosylation sites only Asn279 is actually posttranslationally modified which is involved in the tetramerization of DP IV. Further glycosylation sites are located on blade I (Asn92 at the end of strand 4), blade IV (Asn229 close to the tetramerization motif), blade V (Asn321 on theloop connecting strand 2 and 3),FIG. 23, 24 . Asn150 on the exit strand of blade II is not actually modified in the crystals. The shape of the DP IV-β8-propeller is asymmetric where blades VI, VII, VIII, I, and blades II, III, IV, V form more compact subdomains, respectively (FIGS. 23, 25B ). The structural division of the β-propeller fits physico-chemical data which indicated a three domain organization of DP IV (Lambeir, A. M., Pereira, J. F. D., Chacon, P., Vermeulen, G., Heremans, K., Devreese, B., VanBeeumen, J., Demeester, I. & Scharpe, S. (1997) Biochim. Biophys. Acta 1340, 215-226.). The ellipsoidal tunnel through the propeller is continuously open. At the solvent exposed opening, its diameter measures 9 Å and 15 Å from blade IV to VIII and from blade II to VI, respectively. The tunnel widens towards the catalytic domain with opening diameters of 15 Å and 25 Å between the same pairs of propeller blades. By its dimensions, the tunnel allows for direct passage of an extended peptide, but not for a folded α-helix. - Only few solvent molecules are visible in the tunnel, most remarkable a sulfate is bound to the oxyanion pocket formed by the amide nitrogens of Glu361 and Ile407 and Nε2 of His363.
- The Catalytic domain. The catalytic domain is located at the C-terminus of DP IV and spans residues Gln509 to Pro766. It adopts a typical α/β-hydrolase fold with a central 8 stranded β sheet, where only the second strand Thr522-Pro531 deviates from the otherwise parallel strand polarity,
FIG. 23 . The β-sheet exerts a significant twist of more than 90 degrees, in line with observations on related α/β-hydrolases. - Within the catalytic domain a single disulfide bond Cys649-Cys762 crosslinks the C-terminal helix Met746-Ser764 with the sixth strand of the β-sheet (Lys648-Ala654), thus stabilizing its tertiary arrangement. Helix Met746-Ser764, together with helix Gln714-Asp725 and strand Asp729-Thr736 from the C-terminal region, constitutes the central dimerization motif which is further stabilized through an interaction contributed by the oligomerization blade IV of the β-propeller.
- The β-sheet is sandwiched by several a-helices, including helix Tyr631-Ala642 immediately succeeding the catalytic Ser630. Ser630 is embedded in the surrounding secondary structure framework where it participates both in the preceding strand 4 (Arg623-Trp629) as well as in the following helix Tyr631-Ala642. This causes a strained backbone conformation of the active site Ser630. The high energy conformation of Ser630 is reflected by its dihedral angles (Φ, ψ)=(61.4,-115.7) and presumably provides a reservoir needed for catalysis (Goettig, P., Groll, M., Kim, J. -S., Huber, R. & Brandstetter, H. (2002) EMBO J 21, 5343-5352.).
- Active site and substrate recognition. The sequential and three-dimensional arrangement of the catalytic residues Ser630, His740, Asp708 corresponds to that of related α/β-hydrolases. The oxyanion hole is formed by the amide Tyr631 and the hydroxyl Oη of Tyr547 and serves to recognize and activate the carbonyl oxygen of the P1-residue. It is occupied by a water molecule in the uninhibited structure. To detail the exact mechanism of substrate recognition, the structure of a dipeptid mimetic, the iodinated Phe-cyanopyrrolidide inhibitor in complex with DP IV was determined (
FIG. 26A ). The active site nucleophile, the hydoxyl residue of Ser630, forms a covalent bond with the scissile carbonyl carbon of the cyanopyrrolidine of the inhibitor. The bending of the linkage (FIG. 26A ) indicates the formation of a stable carbaminic acid adduct. The pyrrolidine ring is accommodated by a hydrophobic pocket formed by side chains of Tyr666, Tyr662, Val711, Val656 and Trp659. While this environment is almost perfectly suited for the imino acid proline as P1-residue, the hydroxyl Oη of Tyr662 would be correctly positioned to interact with the normal amide nitrogen of an amino acid in P1. The inhibitor also unambiguously maps the S2-site. The P2-carbonyl oxygen gets trapped in an electrostatic sink formed by the side chains of Arg125 and Asn710. Glu205 and Glu206, and to a lesser extent the carbonyl oxygen of Glu205, interact with the free amino terminus of the P2-residue, thus determining the dipeptidyl “amino”-peptidase activity of the enzyme. It is, therefore, the β-propeller which provides essential determinants for P2-recognition, namely Arg125, which is positioned on the hairpin loop betweenstrands strand 1 of the β propeller blade IV. Ample space is available to accommodate voluminous side chains such as Tyr or Trp in P2,FIG. 26A . In our inhibitor the phenyl ring of the P2-residue is iodated rather than hydroxylated. It forms an ionic interaction with Arg358,FIG. 26A . - Substrate access to and product egress from the active site. The β-propeller domain covers the active site and thereby restricts the substrate access to it. There are two possible routes to the active site, namely through the tunnel of the β-propeller and through a side opening. Similar as the propeller tunnel, the shape of the side entrance is oval with dimensions of 15 Å and 22 Å. The side opening to the active site is generated by the kinked blade arrangement of blade I and II,
FIG. 23 . In POP, blades I and II are arranged more regularly and there is no side opening to the active site chamber. The distance from the protein surface to the active site measures 20 Å and 37 Å through the side opening and the propeller tunnel, respectively. From its dimensions, both routes give active site access to unfolded peptidic substrates, but the side entrance is significantly shorter and less winded. Once the substrate has been cleaved, two products have to leave the active site chamber. Clearly, the product exit route differs from the entrance to the active site. - Based on the crystal structure model new functional characteristics of DP IV were identified and are part of the present invention. These new features of DP IV are:
- Oligomerization of membrane-bound and soluble DP IV. Tetramerization on the cell surface involves, for geometric reasons, a membrane bound and a soluble DP IV dimer pair or dimers located on the surface of two different cells, as illustrated on
FIG. 23 . DP IV is known as a cell-cell communication molecule. Thus, the way DP IV is involved in mediating such cell-cell contacts may be by tetramerization of two homodimers present on the surface of interacting cells. Alternatively, soluble dimers can assemble to form a homotetramer, as observed in the crystal structure described above. The tetramer assembles to enclose a large cavity. Since tetramerization of DP IV depends on the correctly glycosylated propeller blade IV, glycosylation could function as a quality control unit. - Dimerization is mediated by the three C-terminal secondary structure elements positioned on the catalytic domain, and a finger like insertion motif within
strand strand - Functional role of oligomerization. The crystal structure shows that dimerization is not required to complete the active site architecture of DP IV, as for example in the case of tricorn (Brandstetter, H., Kim, J. -S., Groll, M. & Huber, R. (2001) Nature 414, 466-469.). Instead, dimerization and tetramerization will affect interaction with other components, including proteolytic substrates and ADA and mediate cell-cell contacts. Moreover, dimerization of DP IV is likely to enhance the receptor-ligand affinity by bivalent interaction. Finally, it is likely that dimerization is critical for signal transduction into the cell.
- Substrate preference and catalytic mechanism. The hydrophobic S1-pocket visualizes that proline is perfectly suited as a P1-residue, although it will also fit other small uncharged residues such as alanine or serine. Interestingly, the S1-site implements a mechanism to adapt to both imino and amino acids in P1-position. The hydroxyl Oθ of Tyr662 is able to form a hydrogen bond with the P1-amide nitrogen and thus optimally presents the substrate for catalysis. By contrast, the proper orientation of proline in P1-position is achieved by its side chain interaction in addition to the binding to the oxyanion pocket. In this situation, the hydroxyl of Tyr662 can slightly reorient to form a hydrogen bond with the side chain Oδ1 of Asn710,
FIG. 26A . The recognition of the P2-residue is dictated by main chain interactions with two prominent anchor sites, namely Glu205-Glu206 which form a twin-single salt bridge with the free amino terminus of the P2-residue; and Arg125 together with Nδ2 of Asn710 which stabilize and activate the P2-carbonyl oxygen. The Glu205-Glu2O6 motif is highly conserved in the DP IV gene family and it has been shown by site directed mutagenesis to be essential for enzymatic activity. The role of the P1oxyanion hole in activating the substrate's scissile bond is well established for all proteases. In the case of DP IV as a post-proline processing enzyme an additional requirement has to be met to achieve efficient catalysis. Proline containing peptides can adopt in solution also cis-peptide bond as well as trans-peptide bond conformation. However, as highlighted by the inhibitor used in this invention, only a peptide in trans-conformation is able to productively bind to the active site. - β-propeller architecture: The tunnel through the eight-bladed β-propeller widens from the surface towards the active site of DP IV.
- Substrate access to and product egress from the active site. Two openings of similar diameter, but differing length, give access to the active site. The situation in DP IV is most closely resembled by the tricom protease where a seven-bladed and six-bladed β-propeller provide a separate entrance to and exit from the active site, respectively. Tricom protease is a serine protease with low but significant structural homology to the family of α/β-hydrolases. This similarity suggests that the β8-propeller provides substrate access to and the side opening product release from the DP IV active site. This tricom-derived model is able to explain the high substrate selectivity critical for DP IV-function to activate or inactivate regulatory peptides. Passage through the β-propeller tunnel requires the substrates to unfold thereby providing their “finger print” to DP IV. Once the amino terminus of the peptide approaches the active site, it is still held in place by its C-terminus interacting with the β-propeller which then contributes to conformationally activate the substrate for cleavage. After the nucleophilic attack the acyl enzyme intermediate forms, while the primed product is directly released through the side exit.
- Interaction with other components. DP IV binds adenosine deaminase (ADA) to the T-cell surface, thereby preventing the cell from adenosine mediated inhibition of proliferation. DP IV-ADA complex formation is presumably hydrophobically driven, as the complex dissociates at very low ionic strength. By using site-directed mutagenesis, Leu294 and Val341 were identified as two ADA binding sites (Abbott, C. A., McCaughan, G. W., Levy, M. T., Church, W. B. & Gorrell, M. D. (1999) Eur. J Biochem. 226, 798-810.). Leu294 and Val341 are positioned at the outer strand of the tetramerization blade IV and blade V, respectively. Therefore, ADA-binding will interfere with tetramerization. Similarly, the glycosylation of Asn279 (Asn281 in the human sequence) is likely to influence ADA-binding. This teaches that tetramerization of DP IV and proper glycosylation of Asn279 serve as major control mechanism for ADA-binding
- DP IV as a target for drug design. The inhibitor structure used to establish the crystal structure of DP IV in the present invention identified important recognition elements at DP IV's active site and represents an excellent starting point for rational design of active site directed inhibitors. However, DP IV's involvement in a great variety of physiological processes poses a high challenge to avoid unwanted side effects for any DP IV drug development program. Ideally, it is possible now to target a particular DP IV substrate rather than the complete DP IV activity. Active site directed DP IV inhibitors, however, will interfere with the complete DP IV proteolytic activity and might even interfere with structurally related members of the α-β hydrolase family. Non-active site directed inhibition strategies depict a solution to this problem. The sulfate bound to the oxyanion pocket within the β propeller tunnel formed by the amide nitrogens of Glu361 and Ile407 and Nε2 of His363, as indicated in
FIG. 26A , identified an excellent target point for the development of inhibitors that block substrate passage through the β propeller tunnel. - In the peptides, proteins and mutants shown, each encoded residue where appropriate is represented by a one-letter or a three-letter designation, corresponding to the trivial name of the amino acid, in accordance with usual practice. Examples of usual definitions are given in the following conventional list:
Amino Acid One-Letter Symbol Three-Letter Symbol Alanine A Ala Arginine R Arg Asparagine N Asn Aspartic acid D Asp Cysteine C Cys Glutamine Q Gln Glutamic acid E Glu Glycine G Gly Histidine H His Isoleucine I Ile Leucine L Leu Lysine K Lys Methionine M Met Phenylalanine F Phe Proline P Pro Serine S Ser Threonine T Thr Tryptophan W Trp Tyrosine Y Tyr Valine V Val Selenocysteine Sec - In a preferred embodiment of the present invention, a secondary binding site in the DP IV protein and/or DP IV-like enzymes is identified. More preferred, the existence of this secondary binding site can be used to influence the selectivity of the DP IV-catalyzed biodegradation of DP IV-substrates, e.g. alanine (GIP), proline (GRP) or serine (glucagon) substrates, dependent on the amino acid residue in the PI position and dependent on the tertiary structure of the DP IV-substrates. Preferred DP IV-substrates, the biodegradation whereof shall be regulated according to the invention with compounds, which bind to the secondary binding site, are serine substrates.
- The regulation of the biodegradation of DP IV-substrates due to compounds, which bind to the secondary binding site, is further dependent on the chain length of the substrates. Preferably, DP V-substrates have a chain length of more than 5 amino acid residues, more preferably more than 10 amino acid residues. Most preferred are substrates with more than 15 amino acid residues up to 70 amino acid residues.
- Currently known substrates of DP IV are:
-
- Xaa-Pro peptides
- Tyr-melanostatin
- Endomorphin-2
- Enterostatin
- β-Casomorphin
- Trypsinogen pro-peptide
- Bradykinin
- Substance P
- Corticotropin-like intermediate lobe peptide
- Gastrin-releasing peptide
- Neuropeptide Y
- Peptide YY
- Aprotinin
- RANTES
- GCP-2
- SDF-1α
- SDF-1β
- MDC
- MCP-1
- MCP-2
- MCP-3
- Eotaxin
- IP-10
- Insulin-like growth factor-I
- Pro-colipase
- Interleukin-2
- Interleukin-1β
- α1-Microglobulin
- Prolactin
- Trypsinogen
- Chorionic gonadotropin
- Xaa-Ala peptides
- PHM
- GRH-(1-29)
- GRH-(1-44)
- GLP-1
-
- GLP-2
- Gastric inhibitory peptide
- Orexin B
- Xaa-Ser peptides
- Orexin A
- In the most preferred embodiment of the present invention, compounds for the modulation of DP IV-catalyzed biodegradation of DP IV-substrates are provided, which compounds bind to the secondary binding site of DP IV or DP IV-like enzymes. Such compounds are e.g. selected from the compounds of the formulas a)-d):
- Furthermore, the present invention provides agents, which bind to both the active site and the secondary binding site of DP IV and DP IV-like enzymes and thereby simultaneously modulate the enzyme activity and substrate specificity of DP IV or DP V-like enzymes.
- DP IV is present in a wide variety of mammalian organs and tissues e.g. the intestinal brush-border ( Gutschmidt S . et al., “In situ”—measurements of protein contents in the brush border region along rat jejunal villi and their correlations with four enzyme activities. Histochemistry 1981, 72 (3), 467-79), exocrine epithelia, hepatocytes, renal tubuli, endothelia, myofibroblasts (Feller A. C. et al., A monoclonal antibody detecting dipeptidylpeptidase IV in human tissue. Virchows Arch. A. Pathol. Anat. Histopathol. 1986; 409 (2):263-73), nerve cells, lateral membranes of certain surface epithelia, e.g. Fallopian tube, uterus and vesicular gland, in the luminal cytoplasm of e.g., vesicular gland epithelium, and in mucous cells of Brunner's gland (Hartel S. et al., Dipeptidyl peptidase (DPP) IV in rat organs. Comparison of immunohistochemistry and activity histochemistry. Histochemistry 1988; 89 (2): 151-61), reproductive organs, e.g. cauda epididymis and ampulla, seminal vesicles and their secretions (Agrawal & Vanha-Perttula, Dipeptidyl peptidases in bovine reproductive organs and secretions. Int. J. Androl. 1986, 9 (6): 435-52). In human serum, two molecular forms of dipeptidyl peptidase are present (Krepela E. et al., Demonstration of two molecular forms of dipeptidyl peptidase IV in normal human serum. Physiol. Bohemoslov. 1983, 32 (6): 486-96), the serum high molecular weight form of DP IV is expressed on the surface of activated T cells (Duke-Cohan J. S. et al., Serum high molecular weight dipeptidyl peptidase IV (CD26) is similar to a novel antigen DPPT-L released from activated T cells. J. Immunol. 1996, 156 (5): 1714-21). It is also a goal of the present invention to minimize possible side effects of currently available DP IV-inhibitors by the control and management of the DP IV substrate specificity for the selective treatment of a DP IV mediated disease.
- In another preferred embodiment of the present invention, all molecular forms, homologues and epitopes of proteins showing DP IV or DP IV-like enzyme activity, from all mammalian tissues and organs, also of those, which are undiscovered yet, are intended to be embraced by the scope of this invention.
- Among the rare group of proline-specific proteases, DP IV was originally believed to be the only membrane-bound enzyme specific for proline as the penultimate residue at the amino-terminus of the polypeptide chain. However, other molecules, even structurally non-homologous with the DP IV but bearing corresponding enzyme activity, have been identified. DP IV-like enzymes, which are identified so far, are e.g. fibroblast activation protein α, dipeptidyl peptidase IV β, dipeptidyl aminopeptidase-like protein, N-acetylated α-linked acidic dipeptidase, quiescent cell proline dipeptidase, dipeptidyl peptidase II, attractin and dipeptidyl peptidase IV related protein (DPP 8), DPL1 (DPX, DP6), DPP 9 and DPL2 (DPP 10) are described in the review articles by Sedo & Malik (Sedo & Malik, Dipeptidyl peptidase IV-like molecules: homologous proteins or homologous activities? Biochimica et Biophysica Acta 2001, 36506: 1-10) and Abbott & Gorrell (Abbott, C. A. & Gorrell, M. D., The family of CD26/DP IV and related ectopeptidases. In: Langner & Ansorge (ed.), Ectopeptidases. Kluwer Academic/Plenum Publishers, New York, 2002, pp. 171-195), and in Qi, S. Y., Cloning and characterization of
dipeptidyl peptidase 10, a new member of an emerging subgroup of serine proteases. - Another preferred embodiment of the present invention comprises screening methods for agents which bind to the secondary binding site and/or modulate the selectivity and/or the activity of DP IV and/or DP IV-like enzymes. An agent according to the invention preferably binds to at least one secondary binding site of the DPIV or DP IV-like enzyme proteins.
- The screening method for agents of the secondary binding site comprises the following steps:
-
- a) Contacting at least one of that effectors with DP IV and/or a DP IV-like enzyme, preferably under conditions which permit binding there between;
- b) Adding a substrate of DP IV and/or DP IV-like enzymes to said DP IV and/or DP IV-like enzyme;
- c) Monitoring the biodegradation of the substrate and/or measuring the residual DP IV and/or DP IV-like enzyme activity;
- d) Correlating changes in the biodegradation and/or enzyme activity with the binding of said effectors to DP IV and/or DP IV-like enzymes; and
- e) Identification of selectivity and/or activity modifying effectors.
- The agents selected by the above described screening method can work by regulating (increasing or decreasing) the biodegradation of at least one substrate of DP IV or the DP IV-like enzyme, preferably by the prolongation of the half-life of such substrate, most preferably by the inhibition of the biodegradation of such substrate.
- Conditions, under which binding between compounds and DP IV or DP IV-like enzymes are permitted, are described, e. g. in example 2.
- DP IV or DP IV-like enzymes as used in the screening method described above mean purified DP IV or DP IV-like enzymes from mammals, selected from but not restricted to human, monkey, mouse, rat etc., or DPIV or DP IV-like enzyme containing cells and cell lines from mammals, selected from but not restricted to human, monkey, mouse, rat etc., or DP IV or DP IV-like enzyme containing cell extracts or body liquids e.g. liver extracts, blood plasma samples, blood serum samples, brain extracts etc., from such mammals.
- Preferably, an agent increases the selectivity and/or activity of DP IV or DP IV-like enzymes towards substrates by at least about 10, preferably about 50, more preferably about 75, 90 or 100% relative to the absence of the agent. More preferably, an agent increases the selectivity and/or activity of DP IV or DP IV-like enzymes towards specific substrates by at least about 10, preferably about 50, more preferably about 75, 90 or 100% and prolongs the half live of the substrates in the serum or in the plasma of a mammal at least about 1 fold, preferably about 2fold, more preferably about 3fold, 4fold or higher relative to the absence of the agent. Most preferably, an agent increases the selectivity and/or activity of DP IV or DP IV-like enzymes in such a way that the half live of at least one substrate in the serum or in the plasma of a mammal is increased at least about 1fold, preferably about 2fold, more preferably about 3fold, 4fold or higher, most preferably complete inhibition of the degradation of such a substrate is achieved, relative to the absence of the agent.
- It is also preferred according to the invention that the agents modulate the interaction between DP IV or DP IV-like enzymes and binding proteins thereof. Binding proteins are proteins that bind other proteins in a non-covalent manner and thereby modulate their activity or serve as carriers of these proteins. Binding proteins of DP IV (CD26) identified so far include adenosine deaminase, two proteins of HIV, transactivator protein (tat) and the gp120 envelope protein, CD45, a membrane located tyrosine phosphatase, extracellular matrix proteins, such as collagen and fibronectin, plasminogen and streptokinase, mannose 6-phosphat/insulin-like growth factor II receptor, the isoform NH3 of the Na+/H+ exchanger from renal microvilly membranes and the thromboxane A2 receptor.
- Especially preferred are compounds or agents that prevent and/or inhibit the interaction between DP IV and/or DP IV-like enzymes and binding proteins of these enzymes.
- According to another embodiment of the present invention, the selectivity and/or activity modifying effectors block the product release site of DP IV and/or DP IV-like enzymes.
- Further preferred are selectivity and/or activity modifying effectors, which prevent the tetramerization of DP IV and/or DP IV-like enzymes at the cell surface between a soluble DP IV dimer pair or dimers located on the surface of two different cells in a mammal.
- Agents (also called compounds herein) can be pharmacological agents already known in the art or can be compounds previously unknown to have any pharmacological activity. The compounds can be naturally occurring or designed in the laboratory. They can be isolated from microorganisms, animals, or plants, and can be produced recombinantly, or synthesized by chemical methods in the art. If desired, agents can be obtained using any of the numerous combinatorial library methods known in the art, including but not limited to, biological libraries, spatially addressable parallel solid phase or solution phase libraries, synthetic library methods requiring deconvolution, the “one-bead-one-compound” library method, and synthetic library methods using affinity chromatography selection. The biological library approach is limited to polypeptide libraries, while the other four approaches are applicable to polypeptide, non-peptide oligomer, or small molecule libraries of compounds. See Lam, Anticancer Drug Des., 12, 145, 1997.
- Methods for the synthesis of molecular libraries are well known in the art (see, for example, De Witt et al., Proc. Natl.
Acad. Sci. USA 90, 6909, 1993; Erb et al. Proc. Natl. Acad. Sci. USA 91, 11422, 1994; Zuckermann et al., J. Med. Chem. 37, 2678, 1994; Cho et al., Science 261, 1303, 1993 ; Carell et al., Angew. Chem. Int. Ed. Engl. 33, 2059, 1994; Carell et al., Angew. Chem. Int. ed. engl. 33, 2061; Gallop et al., J. Med. Chem. 37, 1233, 1994). Libraries of compounds can be present in solution (see, e.g. Houghten, Bio Techniques 13, 412421, 1992) or on beads (Lam, nature 354, 824, 1991) chips (Fodor, Nature 364, 555556, 1993) bacteria or spores (Ladner, U.S. Pat. No. 5,223,409), plasmids (Cull et al., Proc. Natl. Acad. Sci. USA 89, 198651869, 1992), or phage (Scott & Smith, Science 249, 386390, 1990; Devlin, Science 249, 404406, 1990); Cwirla et la., Proc. Natl. Acad. Sci. 97, 63786382, 1990; Felici, J. Mol. Biol. 222, 301310, 1991; and Ladner, U.S. Pat. No. 5,223,409). - High Throughput Screening
- Agents can be screened for the ability to bind to DP IV or DP IV-like enzymes or to affect DP IV or DP IV-like enzyme activity using high throughput screening. Using high throughput screening, many discrete compounds can be tested in parallel so that large numbers of agents can be quickly screened. The most widely established techniques utilize 96-well microtiter plates. The well of the microtiter plates typically require assay volumes that range from 50 to 500 μl. In addition to the plates, many instruments, materials, pipettors, robotics, plate washers, and plate readers are commercially available to fit the 96-well format.
- Alternatively, “Free format assays”, or assays that have no physical barrier between samples, can be used. For example, an assay using pigment cells (melanocytes) in a simple homogeneous assay for combinatorial peptide libraries is described by Jayawickreme et al., Proc. Natl. Acad. Sci. USA 19, 161418 (1994).
- Another example of a free format assay is described by Chelsky, “Strategies for Screening Combinatorial Libraries: Novel and Traditional Approaches,” reported at the First Annual conference of The Society for Biomolecular Screening in Philadelphia, Pa. (Nov. 710, 1995). Chelsky placed a simple homogenous enzyme assay for carbonic anhydrase inside an agarose gel such that the enzyme in the gel would cause a color change throughout the gel. Thereafter, beads carrying combinatorial compounds were partially released by UV LIGHT. Compounds that inhibited the enzyme were observed as local zones of inhibition having less color change.
- Yet another example is described by Salomon et al.,
Molecular Diversity 2, 5763 (1996). In this example, combinatorial libraries were screened for compounds that had cytotoxic effects on cancer cells growing in agar. - Another high throughput screening method is described in Beutel et al., U.S. Pat. No. 5,976,813. In this method, test samples are placed in a porous matrix. One or more assay components are then placed within, on top of, or at the bottom of a matrix such as a gel, a plastic sheet, a filter, or other form of easily manipulated solid support. When samples are introduced to the porous matrix they diffuse sufficiently slowly, such that the assays can be performed without the test samples running together.
- Binding Assays
- For binding assays, the agent is preferably a small molecule which binds to and occupies, the secondary binding site of DP IV or DP IV-like enzymes, such that normal biological activity is changed or prevented. Examples of such small molecules include, but are not limited to, small peptides or peptide like molecules.
- In binding assays, either the agent of DP IV or the DP IV-like enzyme can comprise a detectable label, such as a fluorescent, radioisotopic, chemiluminescent, or the enzyme is labeled, such as horseradish peroxidase, alkaline phosphatase, or luciferase. Detection of an agent, which is bound to DP IV or the DP IV-like enzyme can then be accomplished, for example, by direct counting of radioemmission, by scintillation counting, or by determining conversion of an appropriate substrate to a detectable product.
- Alternatively, binding of an agent to DP IV or a DP IV-like enzyme can be determined without labelling either of the interactants. For example, a microphysiometer can be used to detect binding of an agent with DP IV or a DP IV-like enzyme. A microphysiometer (e.g., Cytosensor™) is an analytical instrument that measures the rate at which a cell acidifies its environment using a light-addressable potentiometric sensor (LAPS). Changes in this acidification rate can be used as an indicator of the interaction between an agent and DP IV or a DP IV-like enzyme (McConnel et al., Science 257, 19061912, 1992).
- Determining the ability of an agent to bind to DP IV or a DP IV-like enzyme also can be accomplished using a technology such as real-time Biomolecular Interaction Analysis (BIA) (Sjolander & Urbaniczky, Anal. Chem. 63, 23382345, 1991, and Szabo et al., Curr. Opin. Struct. Biol. 5, 699705, 1995) BIA is a technology for studying biospecific interactions in real time, without labelling any of the interactants (e.g. BIAcore™). Changes in the optical phenomenon surface plasmon resonance (SPR) can be used as an indication of real-time reactions between biological molecules.
- In yet another aspect of the invention, DP IV or a DP IV-like enzyme can be used as a “bait protein” in a two hybrid assay or three-hybrid assay (see, e.g. U.S. Pat. No. 5,283,317; Zervos et al., Cell 72, 223232, 1993; Madura 920924, 193; Iwabuchi et al.,
Oncogene 8, 16931696, 1993; and Brent WO94/10300), to identify other proteins which bind to or interact with the DP IV or the DP IV-like enzyme and modulate its activity. - The two hybrid system is based on the modular nature of most transcription factors, which consist of separable DNA binding and activation domains. Briefly, the assay utilizes two different DNA constructs. For example, in one construct, a polynucleotide encoding DP IV or a DP IV-like enzyme can be fused to a polynucleotide encoding the DNA binding domain of a known transcription factor (e.g. GAL4). In the other construct a DNA sequence that encodes an unidentified protein (“prey” or “sample”) can be fused to a polynucleotide that c odes for the activation domain of the known transcription factor. If the “bait” and the “prey” proteins are able to interact in vivo to form an protein dependent complex, the DNA binding and activation domains of the transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g. LacZ), which is operably linked to a transcriptional regulatory site responsive to the transcription factor. Expression of the reporter gene can be detected, and cell colonies containing the functional transcription factor can be isolated and used to obtain the DNA sequence encoding the protein which interacts with the dipeptidyl-peptidase IV-like enzyme polypeptide.
- It may be desirable to immobilize either the DP IV or DP IV-like enzyme or the agent to facilitate separation of bound from unbound forms of one or both of the interactants, as-well-as to accommodate automation of the assay. Thus, either DP IV or the DP IV-like enzyme or the agent can be bound to a solid support. Suitable solid supports include, but are not limited to, glass or plastic slices, tissue culture plates, microtiter wells, tubes, silicon chips, or particles such as beads (including, but not limited to latex, polysterene, or glass beads). Any method known in the art can be used to attach DP IV or the DP IV-like enzyme or agent to a solid support, including use of covalent and non-covalent linkages, passive absorption, or pairs of binding moieties attached respectively to the polypeptide or agent and the solid support. Agents are preferably bound to the solid support in an array, so that the location of individual test compounds can be tracked. Binding of a test compound to a DP IV or a DP IV-like enzyme can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels include microtiter plates, test tubes, and microcentrifuge tubes.
- In one embodiment, the DP IV or DP IV-like enzyme is a fusion protein comprising a domain that allows the DP IV or DP IV-like enzyme to be bound to a solid support. For example, glutathione-S-transferase fusion proteins can be absorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, Mo.) or glutathione derivatized microtiter plates, which are then combined with the agent and the non-absorbed DP IV or DP IV-like enzyme; the mixture is then incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtiter plate wells are washed to remove any unbound components. Binding of the interactants can be determined either directly or indirectly, as described above. Alternatively, the complexes can be dissociated from the solid support before binding is determined.
- Other techniques for immobilizing proteins on a solid support also can be used in the screening assays of the invention. For example, either DP IV or a DP IV-like enzyme or an agent can be immobilized utilizing conjugation of biotin and streptavidin. Biotinylated DP IV or DP IV-like enzymes or agents can be prepared from biotin-NHS-(N-hydroxysuccinimide) using techniques well known in the art (e.g. biotinylation kit, Pierce Chemicals, Rockford, Ill.) and immobilized in the wells of streptavidin-coated 96 well plates (Pierce chemical). Alternatively, antibodies which specifically bind to DP IV, a DP IV-like enzyme or an agent, but which do not interfere with a desired binding site, such as secondary binding site or the active site of DP IV or the DP IV-like enzyme, can be derivatized to the wells of the plate. Unbound targets or proteins can be trapped in the wells by antibody conjugation.
- Examples for commercial available antibodies against DP IV or CD26 are for instance:
Species Company Clone (antigen) Application Host Coulter Ta1 human IF, FACS Mouse Ba5 human FACS Biozol TA59 human ICH* (Endogen) Pharmingen M-A216 human IF, FACS Mouse Biotrend 13.4 rat ICH, IF Mouse M-T099 human ICH, IF Mouse 134-2C2 human IF, FACS Mouse LT-27 human IF, FACS Mouse Biozol MRCOX-61 rat FC Mouse Biozol 236.3 rat IF, IPrep, IHstaining Mouse Research 202.36 human IF Mouse Diagnostics Research 134-2C2 human T-cell signaling, HIV Mouse Diagnostics infection - Methods for detecting such complexes, in addition to those described above for the GST-immobilized complexes, include immunodetection of complexes using antibodies which specifically bind to DP IV or DP IV-like enzymes or the agent, enzyme linked assays which rely on detecting an activity of the DP IV or the DP IV-like enzyme, and SDS gel electrophoresis under non-reducing conditions.
- Screening for agents which bind to DP IV or a DP IV-like enzyme also can be carried out in an intact cell. Any cell which comprises DP IV or a DP IV-like enzyme can be used in a cell-based assay system. DP IV or a DP IV-like enzyme can be naturally occurring in the cell or can be introduced using techniques such as those described above. Binding of the agents to DP IV or a DP IV-like enzyme is determined as described above.
- Enzyme Assays
- Agents can be tested for the ability to increase or decrease the activity of a mammalian DP IV or DP IV-like enzyme. DP IV activity can be measured, for example, as described in U.S. Pat. No. 5,601,986 and, specific for the present invention, in examples 1 to 3.
- Further on, a screening method for the identification and determination of one or more secondary binding sites on DP IV and/or DP IV-like enzymes is provided.
- The screening method for secondary binding site(s) of DP IV and/or DP IV-like enzymes comprises the following steps:
-
- a) Providing two or more different substrates, each having an amino acid sequence, which binds to DP IV and/or DP IV-like enzymes and aligning the amino acid sequences of said substrates;
- b) Identifying at least one consensus sequence amongst said substrate amino acid sequences;
- c) Synthesizing a peptide having said consensus sequence;
- d) Contacting said synthesized peptide with DP IV and/or a DP IV-like enzyme;
- e) Adding a substrate of DP IV and/or a DP IV-like enzyme to the DP IV and/or DP IV-like enzyme;
- f) Monitoring the biodegradation of the substrate and/or measuring the residual DP IV and/or DP IV-like enzyme activity; and
- g) Correlating changes in said biodegradation and/or enzyme activity with the presence of a secondary binding site capable of modulating the substrate specificity of DP IV and/or DP IV-like enzymes.
- Consensus sequences are highly conserved sequence segments. Preferred according to the invention are consensus sequences with the length of 3 to 20 amino acids, more preferred of 5 to 12 amino acids, most preferred 5 to 7 amino acids.
- In another illustrative embodiment of the present invention, the agents, which bind to the secondary binding site, e.g. obtained or selected by the screening method described herein, can be used alone or in combination with DP IV-inhibitors for the treatment of any type of DP IV mediated disorders, selected but not restricted to, impaired glucose tolerance, glucosuria, lipid disorders, dyslipidemia, hyperlipidaemia, hypertriglyceridemia, hypercholesterolemia, low HDL levels, high LDL levels, metabolic acidosis, hyperglycemia, diabetes mellitus, diabetic neuropathy and nephropathy and of sequelae caused by diabetes mellitus in mammals, metabolism-related hypertension and cardiovascular sequelae caused by hypertension in mammals, for the prophylaxis or treatment of skin diseases and diseases of the mucosae, autoimmune diseases and inflammatory conditions, and for the treatment of psychosomatic, neuropsychiatric and depressive illnesses, such as anxiety, depression, sleep disorders, chronic fatigue, schizophrenia, epilepsy, nutritional disorders, spasm and chronic pain, atherosclerosis and its sequelae, vascular restenosis, irritable bowel syndrome, inflammatory bowel disease, including Crohn's disease and ulcerative colitis, other inflammatory conditions, pancreatitis, abdominal obesity, neurodegenerative disease, retinopathy, nephropathy, Syndrome X, ovarian hyperandrogenism (polycystic ovarian syndrome), growth hormone deficiency, neutropenia, tumor metastasis, benign prostatic hypertrophy, gingivitis, osteoporosis, and other conditions.
- Agents such as N-(N′-substituted glycyl)-2-cyanopyrrolidines, L-threo-isoleucyl thiazolidine (P32/98), L-allo-isoleucyl thiazolidine, L-threo-isoleucyl pyrrolidine, and L-allo-isoleucyl pyrrolidine have been developed which inhibit the enzymatic activity of DP IV and are described in U.S. Pat. No. 6,001,155, WO 99/61431, WO 99/67278, WO 99/67279, DE 198 34 591, WO 97/40832, DE 196 16 486
C 2, WO 98/19998, WO 00/07617, WO 99/38501, and WO 99/46272. Further examples of low molecular weight dipeptidyl peptidase IV inhibitors are agents such as tetrahydroisoquinolin-3-carboxamide derivatives, N-substituted 2-cyanopyroles and—pyrrolidines, N-(N′-substituted glycyl)-2-cyanopyrrolidines, N-(substituted glycyl)-thiazolidines, N-(substituted glycyl)-4-cyanothiazolidines, amino-acyl-borono-prolyl-inhibitors and cyclopropyl-fused pyrrolidines. Inhibitors of dipeptidyl peptidase IV are described in U.S. Pat. No. 6,380,398, U.S. Pat. No. 6,011,155; U.S. Pat. No. 6,107,317; U.S. Pat. No. 6,110,949; U.S. Pat. No. 6,124,305; U.S. Pat. No. 6,172,081; WO 95/15309, WO 99/61431, WO 99/67278, WO 99/67279, DE 198 34 591, WO 97/40832, DE 196 16 486 C 2, WO 98/19998, WO 00/07617, WO 99/38501, WO 99/46272, WO 99/38501, WO 01/68603, WO 01/40180, WO 01/81337, WO 01/81304, WO 01/55105, WO 02/02560 and WO 02/14271, WO 02/04610, WO 02/051836, WO 02/068420, WO 02/076450; WO 02/083128, WO 02/38541, WO 03/000180, WO03/000181, WO 03/000250, WO 0 3/002530, WO 03/002531, WO 03/002553, WO 03/002593, WO 03/004496, WO 03/004498, WO 03/024965, WO 03/024942, WO 03/035067, WO 03/037327, WO 03/035057, WO 03/045977, WO 03/055881, WO 03/68748, WO 03/68757, WO 03/057666, WO 03057144, WO 03/040174 and WO 03/033524, the teachings of which are herein incorporated by reference in their entirety concerning these inhibitors, their uses, definition and their production. The goal of these agents is to inhibit DP IV, and by doing so, to relieve effectively any type of DP IV-mediated disease. The inventors of the present invention have surprisingly found that such agents can be advantageously employed for an entirely different therapeutic purpose, then previously known by those skilled in the art. - Preferred for the use in combination with agents binding to the secondary binding site of DP IV or DP IV-like enzymes are DP IV-inhibitors such as valine pyrrolidide (Novo Nordisk), NVP-DPP728A (1-[[[2-[{5-cyanopyridin-2-yl}amino]ethyl]amino]acetyl]-2-cyano-(S)-pyrrolidine) (Novartis) as disclosed by Hughes et al., Biochemistry, 38 (36), 11597-11603, 1999, LAF-237 (1-[(3-hydroxy-adamant-1-ylamino)-acetyl]-pyrrolidine-2(S)-carbonitrile); disclosed by Hughes et al., Meeting of the American Diabetes Association 2002, Abstract no. 272 or (Novartis), TSL-225 (tryptophyl-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid), disclosed by Yamada et. al., Bioorg. & Med. Chem. Lett. 8 (1998), 1537-1540, 2-cyanopyrrolidides and 4-cyanopyrrolidides as disclosed by Asworth et al., Bioorg. & Med. Chem. Lett., 6, No. 22, pp 1163-1166 and 2745-2748 (1996), FE-999011, disclosed by Sudre et al., Diabetes 51 (5), pp 1461-1469 (2002) (Ferring) and the compounds disclosed in WO 01/34594 (Guilford), employing dosages as set out in the above references.
- In one especially illustrative embodiment, the present invention relates to the use of agents, which bind to the secondary binding site(s) of DP IV or DP IV-like enzymes in combination with dipeptide-like compounds and compounds analogous to dipeptide compounds that are formed from an amino acid and a thiazolidine or pyrrolidine group, and salts thereof, referred to hereinafter as dipeptide-like compounds. Preferably the amino acid and the thiazolidine or pyrrolidine group are bonded with an amide bond.
- Especially suitable for that purpose according to the invention are dipeptide-like compounds in which the amino acid is preferably selected from a natural amino acid, such as, for example, leucine, valine, glutamine, glutamic acid, proline, isoleucine, asparagines and aspartic acid.
- The dipeptide-like compounds used according to the invention exhibit at a concentration (of dipeptide compounds) of 10 μM, a reduction in the activity of plasma dipeptidyl peptidase IV or DP IV-analogous enzyme activities of at least 10%, especially of at least 40%. Frequently a reduction in activity of at least 60% or at least 70% is also required. Preferred agents may also exhibit a reduction in activity of a maximum of 20% or 30%.
- Preferred compounds are N-valyl prolyl, O-benzoyl hydroxylamine, a lanyl pyrrolidine, isoleucyl thiazolidine like L-allo-isoleucyl thiazolidine, L-threo-isoleucyl pyrrolidine and salts thereof, especially the fumaric salts, and L-allo-isoleucyl pyrrolidine and salts thereof. Especially preferred compounds are glutaminyl pyrrolidine and glutaminyl thiazolidine of formulas 1 and 2:
- Further preferred compounds are given in Table 6.
- The salts of the dipeptide-like compounds can be present in a molar ratio of dipeptide (-analogous) component to salt component of 1:1 or 2:1. Such a salt is, for example, (Ile-Thia)2 fumaric acid.
TABLE 6 Structures of further preferred dipeptide compounds DP IV-inhibitor H-Asn-pyrrolidine H-Asn-thiazolidine H-Asp-pyrrolidine H-Asp-thiazolidine H-Asp(NHOH)-pyrrolidine H-Asp(NHOH)-thiazolidine H-Glu-pyrrolidine H-Glu-thiazolidine H-Glu(NHOH)-pyrrolidine H-Glu(NHOH)-thiazolidine H-His-pyrrolidine H-His-thiazolidine H-Pro-pyrrolidine H-Pro-thiazolidine H-Ile-azididine H-Ile-pyrrolidine H-L-allo-Ile-thiazolidine H-Val-pyrrolidine H-Val-thiazolidine -
- A, B, C, D and E are independently any amino acid moieties including proteinogenic amino acids, non-proteinogenic amino acids, L-amino acids and D-amino acids and wherein E and/or D may be absent.
- Further conditions regarding formula (3):
-
- A is an amino acid except a D-amino acid,
- B is an amino acid selected from Pro, Ala, Ser, Gly, Hyp, acetidine-(2)-carboxylic acid and pipecolic acid,
- C is any amino acid except Pro, Hyp, acetidine-(2)-carboxylic acid, pipecolic acid and except N-alkylated amino acids, e.g. N-methyl valine and sarcosine,
- D is any amino acid or missing, and
- E is any amino acid or missing,
or: - C is any amino acid except Pro, Hyp, acetidine-(2)-carboxylic acid, pipecolic acid, except N-alkylated amino acids, e.g. N-methyl valine and sarcosine, and except a D-amino-acid;
- D is any amino acid selected from Pro, Ala, Ser, Gly, Hyp, acetidine-(2)-carboxylic acid and pipecolic acid, and
- E is any amino acid except Pro, Hyp, acetidine-(2)-carboxylic acid, pipecolic acid and except N-alkylated amino acids, e.g. N-methyl valine and sarcosine.
- Examples of amino acids which can be used in the present invention are: L and D-amino acids, N-methyl-amino-acids; allo- and threo-forms of Ile and Thr, which can, e.g. be α-, β- or Ω-amino acids, whereof α-amino acids are preferred.
- Examples of amino acids throughout the claims and the description are: aspartic acid (Asp), glutamic acid (Glu), arginine (Arg), lysine (Lys), histidine (His), glycine (Gly), serine (Ser) and cysteine (Cys), threonine (Thr), asparagine (Asn), glutamine (Gln), tyrosine (Tyr), alanine (Ala), proline (Pro), valine (Val), isoleucine (Ile), leucine (Leu), methionine (Met), phenylalanine (Phe), tryptophan (Trp), hydroxyproline (Hyp), beta-alanine (beta-Ala), 2-amino octanoic acid (Aoa), azetidine-(2)-carboxylic acid (Ace), pipecolic acid (Pip), 3-amino propionic, 4-amino butyric and so forth, alpha-aminoisobutyric acid (Aib), sarcosine (Sar), ornithine (Orn), citrulline (Cit), homoarginine (Har), t-butylalanine (t-butyl-Ala), t-butylglycine (t-butyl-Gly), N-methylisoleucine (N-MeIle), phenylglycine (Phg), cyclohexylalanine (Cha), norleucine (Nle), cysteic acid (Cya) and methionine sulfoxide (MSO), Acetyl-Lys, modified amino acids such as phosphoryl-serine (Ser(P)), benzyl-serine (Ser(Bzl)) and phosphoryl-tyrosine (Tyr(P)), 2-aminobutyric acid (Abu), aminoethylcysteine (AECys), carboxymethylcysteine (Cmc), dehydroalanine (Dha), dehydroamino-2-butyric acid (Dhb), carboxyglutaminic acid (Gla), homoserine (Hse), hydroxylysine (Hyl), cis-hydroxyproline (cisHyp), trans-hydroxyproline (transHyp), isovaline (Iva), pyroglutamic acid (Pyr), norvaline (Nva), 2-aminobenzoic acid (2-Abz), 3-aminobenzoic acid (3-Abz), 4-aminobenzoic acid (4-Abz), 4-(aminomethyl)benzoic acid (Amb), 4-(aminomethyl)cyclohexanecarboxylic acid (4-Amc), Penicillamine (Pen), 2-Amino-4-cyanobutyric acid (Cba), cycloalkane-carboxylic aicds.
- Examples of Ω-amino acids are e.g.: 5-Ara (aminoraleric acid), 6-Ahx (aminohexanoic acid), 8-Aoc (aminooctanoic aicd), 9-Anc (aminovanoic aicd), 10-Adc (aminodecanoic acid), 11-Aun (aminoundecanoic acid), 12-Ado (aminododecanoic acid).
- Further amino acids are: indanylglycine (Igl), indoline-2-carboxylic acid (Idc), octahydroindole-2-carboxylic acid (Oic), diaminopropionic acid (Dpr), diaminobutyric acid (Dbu), naphtylalanine (1-Nal), (2-Nal), 4-aminophenylalanin (Phe(4-NH2)), 4-benzoylphenylalanine (Bpa), diphenylalanine (Dip), 4-bromophenylalanine (Phe(4-Br)), 2-chlorophenylalanine (Phe(2-C1)), 3-chlorophenylalanine (Phe(3-C1)), 4-chlorophenylalanine (Phe(4-C1)), 3,4-chlorophenylalanine (Phe (3,4-C12)), 3- fluorophenylalanine (Phe(3-F)), 4-fluorophenylalanine (Phe(4-F)), 3,4- fluorophenylalanine (Phe(3,4-F2)), pentafluorophenylalanine (Phe(F5)), 4-guanidinophenylalanine (Phe(4-guanidino)), homophenylalanine (hPhe), 3-jodophenylalanine (Phe(3-J)), 4 jodophenylalanine (Phe(4-J)), 4-methylphenylalanine (Phe(4-Me)), 4-nitrophenylalanine (Phe-4-NO2)), biphenylalanine (Bip), 4-phosphonomehtylphenylalanine (Pmp), cyclohexyglycine (Ghg), 3-pyridinylalanine (3-Pal), 4-pyridinylalanine (4-Pal), 3,4-dehydroproline (A-Pro), 4-ketoproline (Pro(4-keto)), thioproline (Thz), isonipecotic acid (Inp), 1,2,3,4,-tetrahydroisoquinolin-3-carboxylic acid (Tic), propargylglycine (Pra), 6-hydroxynorleucine (NU(6-OH)), homotyrosine (hTyr), 3-jodotyrosine (Tyr(3-J)), 3,5-dijodotyrosine (Tyr(3,5-J2)), d-methyl-tyrosine (Tyr(Me)), 3-NO2-tyrosine (Tyr(3-NO2)), phosphotyrosine (Tyr(PO3H2)), alkylglycine, 1-aminoindane-1-carboxy acid, 2-aminoindane-2-carboxy acid (Aic), 4-amino-methylpyrrol-2-carboxylic acid (Py), 4-amino-pyrrolidine-2-carboxylic acid (Abpc), 2-aminotetraline-2-carboxylic acid (Atc), diaminoacetic acid (Gly(NH2)), diaminobutyric acid (Dab), 1,3-dihydro-2H-isoinole-carboxylic acid (Disc), homocylcohexylalanin (hCha), homophenylalanin (hPhe oder Hof), trans-3-phenyl-azetidine-2-carboxylic acid, 4-phenyl-pyrrolidine-2-carboxylic acid, 5-phenyl-pyrrolidine-2-carboxylic acid, 3-pyridylalanine (3-Pya), 4-pyridylalanine (4-Pya), styrylalanine, tetrahydroisoquinoline-1-carboxylic acid (Tiq), 1,2,3,4-tetrahydronorharmane-3-carboxylic acid (Tpi), β-(2-thienryl)-alanine (Tha).
- Other amino acid substitutions for those encoded in the genetic code can also be included in peptide compounds within the scope of the invention and can be classified within this general scheme.
- Proteinogenic amino acids are defined as natural protein-derived α-amino acids. Non-proteinogenic amino acids are defined as all other amino acids, which are not building blocks of common natural proteins.
- The resulting peptides may be synthesized as the free C-terminal acid or as the C-terminal amide form. The free acid peptides or the amides may be varied by side chain modifications. Such side chain modifications include for instance, but are not restricted to, homoserine formation, pyroglutamic acid formation, disulphide bond formation, deamidation of asparagine or glutamine residues, methylation, t-butylation, t-butyloxycarbonylation, 4-methylbenzylation, thioanysilation, thiocresylation, benzyloxyrnethylation, 4-nitrophenylation, benzyloxycarbonylation, 2-nitrobencoylation, 2-nitrosulphenylation, 4-toluenesulphonylation, pentafluorophenylation, diphenylmethylation, 2-chlorobenzyloxycarbonylation, 2,4,5-trichlorophenylation, 2-bromobenzyloxycarbonylation, 9-fluorenylmethyloxycarbonylation, triphenylmethylation, 2,2,5,7,8,-pentamethylchroman-6-sulphonylation, hydroxylation, oxidation of methionine, formylation, acetylation, anisylation, benzylation, bencoylation, trifluoroacetylation, carboxylation of aspartic acid or glutamic acid, phosphorylation, sulphation, cysteinylation, glycolysation with pentoses, deoxyhexoses, hexosamines, hexoses or N-acetylhexosamines, famesylation, myristolysation, biotinylation, palmitoylation, stearoylation, geranylgeranylation, glutathionylation, 5′-adenosylation, ADP-ribosylation, modification with N-glycolylneuraminic acid, N-acetylneuraminic acid, pyridoxal phosphate, lipoic acid, 4′-phosphopantetheine, or N-hydroxysuccinimide.
- In the compounds of formula (3), the amino acid moieties A, B, C, D, and E are respectively attached to the adjacent moiety by amide bonds in a usual manner according to standard nomenclature so that the amino-terminus (N-terminus) of the amino acids (peptide) is drawn on the left and the carboxyl-terminus of the amino acids (peptide) is drawn on the right. (C-terminus).
- Until the present invention by Applicants, known peptide substrates of the proline-specific serine protease dipeptidyl peptidase IV in vitro are the tripeptides Diprotin A (Ile-Pro-Ile), Diprotin B (Val-Pro-Leu) and Diprotin C (Val-Pro-Ile). Applicants have unexpectedly discovered that the compounds disclosed herein above and below act as substrates of dipeptidyl peptidase IV in vivo in a mammal and, in pharmacological doses, improve insulin sensitivity and islet signaling and alleviate pathological abnormalities of the metabolism of mammals such as glucosuria, hyperlipidaemia, metabolic acidosis and diabetes mellitus by competitive catalysis.
- Preferred peptide compounds are listed in table 7.
TABLE 7 Examples of peptide substrates Mass (exp.)1 Peptide Mass (calc.) [M + H+] 2-Amino octanoic acid-Pro-Ile 369.5 370.2 Abu-Pro-Ile 313.4 314.0 Aib-Pro-Ile 313.4 314.0 Aze-Pro-Ile 311.4 312.4 Cha-Pro-Ile 381.52 382.0 Ile-Hyp-Ile 356.45 358.2 Ile-Pro-allo-Ile 341.4 342.0 Ile-Pro-t-butyl-Gly 341.47 342.36 Ile-Pro-Val 327.43 328.5 Nle-Pro-Ile 341.45 342.2 Nva-Pro-Ile 327.43 328.2 Orn-Pro-Ile 342.42 343.1 Phe-Pro-Ile 375.47 376.2 Phg-Pro-Ile 361.44 362.2 Pip-Pro-Ile 338.56 340.0 Ser(Bzl)-Pro-Ile 405.49 406.0 Ser(P)-Pro-Ile 395.37 396.0 Ser-Pro-Ile 315.37 316.3 t-butyl-Gly-Pro-D-Val 327.4 328.6 t-butyl-Gly-Pro-Gly 285.4 286.3 t-butyl-Gly-Pro-Ile 341.47 342.1 t-butyl-Gly-Pro-Ile-amide 340.47 341.3 t-butyl-Gly-Pro-t-butyl-Gly 341.24 342.5 t-butyl-Gly-Pro-Val 327.4 328.4 Thr-Pro-Ile 329.4 330.0 Tic-Pro-Ile 387.46 388.0 Trp-Pro-Ile 414.51 415.2 Tyr(P)-Pro-Ile 471.47 472.3 Tyr-Pro-allo-Ile 391.5 392.0 Val-Pro-allo-Ile 327.4 328.5 Val-Pro-t-butyl-Gly 327.4 328.15 Val-Pro-Val 313.4 314.0
1[M + H+] were determined by Electrospray mass spectrometry in positive ionization mode.
t-butyl-Gly is defined as: - Ser(Bzl) and Ser(P) are defined as benzyl-serine and phosphoryl-serine, respectively. Tyr(P) is defined as phosphoryl-tyrosine.
-
-
-
- X1 is H or an acyl or oxycarbonyl group including an amino acid residue, N-protected amino acid residue, a peptide residue or a N-protected peptide residue,
- X2 is H, —(CH)m—NH—C5H3N—Y with m=2-4 or —C5H3N—Y (a divalent pyridyl residue) and Y is selected from H, Br, Cl, I, NO2 or CN,
- X3 is H or selected from an alkyl-, alkoxy-, halogen-, nitro-, cyano- or carboxy-substituted phenyl or from an alkyl-, alkoxy-, halogen-, nitro-, cyano- or carboxy-substituted pyridyl residue,
- X4 is H or selected from an alkyl-, alkoxy-, halogen-, nitro-, cyano- or carboxy-substituted phenyl or from an alkyl-, alkoxy-, halogen-, nitro-, cyano- or carboxy-substituted pyridyl residue,
- X5 is H or an alkyl, alkoxy or phenyl residue,
- X6 is H or an alkyl residue,
- for n=1
- X is selected from: H, OR2, SR2, NR2R3, N+R2R3R4, wherein:
-
- R2 stands for acyl residues, which are optionally substituted with alkyl, cycloalkyl, aryl or heteroaryl residues, or for amino acid residues or peptidic residues, or alkyl residues, which are optionally substituted with alkyl, cycloalkyl, aryl or heteroaryl residues,
- R3 stands for alkyl or acyl residues, wherein R2 and R3 may be part of a saturated or unsaturated carbocyclic or heterocyclic ring,
- R4 stands for alkyl residues, wherein R2 and R4 or R3 and R4 may be part of a saturated or unsaturated carbocyclic or heterocyclic ring,
- for n=0
-
-
- B stands for: O, S or NR5, wherein R5 is H, alkyl or acyl,
- C, D, E, F, G, Y, K, L, M, Q, T, U, V and W are independently selected from alkyl and substituted alkyl residues, oxyalkyl, thioalkyl, aminoalkyl, carbonylalkyl, acyl, carbamoyl, aryl and heteroaryl residues, and
- Z is selected from H, or a branched or straight chain alkyl residue from C1-C9, a branched or straight chain alkenyl residue from C2-C9, a cycloalkyl residue from C3-C8, a cycloalkenyl residue from C5-C7, an aryl or heteroaryl residue, or a side chain selected from all side chains of all natural amino acids or derivatives thereof.
-
-
- X1 is H or an acyl or oxycarbonyl group including an amino acid residue, N-acylated amino acid residue, a peptide residue from di- to pentapeptides, preferably a dipeptide residue, or a N-protected peptide residue from di- to pentapeptides, preferably a N-protected dipeptide residue
- X2 is H, —(CH)m—NH—C5H3N—Y with m=2-4 or —C5H3N—Y (a divalent pyridyl residue) and Y is selected from H, Br, Cl, I, NO2 or CN,
- for n=1
- X is preferably selected from: H, OR2, SR2, NR2R3, wherein:
-
- R stands for acyl residues, which are optionally substituted with alkyl, cycloalkyl, aryl or heteroaryl residues, or for amino acid residues or peptidic residues, or alkyl residues, which are optionally substituted with alkyl, cycloalkyl, aryl or heteroaryl residues,
- R3 stands for alkyl or acyl residues, wherein R2 and R3 may be part of a saturated or unsaturated carbocyclic or heterocyclic ring,
- for n=0
-
-
- B stands for: O, S or NR , wherein R5 is H, alkyl or acyl,
- C, D, E, F, G, Y, K, L, M and Q are independently selected from alkyl and substituted alkyl residues, oxyalkyl, thioalkyl, aminoalkyl, carbonylalkyl, acyl, carbamoyl, aryl and heteroaryl residues, and
- Z is selected from H, or a branched or straight chain alkyl residue from C1-C9, preferably C2-C6, a branched or straight chain alkenyl residue from C2-C9, a cycloalkyl residue from C3-C8, a cycloalkenyl residue from C5-C7, an aryl or heteroaryl residue, or a side chain selected from all side chains of all natural amino acids or derivatives thereof
-
-
- X1 is H or an acyl or oxycarbonyl group including an amino acid residue, N-acylated amino acid residue or a peptide residue from di- to pentapeptides, preferably a dipeptide residue, or a N-protected peptide residue from di- to pentapeptides, preferably a N-protected dipeptide residue
- for n=1,
- X is preferably selected from: H, OR2, SR2, wherein:
-
- R2 stands for acyl residues, which are optionally substituted with alkyl or aryl residues,
- for n=0
-
-
- B stands for: O, S or NR5, wherein R5 is H, alkyl or acyl,
- C, D, E, F, G, Y, K, L, M and Q are independently selected from alkyl and substituted alkyl residues, oxyalkyl, thioalkyl, aminoalkyl, carbonylalkyl, acyl, carbamoyl, aryl and heteroaryl residues, and
- Z is selected from H, or a branched or straight chain alkyl residue from C1-C9, preferably C2-C6, a branched or straight chain alkenyl residue from C2-C9, a cycloalkyl residue from C3-C8, a cycloalkenyl residue from C5-C7, an aryl or heteroaryl residue, or a side chain selected from all side chains of all natural amino acids or derivatives thereof.
-
-
- X1 is H or an acyl or oxycarbonyl group including an amino acid residue, N-acylated amino acid residue or a dipeptide residue, containing a Pro or Ala in the penultimate position, or a N-protected dipeptide residue containing a Pro or Ala in the penultimate position,
- for n=1,
- X is H,
-
- for n=0
-
-
- B stands for: O or S, most preferably for S
- C, D, E, F, G, Y, K, L, M, Q, are H and
- Z is selected from H, or a branched or straight chain alkyl residue from C3-C5, a branched or straight chain alkenyl residue from C2-C9, a cycloalkyl residue from C5-C7, a cycloalkenyl residue from C5-C7, an aryl or heteroaryl residue, or a side chain selected from all side chains of all natural amino acids or derivatives thereof.
- Most preferred for Z is H.
- According to a preferred embodiment the acyl groups are C1-C6-acyl groups.
- According to a further preferred embodiment the alk(yl) groups are C1-C6-alk(yl) groups, which may be branched or unbranched.
- According to a still further preferred embodiment the alkoxy groups are C1-C6-alkoxy groups.
- According to yet another preferred embodiment the aryl residues are C5-C12 aryl residues that have optionally fused rings.
- According to a still further preferred embodiment the cycloalkyl residues (carbocycles) are C3-C8-Cycloalkyl residues.
- According to another preferred embodiment the heteroaryl residues are C4-C11 aryl residues that have optionally fused rings and, in at least one ring, additionally from 1 to 4 preferably 1 or 2 hetero atoms, such as O, N and/or S.
- According to a further preferred embodiment peptide residues are corresponding residues containing from 2 to 50 amino acids.
- According to another preferred embodiment the heterocyclic residues are C2-C7-cycloalkyl radicals that additionally have from 1 to 4, preferably 1 or 2 hetero atoms, such as O, N and/or S.
- According to astill further preferred embodiment the carboxy groups are C1-C6 carboxy groups, which may be branched or unbranched.
- According to yet another preferred embodiment the oxycarbonyl groups are groups of the formula —O—(CH2)1-6COOH.
- The amino acids can be any natural or synthetic amino acid, preferably natural alpha amino acids.
- Preferred compounds of formula (4) are 2-Methylcarbonyl-1-N-[(L)-Alanyl-(L)-Valinyl]-(2S)-pyrrolidine hydrobromide; 2-Methyl)carbonyl-1-N-[(L)-Valinyl-(L)-Prolyl-(L)-Valinyl]-(2S)-pyrrolidine hydrobromide; 2-[(Acetyl-oxy-methyl)carbonyl]-1-N-[(L)-Alanyl-(L)-Valinyl]-(2S)-pyrrolidine hydrobromide; 2-[Benzoyl-oxy-methyl)carbonyl]-1-N-[{(L)-Alanyl}-(L)-Valinyl]-(2S)-pyrrolidine hydrobromide; 2-{[(2,6-Dichlorbenzyl)thiomethyl]carbonyl}-1-N-[{(L)-Alanyl}-(L)-Valinyl]-(2S)-pyrrolidine; 2-[Benzoy-loxy-methyl)carbonyl]-1-N-[Glycyl-(L)-Valinyl]-(2S)-pyrrolidine hydrobromide; 2-[([1,3]-thiazole-2-yl)carbonyl]-1-N-[{(L)-Alanyl}-(L)-Valinyl]-(2S)-pyrrolidine trifluoracetat; 2-[(benzothiazole-2-yl)carbonyl]-1-N-[N-{(L)-Alanyl}-(L)-Valinyl]-(2S)-pyrrolidin trifluoracetat; 2-[(-benzothiazole-2-yl)carbonyl]-1-N-[{(L)-Alanyl}-Glycyl]-(2S)-pyrrolidine trifluoracetat; 2-[(pyridin-2-yl)carbonyl]-1-N-[N-{(L)-Alanyl}-(L)-Valinyl]-(2S)-pyrrolidine trifluoracetat.
- Further, according to the present invention compounds of formula (5) including all stereoisomers and pharmaceutical acceptable salts thereof can be used in combination with agents binding to the secondary binding site(s) of DP IV or DP IV-like enzymes:
B—(CH—R1)n—C(═X2)—D (5)
wherein -
- n is 0 or 1,
- R1 stands for H, C1-C9 branched or straight chain alkyl, preferably H, n-butan-2-yl, n-prop-2-yl or isobutyl, C2-C9 branched or straight chain alkenyl, C3-C9 cycloalkyl, preferably cyclohexyl, C5-C7 cycloalkenyl, aryl, heteroaryl or a side chain of a natural amino acid or mimetics thereof,
- X2 stands for O, NR6, N+(R7)2, or S,
-
-
- where X5 is H or an acyl or oxycarbonyl group including amino acids,
- R5 is H, C1-C9 branched or straight chain alkyl, preferably H, n-butan-2-yl, n-prop-2-yl or isobutyl, C2-C9 branched or straight chain alkenyl, C3-C9 cycloalkyl, preferably cyclohexyl, 3-hydroxyadamant-d-yl, C5-C7 cycloalkenyl, aryl, heteroaryl or a side chain of a natural amino acid or derivatives thereof, or a group of the formula —(CH)m—NH—C5H3N—Y where m is an integer of 2-4, —C5H3N—Y is a divalent pyridyl moiety and Y is a hydrogen atom, a halogen atom, a nitro group or a cyano group,
- R6, R7 R8 and R9 are independently selected from H, optionally substituted C1-C9 branched or straight chain alkyl, preferably an optionally substituted C2-C5 branched or straight chain alkyl; or optionally substituted C2-C9 branched or straight chain alkenyl, preferably an C2-C5 branched or straight chain alkenyl; or optionally substituted C3-C8 cycloalkyl, preferably an optionally substituted C4-C7 cycloalkyl; or an optionally substituted C5-C7 cycloalkenyl, or an optionally substituted aryl residue,
- Z is selected from H, pyridyl or optionally substituted phenyl, optionally substituted alkyl groups, alkoxy groups, halogens, nitro, cyano and carboxy groups,
- W is selected from H, pyridyl or optionally substituted phenyl, optionally substituted alkyl groups, alkoxy groups, halogens, nitro, cyano and carboxy groups,
- W1 is H or optionally substituted alkyl, alkoxy or optionally substituted phenyl, and
- Z1 is H, or optionally substituted alkyl,
- R3 and R4 are independently H, hydroxy, alkyl, alkoxy, aralkoxy, nitro, cyano or halogen,
- D is an optionally substituted compound of the formula
which can be saturated, or can have one, two or three double bonds,
wherein - X8 to X11 are independently CH, N, N+(R7), or CR8, if unsaturated, or
- X8 to X11 are independently CH2, NH, NH+(R7), O, or S if saturated,
- X12 is CHA, NA, CH2, NH, NH+(R7), or CHR8, if saturated or
- X12 is CA, NA+, CH, N, N+(R7), or CR8, if unsaturated and
- A is H or an isoster of a carboxylic acid such as CN, SO3H, CONOH, PO3R5R6, a tetrazole, an amide, an ester or an acid anhydride.
- Throughout the application, D contains preferably at most two, further preferred at most one hetero atom in the ring.
- According to preferred embodiments of the present invention, D stands for optionally substituted C4-C7 cycloalkyl, preferably C4-C6 cycloalkyl, optionally substituted C4-C7 cycloalkenyl, or optionally substituted (hetero)cycloalkyl of the formulae
wherein the residues are as defined above,
or
that is, a five-membered ring containing one or two double bonds in the ring,
wherein the residues are as defined above,
wherein the residues are as defined above,
wherein the residues are as defined above,
that is a six-membered ring containing one or two double bonds in the ring,
wherein the residues are as defined above,
wherein the residues are as defined above. -
-
- Preferred compounds according to formula (5) are
-
- 1-cyclopentyl-3-methyl-1-oxo-2-pentanaminium chloride,
- 1-cyclopentyl-3-methyl-1-oxo-2-butanaminium chloride,
- 1-cyclopentyl-3,3-dimethyl-1-oxo-2-butanaminium chloride,
- 1-cyclohexyl-3,3-dimethyl-1-oxo-2-butanaminium chloride,
- 3-(cyclopentylcarbonyl)-1,2,3,4-tetrahydroisoquinolinium chloride, and N-(2-cyclopentyl-2-oxoethyl)cyclohexanaminium chloride.
- Because of the wide distribution of the protein in the body and the wide variety of mechanisms involving DP IV, DP IV-activity and DP W-related proteins, systemic therapy (enteral or parenteral administration) with DP IV-inhibitors can result in a series of undesirable side-effects.
- The problem to be solved was moreover, to provide compounds that can be used, in combination with agents binding to the secondary binding site(s) of DP IV or DP IV-like enzymes, for targeted influencing of locally limited patho-physiological and physiological processes. The problem of the invention especially consists in obtaining locally limited and highly specific inhibition of DP IV or DP IV-analogous activity for the purpose of targeted intervention in the regulation of the activity of locally active substrates.
-
- A is an amino acid having at least one functional group in the side chain,
- B is a chemical compound covalently bound to at least one functional group of the side chain of A,
- C is a thiazolidine, pyrrolidine, cyanopyrrolidine, hydroxyproline, dehydroproline or piperidine group amide-bonded to A.
- In accordance with a preferred embodiment of the invention, pharmaceutical compositions are used comprising at least one compound of the general formula (6) and at least one customary adjuvant appropriate for the site of action.
- Preferably A is an α-amino acid, especially a natural α-amino acid having one, two or more functional groups in the side chain, preferably threonine, tyrosine, serine, arginine, lysine, aspartic acid, glutamic acid or cysteine.
- Preferably B is an oligopeptide having a chain length of up to 20 amino acids, a polyethylene glycol having a molar mass of up to 20 000 g/mol, an optionally substituted organic amine, amide, alcohol, acid or aromatic compound having from 8 to 50 C atoms.
- Despite an extended side chain function, the compounds of formula (6) can still bind to the active centre of the enzyme dipeptidyl peptidase IV and analogous enzymes but are no longer actively transported by the peptide transporter PepT1. The resulting reduced or greatly restricted transportability of the compounds according to the invention leads to local or site directed inhibition of DP IV and DP IV-like enzyme activity.
- By extending/expanding the side chain modifications, for example beyond a number of seven carbon atoms, it is accordingly possible to obtain a dramatic reduction in transportability. With increasing spatial size of the side chains, there is a reduction in the transportability of the substances. By spatially and sterically expanding the side chains, for example beyond the atom group size of a monosubstituted phenyl radical, hydroxylamine radical or amino acid residue, it is possible according to the invention to modify or suppress the transportability of the target substances.
- Preferred compounds of formula (6) are compounds, wherein the oligopeptides have chain lengths of from 3 to 15, especially from 4 to 10, amino acids, and/or the polyethylene glycols have molar masses of at least 250 g/mol, preferably of at least 1500 g/mol and up to 15 000 g/mol, and/or the optionally substituted organic amines, amides, alcohols, acids or aromatic compounds have at least 12 C atoms and preferably up to 30 C atoms.
- The compounds of the present invention can be converted into and used as acid addition salts, especially pharmaceutically acceptable acid addition salts. The pharmaceutically acceptable salt generally takes a form in which an amino acids basic side chain is protonated with an inorganic or organic acid. Representative organic or inorganic acids include hydrochloric, hydrobromic, perchloric, sulfuric, nitric, phosphoric, acetic, propionic, glycolic, lactic, succinic, maleic, fumaric, malic, tartaric, citric, benzoic, mandelic, methanesulfonic, hydroxyethanesulfonic, benzenesulfonic, oxalic, pamoic, 2-naphthalenesulfonic, p-toulenesulfonic, cyclohexanesulfamic, salicylic, saccharinic or trifluoroacetic acid. All pharmaceutically acceptable acid addition salt forms of the compounds of formulas (1) to (6) are intended to be embraced by the scope of this invention.
- In view of the close relationship between the free compounds and the compounds in the form of their salts, whenever a compound is referred to in this context, a corresponding salt is also intended, provided such is possible or appropriate under the circumstances.
- The present invention further includes within its scope prodrugs of the compounds of formulas (1) to (6). In general, such prodrugs will be functional derivatives of the compounds which are readily convertible in vivo into the desired therapeutically active compound. Thus, in these cases, the present invention shall encompass the treatment of the various disorders described with prodrug versions of one or more of the claimed compounds, which convert to the above specified compound in vivo after administration to the subject. Conventional procedures for the selection and preparation of suitable prodrug derivatives are described, for example, in “Design of Prodrugs”, ed. H. Bundgaard, Elsevier, 1985 and the patent applications DE 198 28 113 and DE 198 28 114, which are fully incorporated herein by reference.
- Where the compounds or prodrugs according to this invention have at least one chiral center, they may accordingly exist as enantiomers. Where the compounds or prodrugs possess two or more chiral centers, they may additionally exist as diastereomers. It is to be understood that all such isomers and mixtures thereof are encompassed within the scope of the present invention. Furthermore, some of the crystalline forms of the compounds or prodrugs may exist as polymorphs and as such are intended to be included in the present invention. In addition, some of the compounds may form solvates with water (i.e. hydrates) or common organic solvents, and such solvates are also intended to be encompassed within the scope of this invention.
- The compounds, including their salts, can also be obtained in the form of their hydrates, or include other solvents used for their crystallization.
- A further preferred embodiment of the present invention comprises compounds capable of binding to the secondary binding site of DP IV or DP IV-like enzymes according to any one of the embodiments of the present invention
-
- in combination with acarbose, or
- in combination with metformin; or
- in combination with acarbose and metformin.
- In a further preferred embodiment, the compounds capable of binding to the secondary binding site of DP IV and/or DP IV-like enzymes of the present invention, can be used in combination with at least one antidiabetic agent selected from the group consisting of:
-
- insulin sensitizers selected from the group consisting of
- PPAR agonists,
- biguanides, and
- protein tyrosin phosphatase-1B (PTP-1B) inhibitors;
- insulin and insulin mimetics;
- sulfonylureas and other insulin secretagogues;
- α-glucosidase inhibitors, e.g. acarbose;
- glucagon receptor agonists;
- GLP-1; GLP-1 mimetics, and GLP-1 receptor agonists;
- GLP-2; GLP-2 mimetics, and GLP-2 receptor agonists, e.g. ALX-600 (teduglutide from NPS Allelix Corp.);
- exendin-4 and exendin-4 mimetics, e.g. exenatide (AC-2993, synthetic exendin-4 from Amylin/Eli Lilly);
- GIP, GIP mimetics, and GIP receptor agonists;
- PACAP, PACAP mimetics, and
PACAP receptor 3 agonists; - PYY, PYY mimetics, PYY receptor agonists, and PYY receptor antagonists,
- cholesterol lowering agents selected from the group consisting of
- HMG-CoA reductase inhibitors,
- sequestrants,
- nicotinyl alkohol, nicotinic acid and salts thereof,
- PPARα agonists,
- PPARγ agonists,
- PPARα/γ dual agonists,
- inhibitors of cholesterol absorption,
- acyl CoA:cholesterol acyltransferase inhibitors, and
- antioxidants;
- PPARδ agonists;
- antiobesity compounds;
- an ileal bile acid transporter inhibitor; and
- anti-inflammatory agents.
- insulin sensitizers selected from the group consisting of
- A further preferred embodiment of the present invention comprises compounds capable of binding to the secondary binding site of DP IV or DP IV-like enzymes according to any one of the embodiments of the present invention mentioned above
-
- in combination with a gene therapeutic expression system for GLP-1 comprising a viral vector comprising
- (a) a polynucleotide sequence encoding GLP-1 (gluacogen like peptide-1); and
- (b) a polynucleotide sequence encoding a signal sequence upstream of (a); and
- (c) a polyadenylation signal downstream of (a); and
- (d) a polynucleotide sequence encoding a proteolytic cleavage site located between the polynucleotide sequence encoding GLP-1 and the polynucleotide sequence encoding the signal sequence; and
- (e) wherein the expression of GLP-1 underlies a constitutive promoter or is controlled by a regulatable promotor;
- (f) wherein, optionally, the viral vector comprises a polynucleotide sequence encoding GIP (glucose dependent insulinotropic peptide);
- (g) wherein, optionally, the viral vector is encompassed by a mammalian cell. and /or
- in combination with a gene therapeutic expression system for GIP comprising a viral vector comprising
- (a) a polynucleotide sequence encoding GIP (glucose dependent insulinotropic peptide); and
- (b) a polynucleotide sequence encoding a signal sequence upstream of (a); and
- (c) a polyadenylation signal downstream of (a); and
- (d) a polynucleotide sequence encoding a proteolytic cleavage site located between the polynucleotide sequence encoding GIP and the polynucleotide sequence encoding the signal sequence; and
- (e) wherein the expression of GIP underlies a constitutive promoter or is controlled by a regulatable promotor;
- (f) wherein, optionally, the viral vector comprises a polynucleotide sequence encoding GLP-1 (glucagon like peptide 1);
- in combination with a gene therapeutic expression system for GLP-1 comprising a viral vector comprising
- (g) wherein, optionally, the viral vector is encompassed by a mammalian cell.
- A further preferred embodiment of the present invention comprises the compounds capable of binding to the secondary binding site of DP IV or DP IV-like enzymes in combination with a gene therapeutic expression system for GLP-1 and/or GIP according to any one of the embodiments of the present invention mentioned above wherein
-
- the signal sequence upstream of the gene of interest (GLP-1; GIP) is the murine immunoglobulin K signal sequence or the glia monster exendin signal sequence; and/or
- the polyadenylation signal downstream of the gene of interest (GLP-1; GIP) is derived from simian viraus 40 (SV 40); and /or
- the proteolytic cleavage site is cleaved by furin preotease; and/ or
- the gene delivery vector for expression the gene of interest is an adenoviral, retroviral, leniviral, adeno associated viral vector; and /or
- the constitutive promoter is a cytomegalovirus (CMV) promotor, or a Rous sarcoma long-terminal repeat (LTR) sequence, and the
SV 40 early gene gene promoter; and the inducible promoter is the Tet-On™/Tet-Off™ system available from Clontech; and /or - the mammalian cell is a primate or rodent cell, preferably a human cell, more preferably a human hepatocyte.
- In a further illustrative embodiment, the present invention provides formulations for agents binding to the secondary binding site of DP IV or DP IV-like enzymes allone or in combination with DP IV-inhibitors, e.g. the compounds of formulas (1) to (6), and their corresponding pharmaceutically acceptable prodrugs and acid addition salt forms, in pharmaceutical compositions. 7
- To prepare the pharmaceutical compositions of this invention, one or more compounds capable of binding to the secondary binding site and/or DP IV-inhibitors or salts thereof of the invention can be used as the active ingredient(s). The active ingredient(s) is intimately admixed with a pharmaceutical carrier according to conventional pharmaceutical compounding techniques, which carrier may take a wide variety of forms depending of the form of preparation desired for administration, e.g., oral or parenteral such as intramuscular. In preparing the compositions in oral dosage form, any of the usual pharmaceutical media may be employed. Thus, for liquid oral preparations, such as for example, suspensions, elixirs and solutions, suitable carriers and additives include water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents and the like; for solid oral preparations such as, for example, powders, capsules, gelcaps and tablets, suitable carriers and additives include starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like. Because of their ease in administration, tablets and capsules represent the most advantageous oral dosage unit form, in which case solid pharmaceutical carriers are obviously employed. If desired, tablets may be sugar coated or enteric coated by standard techniques. For parenterals, the carrier will usually comprise sterile water, through other ingredients, for example, for purposes such as aiding solubility or for preservation, may be included.
- Injectable suspensions may also prepared, in which case appropriate liquid carriers, suspending agents and the like may be employed. The pharmaceutical compositions herein will contain, per dosage unit, e.g., tablet, capsule, powder, injection, teaspoonful and the like, an amount of the active ingredient(s) necessary to deliver an effective dose as described above. The pharmaceutical compositions herein will contain, per dosage unit, e.g., tablet, capsule, powder, injection, suppository, teaspoonful and the like, from about 0.03 mg to 100 mg/kg (preferred 0.1-30 mg/kg) and may be given at a dosage of from about 0.1-300 mg/kg per day (preferred 1-50 mg/kg per day) of each active ingredient or combination thereof The dosages, however, may be varied depending upon the requirement of the patients, the severity of the condition being treated and the compound being employed. The use of either daily administration or post-periodic dosing may be employed.
- Preferably these compositions are in unit dosage forms from such as tablets, pills, capsules, powders, granules, sterile parenteral solutions or suspensions, metered aerosol or liquid sprays, drops, ampoules, autoinjector devices or suppositories; for oral parenteral, intranasal, sublingual or rectal administration, or for administration by inhalation or insufflation. Alternatively, the composition may be presented in a form suitable for once-weekly or once-monthly administration; for example, an insoluble salt of the active compound, such as the decanoate salt, may be adapted to provide a depot preparation for intramuscular injection. For preparing solid compositions such as tablets, the principal active ingredient is mixed with a pharmaceutical carrier, e.g. conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g. water, to form a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a pharmaceutically acceptable salt thereof. When referring to these preformulation compositions as homogeneous, it is meant that the active ingredient is dispersed evenly throughout the composition so that the composition may be readily subdivided into equally effective dosage forms such as tablets, pills and capsules. This solid preformulation composition is then subdivided into unit dosage forms of the type described above containing from 0.1 to about 500 mg of each active ingredient or combinations thereof of the present invention.
- The tablets or pills of the compositions of the present invention can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action. For example, the tablet or pill can comprise an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former. The two components can be separated by an enteric layer which serves to resist disintegration in the stomach and permits the inner component to pass intact into the duodenum or to be delayed in release. A variety of material can be used for such enteric layers or coatings, such materials including a number of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.
- This liquid forms in which the compositions of the present invention may be incorporated for administration orally or by injection include, aqueous solutions, suitably flavoured syrups, aqueous or oil suspensions, and flavoured emulsions with edible oils such as cottonseed oil, sesame oil, coconut oil or peanut oil, as well as elixirs and similar pharmaceutical vehicles. Suitable dispersing or suspending agents for aqueous suspensions, include synthetic and natural gums such as tragacanth, acacia, alginate, dextran, sodium carboxymethylcellulose, methylcellulose, polyvinylpyrrolidone or gelatin.
- Where the processes for the preparation of the compounds according to the invention give rise to mixture of stereoisomers, these isomers may be separated by conventional techniques such as preparative chromatography. The compounds may be prepared in racemic form, or individual enantiomers may be prepared either by enantiospecific synthesis or by resolution. The compounds may, for example, be resolved into their components enantiomers by standard techniques, such as the formation of diastereomeric pairs by salt formation with an optically active acid, such as (−)-di-p-toluoyl-d-tartaric acid and/or (+)-di-p-toluoyl-1-tartaric acid followed by fractional crystallization and regeneration of the free base. The compounds may also resolved by formation of diastereomeric esters or amides, followed by chromatographic separation and removal of the chiral auxiliary. Alternatively, the compounds may be resolved using a chiral HPLC column.
- During any of the processes for preparation of the compounds of the present invention, it may be necessary and/or desirable to protect sensitive or reactive groups on any of the molecules concerned. This may be achieved by means of conventional protecting groups, such as those described in Protective Groups in Organic Chemistry, ed. J. F. W. McOmie, Plenum Press, 1973; and T. W. Greene & P. G. M. Wuts, Protective Groups in Organic Synthesis, John Wiley & Sons, 1991. The protecting groups may be removed at a convenient subsequent stage using conventional methods known from the art.
- The method of treating conditions modulated by the dipeptidyl peptidase IV or dipeptidyl peptidase IV-like enzymes described in the present invention may also be carried out using a pharmaceutical composition comprising any compound or any combination of the compounds as defined herein and a pharmaceutically acceptable carrier. The pharmaceutical composition may contain between about 0.01 mg and 100 mg, preferably about 5 to 50 mg, of each compound, and may be constituted into any form suitable for the mode of administration selected. Carriers include necessary and inert pharmaceutical excipients, including, but not limited to, binders, suspending agents, lubricants, flavorants, sweeteners, preservatives, dyes, and coatings. Compositions suitable for oral administration include solid forms, such as pills, tablets, caplets, capsules (each including immediate release, timed release and sustained release formulations), granules, and powders, and liquid forms, such as solutions, syrups, elixirs, emulsions, and suspensions. Forms useful for parenteral administration include sterile solutions, emulsions and suspensions.
- Advantageously, compounds of the present invention may be administered in a single daily dose, or the total daily dosage may be administered in divided doses of two, three or four times daily. Furthermore, compounds for the present invention can be administered in intranasal form via topical use of suitable intranasal vehicles, or via transdermal skin patches well known to those of ordinary skill in that art. To be administered in the form of transdermal delivery system, the dosage administration will, of course, be continuous rather than intermittent throughout the dosage regimen.
- For instance, for oral administration in the form of a tablet or capsule, the active drug component can be combined with an oral, non-toxic pharmaceutically acceptable inert carrier such as ethanol, glycerol, water and the like. Moreover, when desired or necessary, suitable binders; lubricants, disintegrating agents and coloring agents can also be incorporated into the mixture. Suitable binders include, without limitation, starch, gelatin, natural sugars such as glucose or betalactose, corn sweeteners, natural and synthetic gums such as acacia, tragacanth or sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, sodium chloride and the like. Disintegrators include, without limitation, starch, methyl cellulose, agar, bentonite, xanthan gum and the like.
- The liquid forms in suitable flavored suspending or dispersing agents such as the synthetic and natural gums, for example, tragacanth, acacia, methyl-cellulose and the like. For parenteral administration, sterile suspensions and solutions are desired. Isotonic preparations which generally contain suitable preservatives are employed when intravenous administration is desired.
- The compounds of the present invention can also be administered in the form of liposome delivery systems, such as small unilamellar vesicles, large unilamellar vesicles, and multilamellar vesicles. Liposomes can be formed from a variety of phospholipids, such as cholesterol, stearylamine or phosphatidylcholines.
- Compounds of the present invention may also be delivered by the use of monoclonal antibodies as individual carriers to which the compound molecules are coupled. The compounds of the present invention may also be coupled with soluble polymers as targetable drug carriers. Such polymers can include polyvinylpyrrolidone, pyran copolymer, polyhydroxypropylmethacrylamidephenol, polyhydroxyethylaspartamid-ephenol, or polyethyl eneoxidepolyllysine substituted with palmitoyl residue. Furthermore, the compounds of the present invention may be coupled to a class of biodegradable polymers useful in achieving controlled release of a drug, for example, polyactic acid, polyepsilon caprolactone, polyhydroxy butyeric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanoacrylates and cross-linked or amphipathic block copolymers of hydrogels.
- Compounds of this invention may be administered in any of the foregoing compositions and according to dosage regimens established in the art whenever treatment of the addressed disorders is required.
- The daily dosage of the products may be varied over a wide range from 0.01 to 1.000 mg per mammal per day. For oral administration, the compositions are preferably provided in the form of tablets containing, 0.01, 0.05, 0.1, 0.5, 1.0, 2.5, 5.0, 10.0, 15.0, 25.0, 50.0, 100, 150, 200, 250 and 500 milligrams of each active ingredient or combinations thereof for the symptomatic adjustment of the dosage to the patient to be treated. An effective amount of the drug is ordinarily supplied at a dosage level of from about 0.1 mg/kg to about 300 mg/kg of body weight per day. Preferably, the range is from about 1 to about 50 mg/kg of body weight per day. The compounds may be administered on a regimen of 1 to 4 times per day.
- Optimal dosages to be administered may be readily determined by those skilled in the art, and will vary with the particular compound used, the mode of administration, the strength of the preparation, the mode of administration, and the advancement of disease condition. In addition, factors associated with the particular patient being treated, including patient age, weight, diet and time of administration, will result in the need to adjust dosages.
- Determination of the Half-Life (t1/2)
- Matrix-assisted laser-desorption ionization time of flight mass spectrometry (MALDI-TOF MS) experiments were carried out at 30° C. at pH 7.6 in 0.1 M Tris/HCl (Sigma-Aldrich, Deisenhofen, Germany) buffer with 25 μM peptide solution. The degradation fate of peptides was measured by monitoring the signal intensity of the pseudomolecular ion peaks of parent peptides and N-terminal shorted peptides versus time when incubated with 40 mU procine DP IV, recombinant human DP IV or serum DP IV activity. The enzyme was preincubated with hexapeptide TFTSDY or TFTDDY or the heptapeptide H-Ser-D-Glu-Thr-Gly-D-Val-D-Lys-D-Val-OH (15 min, 30° C., 0,016M, 1:1 with DP IV, the concentration of the hexapeptide or the heptapeptide in the reaction mixture was 160 μM). As control served the preincubation of DP IV with 0.01M Tris-buffer (Sigma-Aldrich, Deisenhofen, Germany). The mass spectrometer employed was a Hewlett-Packard G2025 model with a linear time of flight analyzer; samples (4 μL) were mixed 1:1 v/v with matrix (44 mg diammonium-hydrogen-citrate and 30
mg 2′,6′-dihydroxyacetophenone in 1 ml aqueous solution containing 50% acetonitrile and 0.05% trifluoroacetic acid; Sigma-Aldrich), transferred to a probe tip and immediately evaporated using the Hewlett-Packard G2024A (Hewlett-Packard, Waldbronn, Germany) sample preparation vacuum chamber. 250 single laser-shot spectra were accumulated. This method of monitoring biodegradation has been validated and allows the general comparison of half-degradation times (t1/2) under various conditions. - The t1/2- calculation followed this procedure:
- The height of the substrate peak was measured and set as 100% at time=0. During the reaction course the sum of substrate and product peak height were set as 100% and the percentage of the remaining substrate peak (also expressed as relative concentration) was determined. Diagrammed relative substrate concentration versus time t1/2 can be calculated based on first order exponential decay reaction course.
- Legend:
-
- A substrate (bioactive peptide)
- B product (N-terminal truncated bioactive peptide)
- Ki first order rate constant
- Km Michaelis-Menten-constant
- vi initial rate of the reaction
- Vmax maximal rate of the reaction
- [S] substrate concentration
- Determination of Ki:
- In order to measure the inhibition constant Ki a photometric assay was used The peptides were measured as competitors of the standard substrate GP-4-Nitroanilide. Three different substrate concentrations (0.4 mM to 0.05 mM) were combined with 8 different competitor concentrations (0.5 mM to 2 μM). The reaction was started by addition of 3.5 nM DP IV. Experiments were carried out under standard conditions: 30° C. in pH 7.6 40 mM HEPES (Sigma-Aldrich) buffer. Nitroaniline production was monitored using a HTS 7000+ microplate reader (PerkinElmer, Uberlingen, Germany). The Ki-values were calculated via non-linear regression using the enzyme kinetic program Grafit 4.016 (Erithacus Ltd, UK).
- For a reversible competitive inhibition is to assumed:
- Legend.
-
- [I] inhibitor concentration
- Ki inhibition constant
- MALDI-TOF Approach
- In order to investigate directly the influence of the test compounds TFTSDY, TFTDDY and H-Ser-D-Glu-Thr-Gly-D-Val-D-Lys-D-Val-OH on the DP IV-catalyzed peptide hydrolysis the MALDI-TOF assay was used.
- As described before (determination of t1/2) DP IV and the test compounds were preincubated and the reaction was started by adding the enzyme/hexapeptide mixture to substrate/buffer mix. The control reaction mixture consisted of buffer, enzyme and substrate. From the curves of the first order exponential the initial rate (vi) for the control and the reversible inhibited reaction was calculated.
- For the uninfluenced reaction the Michaelis-Menten-equation was used.
-
- Vi was calculated from plotting the relative substrate concentration versus time.
- Km is given, also the substrate concentration.
- For the reversible inhibited reaction the following reaction was used to calculate Ki:
- Determination of Km
- Experiments were carried out with a capillary zone electrophoresis apparatus (MDQ, Beckmann, Muinchen, Germany).
- The reaction mixture contained 50 μl Gly-Gly (100 mM as standard), 50 μM substrate solved in 0.01 M sodium phosphat buffer (pH 7.6) and 10 μl DP IV (40 mU/ml) stored at 30° C. Six substrate concentrations varying from 1 μM to 60 μM were measured. As running buffer 0.1 M sodium phosphat buffer, pH 2.5 was used. A sample from the reaction mixture was injected with 0.5 psi over 5 s at predefined time points. Separation was carried out in a capillary with 50 μM inner diameter and 20 cm effective length. The following separation parameters were used:
Separation voltage: 16 kV Separation time: 12 min Separation temperature: 25° C. Detection wave length: 200 nm - The maximal rate was calculated by plotting product concentration versus time. The Km-value was calculated transferrng the data in the Michaelis-Menten-equation (GraFit 4.0.16, Erithacus Ltd., UK).
- Expression, Fermentation and Purification of Human DP IV and its Mutant Variants
- Strains and Plasmid:
- P. pastoris strain X-33 and the vector pPICαC were purchased from Invitrogen (USA). E. coli XL-10 cells were provided from Stratagene (USA).
- Plasmid Construction and DNA Sequencing
- The DP IV encoding region (Δ1-36) plus his6-tag contained in a pcDNA-3.1 vector was amplified using primers DP IV-21 (TCATCGATGCATCATCATCATCATCAT) and DP IV-22 (TAGGTACCGCTAAGGTAAAGAGAAAC) while implementing the restriction sites for KpnI and BspD1. This fragment was digested with the restriction enzymes KpnI and BspD1 as well as the vector pPCR-ScriptCam (Stratagene, USA), afterwards vector and PCR product were ligated and transformed into the E. coli-strain XL-10. Insertion and orientation was confirmed applying restriction enzyme analysis and partial sequencing. That was followed by excision of the DP IV encoding region from the pPCR-ScriptCam vector with the same restriction enzymes KpnI and BspD1 and its ligation into the Pichia vector pPICαC, which was also treated with the same restriction enzymes before.
- Site Directed Mutagenesis:
- Single amino acid mutations were carried out with the Quick Change Site-directed Mutagenesis Kit from Stratagene (USA). Following primers were used to introduce the mutations:
R310A-DP IV: DP IV-84 GACATGGGCAACACAAGAAGCAATTTCTTTGCAGTGGC DP IV-85 GCCACTGCAAAGAAATTGCTTCTTGTGTTGCCCATGTC R560A-DP IV: DP IV-73: GCAGACACTGTCTTCGCACTGAACTGGGCCACTTACC DP IV-74b: GGTAAGTGGCCCAGTTCAGTGCGAAGACAGTGTCTGC W629A-DP IV: DP IV-75: GCAATTTGGGGCTGGTCATAGCGAGGGTACGTAACC DP IV 76: GGTTACGTACCCTCGCTATGACCAGCCCCAAATTGC.
Transformation of P. pastoris X-33: - The vector pPICαC containing the DP IV-variants was linearized using the restriction enzyme Sac I. Transformation was carried out with an electroporation system from BioRad (Germany) according to the Invitrogen Pichia expression kit manual.
- Media and Buffers:
- YPD, BMMY, and BMGY for shake flask expression were prepared as described in the Invitrogen Pichia expression kit manual using reagents obtained from Difco. Media for fermentation were composed as described in the Invitrogen Pichia fermentation process guidelines using chemicals purchased from Sigma (Deisenhofen, Germany).
- Small-Scale Expression Studies:
- Single colonies were grown in BMGY at 250 rpm, 28° C. overnight. Induction of gene expression was initiated after a media exchange to BMMY. DP IV activity in the expression medium was assayed after 48 hours. Clones displaying highest activity were further monitored in a shaking flask culture (15 ml BMGY and 15 ml BMMY respectively) regarding growth rate and expression rate.
- Fermentation:
- The clone displaying the highest DP IV activity was used to inoculate 5 ml of BMGY. After 16-18 h of growth at 250 rpm and 28° C. 1 ml of the culture was used to start a 200 ml BMGY flask shake preculture. The cells were grown for 16-18 h at 28° C. A 21 fermentation was started with the 200 ml inoculum according to the Invitrogen Pichia fermentation process guidelines.
- Purification of DP IV
- Expression medium was centrifuged at 40,000*g for 20 minutes to pellet the yeast cells. The supernatant was filtered to remove any residual solids using a 45 μM cellulose acetate filter from Satorius (Germany). Medium was adjusted to
pH - Affinity chromatography was carried out at 4° C. with a Ni-NTA sepharose column (Qiagen, Germany). The column was pre-equilibrated with 300 mM NaCl, 50 mM NaH2PO4-
buffer pH - Gel Filtration:
- The 0.5 ml ultra-filtrate were applied to a
Superdex 200 HiLoad 26/60 column (Pharmacia, Upsalla, Sweden) with a flow rate at 0.25 ml /min using a 300 mM NaCl, 50 mM NaH2PO4-buffer pH - DP IV Assay:
- DP IV activity assays were performed spectrofluorimetrically using H-Gly-Pro-AMC (Bachem, Heidelberg, Germany) as substrate and a 0.1M HEPES buffer pH 7.6 plus 0.05 M NaCl (Sigma, Deisenhofen, Germany) while monitoring the releasing of AMC by DP IV (λexcitation=380 nm; λemission=460 nm).
- SDS-PAGE Analysis:
- Proteins were analysed by SDS-PAGE using 12% separating gels with 3% stacking gel. Gels were stained applying Coomassie brilliant blue R-250.
- Protein Determination:
- Protein concentrations were determined using the BioRad (Germany) Bradford assay kit according to the instructions of the manufacturer.
- Western Blot Analysis:
- Analytical gel electrophoreses in SDS-polyacrylamid gels were performed according to Laemmli [1] with seperation gels containing 12% acrylamide. The seperated proteins were transferred to a nitrocellulose membrane (Schleicher&Schuell, Germany) following standard procedures. To detect his-tagged protein a penta-his-tag-antibody and a secondary antibody provided from Qiagen (Germany) (1:2000) was used. Chemo-luminescence was assayed according to the manufacturers protocol (SuperSignal™ West Pico, PIERCE).
- Substrates:
- All investigated bioactive peptides were obtained from Bachem (Heidelberg, Germany), with exception of glucagon, GIP and its analogs and fragments. These peptides were synthesized at applicant's laboratories.
- Synthesis of DP IV-Substrates
- Glucagon, GIP and the GIP analogs were synthesized with an automated synthesizer SYMPHONY (RAININ) using a modified Fmoc-protocol. Cycles were modified by using double couplings from the 15th amino acid from the C-terminus of the peptide with five-fold excess of Fmoc-amino acids and coupling reagent. The peptide couplings were performed by TBTU/NMM-activation using a 0.23 mmol substituted NovaSyn TGR-resin or the corresponding preloaded Wang-resin at 25 μmol scale. The cleavage from the resin was carried out by a cleavage-cocktail consisting of 94.5% TFA, 2.5% water, 2.5% EDT and 1% TIS.
- Analytical and preparative HPLC were performed by using different gradients on the LiChrograph HPLC system of Merck-Hitachi. The gradients were made up from two solvents: (A) 0.1% TFA in H2O and (B) 0.1% TFA in acetonitrile. Analytical HPLC were performed under the following conditions: solvents were run (1 ml/min) through a 125-4 Nucleosil RP18-column, over a gradient from 5%-50% B over 15 min and then up to 95 % B until 20 min, with UV detection (λ=220 nm). Purification of the peptides was carried out by preparative HPLC on either a 250-20
Nucleosil 100 RP8-colunm or a 250-10LiChrospher 300 RP18-column (flowrate 6 ml/min, 220 nm) under various conditions depending on peptide chain length. For the identification of the peptide analogues, laser desorption mass spectrometry was employed using the HP G2025 MALDI-TOF system of Hewlett-Packard. - Computer-assisted Model for Specificity Examinations of Proline-Specific Proteases
- By means of homology modeling approaches a tertiary-structure-models of human DP IV and porcine DP IV have been developed.
- The structure of prolyl oligopeptidase (Fülöbp, V., et al. (1998) Prolyl Oligopeptidase: An unusual β-propeller domain regulates proteolysis. Cell 94, 161-170) (Brookhaven Protein Data Bank entry: 1 qfm) was used as a target to model the structure of DP IV.
- COMPOSER (Blundell, T. L.; Sibanda, B. L.; Sternberg, M. J. E.; Thornton, J. M. Knowledge-based prediction of protein structures and the design of novel molecules. Nature 1987, 326, 347-352; Blundell, T. L.; Carney, D.; Gardner, S.; Hayes, F.; Howlin, B.; Hubbard, T.; Overington, J.; Singh, D. A.; Sibanda, B. L.; Sutcliffe, M. Knowledge-based protein modelling and design. Eur. J. Biochem. 1988, 172, 5 13-520) a program for homology modeling which is included in the molecular graphics program package SYBYL (TRIPOS Associates Inc., 1699 S. Hanley Road, Suite 303, St. Louis, Mo. 63144) (TRIPOS Associates Inc.) was used to generate the model of DP IV. The amino acid sequences were aligned using the BLOSUM30 matrix (Henikoff, S.; Henikoff, J. G. Amino acid substitution matrices from protein blocks. Proc. Natl. Acad. Sci. USA, (1992), 89, 10915-10919). Afterwards, the modeling procedure consisted of the following steps: structurally conserved regions (SCRs) were identified and a framework of conserved regions was defined as mean positions of structurally equivalent C□-atoms. Structurally variable regions (SVRs, loops) were selected from a program attached database of peptide fragments in order to satisfy end-to-end distances of the SCRs already positioned in the framework. Loops which could not be formed with this procedure were added manually to complete the structure. The conformations of these loops (mainly in the propeller domain) were determined by simulated annealing techniques in heating the temperature to 700 K and subsequently cooling to 100 K by fixing the remaining part of the structure. This procedure was repeated 30 times. All resulting low temperature structures were minimized using the Kollman all-atom force field (Weiner, S. J.; Kollman, P. A.; Case, D. A.; Singh, U. C.; Ghi, C.; Alagona, G.; Profeta, S.; Weiner, P. A new Force Field for molecular mechanical simulation of nucleic acids and proteins, J. Am. Chem. Soc., 1984, 106,765-784). Loop conformations with the lowest energy which fulfill all criteria by analyzing the stereo-chemical quality of the protein structure by means of PROCHECK (Laskowski, R. A. et al. (1993) PROCHECK: a program to check the stereochemical quality of protein structures, J. Appl. Cryst. 26, 283-289) were used.
- Small molecule ligands such as substrates of the type Xaa-Pro-p-Nitroanilide were docked with the “automatic” docking program GOLD (C. Bissantz, G. Folkers, D. Rognan; J. Med. Chem. 43, 4759-4767, 2000) to the catalytically active site of DP IV to inspect and analyze the principal correctness of the tertiary structure. Ligands such as GIP or glucagon and longer peptides of the GRF family were docked by application of molecular dynamics simulations. These simulations were started to form a random conformation of these compounds, manual positioned at the outer side of the pore formed by the propeller domain. A low force constant between the protonated N-terminus of the ligands and the side chain of Glu668, which is proposed to be the responsible residue for the recognition of the N-terminus of DP IV was added. Molecular dynamics simulations at 300 K for 100 ps using the Kollman all-atom force field were performed by fixing the backbone atoms of DP IV. All these longer peptides reached the catalytically active site (amino acid position S630), showing that ligands are penetrating through the propeller domain to dock to the active site. The resulting docking structures were optimized and subsequently analyzed to define the so called second binding site of DP IV-substrates.
- Validation of the Computer-Assisted Model of DP IV
- Glycosylation Sites
- The following residues are assumed to be glycosylated and are therefore placed at the surface of the protein: Asn85, Asn92, Asn150, Asn299, Asn229, Asn281, Asn321, Asn520 and Asn685, which are displayed in
FIG. 3 . All these amino acid residues are accessible except Asn150 and 321, which are slightly buried but may become accessible by thermal moving of the loop region close to this position. - ADA-Binding Site
- Site directed mutagenesis studies proved that the residues L294, V341 and R343 play an important role in ADA binding to DP IV. Therefore, these residues have to be accessible too. These amino acid residues are displayed in
FIG. 3 . All these residues are situated at the surface of the protein and interact with ADA. - Binding of Small Inhibitors to the Active Site of DP IV
- A number of Xaa-Pyrrolidine and Xaa-Proline dipeptides where docked to DP IV and their preferred interaction with the active site was examined (
FIG. 4 ). One of the most important region is the proline recognition site. In POP this site is formed by the two to three amino acid residues. In analogy to POP the proline binding pocked in DP IV is formed also by two aromatic side chains, the two tyrosine residues Y670 and Y631 and by the hydrophobic residue V711. - The S2-binding site in DP IV must be responsible for the recognition of the protonated and positively charged N-terminus of DP IV ligands and preferred interactions of hydrophobic residues such as Val or Ile. The model shows that the side chain of Glu668 is able to form a salt bridge to the N-terminus of ligands. The recognition of the side chains is realized by interactions with the side chains of two other tyrosine residues (Y211 and Y330) and explains the preferred hydrophobic P2-residues of inhibitors.
- Another DP IV-inhibitor, Lys(Z-nitro)-Pyrrolidine, which carries not a completely hydrophobic P2-side chain, was also docked to DP IV. The result is represented in
FIG. 5 . In the most stable docking arrangement a scorpion like conformation of the Lys-Z-nitro group can be observed, which finally leads to the formation of a strong hydrogen bond to R453. This additional interaction in comparison to usual dipeptide related ligands explains the high affinity and action of this compound. - Substrate Interactions and Aspects of the Catalytic Mechanism
- The mode of interaction of substrates to DP IV is shown in
FIG. 6 . First, the substrates dock exactly in the following conformation: A hydrogen bond is formed between the N-H group and the carbonyl group (torsional angle ψ2˜80°) of the first amino acid residue (C7-conformation) and the N-terminal amino group is turned out of a ψ1 torsion of 180° to about 120°. The scissile bond or better plane of the peptide bond to be cleaved is in a perpendicular orientation to the active serine side chain (S630) and allows the reactive attack of the serine to the peptide bond. - Of main importance is the side chain of Y547. The phenolic hydroxyl group forms a hydrogen bond to the carbonyl group of the scissile peptide bond. This interaction plays a very important role in the stabilisation of the tetrahedral intermediate and therefore in the catalytic mechanism in particular in the acylation step. Another interesting finding by Heins et al. (heins et al., Biochim. Biophys. Acta, 1988, 954(2),161-169) was the fact that in the case of proline (in P1) substrates usually the deacylation is the rate limiting step except, when in P2-position an Asp is introduced. A possible docking arrangement of such a substrate is displayed in
FIG. 6 . The aspartate side chain forms a hydrogen bond to the phenolic OH-group of Y547. This strong interaction prevents the cleaved dipeptide to move out of the binding site and thus shifts the thermodynamic equilibrium and the activation barrier somewhat to the tetrahedral intermediate site and consequently the acylation rate is considerably reduced and becomes rate limiting. - Docking Behavior of Ligands with Biological Importance
- It has been demonstrated that the N-terminal nonapeptide of the HIV-tat protein shows inhibitory effects to DP IV. Docking studies of this compound were done with the complete DP IV model as described above. The resulting most stable binding arrangement is shown in
FIG. 7 . - There are some important interactions. Similar to the already discussed interaction of the substrate Asp-Pro-PNA D2 of Tat forms a hydrogen bond with Y330 and furthermore as seen for Lys-Z-nitro-Pyrrolidine, D5 forms a salt bridge with R453. Further considerable hydrophobic interactions occur between I8 and Y330 and another salt bridge is observed between the C-terminal E9 and R310 of DP IV.
- Another similar peptide that was used for docking studies is the N-terminal nonapeptide of the tromboxane receptor (
FIG. 8 ). Similar interactions as seen for HIV-tat were detected. Additionally important is the hydrophobic interaction between W2 and I742. - Docking of GIP; VIP and Glucagons to DP IV
- Several oligopeptides such as GIP, VIP, glucagon and others are hydrolysed by DP IV and therefore it is clear, that these substrates are docking to DP IV and reaching the active site. Extensive docking investigations by means of molecular dynamics simulations were done using the old model. From these studies the amino acid sequences of the hexapeptides, TFTSDY and TFTDDY and the degradation stabilized heptapeptide H-Ser-D-Glu-Thr-Gly-D-Val-D-Lys-D-Val-OH were derived and its ability to protect oligopeptide substrates from their interaction with a secondary binding site.
- Results
- The binding and hydrolysis of small dipeptide substrates were only slightly influenced when DP IV was preincubated with the hexapeptides TFTSDY or TFTDDY or the degradation stabilized heptapeptide H-Ser-D-Glu-Thr-Gly-D-Val-D-Lys-D-Val-OH but the affinity of larger oligopeptides such as GIP, VIP, glucagon and others was considerably reduced. These experiments clearly prove the existence of a secondary binding site.
- How these rather long peptides reach the active site of DP IV without essential steric hindrance was investigated. GIP was placed at the top of the propeller domain with the N-terminus pointing to the direction middle to DP IV. A small constraint (additional force constant) was placed between the N-terminal nitrogen atom of GIP and a carboxyl oxygen atom of E668. Then a molecular dynamics simulation over 50.000 fs at 300 K was started with fixed backbone atoms of DP IV in the gas phase. Surprisingly it was shown that GIP moved in the pore rapidly without any considerable steric hindrance and was indeed able to reach the active site. Finally starting from the end structure of this “constrained” dynamic model, dynamic simulations with GIP already situated inside DP IV were repeated. The final optimized docking arrangement is shown in FIGS. 9 to 12 and the most important interactions are summarized in Tables 8 to 11.
TABLE 8 Most important interactions of GIP with DP IV GIP DP IV typ of interaction NT E668 salt bridge Y1—CO N710 H-bond S2—OH Y631 H-bond S2—CO Y547 H-bond (Catalysis!) E3 R560 salt bridge I7 Y330 hydrophob D9 R310 salt bridge Y10 W154 hydrophob I12 W157 hydrophob D15 K463 (R318) salt bridge K16 E464 (E91) salt bridge -
TABLE 9 Most important interactions of VIP with DP IV VIP DP IV typ of interaction NT E668 salt bridge H1—CO N710 H-bond H1-side chain I742 hydrophob S2—OH Y631 H-bond S2—CO Y547 H-bond (catalysis!) D3 R560 salt bridge D8 R310 salt bridge Y10 W154 hydrophob Y10—CO S460 H-bond K15 E464 salt bridge -
TABLE 10 Most important interactions of Glucagon with DP IV Glucagon DP IV typ of interaction NT E668 salt bridge H1—CO N710 H-bond H1-side chain I742 hydrophob A2-CO Y547 H-bond Q3 R560 H-bond T5 T152 H-bond T7 Y416 H-bond S8 Y330 H-bond D9-CO Y416 H-bond D9 R310 salt bridge Y10 W154 hydrophob Y13 L90 hydrophob D15 R318 salt bridge R17 E91 salt bridge -
TABLE 11 Most important interactions of the hexapeptide T(5)-F-T-S-D-Y with DP IV hexapeptide DP IV type of interaction T5 T152 H-bond T7 Q153(CO-backbone) H-bond S8 S552 H-bond D9 R310 salt bridge Y10 W154 hydrophobic Y10(OH) T152(OH) H-bond Y10(OH) T152(CO-backbone) H-bond Y10(CT) S460(OH) H-bond - As can be seen in
FIGS. 9 and 11 , GIP is able to reach the active site of DP IV, but the C-terminal tail is still at the surface of the propeller domain. - The scissile peptide bond after Ser2 is exactly in an orientation required for optimal hydrolysis (
FIG. 10 ). A number of important interactions which explain the affinity of GIP to DP IV were detected. These attractive interactions are summarized in Table 6. Interestingly a number of interactions were observed, which were already discussed for other ligands (see above). - Based on these results analogous docking studies were performed with VIP, glucagon and the hexapeptide TFTSDY (FIGS. 12 to 15) The results are summarized by listing the most attractive interactions in Tables 7 to 9.
- These results prove that the oligopeptide ligands penetrate through the propeller domain to dock to the active site. Furthermore, some highly attractive interactions between the oligopeptide ligands and DP IV were shown, which explain the affinity of the calculated compounds and which were used to predict the structure of non-peptidic ligands for the secondary binding site of DP IV. Some preliminary structures of such non-peptidic ligands are provided in the description above.
- Moreover, the results of these studies confirm the proposed docking of Lys-Z-nitro-Pyrrolidine, e.g. the interaction of the nitro-group with AR560. Wher the oligopeptide ligands have an Asp in third or fourth position in their amino acid sequence, a salt bridge with R560 is formed. By docking arrangement of the hexapetide TFTSDY (
FIG. 15 ), it was proven that this hexapeptide indeed prevents binding of oligopeptide ligands to the active site. - Preparation of Porcine DP IV
- DP IV was purified from porcine kidney. Approximately 2 kg cortex was removed from pig kidneys and cut in small pieces. This tissue material was washed with 0.9% NaCl solution overnight at 4° C. to remove remaining blood. The washed cortex was homogenized using an ultraturrax. During homogenization an equal amount of a 0.02 M sucrose solution containing 0.2% Triton X-100 was added. After homogenization the DP IV-protein was released from the membrane by an 18 h autolysis step at 30° C. Insoluble particles were removed by centrifugation at 15900× g for 30 min. After a first precipitation and centrifugation step (60% (NH4)2SO4-saturation, 3 h, room temperature, centrifugation: 39200× g, 30 min) DP IV-activity remains in the supernatant. Second precipitation was conducted overnight at 4° C. and 85% saturation. After centrifugation the DP IV-containing pellet was dissolved in a minimal volume of a 25 mM phosphate buffer, pH 6.8 and dialyzed against 3×21 of this buffer over night. After additional centrifugation (30 min, 39200× g) the solution was concentrated to approximately 45 ml using an Amicon ultrafiltration cell (cut-off 100 kDa) and again centrifuged at 44000× g. A preparative size exclusion chromatography was used as second purification step. 15 ml of the DP IV-containing solution were applied to a Sepharose 6B (Pharmacia) column (100 cm×2.6 cm) and eluted with the phosphate buffer, pH 6.8. The pooled fractions from 3 runs were further purified by anion exchange chromatography on a DEAE-Sephacel (Pharmacia) column (17 cm×2.5 cm). For binding the 25 mM phosphate buffer pH 6.8 was used and DP IV was eluted with a salt gradient from 39 mM to 150 mM NaCl in 5 column volumes. The final separation step was a high resolution anion exchange chromatography on a Uno Q column (6 ml, BioRad). The DP IV-containing fraction was diluted with an equal volume of H2O and applied to the column using a 25 mM Bis-Tris buffer pH 6.8. Elution was performed with a NaCl gradient from 0 to 60 mM. Final purification of the naturally glycosylated protein to homogeneity was achieved by preparative isoelectric focusing using the Rotofor system (BioRad). One run of the above procedure yields roughly 60 mg of total protein, purified by a factor of approximately 280 and exhibiting a specific activity of always above 42 U/mg.
- Sequencing of Porcine DP IV cDNA
- To obtain the cDNA sequence of porcine DP IV, total RNA was extracted from porcine kidney and RT-PCR was performed as described elsewhere. The sequence was submitted to GenBank (accession number: AY198323).
- Synthesis of p-Iodo-Phe-Pyr-CN *TFA
- Synthesis of p-Iodo-Phe-Pyr-CN *TFA, an slow-tight binding inhibitor of DP IV was performed according to known chemical protocols (Ashworth, D. M., Atrash, B., Baker, G. R., Baxter, A. J., Jenkins, P. D., Jones, D. M. & Szelke, M. (1996) Bioorg.
Medicinal Chem. Letter 6, 1163-1166). - Boc-p-Iodo-Phe-Pro-NH2. Triethylamine (163.8 ml, 1.17 mmol) was added to a solution of H-ProNH2*HCl (118.5 mg, 0.782 mmol) in dry DMF (10 ml). Boc-p-Iodo-Phe-OSu (0.42 g, 0.86 mmol) was added in one portion and the mixture stirred for 16 h under an argon atmosphere. The solvent was evaporated and the residue treated in a standard way, i.e. the residue was partitioned between ethylacetate (60 ml) and 0.3N KHSO4 solution (10 ml). The organic layer was further washed with saturated NaCHO3 solution (10 ml), water (10 ml)and brine (5 ml). The solution was dried and evaporated at reduced pressure.
- Boc-p-Iodo-Phe-Pyr-CN. Imidazole (38.96 mg, 0.572 mmol) was added to a solution of Boc-p-Iodo-Phe-Pro-NH2 in dry pyridine (5 ml) under an argon atmosphere. The solution was cooled to −35° C., before the dropwise addition of POCl3 (0.105 ml, 1.13 mmol). The reaction was stirred at −30° C.—to −20° C. for 60 min. The solution was then evaporated and the crude residue subjected to column chromatography (silica gel) to yield 180 mg (94%) of 2-(S)-cyano-1-[tert-(butoxycarbonyl)(p-Iodo-phenylalanyl)-pyrrolidine as a colourless oil.
- p-Iodo-Phe-Pyr-CN *TFA. Deprotection was carried out by stirring with trifluoro acetic acid for 60 min. Evaporation and lyophilisation from water afforded 82.7 mg of 2-(S)cyano-1-(p-Iodo-phenylalanyl)pyrrolidine as a white solid.
- ESI-MS: calculated 369.0, found (M+H)+=370.0
- 1H-NMR: (D2O), d (ppm): 1.55-1.61 (m, 1H), 1.7-1.82 (m, 1H), 1.91-2.19 (m, 2H), 2.49-2.62 (m, 1H), 2.89-3.09 (m, 1H), 3.19-3.21 (m, 1H), 3.21-3.34 (m, 1H), 4.31-4.39 (m, 1H), 4.61-4.69 (m, 4H), 6.91-7.00 (m, 2H), 7.60-7.71 (m, 2H) 13C-NMR: (D2O), d (ppm); 167.832, 131.656, 118.055, 93.173, 65.934, 52.250, 47.061, 46.428, 36.322, 29154, 24.063,
- Crystallization and Crystal Transformation
- Triclinic crystals were obtained at room temperature within several days by mixing equal volumes of protein at concentration of 20 mg/ml with the reservoir solution (20-22% PEG2K, 0.1 M ammonium sulfate, and 0.1 M Tris/HCl pH 8.0) using the sitting drop vapor diffusion method. The crystals were very sensitive towards manual handling and oxygen. Opening of the crystallization vials led to protein precipitation which was only partly reversible. These problems were solved by piercing the cover tape of the crystallization plates with a syringe and immediate covering of the crystallization drop with perfluoropolyether (PFPE) oil. By harvesting the crystals using a loop with humidity control most of the surrounding mother liquor gets replaced with the PFPE oil. Crystals were mounted on an in-house rotating anode. Crystals initially diffracted very weakly, typically below 10 Å. The humidity was then ramped down from 96.5% to 86.5% using a gradient of 0.5% (150 s)−1 which induced a phase transition in the crystalline lattice order reflected by a dramatically improved diffraction pattern. At an optimal relative humidity crystals were flash frozen in the cold nitrogen stream and transported to the synchrotron for data collection. For ligand complex studies, DP IV-crystals were soaked with the inhibitor prior to the crystal transformation procedure. Data were processed and scaled using DENZO and SCALEPACK (Otwinowski, Z. & Minor, W. (1997) in Meth. Enzym., eds. Carter, C. W. J. & Sweet, R. M. (Academic Press, Vol. 276, pp. 307-326.).
- Structure Determination
- The structure was determined by multiple wavelength anomalous dispersion (MAD) using a mercury derivative and subsequent non-crystallographic symmetry (NCS) electron density averaging. Briefly, local two-fold axes were determined by using the program GLRF (Tong, L. & Rossmann, M. G. (1990) Acta Cryst. A46, 783-792.). Next, a local Harker section perpendicular to the molecular dimer axis was cut out of the three-dimensional anomalous Patterson map using the program MAIN (Turk, D. (1992) in Chemistry (Technische Universitat, München.), averaged along the orthogonal local two-fold axes, and subsequently input to RSPS (Knight, S. D. (2000) Acta Cryst. D52, 42-47) for automatic local doublet sites detection. We estimate this procedure to enhance the signal to noise ratio for about 50-100 fold. The relative position of the two symmetry-related Hg-doublets was determined by translational search (Knight, S. D. (2000) Acta Cryst. D52, 42-47). By construction, the resulting sites follow the local symmetry and determine the translational NCS parameters. After heavy atom refinement and phasing (program MLPHARE) and solvent flipping (SOLOMON) (Collaborative Computational Project Number 4 (1994) Acta Cryst. D50, 760-763; Abrahams, J. P. & Leslie, A. G. W. (1996) Acta Cryst. D52, 30-42.), phases were extended to 2.0 Å resolution by NCS averaging using the program MAIN (Turk, D. (1992) in Chemistry (Technische Universitat, München.) which rendered the electron density readily interpretable,
FIG. 25 . - Model Building and Refinement
- Using the program MAIN, we placed the catalytic domain of POP in the electron density which served as a jump start in model building and sequence assignment of the DP IV-structure. The model was refined by using the program CNS (Brüinger, A. T., Adams, P. D., Clore, G. M., Delano, W. L., Gros, P., Grossekunstleve, R. W., Jiang, J. S., Kuszewski, J., Nilges, M., Pannu, N. S., Read, R. J., Rice, L. M., Simonson, T. & Warren, G. L. (1998) Acta Cryst. D54, 905-921.) with current R-values of 21.7% (working set) and 24.9% (test set) and deviations from ideality of 0.008 Å (bond length) and 1.4 degree (angle deviation).
Claims (21)
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US10/667,200 US20050176622A1 (en) | 2002-09-18 | 2003-09-18 | Secondary binding site of dipeptidyl peptidase IV (DPIV) |
US11/478,217 US7816325B2 (en) | 2002-09-18 | 2006-06-29 | Secondary binding site of dipeptidyl peptidase IV (DP IV) |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US10/246,817 US20040058876A1 (en) | 2002-09-18 | 2002-09-18 | Secondary binding site of dipeptidyl peptidase IV (DP IV) |
US44341703P | 2003-01-29 | 2003-01-29 | |
US10/667,200 US20050176622A1 (en) | 2002-09-18 | 2003-09-18 | Secondary binding site of dipeptidyl peptidase IV (DPIV) |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/478,217 Continuation US7816325B2 (en) | 2002-09-18 | 2006-06-29 | Secondary binding site of dipeptidyl peptidase IV (DP IV) |
Publications (1)
Publication Number | Publication Date |
---|---|
US20050176622A1 true US20050176622A1 (en) | 2005-08-11 |
Family
ID=32072828
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/667,200 Abandoned US20050176622A1 (en) | 2002-09-18 | 2003-09-18 | Secondary binding site of dipeptidyl peptidase IV (DPIV) |
US11/478,217 Active 2025-06-19 US7816325B2 (en) | 2002-09-18 | 2006-06-29 | Secondary binding site of dipeptidyl peptidase IV (DP IV) |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/478,217 Active 2025-06-19 US7816325B2 (en) | 2002-09-18 | 2006-06-29 | Secondary binding site of dipeptidyl peptidase IV (DP IV) |
Country Status (6)
Country | Link |
---|---|
US (2) | US20050176622A1 (en) |
EP (1) | EP1543023B1 (en) |
AT (1) | ATE461212T1 (en) |
AU (1) | AU2003293311A1 (en) |
DE (1) | DE60331747D1 (en) |
WO (1) | WO2004031374A2 (en) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8076330B2 (en) | 2005-04-22 | 2011-12-13 | Amgen Inc. | Dipeptidyl peptidase-IV inhibitors |
CN113507961A (en) * | 2018-12-13 | 2021-10-15 | 拜斯科阿迪有限公司 | FAP alpha specific bicyclic peptide ligands |
Families Citing this family (20)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2004087053A2 (en) | 2003-03-25 | 2004-10-14 | Syrrx, Inc. | Dipeptidyl peptidase inhibitors |
EP1506967B1 (en) | 2003-08-13 | 2007-11-21 | Takeda Pharmaceutical Company Limited | Dipeptidyl peptidase inhibitors |
US7169926B1 (en) | 2003-08-13 | 2007-01-30 | Takeda Pharmaceutical Company Limited | Dipeptidyl peptidase inhibitors |
US7678909B1 (en) | 2003-08-13 | 2010-03-16 | Takeda Pharmaceutical Company Limited | Dipeptidyl peptidase inhibitors |
EP1663200A2 (en) * | 2003-09-02 | 2006-06-07 | Prosidion Limited | Combination therapy for glycaemic control |
JP2007505121A (en) | 2003-09-08 | 2007-03-08 | 武田薬品工業株式会社 | Dipeptidyl peptidase inhibitor |
US7732446B1 (en) | 2004-03-11 | 2010-06-08 | Takeda Pharmaceutical Company Limited | Dipeptidyl peptidase inhibitors |
WO2005095381A1 (en) | 2004-03-15 | 2005-10-13 | Takeda Pharmaceutical Company Limited | Dipeptidyl peptidase inhibitors |
EP1753730A1 (en) | 2004-06-04 | 2007-02-21 | Takeda Pharmaceutical Company Limited | Dipeptidyl peptidase inhibitors |
WO2006019965A2 (en) | 2004-07-16 | 2006-02-23 | Takeda San Diego, Inc. | Dipeptidyl peptidase inhibitors |
EP2805953B1 (en) | 2004-12-21 | 2016-03-09 | Takeda Pharmaceutical Company Limited | Dipeptidyl peptidase inhibitors |
EP1695973A1 (en) * | 2005-02-24 | 2006-08-30 | Neuro3D | Ocaperidone salt and pharmaceutical compositions containing the same |
EP1942898B2 (en) | 2005-09-14 | 2014-05-14 | Takeda Pharmaceutical Company Limited | Dipeptidyl peptidase inhibitors for treating diabetes |
EP1924567B1 (en) | 2005-09-16 | 2012-08-22 | Takeda Pharmaceutical Company Limited | Process for the preparation of pyrimidinedione derivatives |
US8324383B2 (en) | 2006-09-13 | 2012-12-04 | Takeda Pharmaceutical Company Limited | Methods of making polymorphs of benzoate salt of 2-[[6-[(3R)-3-amino-1-piperidinyl]-3,4-dihydro-3-methyl-2,4-dioxo-1(2H)-pyrimidinyl]methyl]-benzonitrile |
TW200838536A (en) | 2006-11-29 | 2008-10-01 | Takeda Pharmaceutical | Polymorphs of succinate salt of 2-[6-(3-amino-piperidin-1-yl)-3-methyl-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-ylmethy]-4-fluor-benzonitrile and methods of use therefor |
US8093236B2 (en) | 2007-03-13 | 2012-01-10 | Takeda Pharmaceuticals Company Limited | Weekly administration of dipeptidyl peptidase inhibitors |
BRPI0814299B8 (en) | 2007-07-19 | 2021-05-25 | Takeda Pharmaceuticals Co | solid preparation comprising alogliptin and metformin hydrochloride, use of a solid preparation, and, methods for stabilizing a compound in a solid preparation, and for producing a solid preparation |
US20140031282A1 (en) * | 2012-07-06 | 2014-01-30 | Emily L. Cooper | Formulation for treatment of hyperinsulinemic hypoglycemia following gastric bypass surgery |
CN111514276B (en) * | 2020-06-29 | 2021-07-27 | 黑龙江中医药大学 | Application of short peptide Asp-His-Tyr in preparation of medicine for treating polycystic ovarian syndrome |
Citations (26)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US2961377A (en) * | 1957-08-05 | 1960-11-22 | Us Vitamin Pharm Corp | Oral anti-diabetic compositions and methods |
US3174901A (en) * | 1963-01-31 | 1965-03-23 | Jan Marcel Didier Aron Samuel | Process for the oral treatment of diabetes |
US3879541A (en) * | 1970-03-03 | 1975-04-22 | Bayer Ag | Antihyperglycemic methods and compositions |
US3960949A (en) * | 1971-04-02 | 1976-06-01 | Schering Aktiengesellschaft | 1,2-Biguanides |
US4028402A (en) * | 1974-10-11 | 1977-06-07 | Hoffmann-La Roche Inc. | Biguanide salts |
US4935493A (en) * | 1987-10-06 | 1990-06-19 | E. I. Du Pont De Nemours And Company | Protease inhibitors |
US5433955A (en) * | 1989-01-23 | 1995-07-18 | Akzo N.V. | Site specific in vivo activation of therapeutic drugs |
US5462928A (en) * | 1990-04-14 | 1995-10-31 | New England Medical Center Hospitals, Inc. | Inhibitors of dipeptidyl-aminopeptidase type IV |
US5512549A (en) * | 1994-10-18 | 1996-04-30 | Eli Lilly And Company | Glucagon-like insulinotropic peptide analogs, compositions, and methods of use |
US5543396A (en) * | 1994-04-28 | 1996-08-06 | Georgia Tech Research Corp. | Proline phosphonate derivatives |
US5614379A (en) * | 1995-04-26 | 1997-03-25 | Eli Lilly And Company | Process for preparing anti-obesity protein |
US5624894A (en) * | 1992-09-17 | 1997-04-29 | University Of Florida | Brain-enhanced delivery of neuroactive peptides by sequential metabolism |
US5705483A (en) * | 1993-12-09 | 1998-01-06 | Eli Lilly And Company | Glucagon-like insulinotropic peptides, compositions and methods |
US5827898A (en) * | 1996-10-07 | 1998-10-27 | Shaman Pharmaceuticals, Inc. | Use of bisphenolic compounds to treat type II diabetes |
US5939560A (en) * | 1993-12-03 | 1999-08-17 | Ferring B.V. | Inhibitors of DP-mediated processes, compositions and therapeutic methods thereof |
US6006753A (en) * | 1996-08-30 | 1999-12-28 | Eli Lilly And Company | Use of GLP-1 or analogs to abolish catabolic changes after surgery |
US6011155A (en) * | 1996-11-07 | 2000-01-04 | Novartis Ag | N-(substituted glycyl)-2-cyanopyrrolidines, pharmaceutical compositions containing them and their use in inhibiting dipeptidyl peptidase-IV |
US6107317A (en) * | 1999-06-24 | 2000-08-22 | Novartis Ag | N-(substituted glycyl)-thiazolidines, pharmaceutical compositions containing them and their use in inhibiting dipeptidyl peptidase-IV |
US6110949A (en) * | 1999-06-24 | 2000-08-29 | Novartis Ag | N-(substituted glycyl)-4-cyanothiazolidines, pharmaceutical compositions containing them and their use in inhibiting dipeptidyl peptidase-IV |
US6172081B1 (en) * | 1999-06-24 | 2001-01-09 | Novartis Ag | Tetrahydroisoquinoline 3-carboxamide derivatives |
US20010025023A1 (en) * | 2000-02-25 | 2001-09-27 | Carr Richard David | Inhibition of beta cell degeneration |
US6303661B1 (en) * | 1996-04-25 | 2001-10-16 | Probiodrug | Use of dipeptidyl peptidase IV effectors for lowering the blood glucose level in mammals |
US6319893B1 (en) * | 1998-07-31 | 2001-11-20 | Probiodrug | Raising blood sugar level in hypoglycemic mammals by administering inhibitors of dipeptidyl peptidase IV |
US6376549B1 (en) * | 1998-09-17 | 2002-04-23 | Akesis Pharmaceuticals, Inc. | Metforimin-containing compositions for the treatment of diabetes |
US6500804B2 (en) * | 2000-03-31 | 2002-12-31 | Probiodrug Ag | Method for the improvement of islet signaling in diabetes mellitus and for its prevention |
US6548481B1 (en) * | 1998-05-28 | 2003-04-15 | Probiodrug Ag | Effectors of dipeptidyl peptidase IV |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
GB0014969D0 (en) * | 2000-06-19 | 2000-08-09 | Smithkline Beecham Plc | Novel method of treatment |
-
2003
- 2003-09-18 EP EP03788909A patent/EP1543023B1/en not_active Expired - Lifetime
- 2003-09-18 WO PCT/EP2003/010408 patent/WO2004031374A2/en not_active Application Discontinuation
- 2003-09-18 AT AT03788909T patent/ATE461212T1/en not_active IP Right Cessation
- 2003-09-18 US US10/667,200 patent/US20050176622A1/en not_active Abandoned
- 2003-09-18 DE DE60331747T patent/DE60331747D1/en not_active Expired - Lifetime
- 2003-09-18 AU AU2003293311A patent/AU2003293311A1/en not_active Abandoned
-
2006
- 2006-06-29 US US11/478,217 patent/US7816325B2/en active Active
Patent Citations (28)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US2961377A (en) * | 1957-08-05 | 1960-11-22 | Us Vitamin Pharm Corp | Oral anti-diabetic compositions and methods |
US3174901A (en) * | 1963-01-31 | 1965-03-23 | Jan Marcel Didier Aron Samuel | Process for the oral treatment of diabetes |
US3879541A (en) * | 1970-03-03 | 1975-04-22 | Bayer Ag | Antihyperglycemic methods and compositions |
US3960949A (en) * | 1971-04-02 | 1976-06-01 | Schering Aktiengesellschaft | 1,2-Biguanides |
US4028402A (en) * | 1974-10-11 | 1977-06-07 | Hoffmann-La Roche Inc. | Biguanide salts |
US4935493A (en) * | 1987-10-06 | 1990-06-19 | E. I. Du Pont De Nemours And Company | Protease inhibitors |
US5433955A (en) * | 1989-01-23 | 1995-07-18 | Akzo N.V. | Site specific in vivo activation of therapeutic drugs |
US5462928A (en) * | 1990-04-14 | 1995-10-31 | New England Medical Center Hospitals, Inc. | Inhibitors of dipeptidyl-aminopeptidase type IV |
US5624894A (en) * | 1992-09-17 | 1997-04-29 | University Of Florida | Brain-enhanced delivery of neuroactive peptides by sequential metabolism |
US5939560A (en) * | 1993-12-03 | 1999-08-17 | Ferring B.V. | Inhibitors of DP-mediated processes, compositions and therapeutic methods thereof |
US6201132B1 (en) * | 1993-12-03 | 2001-03-13 | Ferring B.V. | Inhibitors of DP-mediated processes, compositions, and therapeutic methods thereof |
US5705483A (en) * | 1993-12-09 | 1998-01-06 | Eli Lilly And Company | Glucagon-like insulinotropic peptides, compositions and methods |
US5543396A (en) * | 1994-04-28 | 1996-08-06 | Georgia Tech Research Corp. | Proline phosphonate derivatives |
US5512549A (en) * | 1994-10-18 | 1996-04-30 | Eli Lilly And Company | Glucagon-like insulinotropic peptide analogs, compositions, and methods of use |
US5614379A (en) * | 1995-04-26 | 1997-03-25 | Eli Lilly And Company | Process for preparing anti-obesity protein |
US6303661B1 (en) * | 1996-04-25 | 2001-10-16 | Probiodrug | Use of dipeptidyl peptidase IV effectors for lowering the blood glucose level in mammals |
US6006753A (en) * | 1996-08-30 | 1999-12-28 | Eli Lilly And Company | Use of GLP-1 or analogs to abolish catabolic changes after surgery |
US5827898A (en) * | 1996-10-07 | 1998-10-27 | Shaman Pharmaceuticals, Inc. | Use of bisphenolic compounds to treat type II diabetes |
US6011155A (en) * | 1996-11-07 | 2000-01-04 | Novartis Ag | N-(substituted glycyl)-2-cyanopyrrolidines, pharmaceutical compositions containing them and their use in inhibiting dipeptidyl peptidase-IV |
US6124305A (en) * | 1996-11-07 | 2000-09-26 | Novartis Ag | Use of N-(substituted glycyl)-2-cyanopyrrolidines in inhibiting dipeptidyl peptidase-IV |
US6548481B1 (en) * | 1998-05-28 | 2003-04-15 | Probiodrug Ag | Effectors of dipeptidyl peptidase IV |
US6319893B1 (en) * | 1998-07-31 | 2001-11-20 | Probiodrug | Raising blood sugar level in hypoglycemic mammals by administering inhibitors of dipeptidyl peptidase IV |
US6376549B1 (en) * | 1998-09-17 | 2002-04-23 | Akesis Pharmaceuticals, Inc. | Metforimin-containing compositions for the treatment of diabetes |
US6110949A (en) * | 1999-06-24 | 2000-08-29 | Novartis Ag | N-(substituted glycyl)-4-cyanothiazolidines, pharmaceutical compositions containing them and their use in inhibiting dipeptidyl peptidase-IV |
US6172081B1 (en) * | 1999-06-24 | 2001-01-09 | Novartis Ag | Tetrahydroisoquinoline 3-carboxamide derivatives |
US6107317A (en) * | 1999-06-24 | 2000-08-22 | Novartis Ag | N-(substituted glycyl)-thiazolidines, pharmaceutical compositions containing them and their use in inhibiting dipeptidyl peptidase-IV |
US20010025023A1 (en) * | 2000-02-25 | 2001-09-27 | Carr Richard David | Inhibition of beta cell degeneration |
US6500804B2 (en) * | 2000-03-31 | 2002-12-31 | Probiodrug Ag | Method for the improvement of islet signaling in diabetes mellitus and for its prevention |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8076330B2 (en) | 2005-04-22 | 2011-12-13 | Amgen Inc. | Dipeptidyl peptidase-IV inhibitors |
CN113507961A (en) * | 2018-12-13 | 2021-10-15 | 拜斯科阿迪有限公司 | FAP alpha specific bicyclic peptide ligands |
Also Published As
Publication number | Publication date |
---|---|
AU2003293311A1 (en) | 2004-04-23 |
US7816325B2 (en) | 2010-10-19 |
US20060234940A1 (en) | 2006-10-19 |
EP1543023A2 (en) | 2005-06-22 |
WO2004031374A3 (en) | 2004-08-12 |
AU2003293311A8 (en) | 2004-04-23 |
ATE461212T1 (en) | 2010-04-15 |
EP1543023B1 (en) | 2010-03-17 |
WO2004031374A2 (en) | 2004-04-15 |
DE60331747D1 (en) | 2010-04-29 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US7816325B2 (en) | Secondary binding site of dipeptidyl peptidase IV (DP IV) | |
US20040058876A1 (en) | Secondary binding site of dipeptidyl peptidase IV (DP IV) | |
Armstrong et al. | α2-macroglobulin: an evolutionarily conserved arm of the innate immune system | |
Valverde et al. | Synthesis of a biologically active triazole‐containing analogue of cystatin A through successive peptidomimetic alkyne–azide ligations | |
US8071541B2 (en) | Methods for preparing internally constrained peptides and peptidomimetics | |
Steinkühler et al. | Product inhibition of the hepatitis C virus NS3 protease | |
Lu et al. | Comparative total syntheses of turkey ovomucoid third domain by both stepwise solid phase peptide synthesis and native chemical ligation | |
Gould et al. | Cyclotides, a novel ultrastable polypeptide scaffold for drug discovery | |
Bolin et al. | Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure− activity relationships, and x-ray crystal structures | |
Svenson et al. | Antimicrobial peptides with stability toward tryptic degradation | |
JP6571333B2 (en) | Modified minihepcidin peptides and methods of use thereof | |
US9902754B2 (en) | Modified peptides as potent inhibitors of the PSD-95/NMDA receptor interaction | |
Angelini et al. | Bicyclization and tethering to albumin yields long-acting peptide antagonists | |
Eildal et al. | Probing the role of backbone hydrogen bonds in protein–peptide interactions by amide-to-ester mutations | |
Yang et al. | Site-specific incorporation of multiple thioamide substitutions into a peptide backbone via solid phase peptide synthesis | |
Malkar et al. | Modulation of triple-helical stability and subsequent melanoma cellular responses by single-site substitution of fluoroproline derivatives | |
De Filippis et al. | Effect of Na+ binding on the conformation, stability and molecular recognition properties of thrombin | |
Lu et al. | Deciphering the role of the electrostatic interactions involving Gly70 in eglin C by total chemical protein synthesis | |
WO2021207517A2 (en) | Modified hr2 peptide inhibitors of coronavirus fusion | |
Martin et al. | Design of selective eglin inhibitors of HCV NS3 proteinase | |
Shu et al. | Development of mirror-image screening systems for XIAP BIR3 domain inhibitors | |
Leonard et al. | Structure− Activity Relationships of Cysteine-Lacking Pentapeptide Derivatives That Inhibit ras Farnesyltransferase | |
Johansson et al. | Tetrapeptides as potent protease inhibitors of hepatitis C virus full-length NS3 (protease-helicase/NTPase) | |
Umashankara et al. | Orchestration of structural, stereoelectronic, and hydrogen-bonding effects in stabilizing triplexes from engineered chimeric collagen peptides (ProX-ProY-Gly) 6 incorporating 4 (R/S)-aminoproline | |
Qian et al. | Structure-based optimization of a peptidyl inhibitor against calcineurin-nuclear factor of activated T cell (NFAT) interaction |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: PROBIODRUG AG, GERMANY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:KUHN-WACHE, KERSTIN;BAR, JOACHIM;DEMUTH, HANS-ULRICH;AND OTHERS;REEL/FRAME:014620/0201;SIGNING DATES FROM 20040414 TO 20040420 |
|
AS | Assignment |
Owner name: PROSIDION LIMITED, UNITED KINGDOM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:PROBIODRUG AG;REEL/FRAME:016536/0107 Effective date: 20050321 |
|
AS | Assignment |
Owner name: PROSIDION LIMITED, UNITED KINGDOM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:PROBIODRUG AG;REEL/FRAME:017045/0252 Effective date: 20050321 Owner name: PROSIDION LIMITED, UNITED KINGDOM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:PROBIODRUG AG;REEL/FRAME:016561/0783 Effective date: 20050321 Owner name: PROSIDION LIMITED, UNITED KINGDOM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:PROBIODRUG AG;REEL/FRAME:016536/0621 Effective date: 20050321 Owner name: PROSIDION LIMITED, UNITED KINGDOM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:PROBIODRUG AG;REEL/FRAME:016547/0581 Effective date: 20050321 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |