US20030119093A1 - Thermal tolerant mannanase from acidothermus cellulolyticus - Google Patents
Thermal tolerant mannanase from acidothermus cellulolyticus Download PDFInfo
- Publication number
- US20030119093A1 US20030119093A1 US09/917,378 US91737801A US2003119093A1 US 20030119093 A1 US20030119093 A1 US 20030119093A1 US 91737801 A US91737801 A US 91737801A US 2003119093 A1 US2003119093 A1 US 2003119093A1
- Authority
- US
- United States
- Prior art keywords
- mannanase
- acid sequence
- sequence
- seq
- mana
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 108010055059 beta-Mannosidase Proteins 0.000 title abstract description 69
- 102100032487 Beta-mannosidase Human genes 0.000 title abstract description 52
- 241001134630 Acidothermus cellulolyticus Species 0.000 title abstract description 12
- 101710136501 Mannan endo-1,4-beta-mannosidase Proteins 0.000 claims abstract description 176
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 151
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 120
- 229920001184 polypeptide Polymers 0.000 claims abstract description 119
- 238000000034 method Methods 0.000 claims abstract description 66
- 108010031186 Glycoside Hydrolases Proteins 0.000 claims abstract description 28
- 102000005744 Glycoside Hydrolases Human genes 0.000 claims abstract description 27
- 101710168362 Beta-mannosidase A Proteins 0.000 claims abstract 28
- 102000040430 polynucleotide Human genes 0.000 claims description 93
- 108091033319 polynucleotide Proteins 0.000 claims description 93
- 239000002157 polynucleotide Substances 0.000 claims description 93
- 108090000623 proteins and genes Proteins 0.000 claims description 55
- 150000007523 nucleic acids Chemical group 0.000 claims description 44
- 102000004169 proteins and genes Human genes 0.000 claims description 41
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 40
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 40
- 239000000203 mixture Substances 0.000 claims description 40
- 229920002488 Hemicellulose Polymers 0.000 claims description 33
- 230000000694 effects Effects 0.000 claims description 32
- 239000013598 vector Substances 0.000 claims description 30
- 150000001413 amino acids Chemical class 0.000 claims description 28
- 230000003197 catalytic effect Effects 0.000 claims description 28
- 239000000758 substrate Substances 0.000 claims description 28
- 108010038196 saccharide-binding proteins Proteins 0.000 claims description 26
- 150000001720 carbohydrates Chemical class 0.000 claims description 25
- 230000015556 catabolic process Effects 0.000 claims description 21
- 238000006731 degradation reaction Methods 0.000 claims description 21
- 239000003795 chemical substances by application Substances 0.000 claims description 20
- 108020001507 fusion proteins Proteins 0.000 claims description 20
- 102000037865 fusion proteins Human genes 0.000 claims description 20
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 12
- 239000002028 Biomass Substances 0.000 claims description 11
- 238000004519 manufacturing process Methods 0.000 claims description 11
- 229920001131 Pulp (paper) Polymers 0.000 claims description 8
- 239000003550 marker Substances 0.000 claims description 8
- 102000039446 nucleic acids Human genes 0.000 claims description 8
- 108020004707 nucleic acids Proteins 0.000 claims description 8
- 230000008685 targeting Effects 0.000 claims description 7
- 238000003556 assay Methods 0.000 claims description 6
- -1 hemaglutinin Proteins 0.000 claims description 6
- 238000006384 oligomerization reaction Methods 0.000 claims description 5
- 230000001105 regulatory effect Effects 0.000 claims description 5
- 239000000523 sample Substances 0.000 claims description 5
- 230000002103 transcriptional effect Effects 0.000 claims description 5
- 230000001580 bacterial effect Effects 0.000 claims description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 claims description 3
- 108010079246 OMPA outer membrane proteins Proteins 0.000 claims description 3
- 102000002933 Thioredoxin Human genes 0.000 claims description 3
- 230000000593 degrading effect Effects 0.000 claims description 3
- 239000003599 detergent Substances 0.000 claims description 3
- 239000003623 enhancer Substances 0.000 claims description 3
- 108060008226 thioredoxin Proteins 0.000 claims description 3
- 229940094937 thioredoxin Drugs 0.000 claims description 3
- 238000001514 detection method Methods 0.000 claims description 2
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 claims description 2
- 239000007858 starting material Substances 0.000 claims 4
- 230000003321 amplification Effects 0.000 claims 3
- 238000003199 nucleic acid amplification method Methods 0.000 claims 3
- 230000005764 inhibitory process Effects 0.000 claims 1
- 230000000638 stimulation Effects 0.000 claims 1
- AEMOLEFTQBMNLQ-VANFPWTGSA-N D-mannopyranuronic acid Chemical compound OC1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@@H]1O AEMOLEFTQBMNLQ-VANFPWTGSA-N 0.000 abstract description 151
- 235000013305 food Nutrition 0.000 abstract description 14
- 238000012545 processing Methods 0.000 abstract description 7
- 239000004067 bulking agent Substances 0.000 abstract description 5
- 230000004927 fusion Effects 0.000 abstract description 5
- 210000004027 cell Anatomy 0.000 description 52
- 108020004414 DNA Proteins 0.000 description 26
- 230000014509 gene expression Effects 0.000 description 25
- 239000012634 fragment Substances 0.000 description 21
- 229920000057 Mannan Polymers 0.000 description 17
- 125000003729 nucleotide group Chemical group 0.000 description 17
- 230000027455 binding Effects 0.000 description 16
- 239000002773 nucleotide Substances 0.000 description 16
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 15
- 102000004190 Enzymes Human genes 0.000 description 14
- 108090000790 Enzymes Proteins 0.000 description 14
- 229940088598 enzyme Drugs 0.000 description 14
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 12
- 238000000746 purification Methods 0.000 description 11
- 238000012163 sequencing technique Methods 0.000 description 11
- 238000012360 testing method Methods 0.000 description 11
- 235000014633 carbohydrates Nutrition 0.000 description 10
- 229920001542 oligosaccharide Polymers 0.000 description 10
- 108010059892 Cellulase Proteins 0.000 description 9
- 150000002482 oligosaccharides Chemical class 0.000 description 9
- 238000009396 hybridization Methods 0.000 description 8
- LUEWUZLMQUOBSB-GFVSVBBRSA-N mannan Chemical class O[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@@H](O[C@@H]2[C@H](O[C@@H](O[C@H]3[C@H](O[C@@H](O)[C@@H](O)[C@H]3O)CO)[C@@H](O)[C@H]2O)CO)[C@H](O)[C@H]1O LUEWUZLMQUOBSB-GFVSVBBRSA-N 0.000 description 8
- 239000008194 pharmaceutical composition Substances 0.000 description 8
- 239000000243 solution Substances 0.000 description 8
- 235000000346 sugar Nutrition 0.000 description 8
- 102000053602 DNA Human genes 0.000 description 7
- 241000196324 Embryophyta Species 0.000 description 7
- 241000588724 Escherichia coli Species 0.000 description 7
- 241000499912 Trichoderma reesei Species 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- 238000002741 site-directed mutagenesis Methods 0.000 description 7
- 238000006467 substitution reaction Methods 0.000 description 7
- 241000894006 Bacteria Species 0.000 description 6
- 241000233866 Fungi Species 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 108020001778 catalytic domains Proteins 0.000 description 6
- 210000002421 cell wall Anatomy 0.000 description 6
- 230000000295 complement effect Effects 0.000 description 6
- 239000013604 expression vector Substances 0.000 description 6
- 230000028327 secretion Effects 0.000 description 6
- 239000002904 solvent Substances 0.000 description 6
- 150000008163 sugars Chemical class 0.000 description 6
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 239000002551 biofuel Substances 0.000 description 5
- 229920002678 cellulose Polymers 0.000 description 5
- 235000010980 cellulose Nutrition 0.000 description 5
- 150000001875 compounds Chemical class 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 230000002779 inactivation Effects 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 229920001223 polyethylene glycol Polymers 0.000 description 5
- 229920001282 polysaccharide Polymers 0.000 description 5
- 239000000725 suspension Substances 0.000 description 5
- 244000251953 Agaricus brunnescens Species 0.000 description 4
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 4
- 230000009471 action Effects 0.000 description 4
- 239000001913 cellulose Substances 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 238000004587 chromatography analysis Methods 0.000 description 4
- 238000012217 deletion Methods 0.000 description 4
- 230000037430 deletion Effects 0.000 description 4
- 239000005547 deoxyribonucleotide Substances 0.000 description 4
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 230000007062 hydrolysis Effects 0.000 description 4
- 238000006460 hydrolysis reaction Methods 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 108020004999 messenger RNA Proteins 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 231100000252 nontoxic Toxicity 0.000 description 4
- 230000003000 nontoxic effect Effects 0.000 description 4
- 239000005017 polysaccharide Substances 0.000 description 4
- 150000004804 polysaccharides Chemical class 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 239000011122 softwood Substances 0.000 description 4
- 239000003381 stabilizer Substances 0.000 description 4
- 238000013518 transcription Methods 0.000 description 4
- 230000035897 transcription Effects 0.000 description 4
- 241000193830 Bacillus <bacterium> Species 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 108010084185 Cellulases Proteins 0.000 description 3
- 102000005575 Cellulases Human genes 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 241000238631 Hexapoda Species 0.000 description 3
- 241000235058 Komagataella pastoris Species 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- 108700026244 Open Reading Frames Proteins 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 241000187747 Streptomyces Species 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 238000001042 affinity chromatography Methods 0.000 description 3
- 230000000692 anti-sense effect Effects 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 238000007796 conventional method Methods 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 239000004744 fabric Substances 0.000 description 3
- 238000000855 fermentation Methods 0.000 description 3
- 230000004151 fermentation Effects 0.000 description 3
- 238000010353 genetic engineering Methods 0.000 description 3
- 238000001802 infusion Methods 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 230000008520 organization Effects 0.000 description 3
- 230000036961 partial effect Effects 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 238000002864 sequence alignment Methods 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 229920001221 xylan Polymers 0.000 description 3
- 150000004823 xylans Chemical class 0.000 description 3
- 241001134629 Acidothermus Species 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- 235000001674 Agaricus brunnescens Nutrition 0.000 description 2
- 241000219194 Arabidopsis Species 0.000 description 2
- 229920000742 Cotton Polymers 0.000 description 2
- 101710121765 Endo-1,4-beta-xylanase Proteins 0.000 description 2
- 241000588722 Escherichia Species 0.000 description 2
- 229920002324 Galactoglucomannan Polymers 0.000 description 2
- 229920000926 Galactomannan Polymers 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 241000219146 Gossypium Species 0.000 description 2
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 2
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 2
- 229920002752 Konjac Polymers 0.000 description 2
- 108090001090 Lectins Proteins 0.000 description 2
- 102000004856 Lectins Human genes 0.000 description 2
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 244000061176 Nicotiana tabacum Species 0.000 description 2
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 241000589516 Pseudomonas Species 0.000 description 2
- 241000607142 Salmonella Species 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- 108020004682 Single-Stranded DNA Proteins 0.000 description 2
- 241000191940 Staphylococcus Species 0.000 description 2
- 241000187398 Streptomyces lividans Species 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 2
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 2
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 2
- 235000011130 ammonium sulphate Nutrition 0.000 description 2
- 238000005571 anion exchange chromatography Methods 0.000 description 2
- 150000001450 anions Chemical class 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 238000005277 cation exchange chromatography Methods 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 238000004590 computer program Methods 0.000 description 2
- 239000000356 contaminant Substances 0.000 description 2
- 239000008367 deionised water Substances 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 230000007515 enzymatic degradation Effects 0.000 description 2
- 238000012869 ethanol precipitation Methods 0.000 description 2
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 2
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 235000010485 konjac Nutrition 0.000 description 2
- 239000002523 lectin Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000002844 melting Methods 0.000 description 2
- 230000008018 melting Effects 0.000 description 2
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 2
- 229940016286 microcrystalline cellulose Drugs 0.000 description 2
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 2
- 239000008108 microcrystalline cellulose Substances 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 229920001277 pectin Polymers 0.000 description 2
- 239000001814 pectin Substances 0.000 description 2
- 235000010987 pectin Nutrition 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 229940080469 phosphocellulose Drugs 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 210000001236 prokaryotic cell Anatomy 0.000 description 2
- 238000000159 protein binding assay Methods 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 239000013605 shuttle vector Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- URAYPUMNDPQOKB-UHFFFAOYSA-N triacetin Chemical compound CC(=O)OCC(OC(C)=O)COC(C)=O URAYPUMNDPQOKB-UHFFFAOYSA-N 0.000 description 2
- 235000015112 vegetable and seed oil Nutrition 0.000 description 2
- 239000008158 vegetable oil Substances 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 239000002023 wood Substances 0.000 description 2
- OMDQUFIYNPYJFM-XKDAHURESA-N (2r,3r,4s,5r,6s)-2-(hydroxymethyl)-6-[[(2r,3s,4r,5s,6r)-4,5,6-trihydroxy-3-[(2s,3s,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]methoxy]oxane-3,4,5-triol Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O[C@H]2[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@H](O)[C@H](O)O1 OMDQUFIYNPYJFM-XKDAHURESA-N 0.000 description 1
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- RJQKKZNUWRIHCS-YDPWGIMBSA-N 1,4-b-d-mannan Chemical compound O[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)OC1O[C@@H]1[C@@H](CO)OC(O[C@@H]2[C@H](OC(O[C@@H]3[C@H](OC(O[C@@H]4[C@H](OC(O[C@@H]5[C@H](OC(O[C@@H]6[C@H](OC(O[C@@H]7[C@H](OC(O[C@@H]8[C@H](OC(O[C@@H]9[C@H](OC(O)[C@@H](O)[C@H]9O)CO)[C@@H](O)[C@H]8O)CO)[C@@H](O)[C@H]7O)CO)[C@@H](O)[C@H]6O)CO)[C@@H](O)[C@H]5O)CO)[C@@H](O)[C@H]4O)CO)[C@@H](O)[C@H]3O)CO)[C@@H](O)[C@H]2O)CO)[C@@H](O)[C@H]1O RJQKKZNUWRIHCS-YDPWGIMBSA-N 0.000 description 1
- IXPNQXFRVYWDDI-UHFFFAOYSA-N 1-methyl-2,4-dioxo-1,3-diazinane-5-carboximidamide Chemical compound CN1CC(C(N)=N)C(=O)NC1=O IXPNQXFRVYWDDI-UHFFFAOYSA-N 0.000 description 1
- GZCGUPFRVQAUEE-UHFFFAOYSA-N 2,3,4,5,6-pentahydroxyhexanal Chemical compound OCC(O)C(O)C(O)C(O)C=O GZCGUPFRVQAUEE-UHFFFAOYSA-N 0.000 description 1
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 1
- 101150096316 5 gene Proteins 0.000 description 1
- GMVPRGQOIOIIMI-DODZYUBVSA-N 7-[(1R,2R,3R)-3-hydroxy-2-[(3S)-3-hydroxyoct-1-enyl]-5-oxocyclopentyl]heptanoic acid Chemical compound CCCCC[C@H](O)C=C[C@H]1[C@H](O)CC(=O)[C@@H]1CCCCCCC(O)=O GMVPRGQOIOIIMI-DODZYUBVSA-N 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- 230000005730 ADP ribosylation Effects 0.000 description 1
- 108010024223 Adenine phosphoribosyltransferase Proteins 0.000 description 1
- 241000607534 Aeromonas Species 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 244000247812 Amorphophallus rivieri Species 0.000 description 1
- 235000001206 Amorphophallus rivieri Nutrition 0.000 description 1
- 241000256844 Apis mellifera Species 0.000 description 1
- 241000203069 Archaea Species 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 229920003043 Cellulose fiber Polymers 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 244000303965 Cyamopsis psoralioides Species 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- 102100024746 Dihydrofolate reductase Human genes 0.000 description 1
- 108010087427 Endo-1,3(4)-beta-Glucanase Proteins 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 102000016359 Fibronectins Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 239000004606 Fillers/Extenders Substances 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 229920002581 Glucomannan Polymers 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 240000005979 Hordeum vulgare Species 0.000 description 1
- 235000007340 Hordeum vulgare Nutrition 0.000 description 1
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 1
- 102100029098 Hypoxanthine-guanine phosphoribosyltransferase Human genes 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 108700001097 Insect Genes Proteins 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 239000006137 Luria-Bertani broth Substances 0.000 description 1
- 102100037812 Medium-wave-sensitive opsin 1 Human genes 0.000 description 1
- 108700005443 Microbial Genes Proteins 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241000194105 Paenibacillus polymyxa Species 0.000 description 1
- 241000222393 Phanerochaete chrysosporium Species 0.000 description 1
- 244000046052 Phaseolus vulgaris Species 0.000 description 1
- 235000010627 Phaseolus vulgaris Nutrition 0.000 description 1
- 244000208789 Phytelephas macrocarpa Species 0.000 description 1
- 235000012541 Phytelephas macrocarpa Nutrition 0.000 description 1
- 241000235648 Pichia Species 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- AUNGANRZJHBGPY-SCRDCRAPSA-N Riboflavin Chemical compound OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-SCRDCRAPSA-N 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 241000235088 Saccharomyces sp. Species 0.000 description 1
- 108091081021 Sense strand Proteins 0.000 description 1
- 241000533293 Sesbania emerus Species 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 244000061456 Solanum tuberosum Species 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 241000223259 Trichoderma Species 0.000 description 1
- 241000223260 Trichoderma harzianum Species 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 241000589636 Xanthomonas campestris Species 0.000 description 1
- 229920002000 Xyloglucan Polymers 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 229940124532 absorption promoter Drugs 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 238000003916 acid precipitation Methods 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- WQZGKKKJIJFFOK-UHFFFAOYSA-N alpha-D-glucopyranose Natural products OCC1OC(O)C(O)C(O)C1O WQZGKKKJIJFFOK-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000001408 amides Chemical group 0.000 description 1
- 229940126575 aminoglycoside Drugs 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 229920000617 arabinoxylan Polymers 0.000 description 1
- 150000004783 arabinoxylans Chemical class 0.000 description 1
- 210000004507 artificial chromosome Anatomy 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- WQZGKKKJIJFFOK-RWOPYEJCSA-N beta-D-mannose Chemical compound OC[C@H]1O[C@@H](O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-RWOPYEJCSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 235000008429 bread Nutrition 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- AIYUHDOJVYHVIT-UHFFFAOYSA-M caesium chloride Chemical compound [Cl-].[Cs+] AIYUHDOJVYHVIT-UHFFFAOYSA-M 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 229940106157 cellulase Drugs 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 230000003196 chaotropic effect Effects 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 238000000224 chemical solution deposition Methods 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000000205 computational method Methods 0.000 description 1
- IQFVPQOLBLOTPF-HKXUKFGYSA-L congo red Chemical compound [Na+].[Na+].C1=CC=CC2=C(N)C(/N=N/C3=CC=C(C=C3)C3=CC=C(C=C3)/N=N/C3=C(C4=CC=CC=C4C(=C3)S([O-])(=O)=O)N)=CC(S([O-])(=O)=O)=C21 IQFVPQOLBLOTPF-HKXUKFGYSA-L 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 108020001096 dihydrofolate reductase Proteins 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 230000003028 elevating effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 108010024521 exo-1,4-beta-mannanase Proteins 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 235000012055 fruits and vegetables Nutrition 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 125000005908 glyceryl ester group Chemical group 0.000 description 1
- 239000001087 glyceryl triacetate Substances 0.000 description 1
- 235000013773 glyceryl triacetate Nutrition 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 125000003147 glycosyl group Chemical group 0.000 description 1
- 108010002430 hemicellulase Proteins 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 238000013537 high throughput screening Methods 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 239000012729 immediate-release (IR) formulation Substances 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 239000003262 industrial enzyme Substances 0.000 description 1
- 238000012994 industrial processing Methods 0.000 description 1
- 239000003317 industrial substance Substances 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000026045 iodination Effects 0.000 description 1
- 238000006192 iodination reaction Methods 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 239000000252 konjac Substances 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229920005610 lignin Polymers 0.000 description 1
- 239000012978 lignocellulosic material Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 210000005229 liver cell Anatomy 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 238000002803 maceration Methods 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- 229960000951 mycophenolic acid Drugs 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 231100000344 non-irritating Toxicity 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000007505 plaque formation Effects 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 230000023603 positive regulation of transcription initiation, DNA-dependent Effects 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 244000144977 poultry Species 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 150000003214 pyranose derivatives Chemical group 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 239000000661 sodium alginate Substances 0.000 description 1
- 235000010413 sodium alginate Nutrition 0.000 description 1
- 229940005550 sodium alginate Drugs 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 230000003381 solubilizing effect Effects 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 229960002622 triacetin Drugs 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000002699 waste material Substances 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01078—Mannan endo-1,4-beta-mannosidase (3.2.1.78), i.e. endo-beta-mannanase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
- C12N9/2477—Hemicellulases not provided in a preceding group
- C12N9/2488—Mannanases
- C12N9/2494—Mannan endo-1,4-beta-mannosidase (3.2.1.78), i.e. endo-beta-mannanase
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the invention generally relates to a novel mannanase from Acidothermus cellulolyticus, ManA. More specifically, the invention relates to purified and isolated ManA polypeptides, nucleic acid molecules encoding the polypeptides, and processes for production and use of ManA, as well as variants and derivatives thereof.
- Plant biomass is the most abundant source of carbohydrate in the world due to the lignocellulosic materials comprising the cell walls of all higher plants.
- Plant cell walls are divided into primary and secondary cell walls.
- the primary cell wall which provides structure for expanding cells (and hence changes as the cell grows), is composed of three major polysaccharides, cellulose, hemicellulose and pectin, and one group of glycoproteins.
- the secondary cell wall which is produced after the cell has completed growing, also contains polysaccharides and is strengthened through polymeric lignin covalently cross-linked to hemicellulose.
- Hemicellulose is a general term used to refer to cell wall polysaccharides that are not celluloses or pectins.
- Hemicellulose sugar backbones include a variety of compounds, including xylans, xyloglucans, arabinoxylans and mannans.
- One of the chief constituents of hemicellulose is the aldohexose glucose, mannose, which also may be in the form of a pyranose ring structure, ⁇ -D-mannose. With respect to mannose, the glycosidic linkage is on the 1-carbon as a ⁇ -bond, having available linkage sites at the 2-, 3-, 4-, and 6-carbons.
- a particularly rich source of mannans is the hemicellulose content of softwood, and in particular, the waste material from softwood processing in paper manufacturing.
- One of the more important hemicelluloses in softwood is galactoglucomannan, which is composed of a backbone of ⁇ -(1,4)-linked D-mannopyranose and D-glucopyranose in a ratio of approximately 3:1, respectively (Sjostrom, E. (1992) Wood Chemistry, 2nd Ed., Academic Press: New York, N.Y., pp 63-70).
- Other sources of mannans include the endosperm of capra and ivory palm nuts, guar beans, coffee beans, and roots of konjak ( Amorphorphallus konjac ).
- Feed industry applications includes the processing of poultry feed (van Paridon et al., (1992) Xylans and Xylanases, Visser, J., Beldman M., Kusters-van Someren and Voragen, eds., Elsevier: New York, N.Y., pp371-378).
- thermostable enzymes have been isolated from the thermophile Acidothermus cellulolyticus gen. nov., sp. nov., a bacterium originally isolated from decaying wood in an acidic, thermal pool at Yellowstone National Park (Mohagheghi et al., (1986) Int. J. Systematic Bacteriology 36(3):435-443).
- One cellulase enzyme produced by this organism, the endoglucanase EI is known to display maximal activity at 75° C. to 83° C. (Tucker et al., Bio/Technology, 7(8):817-820).
- E1 endoglucanase has been described in U.S. Pat. No. 5,275,944. The A.
- E1 endoglucanase is an active cellulase; in combination with exocellulase CBH I from Trichoderma reesei, E1 gives high levels of saccharification and contributes to a degree of synergism. Baker et al., (1994) Appl. Biochem. Biotechnol. 45/46:245-256.
- the gene encoding E1 catalytic and cellulose binding domains and linker peptide were described in U.S. Pat. No. 5,536,655.
- thermal stable mannanases would likely have the desirable characteristic of maximal activity at elevated temperatures, as well as potentially having the thermal tolerant associated properties of resistance to acid inactivation, proteolytic inactivation, and solvent inactivation (Cowan D A in Danson M J et al. (1992) The Archaebacteria, Biochemistry and Biotechnology at 149-159, University Press, Cambridge, ISBN 1855780100).
- E1 has also been expressed as a stable, active enzyme from a wide variety of hosts, including E. coli, Streptomyces lividans, Pichia pastoris, cotton, tobacco, and Arabidopsis (Dai Z, Hooker B S, Anderson D B, Thomas S R. Transgenic Res. 2000 Feb; 9(1):43-54).
- the present invention provides ManA, a novel member of the glycoside hydrolase (GH) family of enzymes, and in particular a thermal tolerant glycoside hydrolase useful in the degradation of mannans.
- ManA polypeptides of the invention include those having an amino acid sequence shown in SEQ ID NO: 1, as well as polypeptides having substantial amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 and useful fragments thereof, including, a catalytic domain having significant sequence similarity to the GH5 family, a first carbohydrate binding domain (type II) and a second carbohydrate binding domain (type III).
- the invention also provides a polynucleotide molecule encoding ManA polypeptides and fragments of ManA polypeptides, for example catalytic and carbohydrate binding domains.
- Polynucleotide molecules of the invention include those molecules having a nucleic acid sequence as shown in SEQ ID NO:2; those that hybridize to the nucleic acid sequence of SEQ ID NO:2 under high stringency conditions; and those having substantial nucleic acid identity with the nucleic acid sequence of SEQ ID NO:2.
- the invention includes variants and derivatives of the ManA polypeptides, including fusion proteins.
- fusion proteins of the invention include ManA polypeptide fused to a heterologous protein or peptide that confers a desired function.
- the heterologous protein or peptide can facilitate purification, oligomerization, stabilization, or secretion of the ManA polypeptide, for example.
- the heterologous polypeptide can provide enhanced activity, including catalytic or binding activity, for ManA polypeptides, where the enhancement is either additive or synergistic.
- a fusion protein of an embodiment of the invention can be produced, for example, from an expression construct containing a polynucleotide molecule encoding ManA polypeptide in frame with a polynucleotide molecule for the heterologous protein.
- Embodiments of the invention also comprise vectors, plasmids, expression systems, host cells, and the like, containing a ManA polynucleotide molecule.
- Genetic engineering methods for the production of ManA polypeptides of embodiments of the invention include expression of a polynucleotide molecule in cell free expression systems and in cellular hosts, according to known methods.
- the invention further includes compositions containing a substantially purified ManA polypeptide of the invention and a carrier. Such compositions are administered to a biomass containing mannanase for the reduction or degradation of the mannanase or to produce useful oligosaccharides from hemicellulose.
- the invention also provides reagents, compositions, and methods that are useful for analysis of ManA activity.
- Tables 4 and 5 includes sequences used in describing embodiments of the present invention.
- the abbreviations are as follows: CD, catalytic domain; CBD_II, carbohydrate binding domain type II; CBD_III, carbohydrate binding domain type III; and FN-III, fibronectin domain type III.
- N* indicates a string of unknown nucleic acid units
- X* indicates a string of unknown amino acid units, for example about 50 or more.
- Table 4 includes approximate start and stop information for segments
- Table 5 includes amino acid sequence data for segments. TABLE 4 Nucleotide and polypeptide segments. aa aa ManA base base Length, BEGIN END Length, SEQ ID No. SEQ ID No.
- FIG. 1 is a schematic representation of the gene sequence and amino acid segment organization.
- FIG. 2 is a graphic representation of the glycoside hydrolase gene/protein families found in various organisms.
- amino acid refers to any of the twenty naturally occuring amino acids as well as any modified amino acid sequences. Modifications may include natural processes such as posttranslational processing, or may include chemical modifications which are known in the art. Modifications include but are not limited to: phosphorylation, ubiquitination, acetylation, amidation, glycosylatioin, covalent attachment of flavin, ADP-ribosylation, cross linking, iodination, methylation, and alike.
- Antibody refers to a Y-shaped molecule having a pair of antigen binding sites, a hinge region and a constant region. Fragments of antibodies, for example an antigen binding fragment (Fab), chimeric antibodies, antibodies having a human constant region coupled to a murine antigen binding region, and fragments thereof, as well as other well known recombinant antibodies are included in the present invention.
- Fab antigen binding fragment
- chimeric antibodies antibodies having a human constant region coupled to a murine antigen binding region, and fragments thereof, as well as other well known recombinant antibodies are included in the present invention.
- Antisense refers to polynucleotide sequences that are complementary to target “sense” polynucleotide sequence.
- Binding activity refers to any activity that can be assayed by characterizing the ability of a polypeptide to bind to substrate.
- the substrate can be a carbohydrate polymer such as hemicellulose, including mannan, or can be a complex molecule or aggregate of molecules where the entire moiety comprises at least some carbohydrate.
- “Complementary” or “complementarity” refers to the ability of a polynucleotide in a polynucleotide molecule to form a base pair with another polynucleotide in a second polynucleotide molecule.
- the sequence A-G-T is complementary to the sequence T-C-A.
- Complementarity may be partial, in which only some of the polynucleotides match according to base pairing, or complete, where all the polynucleotides match according to base pairing.
- “Expression” refers to transcription and translation occurring within a host cell.
- the level of expression of a DNA molecule in a host cell may be determined on the basis of either the amount of corresponding mRNA that is present within the cell or the amount of DNA molecule encoded protein produced by the host cell (Sambrook et al., 1989, Molecular cloning: A Laboratory Manual, 18.1-18.88).
- Fusion protein refers to a first protein having attached a second, heterologous protein.
- the heterologous protein is fused via recombinant DNA techniques, such that the first and second proteins are expressed in frame.
- the heterologous protein can confer a desired characteristic to the fusion protein, for example, a detection signal, enhanced stability or stabilization of the protein, facilitated oligomerization of the protein, or facilitated purification of the fusion protein.
- heterologous proteins useful in the fusion proteins of the invention include molecules having the catalytic domain of ManA, one or more binding domains of ManA, one or more catalytic domains of a glycoside hydrolase other than ManA, one or more binding domains of a glycoside hydrolase other than ManA, or any combination thereof.
- Further examples include immunoglobulin molecules and portions thereof, peptide tags such as histidine tag (6-His), leucine zipper, substrate targeting moieties, signal peptides, and the like. Fusion proteins are also meant to encompass variants and derivatives of ManA polypeptides that are generated by conventional site-directed mutagenesis and more modem techniques such as directed evolution, discussed infra.
- Genetically engineered refers to any recombinant DNA or RNA method used to create a prokaryotic or eukaryotic host cell that expresses a protein at elevated levels, at lowered levels, or in a mutated form.
- the host cell has been transfected, transformed, or transduced with a recombinant polynucleotide molecule, and thereby been altered so as to cause the cell to alter expression of the desired protein.
- Methods and vectors for genetically engineering host cells are well known in the art; for example various techniques are illustrated in Current Protocols in Molecular Biology, Ausubel et al., eds. (Wiley & Sons, New York, 1988, and quarterly updates).
- Genetically engineering techniques include but are not limited to expression vectors, targeted homologous recombination and gene activation (see, for example, U.S. Pat. No. 5,272,071 to Chappel) and trans activation by engineered transcription factors (see, for example, Segal et al., 1999, Proc Natl Acad Sci USA 96(6):2758-63).
- glycoside hydrolase family refers to a family of enzymes, which hydrolyze the glycosidic bond between two or more carbohydrates or between a carbohydrate and a non-carbohydrate moiety (Henrissat B., (1991) Biochem. J., 280:309-316). Identification of a putative glycoside hydrolase family member is made based on an amino acid sequence comparison and the finding of significant sequence similarity within the putative member's catalytic domain, as compared to the catalytic domains of known family members.
- Homology refers to a degree of complementarity between polynucleotides, having significant effect on the efficiency and strength of hybridization between polynucleotide molecules.
- the term also can refer to a degree of similarity between polypeptides.
- Host cell refers to cells expressing a heterologous polynucleotide molecule. Host cells of the present invention express polynucleotides encoding ManA or a fragment thereof. Examples of suitable host cells useful in the present invention include, but are not limited to, prokaryotic and eukaryotic cells.
- Such cells include bacteria of the genera Escherichia, Bacillus, and Salmonella, as well as members of the genera Pseudomonas, Streptomyces, and Staphylococcus; fungi, particularly filamentous fungi such as Trichoderma and Aspergillus, Phanerochaete chrysosporium, and other white rot fungi; also other fungi including Fusaria, molds and yeast including Saccharomyces sp., and Candida sp. and the like; plants e.g.
- SF 9 insect cells (Summers and Smith, 1987, Texas Agriculture Experiment Station Bulletin, 1555), and the like.
- mammalian cells such as human embyonic kidney cells (293 cells), Chinese hamster ovary (CHO) cells (Puck et al., 1958, Proc. Natl. Acad. Sci.
- HELA human cervical carcinoma cells
- HTB2 human liver cells
- DLD-1 human colon carcinoma cells
- Daudi cells ATCC CRL-213
- murine myeloma cells such as P3/NSI/1-Ag4-1 (ATCC TIB-18), P3X63Ag8 (ATCC TIB-9), SP2/0-Ag14 (ATCC CRL-1581) and the like.
- Hybridization refers to the pairing of complementary polynucleotides during an annealing period. The strength of hybridization between two polynucleotide molecules is impacted by the homology between the two molecules, stringency of the conditions involved, the melting temperature of the formed hybrid and the G:C ratio within the polynucleotides.
- Identity refers to a comparison between pairs of nucleic acid or amino acid molecules. Methods for determining sequence identity are known. See, for example, computer programs commonly employed for this purpose, such as the Gap program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, Madison Wis.), that uses the algorithm of Smith and Waterman, 1981, Adv. Appl. Math., 2: 482-489.
- isolated refers to a polynucleotide or polypeptide that has been separated from at least one contaminant (polynucleotide or polypeptide) with which it is normally associated.
- contaminant polynucleotide or polypeptide
- an isolated polynucleotide or polypeptide is in a context or in a form that is different from that in which it is found in nature.
- Mannanase activity refers to any activity that can be assayed by characterizing the enzymatic activity of a mannanase.
- mannanase activity can be assayed by determining how much reducing sugar is produced during a fixed amount of time for a set amount of enzyme acting on mannan (see Irwin et al., (1998) J. Bacteriology, 1709-1714).
- Other assays are well known in the art and can be substituted, for example, by applying a solution to be tested for mannanase to a 1-4 mm diameter hole punched out in agar plates containing 0.2% AZCL galactomannan or other target mannan substrate.
- Nucleic acid sequence refers to the order or sequence of deoxyribonucleotides along a strand of deoxyribonucleic acid. The order of these deoxyribonucleotides determines the order of amino acids along a polypeptide chain. The deoxyribonucleotide sequence thus codes for the amino acid sequence.
- Polynucleotide refers to a linear sequence of nucleotides.
- the nucleotides may be ribonucleotides, or deoxyribonucleotides, or a mixture of both.
- Examples of polynucleotides in the context of the present invention include single and double stranded DNA, single and double stranded RNA, and hybrid molecules having mixtures of single and double stranded DNA and RNA.
- the polynucleotides of the present invention may contain one or more modified nucleotides.
- Protein “Protein,” “peptide,” and “polypeptide” are used interchangeably to denote an amino acid polymer or a set of two or more interacting or bound amino acid polymers.
- “Purify,” or “purified” refers to a target protein that is free from at least 5-10% of contaminating proteins. Purification of a protein from contaminating proteins can be accomplished using known techniques, including ammonium sulfate or ethanol precipitation, acid precipitation, heat precipitation, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography, size-exclusion chromatography, and lectin chromatography. Various protein purification techniques are illustrated in Current Protocols in Molecular Biology, Ausubel et al., eds. (Wiley & Sons, New York, 1988, and quarterly updates).
- Selectable marker refers to a marker that identifies a cell as having undergone a recombinant DNA or RNA event.
- Selectable markers include, for example, genes that encode antimetabolite resistance such as the DHFR protein that confers resistance to methotrexate (Wigler et al, 1980, Proc Natl Acad Sci USA 77:3567; O'Hare et al., 1981, Proc Natl Acad Sci USA, 78:1527), the GPT protein that confers resistance to mycophenolic acid (Mulligan & Berg, 1981, PNAS USA, 78:2072), the neomycin resistance marker that confers resistance to the aminoglycoside G-418 (Calberre-Garapin et al., 1981, J.
- the herpes simplex virus thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase and adenine phosphoribosyltransferase genes can be employed in tk ⁇ , hgprt ⁇ and aprt ⁇ cells, respectively.
- “Stringency” refers to the conditions (temperature, ionic strength, solvents, etc) under which hybridization between polynucleotides occurs.
- a hybridzation reaction conducted under high stringency conditions is one that will only occur between polynucleotide molecules that have a high degree of complementary base pairing (85% to 100% identity).
- Conditions for high stringency hybridization may include an overnight incubation at about 42° C. for about 2.5 hours in 6 ⁇ SSC/0.1% SDS, followed by washing of the filters in 1.0 ⁇ SSC at 65° C., 0.1% SDS.
- a hybridization reaction conducted under moderate stringency conditions is one that will occur between polynucleotide molecules that have an intermediate degree of complementary base pairing (50% to 84% identity).
- “Substrate targeting moiety” refers to any signal on a substrate, either naturally occurring or genetically engineered, used to target any ManA polypeptide or fragment thereof to a substrate.
- Such targeting moieties include ligands that bind to a substrate structure. Examples of ligand/receptor pairs include carbohydrate binding domains and mannans. Many such substrate-specific ligands are known and are useful in the present invention to target a ManA polypeptide or fragment thereof to a substrate.
- a novel example is a ManA carbohydrate binding domain that is used to tether other molecules to a Mannan-containing substrate such as a fabric.
- Thermal tolerant refers to the property of withstanding partial or complete inactivation by heat and can also be described as thermal resistance or thermal stability. Although some variation exists in the literature, the following definitions can be considered typical for the optimum temperature range of stability and activity for enzymes: psycrophilic (below freezing to 10° C.); mesophilic (10° C. to 50° C.); thermophilic (50° C. to 75° C.); and caldophilic (75° C. to above boiling water temperature).
- the stability and catalytic activity of enzymes are linked characteristics, and the ways of measuring these properties vary considerably. For industrial enzymes, stability and activity are best measured under use conditions, often in the presence of substrate. Therefore, mannanases that must act on process streams of mannans must be able to withstand exposure up to thermophilic or even caldophilic temperatures for digestion times in excess of several hours.
- thermal tolerance refers to the ability to function in a temperature range of from about 15° C. to about 100° C.
- a preferred range is from about 30° C. to about 80° C.
- a highly preferred range is from about 50° C. to about 70° C.
- a protein that can function at about 45° C. is considered in the preferred range even though it may be susceptible to partial or complete inactivation at temperatures in a range above about 45° C. and less than about 80° C.
- the desirable property of thermal tolerance among is often accompanied by other desirable characteristics such as: resistance to extreme pH degradation, resistance to solvent degradation, resistance to proteolytic degradation, resistance to detergent degradation, resistance to oxidizing agent degradation, resistance to chaotropic agent degradation, and resistance to general degradation.
- resistance is intended to include any partial or complete level of residual activity.
- Variant means a polynucleotide or polypeptide molecule that differs from a reference molecule. Variants can include nucleotide changes that result in amino acid substitutions, deletions, fusions, or truncations in the resulting variant polypeptide when compared to the reference polypeptide.
- Vector refers to a first polynucleotide molecule, usually double-stranded, which may have inserted into it a second polynucleotide molecule, for example a foreign or heterologous polynucleotide.
- the heterologous polynucleotide molecule may or may not be naturally found in the host cell, and may be, for example, one or more additional copy of the heterologous polynucleotide naturally present in the host genome.
- the vector is adapted for transporting the foreign polynucleotide molecule into a suitable host cell. Once in the host cell, the vector may be capable of integrating into the host cell chromosomes.
- the vector may optionally contain additional elements for selecting cells containing the integrated polynucleotide molecule as well as elements to promote transcription of mRNA from transfected DNA.
- additional elements for selecting cells containing the integrated polynucleotide molecule as well as elements to promote transcription of mRNA from transfected DNA.
- vectors useful in the methods of the present invention include, but are not limited to, plasmids, bacteriophages, cosmids, retroviruses, and artificial chromosomes.
- Glycoside hydrolases are a large and diverse family of enzymes that hydrolyze the glycosidic bond between two carbohydrate moieties or between a carbohydrate and non-carbohydrate moiety (See FIG. 2). Glycoside hydrolase enzymes are classified into glycoside hydrolase (GH) families based on significant amino acid similarities within their catalytic domains, as compared to the catalytic domain of known family members. Enzymes having related catalytic domains are grouped together within a family (Henrissat et al., (1991) supra; Henrissat et al., (1996), Biochem. J.
- Mannanases belong to the GH family of enzymes. Mannanases are produced by a variety of bacteria and fungi to degrade the ⁇ -1,4 linkages in mannans, glucomannans, galactomannans, and galactoglucomannans and to so produce oligosaccharides. At present, mannanases are found within either the GH5 or GH26 family of glycoside hydrolases (Hilge et al., (1998) Structure 6(11):1433-1444).
- Mannanases are characterized by having a multiple domain unit within their overall structure, a GH or catalytic domain is joined to a carbohydrate binding type domain (CBD) by a glycosylated linker peptide (see FIG. 1) (Koivula et al., (1996) Protein Expression and Purification 8:391-400).
- CBD carbohydrate binding type domain
- the catalytic domain hydrolysis the mannan, the CBD type domain increases the concentration of the enzyme on the substrate, in this case hemicellulose, and the linker peptide provides flexibility for both larger domains.
- mannanases Conversion of hemicellulose to oligosaccharides by mannanases elevates the value of the complex substrate, such as in foods, feeds and paper pulp.
- mannan polymers from the hemicellulose fraction of softwood are known to contaminate the cellulose fibers in paper pulp. Addition of a mannanases to the paper pulp can reduce the amounts of these contaminants and provide a higher quality product.
- mannanases can be useful in the production of biofuels from plant biomass, where the mannanases participate in the hydrolysis of the hemicellulose fraction to oligosaccharides, which can be further reduced to sugars and converted to ethanol via fermentation.
- ManA a novel thermostable mannanase
- the predicted amino acid sequence of ManA (SEQ ID NO:1) has an organization characteristic of a mannanase enzyme.
- ManA contains a GH5 catalytic domain (about amino acid 37 to 411)-linker domain-carbohydrate binding type domain (about amino acid 455 to 608) organization, as well as a second carbohydrate binding type domain (about amino acid 662 to 762).
- significant amino acid similarity of ManA to other mannanases identifies ManA as a mannanase.
- ManA has a catalytic domain belonging to the GH5 family of glycoside hydrolases.
- the GH5 domain family includes a number of ⁇ -mannanases, for example, ⁇ -mannanase isolated from Agaricus bisporus, and ⁇ -mannanase isolated from Trichoderma reesei ( Hypocrea jecorina ).
- the GH5 members degrade substrate using a retaining mechanism.
- mannanase member of the GH5 family of glycoside hydrolases identifies ManA as having ⁇ -mannanase (EC 3.2.1.78) activity.
- the predicted amino acid sequence indicates that CBD type II and CBD type II domains are present as characterized by Tomme P. et al. (1995), in Enzymatic Degradation of Insoluble Polysaccharides (Saddler J N & Penner M, eds.), at 142-163, American Chemical Society, Washington. See also Tomme, P. & Claeyssens, M. (1989) FEBS Lett. 243, 239-2431; Gilkes, N. R et al., (1988) J.Biol.Chem. 263, 10401-10407.
- ManA is also a thermostable mannanase as it is produced by the thermophile Acidothermus cellulolyticus. ManA can have other thermostable associated characteristics—for example, resistance to acidity, resistance to protein degredation, and the like (Cowan D., (1992) supra). Like other members of the mannanase family, and in particular thermostable mannanases, ManA is useful in converting hemicellulose to oligosaccharides and thereby elevating the value of the complex substrate, for example in foods, feeds and paper pulp. Oligosaccharides produced by ManA may also be used as a bulking agent or stabilizer in foods and feeds.
- ManA is useful in the conversion of biofuels from biomass, and in particular, biofuels from hemicellulose. It is envisioned that ManA could be used alone or in combination with one or more other mannanase or other relevant glycoside hydrolase to perform the uses described herein or known within the relevant art, all of which are within the scope of the present disclosure.
- ManA polypeptides of the invention include isolated polypeptides having an amino acid sequence as shown below in Example 1; Table 1 and in SEQ ID NO:1, as well as variants and derivatives, including fragments, having substantial identity to the amino acid sequence of SEQ ID NO:1 and that retain any of the functional activities of ManA.
- ManA polypeptide activity can be determined, for example, by subjecting the variant, derivative, or fragment to a substrate binding assay or a mannanase activity assay such as those described for cellulases in Irwin D et al., J. Bacteriology 180(7): 1709-1714 (April 1998) or U.S. Pat. No. 6,060,299.
- the isolated ManA polypeptide includes an N-terminal hydrophobic region that functions as a signal peptide, having an amino acid sequence that begins with M1 and extends to approximately A36; a catalytic domain having significant sequence similarity to a GH5 family domain that begins at about A37 and extends to about G411, a carbohydrate binding domain type III region that begins at about V455 and extends to about T608, and a carbohydrate binding domain type II that begins at about G662 and extends to about S762.
- ManA polypeptides modified by covalent or aggregative conjugation with other chemical moieties, such as glycosyl groups, polyethylene glycol (PEG) groups, lipids, phosphate, acetyl groups, and the like.
- PEG polyethylene glycol
- the amino acid sequence of ManA polypeptides of the invention is preferably at least about 60% identical, more preferably at least about 70% identical, or in some embodiments at least about 90% identical, to the ManA amino acid sequence shown above in Table 1 and SEQ ID NO:1.
- the percentage identity also termed homology (see definition above) can be readily determined, for example, by comparing the two polypeptide sequences using any of the computer programs commonly employed for this purpose, such as the Gap program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, Madison Wis.), which uses the algorithm of Smith and Waterman, 1981, Adv. Appl. Math. 2: 482-489.
- Variants and derivatives of the ManA polypeptide may further include, for example, fusion proteins formed of a ManA polypeptide and a heterologous polypeptide.
- Preferred heterologous polypeptides include those that facilitate purification, oligomerization, stability, or secretion of the ManA polypeptides.
- Fragments of the ManA polypeptide may include, but are not limited to, the GH5 catalytic domain (SEQ ID NO:3), the carbohydrate binding domain type III (SEQ ID NO:4) and the carbohydrate binding domain type II (SEQ ID NO:5).
- ManA polypeptide variants and derivatives can contain conservatively substituted amino acids, meaning that one or more amino acid can be replaced by an amino acid that does not alter the secondary and/or tertiary structure of the polypeptide.
- substitutions can include the replacement of an amino acid, by a residue having similar physicochemical properties, such as substituting one aliphatic residue (Ile, Val, Leu, or Ala) for another, or substitutions between basic residues Lys and Arg, acidic residues Glu and Asp, amide residues Gln and Asn, hydroxyl residues Ser and Tyr, or aromatic residues Phe and Tyr.
- the ManA polypeptides of the present invention are preferably provided in an isolated form, and preferably are substantially purified.
- the polypeptides may be recovered and purified from recombinant cell cultures by known methods, including, for example, ammonium sulfate or ethanol precipitation, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography, and lectin chromatography.
- HPLC high performance liquid chromatography
- ManA polypeptides are that of recombinant polypeptides as expressed by suitable hosts.
- the hosts can simultaneously produce other mannanases or glycoside hydrolases such that a mixture is produced comprising a ManA polypeptide and one or more other glycoside hydrolases.
- Such a mixture can be effective in crude fermentation processing or other industrial processing (see below).
- ManA polypeptides can be fused to heterologous polypeptides to facilitate purification.
- Many available heterologous peptides allow selective binding of the fusion protein to a binding partner.
- Non-limiting examples of peptide tags include 6-His, thioredoxin, hemaglutinin, GST, and the OmpA signal sequence tag.
- a binding partner that recognizes and binds to the heterologous peptide can be any molecule or compound, including metal ions (for example, metal affinity columns), antibodies, antibody fragments, or any protein or peptide that preferentially binds the heterologous peptide to permit purification of the fusion protein.
- ManA polypeptides can be modified to facilitate formation of ManA oligomers.
- ManA polypeptides can be fused to peptide moieties that promote oligomerization, such as leucine zippers and certain antibody fragment polypeptides, for example, Fc polypeptides. Techniques for preparing these fusion proteins are known, and are described, for example, in WO 99/31241 and in Cosman et.al., 2001 Immunity 14:123-133. Fusion to an Fc polypeptide offers the additional advantage of facilitating purification by affinity chromatography over Protein A or Protein G columns.
- LZ leucine-zipper
- an expanded set of variants and derivatives of ManA polynucleotides and/or polypeptides can be generated to select for useful molecules, where such expansion is achieved not only by conventional methods such as site-directed mutagenesis (SDM) but also by more modem techniques, either independently or in combination.
- SDM site-directed mutagenesis
- Site-directed-mutagenesis is considered an informational approach to protein engineering and can rely on high-resolution crystallographic structures of target proteins and some stratagem for specific amino acid changes (Van Den Burg, B.; Vriend, G.; Veltman, O. R.; Venema, G.; Eijsink, V. G. H. Proc. Nat. Acad. Sci. U.S. 1998, 95, 2056-2060).
- modification of the amino acid sequence of ManA polypeptides can be accomplished as is known in the art, such as by introducing mutations at particular locations by oligonucleotide-directed mutagenesis (Walder et al.,1986, Gene, 42:133; Bauer et al., 1985, Gene 37:73; Craik, 1985, BioTechniques, 12-19; Smith et al., 1981, Genetic Engineering: Principles and Methods, Plenum Press; and U.S. Pat. No. 4,518,584 and U.S. Pat. No. 4,737,462).
- SDM technology can also employ the recent advent of computational methods for identifying site-specific changes for a variety of protein engineering objectives (Hellinga, H. W. Nature Structural. Biol. 1998, 5, 525-527).
- the more modern techniques include, but are not limited to, non-informational mutagenesis techniques (referred to generically as “directed evolution”).
- Directed evolution in conjunction with high-throughput screening, allows testing of statistically meaningful variations in protein conformation (Arnold, F. H. Nature Biotechnol. 1998, 16, 617-618).
- Directed evolution technology can include diversification methods similar to that described by Crameri A. et al. (1998, Nature 391: 288-291), site-saturation mutagenesis, staggered extension process (StEP) (Zhao, H.; Giver, L.; Shao, Z.; Affholter, J. A.; Arnold, F. H. Nature Biotechnol. 1998, 16, 258-262), and DNA synthesis/reassembly (U.S. Pat. No. 5,965,408).
- Fragments of the ManA polypeptide can be used, for example, to generate specific anti-ManA antibodies. Using known selection techniques, specific epitopes can be selected and used to generate monoclonal or polyclonal antibodies. Such antibodies have utlilty in the assay of ManA activity as well as in purifying recombinant ManA polypeptides from genetically engineered host cells.
- the ManA polynucleotide molecules of the invention are preferably isolated molecules encoding the ManA polypeptide having an amino acid sequence as shown in Table 1 and SEQ ID NO:1, as well as derivatives, variants, and useful fragments of the ManA polynucleotide.
- the ManA polynucleotide sequence can include deletions, substitutions, or additions to the nucleic acid sequence of Table 2 and SEQ ID NO:2.
- the ManA polynucleotides of the invention have a nucleic acid sequence that is at least about 60% identical to the nucleic acid sequence shown in Table 2 and SEQ ID NO:2, in some embodiments at least about 70% identical to the nucleic acid sequence shown in Table 2 and SEQ ID NO:2, and in other embodiments at least about 90% identical to the nucleic acid sequence shown in Table 2 and SEQ ID NO:2.
- Nucleic acid sequence identity is determined by known methods, for example by aligning two sequences in a software program such as the BLAST program (Altschul, S. F et al. (1990) J. Mol. Biol. 215:403-410, from the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/BLAST/).
- the ManA polynucleotide molecules of the invention also include isolated polynucleotide molecules having a nucleic acid sequence that hybridizes under high stringency conditions (as defined above) to a the nucleic acid sequence shown in Table 2 and SEQ ID NO:2.
- Hybridization of the polynucleotide is to at least about 15 contiguous nucleotides, or at least about 20 contiguous nucleotides, and in other embodiments at least about 30 contiguous nucleotides, and in still other embodiments at least about 100 contiguous nucleotides of the nucleic acid sequence shown in Table 2 and SEQ ID NO:2.
- Useful fragments of the ManA-encoding polynucleotide molecules described herein include probes and primers.
- probes and primers can be used, for example, in PCR methods to amplify and detect the presence of ManA polynucleotides in vitro, as well as in Southern and Northern blots for analysis of ManA.
- Cells expressing the ManA polynucleotide molecules of the invention can also be identified by the use of such probes. Methods for the production and use of such primers and probes are known.
- 5′ and 3′ primers corresponding to a region at the termini of the ManA polynucleotide molecule can be employed to isolate and amplify the ManA polynucleotide using conventional techniques.
- the present invention also provides vectors containing the polynucleotide molecules of the invention, as well as host cells transformed with such vectors.
- Any of the polynucleotide molecules of the invention may be contained in a vector, which generally includes a selectable marker and an origin of replication, for propagation in a host.
- the vectors further include suitable transcriptional or translational regulatory sequences, such as those derived from a mammalian, microbial, viral, or insect genes, operably linked to the ManA polynucleotide molecule. Examples of such regulatory sequences include transcriptional promoters, operators, or enhancers, mRNA ribosomal binding sites, and appropriate sequences which control transcription and translation.
- Nucleotide sequences are operably linked when the regulatory sequence functionally relates to the DNA encoding the target protein.
- a promoter nucleotide sequence is operably linked to a ManA DNA sequence if the promoter nucleotide sequence directs the transcription of the ManA sequence.
- Suitable vectors for the cloning of ManA polynucleotide molecules encoding the target ManA polypeptides of this invention will depend upon the host cell in which the vector will be transformed, and, where applicable, the host cell from which the target polypeptide is to be expressed.
- Suitable host cells for expression of ManA polypeptides include prokaryotes, yeast, and higher eukaryotic cells, each of which is discussed below.
- the ManA polypeptides to be expressed in such host cells may also be fusion proteins that include regions from heterologous proteins. As discussed above, such regions may be included to allow, for example, secretion, improved stability, or facilitated purification of the ManA polypeptide.
- a nucleic acid sequence encoding an appropriate signal peptide can be incorporated into an expression vector.
- a nucleic acid sequence encoding a signal peptide (secretory leader) may be fused in-frame to the ManA sequence so that ManA is translated as a fusion protein comprising the signal peptide.
- a signal peptide that is functional in the intended host cell promotes extracellular secretion of the ManA polypeptide.
- the signal sequence will be cleaved from the ManA polypeptide upon secretion of ManA from the cell.
- Non-limiting examples of signal sequences that can be used in practicing the invention include the yeast I-factor and the honeybee melatin leader in Sf9 insect cells.
- Suitable host cells for expression of target polypeptides of the invention include prokaryotes, yeast, and higher eukaryotic cells.
- Suitable prokaryotic hosts to be used for the expression of these polypeptides include bacteria of the genera Escherichia, Bacillus, and Salmonella, as well as members of the genera Pseudomonas, Streptomyces, and Staphylococcus.
- the polynucleotide molecule encoding ManA polypeptide preferably includes an N-terminal methionine residue to facilitate expression of the recombinant polypeptide.
- the N-terminal Met may optionally be cleaved from the expressed polypeptide.
- Expression vectors for use in prokaryotic hosts generally comprise one or more phenotypic selectable marker genes. Such genes encode, for example, a protein that confers antibiotic resistance or that supplies an auxotrophic requirement.
- phenotypic selectable marker genes encode, for example, a protein that confers antibiotic resistance or that supplies an auxotrophic requirement.
- a wide variety of such vectors are readily available from commercial sources. Examples include pSPORT vectors, pGEM vectors (Promega, Madison, Wis.), pPROEX vectors (LTI, Bethesda, Md.), Bluescript vectors (Stratagene), and pQE vectors (Qiagen).
- ManA can also be expressed in yeast host cells from genera including Saccharomyces, Pichia, and Kluveromyces.
- Preferred yeast hosts are S. cerevisiae and P. pastoris.
- Yeast vectors will often contain an origin of replication sequence from a 2T yeast plasmid, an autonomously replicating sequence (ARS), a promoter region, sequences for polyadenylation, sequences for transcription termination, and a selectable marker gene.
- Vectors replicable in both yeast and E. coli may also be used.
- a shuttle vector will also include sequences for replication and selection in E. coli. Direct secretion of the target polypeptides expressed in yeast hosts may be accomplished by the inclusion of nucleotide sequence encoding the yeast I-factor leader sequence at the 5′ end of the ManA-encoding nucleotide sequence.
- Insect host cell culture systems can also be used for the expression of ManA polypeptides.
- the target polypeptides of the invention are preferably expressed using a baculovirus expression system, as described, for example, in the review by Luckow and Summers, 1988 Bio/Technology 6:47.
- a suitable expression vector for expression of ManA polypeptides of the invention will depend upon the host cell to be used.
- suitable expression vectors for E. coli include pET, pUC, and similar vectors as is known in the art.
- Preferred vectors for expression of the ManA polypeptides include the shuttle plasmid pIJ702 for Streptomyces lividans, pGAPalpha-A, B, C and pPICZalpha-A, B, C (Invitorgen) for Pichia pastoris, and pFE-1 and pFE-2 for filamentous fungi and similar vectors as is known in the art.
- ManA polynucleotide molecule Modification of a ManA polynucleotide molecule to facilitate insertion into a particular vector (for example, by modifying restriction sites), ease of use in a particular expression system or host (for example, using preferred host codons), and the like, are known and are contemplated for use in the invention.
- Genetic engineering methods for the production of ManA polypeptides include the expression of the polynucleotide molecules in cell free expression systems, in cellular hosts, in tissues, and in animal models, according to known methods.
- compositions containing a substantially purified ManA polypeptide of the invention are administered to biomass, for example, to degrade the hemicellulose in the biomass into simpler carbohydrate units and ultimately, to sugars. These released sugars from the hemicellulose are converted into ethanol by any number of different catalysts. Such compositions may also be included in detergents for removal, for example, of hemicellulose containing stains within fabrics, or compositions used in the pulp and paper industry to address conditions associated with hemicellulose contamination of the cellulose fraction. Compositions of the present invention can be used in degrading the hemicellulose fraction in the food and feed industry to result in a lower content of hemicellulose in food or feed.
- compositions of the present invention can also be used to produce oligosaccharide bulking agents and stabilizers from hemicellulose for use in the food and feed industry.
- Compositions of the present invention that include either the carbohydrate binding domain type III or II polypeptides can be used as linking agents, for example, to link a target molecule fused to the CBD II or III to a carbohydrate containing target, including pharmaceutical compositions where the CBD II or III is used to target drugs to target carbohydrate expressing cells (see below).
- the invention provides pharmaceutical compositions containing a substantially purified ManA polypeptide of the invention and if necessary a pharmaceutically acceptable carrier.
- Such pharmaceutical compositions are administered to cells, tissues, or patients, for example, to aid in delivery or targeting of other pharmaceutical compositions.
- ManA polypeptides, and in particular the carbohydrate binding domains of ManA may be used where carbohydrate-mediated liposomal interactions are involved with target cells. Vyas SP et al. (2001), J. Pharmacy & Pharmaceutical Sciences May-August 4(2): 138-58.
- the invention also provides reagents, compositions, and methods that are useful for analysis of ManA activity and for the analysis of hemicellulose breakdown.
- compositions of the present invention may also include other known glycoside hydrolases, and preferably, other known thermal tolerant glycoside hydrolases for enhanced treatment of hemicellulose.
- the polypeptides of the present invention may be used to raise polyclonal and monoclonal antibodies that are useful in purifying ManA, or detecting ManA polypeptide expression, as well as a reagent tool for characterizing the molecular actions of the ManA polypeptide.
- a peptide containing a unique epitope of the ManA polypeptide is used in preparation of antibodies, using conventional techniques. Methods for the selection of peptide epitopes and production of antibodies are known.
- Agents that modifiy, for example, increase or decrease, ManA hydrolysis or degradation of hemicellulose can be identified, for example, by assay of ManA mannanase activity and/or analysis of ManA binding to a carbohydrate substrate. Incubation of hemicellulose in the presence of ManA and in the presence or absence of a test agent and correlation of mannanase activity or carbohydrate binding permits screening of such agents.
- mannanase activity and binding assays may be performed in a manner similar to those described for cellulases in Irwin et al., J. Bacteriology 180(7): 1709-1714 (April 1998).
- ManA stimulated activity is determined in the presence and absence of a test agent and then compared.
- a higher ManA activated test activity in the presence of the test agent than in the absence of the test agent indicates that the test agent has increased the activity of the ManA.
- Stimulators and inhibitors of ManA may be used to augment, inhibit, or modify ManA mediated activity, and therefore may have potential industrial uses as well as potential use in the further elucidation of ManA's molecular actions.
- ManA polypeptides of the invention are effective in adding in delivery or targeting of other pharmaceutical compositions within a host.
- ManA polypeptides and in particular the ManA carbohydrate binding domains, may be used where carbohydrate-mediated liposomal interactions are involved with target cells. Vyas SP et al. (2001), J. Pharm Pharm Sci May-August 4(2): 138-58.
- ManA polynucleotides and polypeptides, including vectors expressing ManA, of the invention can be formulated as pharmaceutical compositions and administered to a host, preferably mammalian host, including a human patient, in a variety of forms adapted to the chosen route of administration.
- the compounds are preferably administered in combination with a pharmaceutically acceptable carrier, and may be combined with or conjugated to specific delivery agents, including targeting antibodies and/or cytokines.
- ManA can be administered by known techniques, such as orally, parentally (including subcutaneous injection, intravenous, intramuscular, intrasternal or infusion techniques), by inhalation spray, topically, by absorption through a mucous membrane, or rectally, in dosage unit formulations containing conventional non-toxic pharmaceutically acceptable carriers, adjuvants or vehicles.
- Pharmaceutical compositions of the invention can be in the form of suspensions or tablets suitable for oral administration, nasal sprays, creams, sterile injectable preparations, such as sterile injectable aqueous or oleagenous suspensions or suppositories.
- compositions can be prepared according to techniques well-known in the art of pharmaceutical formulation.
- the compositions can contain microcrystalline cellulose for imparting bulk, alginic acid or sodium alginate as a suspending agent, methylcellulose as a viscosity enhancer, and sweeteners or flavoring agents.
- the compositions can contain microcrystalline cellulose, starch, magnesium stearate and lactose or other excipients, binders, extenders, disintegrants, diluents and lubricants known in the art.
- compositions for administration by inhalation or aerosol, can be prepared according to techniques well-known in the art of pharmaceutical formulation.
- the compositions can be prepared as solutions in saline, using benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons or other solubilizing or dispersing agents known in the art.
- compositions can be formulated according to techniques well-known in the art, using suitable dispersing or wetting and suspending agents, such as sterile oils, including synthetic mono- or diglycerides, and fatty acids, including oleic acid.
- suitable dispersing or wetting and suspending agents such as sterile oils, including synthetic mono- or diglycerides, and fatty acids, including oleic acid.
- compositions can be prepared by mixing with a suitable non-irritating excipient, such as cocoa butter, synthetic glyceride esters or polyethylene glycols, which are solid at ambient temperatures, but liquefy or dissolve in the rectal cavity to release the drug.
- a suitable non-irritating excipient such as cocoa butter, synthetic glyceride esters or polyethylene glycols, which are solid at ambient temperatures, but liquefy or dissolve in the rectal cavity to release the drug.
- Solutions or suspensions of the compounds can be prepared in water, isotonic saline (PBS) and optionally mixed with a nontoxic surfactant.
- Dispersions may also be prepared in glycerol, liquid polyethylene, glycols, DNA, vegetable oils, triacetin and mixtures thereof. Under ordinary conditions of storage and use, these preparations may contain a preservative to prevent the growth of microorganisms.
- the pharmaceutical dosage form suitable for injection or infusion use can include sterile, aqueous solutions or dispersions or sterile powders comprising an active ingredient which are adapted for the extemporaneous preparation of sterile injectable or infusible solutions or dispersions.
- the liquid carrier or vehicle can be a solvent or liquid dispersion medium comprising, for example, water, ethanol, a polyol such as glycerol, propylene glycol, or liquid polyethylene glycols and the like, vegetable oils, nontoxic glyceryl esters, and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the formation of liposomes, by the maintenance of the required particle size, in the case of dispersion, or by the use of nontoxic surfactants.
- the prevention of the action of microorganisms can be accomplished by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars, buffers, or sodium chloride.
- Prolonged absorption of the injectable compositions can be brought about by the inclusion in the composition of agents delaying absorption—for example, aluminum monosterate hydrogels and gelatin.
- Sterile injectable solutions are prepared by incorporating the compounds in the required amount in the appropriate solvent with various other ingredients as enumerated above and, as required, followed by filter sterilization.
- the preferred methods of preparation are vacuum drying and freeze-drying techniques, which yield a powder of the active ingredient plus any additional desired ingredient present in the previously sterile-filtered solutions.
- ManA polypeptides of the invention are effective thermostable mannanases.
- the mannanase degrading effects of ManA are achieved by treating biomass at a ratio of about 1 to about 50 of ManA:biomass.
- ManA may be used under extreme conditions, for example, elevated temperatures and acidic pH.
- Treated biomass is degraded into simpler forms of carbohydrates, which is then used in the formation of ethanol or other industrial chemicals, as is known in the art.
- Other methods are envisioned to be within the scope of the present invention, including methods for treating fabrics to remove hemicellulose-containing stains and other methods already discussed.
- ManA polypeptides can be used to degrade the hemicellulose content of a substrate source in the food, feed and paper pulp industries, or alternatively, be used to produce useful oligosaccharides to be added to food and feed as bulking agents or stabilizing agents.
- ManA polypeptides can be used in any known application currently utilizing a mannanases, all of which are within the scope of the present invention. Having generally described the invention, the same will be more readily understood by reference to the following examples, which are provided by way of illustration and are not intended as limiting.
- Genomic DNA was isolated from Acidothermus cellulolyticus and purified by banding on cesium chloride gradients. Genomic DNA was partially digested with Sau 3A and separated on agarose gels. DNA fragments in the range of 9-20 kilobase pairs were isolated from the gels. This purified Sau 3A digested genomic DNA was ligated into the Bam H1 acceptor site of purified EMBL3 lambda phage arms (Clontech, San Diego, Calif.). Phage DNA was packaged according to the manufacturer's specifications and plated with E. coli LE392 in top agar which contained the soluble cellulose analog, carboxymethylcellulose (CMC).
- CMC carboxymethylcellulose
- Template DNA was constructed using a 9 kb BamH1 fragment obtained from the 14.2 kb lambda clone SL3 prepared from Acidothermus cellulolyticus genomic DNA.
- the 9-kb BamHI fragment from SL3 was subcloned into pDR540 to generate a plasmid NREL501.
- NREL501 was first sequenced by the primer walking method as is known in the art.
- NREL501 was then subcloned into pUC19 using restriction enzymes PstI and EcoRI and transformed into E. coli XL1-blue (Stratagene, La Jolla, Calif.) for the production of template DNA for sequencing. Each subclone was sequenced from both forward and reverse directions.
- DNA for sequencing was prepared from an overnight growth in 500 mL LB broth using a megaprep DNA purification kit from Promega.
- the template DNA was PEG precipitated and suspended in de-ionized water and adjusted to a final concentration of 0.25 mg/mL.
- Custom primers were designed by reading upstream known sequence and selecting segments of an appropriate length to function, as is well known in the art. Primers for cycle sequencing were synthesized at the Macromolecular Resources facility located at Colorado State University in Fort Collins, Colo. Typically the sequencing primers were 26-30 nucleotides in length, but were sometimes longer or shorter to accommodate a melting temperature appropriate for cycle sequencing. The sequencing primers were diluted in de-ionized water, the concentration measured using UV absorbance at 260 nm, and then adjusted to a final concentration of 5 pmol/ ⁇ L.
- Templates and sequencing primers were shipped to the Iowa State University DNA Sequencing facility at Ames, Iowa for sequencing using standard chemistries for cycle sequencing. In some cases, regions of the template that sequenced poorly using the standard protocols and dye terminators were repeated with the addition of 2 ⁇ L DMSO and by using nucleotides optimized for the sequencing of high GC content DNA.
- the high frequency of reoccurring small domains, i.e., CBDs and linkers, with high sequence similarity caused initial difficulties in sequence assignments which were only resolved through extensive review of the data and repeated analysis.
- the amino acid sequence represents a novel member of the family of proteins with mannanase activity. Due to the source of isolation from the thermophilic organism Acidothermus, ManA is a novel member of the mannanase family with properties including thermal tolerance. It is also known that thermal tolerant enzymes may have other properties (see definition above).
- ManA Includes a GH5 Catalytic Domain
- Man_Tre Trichoderma reesei beta-mannanase. GeneBank Acc. #11514387 GH5_Ace APAGFVTASGGQFVLNGLPYRYCGTNNYYLSYQ--SHA Ce14a_Abi VSTCFVKASGTRFTLNGQKYTVVGGNSYWVCLTGLSTS Man_Tre RASSFVTISGTQFNTDCKVCYFAGTNCYWCSFLT-NHA :.**. ** :* ::* * * *: . .
- endoglucanase genes include Bacillus polymyxa beta-(1,4) endoglucanase (Baird et al, Journal of Bacteriology, 172: 1576-86 (1992)) Xanthomonas campestris beta-(1,4)-endoglucanase (Gough et al, Gene 89:53-59 (1990)) and Trichoderma harzianum endo-1,3(4)-beta-glucanase (U.S. Pat. No. 6,140,096).
- the result of the fusion of any two or more domains will, upon expression, be a hybrid polypeptide.
- Such hybrid polypeptides can have one or more catalytic or binding domains.
- recombinant techniques may be employed such as the addition of restriction enzyme sites by site-specific mutagenesis. If one is not using one domain of a particular gene, any number of any type of change including complete deletion may be made in the unused domain for convenience of manipulation.
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- General Health & Medical Sciences (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Medicinal Chemistry (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Description
- [0001] The United States Government has rights in this invention under Contract No. DE-AC36-99GO10337 between the United States Department of Energy and the National Renewable Energy Laboratory, a Division of the Midwest Research Institute.
- The invention generally relates to a novel mannanase from Acidothermus cellulolyticus, ManA. More specifically, the invention relates to purified and isolated ManA polypeptides, nucleic acid molecules encoding the polypeptides, and processes for production and use of ManA, as well as variants and derivatives thereof.
- Plant biomass is the most abundant source of carbohydrate in the world due to the lignocellulosic materials comprising the cell walls of all higher plants. Plant cell walls are divided into primary and secondary cell walls. The primary cell wall, which provides structure for expanding cells (and hence changes as the cell grows), is composed of three major polysaccharides, cellulose, hemicellulose and pectin, and one group of glycoproteins. The secondary cell wall, which is produced after the cell has completed growing, also contains polysaccharides and is strengthened through polymeric lignin covalently cross-linked to hemicellulose.
- Hemicellulose is a general term used to refer to cell wall polysaccharides that are not celluloses or pectins. Hemicellulose sugar backbones include a variety of compounds, including xylans, xyloglucans, arabinoxylans and mannans. One of the chief constituents of hemicellulose is the aldohexose glucose, mannose, which also may be in the form of a pyranose ring structure, β-D-mannose. With respect to mannose, the glycosidic linkage is on the 1-carbon as a β-bond, having available linkage sites at the 2-, 3-, 4-, and 6-carbons.
- A particularly rich source of mannans is the hemicellulose content of softwood, and in particular, the waste material from softwood processing in paper manufacturing. One of the more important hemicelluloses in softwood is galactoglucomannan, which is composed of a backbone of β-(1,4)-linked D-mannopyranose and D-glucopyranose in a ratio of approximately 3:1, respectively (Sjostrom, E. (1992) Wood Chemistry, 2nd Ed., Academic Press: New York, N.Y., pp 63-70). Other sources of mannans include the endosperm of capra and ivory palm nuts, guar beans, coffee beans, and roots of konjak ( Amorphorphallus konjac).
- Enzymatic degradation of the β-linkages in β-1,4-D-mannans requires the coordinate action of several mannanases. Mannanases have been identified in Bacillus (Emi et al., (1972) Agr. Biol. Chem. 36:991-1001), Aeromonas (Araki et al., (1983) Agr. Kyushu Univ. 27:89-98), Streptomyces (Takahashi et al., (1984) Biol. Chem. 48:2189-2195) and several fungal species (Hashimoto et al., (1969) J. Nippon Nogeikagaku Kaishi 43:317-322).
- Mannanases are given an Enzyme Commission (EC) designation according to the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (Eur. J. Biochem. 264:607-609 and 610-650 (1999)). β-mannosidase (EC 3.2.1.25) (Hylin et al., (1964) J. Biol. Chem., 239:990) and β-mannanase (EC 3.2.1.78) (Reese, E. T., (1965) Can. J. Microbiol. 11:167) cleave the β-mannoside linkages in β-1,4-D-mannans to yield D-mannose and manno-oligosaccharides, respectively. Other mannanase activities have been identified, for example, exomannanase (1,4-β-D-Mannan mannohydrolase) (EC 3.2.1.xx—unassigned) and exomannobiohydrolase (1,4-β-D-Mannan mannobiohydrolase) (EC 3.2.1.100) (McCleary, B. V., (1988) Methods Enzymol. 160:589-595; Araki et al., (1982) J. Biochem. 91:1181).
- Industrial applications of hemicellulases, and mannanases in particular, are primarily targeted at situations where selective removal of hemicellulose is required to elevate the value of a complex substrate, such as in foods, feeds, and paper pulp. Food industry applications include the processing of coffee (Godfrey, T, (1983) in Industrial Enxymology: The Applications of Enzymes in Industry, Godfrey and Reichelt, eds., MacMillan Press: Basingstoke, UK, pp340-351) the maceration of fruits and vegetables (Biely, P, (1985) Trends Biotechnol. 3:286-290), and bread preparation (Maat et al., (1992) Xylans and Xylanases, Visser, J., Beldman M., Kusters-van Someren and Voragen, eds., Elsevier: New York, N.Y., pp 349-360). Feed industry applications includes the processing of poultry feed (van Paridon et al., (1992) Xylans and Xylanases, Visser, J., Beldman M., Kusters-van Someren and Voragen, eds., Elsevier: New York, N.Y., pp371-378).
- In addition, mannanases can be useful in the production of biofuels from plant biomass, where the mannanases participate in the hydrolysis of the hemicellulose fraction to simpler sugars, which are then converted to ethanol via fermentation.
- Highly thermostable enzymes have been isolated from the thermophile Acidothermus cellulolyticus gen. nov., sp. nov., a bacterium originally isolated from decaying wood in an acidic, thermal pool at Yellowstone National Park (Mohagheghi et al., (1986) Int. J. Systematic Bacteriology 36(3):435-443). One cellulase enzyme produced by this organism, the endoglucanase EI, is known to display maximal activity at 75° C. to 83° C. (Tucker et al., Bio/Technology, 7(8):817-820). E1 endoglucanase has been described in U.S. Pat. No. 5,275,944. The A. cellulolyticus E1 endoglucanase is an active cellulase; in combination with exocellulase CBH I from Trichoderma reesei, E1 gives high levels of saccharification and contributes to a degree of synergism. Baker et al., (1994) Appl. Biochem. Biotechnol. 45/46:245-256. The gene encoding E1 catalytic and cellulose binding domains and linker peptide were described in U.S. Pat. No. 5,536,655. The potential exists for the successful, commercial scale expression of heterologous mannanases, and in particular thermal stable mannanases. Like the E1 endoglucanase, thermal stable mannanases would likely have the desirable characteristic of maximal activity at elevated temperatures, as well as potentially having the thermal tolerant associated properties of resistance to acid inactivation, proteolytic inactivation, and solvent inactivation (Cowan D A in Danson M J et al. (1992) The Archaebacteria, Biochemistry and Biotechnology at 149-159, University Press, Cambridge, ISBN 1855780100). E1 has also been expressed as a stable, active enzyme from a wide variety of hosts, including E. coli, Streptomyces lividans, Pichia pastoris, cotton, tobacco, and Arabidopsis (Dai Z, Hooker B S, Anderson D B, Thomas S R. Transgenic Res. 2000 Feb; 9(1):43-54).
- There is a need within the art to generate alternative mannanase enzymes capable of assisting in the commercial scale processing of mannans to simpler sugars for use in the food, feed, paper pulp and biofuels industries. Against this backdrop the present invention has been developed.
- The present invention provides ManA, a novel member of the glycoside hydrolase (GH) family of enzymes, and in particular a thermal tolerant glycoside hydrolase useful in the degradation of mannans. ManA polypeptides of the invention include those having an amino acid sequence shown in SEQ ID NO: 1, as well as polypeptides having substantial amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 and useful fragments thereof, including, a catalytic domain having significant sequence similarity to the GH5 family, a first carbohydrate binding domain (type II) and a second carbohydrate binding domain (type III).
- The invention also provides a polynucleotide molecule encoding ManA polypeptides and fragments of ManA polypeptides, for example catalytic and carbohydrate binding domains. Polynucleotide molecules of the invention include those molecules having a nucleic acid sequence as shown in SEQ ID NO:2; those that hybridize to the nucleic acid sequence of SEQ ID NO:2 under high stringency conditions; and those having substantial nucleic acid identity with the nucleic acid sequence of SEQ ID NO:2.
- The invention includes variants and derivatives of the ManA polypeptides, including fusion proteins. For example, fusion proteins of the invention include ManA polypeptide fused to a heterologous protein or peptide that confers a desired function. The heterologous protein or peptide can facilitate purification, oligomerization, stabilization, or secretion of the ManA polypeptide, for example. As further examples, the heterologous polypeptide can provide enhanced activity, including catalytic or binding activity, for ManA polypeptides, where the enhancement is either additive or synergistic. A fusion protein of an embodiment of the invention can be produced, for example, from an expression construct containing a polynucleotide molecule encoding ManA polypeptide in frame with a polynucleotide molecule for the heterologous protein. Embodiments of the invention also comprise vectors, plasmids, expression systems, host cells, and the like, containing a ManA polynucleotide molecule. Genetic engineering methods for the production of ManA polypeptides of embodiments of the invention include expression of a polynucleotide molecule in cell free expression systems and in cellular hosts, according to known methods.
- The invention further includes compositions containing a substantially purified ManA polypeptide of the invention and a carrier. Such compositions are administered to a biomass containing mannanase for the reduction or degradation of the mannanase or to produce useful oligosaccharides from hemicellulose.
- The invention also provides reagents, compositions, and methods that are useful for analysis of ManA activity.
- These and various other features as well as advantages which characterize the present invention will be apparent from a reading of the following detailed description and a review of the associated drawings.
- The following Tables 4 and 5 includes sequences used in describing embodiments of the present invention. In Table 4, the abbreviations are as follows: CD, catalytic domain; CBD_II, carbohydrate binding domain type II; CBD_III, carbohydrate binding domain type III; and FN-III, fibronectin domain type III. When used herein, N* indicates a string of unknown nucleic acid units, and X* indicates a string of unknown amino acid units, for example about 50 or more. Table 4 includes approximate start and stop information for segments, and Table 5 includes amino acid sequence data for segments.
TABLE 4 Nucleotide and polypeptide segments. aa aa ManA base base Length, BEGIN END Length, SEQ ID No. SEQ ID No. Segment BEGIN END bp No. aa No. aa aa (amino acid) (nucleotide) Total length 1 2289 2289 1 M 762 S 762 1 2 Signal 1 108 108 1 M 36 A 36 (potential) CD (GH5) 109 1233 1125 37 A 411 G 375 3 CBD III 1363 1824 462 455 V 608 T 154 4 CBD II 1984 2286 303 662 G 762 S 101 5 -
TABLE 5 Gene/polypeptide segments with amino acid sequences. SEQ ID No. SEQ ID No. ManA (amino acid) (nucleotide) Segment segment data 1 2 Total SEQ ID NO:1 (see Table 1): SEQ ID NO:2 (see Table 2) length Signal M GLVRRPARAFVATAAGTAVAAAATLGSITMPSAT A (potential) 3 CD (GH5) A PAGFVTASGGQFVLNGLPYRYGGTNNYYLSYQSHADVDDVLAKAQAMNLSVIRTWGFIDIGSL DGSVPTIDGNGFYFQYWDPSTGAPAYNDGPTGLQGLDYAIASAAAHGLRVIVVLTNDWKEFG GMDQYDKWYGLPYHDNFYTDPRTQQAYKNWVNHLLNRVNSITGVTYKNDPTIFAWELANEPR CVGSGTLPTSGTCTQATIVNWVDQMSAYVKSIDPNHMVSVGDEGFYIGSTQGSGWPYNDPSDGV DNNALLRVKNIDFGTYHLYPNYWGQNADWGTQWIKDHIANAAAIGKPTILEEFGWQTPDRDSV YQTWTQTVRTNGEAGWNFWMLAGNVNGQPYPNYDGENVYYPSSTATVLASEALAIST G 4 CBD III V SGGVKVQYKNNDSAPGDNQIKPGLQLVNTGSSSVDLSTVTVRYWFTRDGGSSTLVYNCDWAA MGCGNIRASFGSVNPATPTADTYLQLSFTGGTLAAGGSTGEIQNRVNKSDWSNFDETNDYSYGT NTAFQDWTKVTVYVNGRLVWGTEPSG T 5 CBD II G VGCRATYVVNSDWGSGFTATVTVTNTGSRATSGWTVAWSFGGNQTVTNYWNTALTQSGASV TATNLSYNNVIQPGQSTTFGFNGSYSGTNTAPTLTCTA S - FIG. 1 is a schematic representation of the gene sequence and amino acid segment organization.
- FIG. 2 is a graphic representation of the glycoside hydrolase gene/protein families found in various organisms.
- Definitions:
- The following definitions are provided to facilitate understanding of certain terms used frequently herein and are not meant to limit the scope of the present disclosure:
- “Amino acid” refers to any of the twenty naturally occuring amino acids as well as any modified amino acid sequences. Modifications may include natural processes such as posttranslational processing, or may include chemical modifications which are known in the art. Modifications include but are not limited to: phosphorylation, ubiquitination, acetylation, amidation, glycosylatioin, covalent attachment of flavin, ADP-ribosylation, cross linking, iodination, methylation, and alike.
- “Antibody” refers to a Y-shaped molecule having a pair of antigen binding sites, a hinge region and a constant region. Fragments of antibodies, for example an antigen binding fragment (Fab), chimeric antibodies, antibodies having a human constant region coupled to a murine antigen binding region, and fragments thereof, as well as other well known recombinant antibodies are included in the present invention.
- “Antisense” refers to polynucleotide sequences that are complementary to target “sense” polynucleotide sequence.
- “Binding activity” refers to any activity that can be assayed by characterizing the ability of a polypeptide to bind to substrate. The substrate can be a carbohydrate polymer such as hemicellulose, including mannan, or can be a complex molecule or aggregate of molecules where the entire moiety comprises at least some carbohydrate.
- “Complementary” or “complementarity” refers to the ability of a polynucleotide in a polynucleotide molecule to form a base pair with another polynucleotide in a second polynucleotide molecule. For example, the sequence A-G-T is complementary to the sequence T-C-A. Complementarity may be partial, in which only some of the polynucleotides match according to base pairing, or complete, where all the polynucleotides match according to base pairing.
- “Expression” refers to transcription and translation occurring within a host cell. The level of expression of a DNA molecule in a host cell may be determined on the basis of either the amount of corresponding mRNA that is present within the cell or the amount of DNA molecule encoded protein produced by the host cell (Sambrook et al., 1989, Molecular cloning: A Laboratory Manual, 18.1-18.88).
- “Fusion protein” refers to a first protein having attached a second, heterologous protein. Preferably, the heterologous protein is fused via recombinant DNA techniques, such that the first and second proteins are expressed in frame. The heterologous protein can confer a desired characteristic to the fusion protein, for example, a detection signal, enhanced stability or stabilization of the protein, facilitated oligomerization of the protein, or facilitated purification of the fusion protein. Examples of heterologous proteins useful in the fusion proteins of the invention include molecules having the catalytic domain of ManA, one or more binding domains of ManA, one or more catalytic domains of a glycoside hydrolase other than ManA, one or more binding domains of a glycoside hydrolase other than ManA, or any combination thereof. Further examples include immunoglobulin molecules and portions thereof, peptide tags such as histidine tag (6-His), leucine zipper, substrate targeting moieties, signal peptides, and the like. Fusion proteins are also meant to encompass variants and derivatives of ManA polypeptides that are generated by conventional site-directed mutagenesis and more modem techniques such as directed evolution, discussed infra.
- “Genetically engineered” refers to any recombinant DNA or RNA method used to create a prokaryotic or eukaryotic host cell that expresses a protein at elevated levels, at lowered levels, or in a mutated form. In other words, the host cell has been transfected, transformed, or transduced with a recombinant polynucleotide molecule, and thereby been altered so as to cause the cell to alter expression of the desired protein. Methods and vectors for genetically engineering host cells are well known in the art; for example various techniques are illustrated in Current Protocols in Molecular Biology, Ausubel et al., eds. (Wiley & Sons, New York, 1988, and quarterly updates). Genetically engineering techniques include but are not limited to expression vectors, targeted homologous recombination and gene activation (see, for example, U.S. Pat. No. 5,272,071 to Chappel) and trans activation by engineered transcription factors (see, for example, Segal et al., 1999, Proc Natl Acad Sci USA 96(6):2758-63).
- “Glycoside hydrolase family” refers to a family of enzymes, which hydrolyze the glycosidic bond between two or more carbohydrates or between a carbohydrate and a non-carbohydrate moiety (Henrissat B., (1991) Biochem. J., 280:309-316). Identification of a putative glycoside hydrolase family member is made based on an amino acid sequence comparison and the finding of significant sequence similarity within the putative member's catalytic domain, as compared to the catalytic domains of known family members.
- “Homology” refers to a degree of complementarity between polynucleotides, having significant effect on the efficiency and strength of hybridization between polynucleotide molecules. The term also can refer to a degree of similarity between polypeptides.
- “Host cell” or “host cells” refers to cells expressing a heterologous polynucleotide molecule. Host cells of the present invention express polynucleotides encoding ManA or a fragment thereof. Examples of suitable host cells useful in the present invention include, but are not limited to, prokaryotic and eukaryotic cells. Specific examples of such cells include bacteria of the genera Escherichia, Bacillus, and Salmonella, as well as members of the genera Pseudomonas, Streptomyces, and Staphylococcus; fungi, particularly filamentous fungi such as Trichoderma and Aspergillus, Phanerochaete chrysosporium, and other white rot fungi; also other fungi including Fusaria, molds and yeast including Saccharomyces sp., and Candida sp. and the like; plants e.g. Arabidopsis, cotton, barley, tobacco, potato, aquatic plants and the like; SF9 insect cells (Summers and Smith, 1987, Texas Agriculture Experiment Station Bulletin, 1555), and the like. Other specific examples include mammalian cells such as human embyonic kidney cells (293 cells), Chinese hamster ovary (CHO) cells (Puck et al., 1958, Proc. Natl. Acad. Sci. USA 60, 1275-1281), human cervical carcinoma cells (HELA) (ATCC CCL 2), human liver cells (Hep G2) (ATCC HB8065), human breast cancer cells (MCF-7) (ATCC HTB22), human colon carcinoma cells (DLD-1) (ATCC CCL 221), Daudi cells (ATCC CRL-213), murine myeloma cells such as P3/NSI/1-Ag4-1 (ATCC TIB-18), P3X63Ag8 (ATCC TIB-9), SP2/0-Ag14 (ATCC CRL-1581) and the like.
- “Hybridization” refers to the pairing of complementary polynucleotides during an annealing period. The strength of hybridization between two polynucleotide molecules is impacted by the homology between the two molecules, stringency of the conditions involved, the melting temperature of the formed hybrid and the G:C ratio within the polynucleotides.
- “Identity” refers to a comparison between pairs of nucleic acid or amino acid molecules. Methods for determining sequence identity are known. See, for example, computer programs commonly employed for this purpose, such as the Gap program (Wisconsin Sequence Analysis Package,
Version 8 for Unix, Genetics Computer Group, University Research Park, Madison Wis.), that uses the algorithm of Smith and Waterman, 1981, Adv. Appl. Math., 2: 482-489. - “Isolated” refers to a polynucleotide or polypeptide that has been separated from at least one contaminant (polynucleotide or polypeptide) with which it is normally associated. For example, an isolated polynucleotide or polypeptide is in a context or in a form that is different from that in which it is found in nature.
- “Mannanase activity” refers to any activity that can be assayed by characterizing the enzymatic activity of a mannanase. For example, mannanase activity can be assayed by determining how much reducing sugar is produced during a fixed amount of time for a set amount of enzyme acting on mannan (see Irwin et al., (1998) J. Bacteriology, 1709-1714). Other assays are well known in the art and can be substituted, for example, by applying a solution to be tested for mannanase to a 1-4 mm diameter hole punched out in agar plates containing 0.2% AZCL galactomannan or other target mannan substrate.
- “Nucleic acid sequence” refers to the order or sequence of deoxyribonucleotides along a strand of deoxyribonucleic acid. The order of these deoxyribonucleotides determines the order of amino acids along a polypeptide chain. The deoxyribonucleotide sequence thus codes for the amino acid sequence.
- “Polynucleotide” refers to a linear sequence of nucleotides. The nucleotides may be ribonucleotides, or deoxyribonucleotides, or a mixture of both. Examples of polynucleotides in the context of the present invention include single and double stranded DNA, single and double stranded RNA, and hybrid molecules having mixtures of single and double stranded DNA and RNA. The polynucleotides of the present invention may contain one or more modified nucleotides.
- “Protein,” “peptide,” and “polypeptide” are used interchangeably to denote an amino acid polymer or a set of two or more interacting or bound amino acid polymers.
- “Purify,” or “purified” refers to a target protein that is free from at least 5-10% of contaminating proteins. Purification of a protein from contaminating proteins can be accomplished using known techniques, including ammonium sulfate or ethanol precipitation, acid precipitation, heat precipitation, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography, size-exclusion chromatography, and lectin chromatography. Various protein purification techniques are illustrated in Current Protocols in Molecular Biology, Ausubel et al., eds. (Wiley & Sons, New York, 1988, and quarterly updates).
- “Selectable marker” refers to a marker that identifies a cell as having undergone a recombinant DNA or RNA event. Selectable markers include, for example, genes that encode antimetabolite resistance such as the DHFR protein that confers resistance to methotrexate (Wigler et al, 1980, Proc Natl Acad Sci USA 77:3567; O'Hare et al., 1981, Proc Natl Acad Sci USA, 78:1527), the GPT protein that confers resistance to mycophenolic acid (Mulligan & Berg, 1981, PNAS USA, 78:2072), the neomycin resistance marker that confers resistance to the aminoglycoside G-418 (Calberre-Garapin et al., 1981, J. Mol Biol, 150:1), the Hygro protein that confers resistance to hygromycin (Santerre et al., 1984, Gene 30:147), and the Zeocin™ resistance marker (Invitrogen). In addition, the herpes simplex virus thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase and adenine phosphoribosyltransferase genes can be employed in tk−, hgprt− and aprt− cells, respectively.
- “Stringency” refers to the conditions (temperature, ionic strength, solvents, etc) under which hybridization between polynucleotides occurs. A hybridzation reaction conducted under high stringency conditions is one that will only occur between polynucleotide molecules that have a high degree of complementary base pairing (85% to 100% identity). Conditions for high stringency hybridization, for example, may include an overnight incubation at about 42° C. for about 2.5 hours in 6×SSC/0.1% SDS, followed by washing of the filters in 1.0×SSC at 65° C., 0.1% SDS. A hybridization reaction conducted under moderate stringency conditions is one that will occur between polynucleotide molecules that have an intermediate degree of complementary base pairing (50% to 84% identity).
- “Substrate targeting moiety” refers to any signal on a substrate, either naturally occurring or genetically engineered, used to target any ManA polypeptide or fragment thereof to a substrate. Such targeting moieties include ligands that bind to a substrate structure. Examples of ligand/receptor pairs include carbohydrate binding domains and mannans. Many such substrate-specific ligands are known and are useful in the present invention to target a ManA polypeptide or fragment thereof to a substrate. A novel example is a ManA carbohydrate binding domain that is used to tether other molecules to a Mannan-containing substrate such as a fabric.
- “Thermal tolerant” refers to the property of withstanding partial or complete inactivation by heat and can also be described as thermal resistance or thermal stability. Although some variation exists in the literature, the following definitions can be considered typical for the optimum temperature range of stability and activity for enzymes: psycrophilic (below freezing to 10° C.); mesophilic (10° C. to 50° C.); thermophilic (50° C. to 75° C.); and caldophilic (75° C. to above boiling water temperature). The stability and catalytic activity of enzymes are linked characteristics, and the ways of measuring these properties vary considerably. For industrial enzymes, stability and activity are best measured under use conditions, often in the presence of substrate. Therefore, mannanases that must act on process streams of mannans must be able to withstand exposure up to thermophilic or even caldophilic temperatures for digestion times in excess of several hours.
- In encompassing a wide variety of potential applications for embodiments of the present invention, thermal tolerance refers to the ability to function in a temperature range of from about 15° C. to about 100° C. A preferred range is from about 30° C. to about 80° C. A highly preferred range is from about 50° C. to about 70° C. For example, a protein that can function at about 45° C. is considered in the preferred range even though it may be susceptible to partial or complete inactivation at temperatures in a range above about 45° C. and less than about 80° C. For polypeptides derived from organisms such as Acidothermus, the desirable property of thermal tolerance among is often accompanied by other desirable characteristics such as: resistance to extreme pH degradation, resistance to solvent degradation, resistance to proteolytic degradation, resistance to detergent degradation, resistance to oxidizing agent degradation, resistance to chaotropic agent degradation, and resistance to general degradation. Cowan D A in Danson M J et al. (1992) The Archaebacteria, Biochemistry and Biotechnology at 149-159, University Press, Cambridge, ISBN 1855780100. Here ‘resistance’ is intended to include any partial or complete level of residual activity. When a polypeptide is described as thermal tolerant it is understood that any one, more than one, or none of these other desirable properties can be present.
- “Variant”, as used herein, means a polynucleotide or polypeptide molecule that differs from a reference molecule. Variants can include nucleotide changes that result in amino acid substitutions, deletions, fusions, or truncations in the resulting variant polypeptide when compared to the reference polypeptide.
- “Vector,” “extra-chromosomal vector” or “expression vector” refers to a first polynucleotide molecule, usually double-stranded, which may have inserted into it a second polynucleotide molecule, for example a foreign or heterologous polynucleotide. The heterologous polynucleotide molecule may or may not be naturally found in the host cell, and may be, for example, one or more additional copy of the heterologous polynucleotide naturally present in the host genome. The vector is adapted for transporting the foreign polynucleotide molecule into a suitable host cell. Once in the host cell, the vector may be capable of integrating into the host cell chromosomes. The vector may optionally contain additional elements for selecting cells containing the integrated polynucleotide molecule as well as elements to promote transcription of mRNA from transfected DNA. Examples of vectors useful in the methods of the present invention include, but are not limited to, plasmids, bacteriophages, cosmids, retroviruses, and artificial chromosomes.
- Within the application, unless otherwise stated, the techniques utilized may be found in any of several well-known references, such as: Molecular Cloning: A Laboratory Manual (Sambrook et al. (1989) Molecular cloning: A Laboratory Manual), Gene Expression Technology (Methods in Enzymology, Vol. 185, edited by D. Goeddel, 1991 Academic Press, San Diego, Calif.), “Guide to Protein Purification” in Methods in Enzymology (M. P. Deutshcer, 3d., (1990) Academic Press, Inc.), PCR Protocols: A Guide to Methods and Applications (Innis et al. (1990) Academic Press, San Diego, Calif.), Culture of Animal Cells: A Manual of Basic Technique, 2nd ed. (R. I. Freshney (1987) Liss, Inc., New York, N.Y.), and Gene Transfer and Expression Protocols, pp 109-128, ed. E. J. Murray, The Humana Press Inc., Clifton, N.J.).
- O-Glycoside Hydrolases
- Glycoside hydrolases are a large and diverse family of enzymes that hydrolyze the glycosidic bond between two carbohydrate moieties or between a carbohydrate and non-carbohydrate moiety (See FIG. 2). Glycoside hydrolase enzymes are classified into glycoside hydrolase (GH) families based on significant amino acid similarities within their catalytic domains, as compared to the catalytic domain of known family members. Enzymes having related catalytic domains are grouped together within a family (Henrissat et al., (1991) supra; Henrissat et al., (1996), Biochem. J. 316:695-696), where the underlying classification provides a direct relationship between the GH domain amino acid sequence and how the GH domain will fold. This information ultimately provides a common mechanism for how the enzyme will hydrolyze the glycosidic bond within a substrate, i.e., either by a retaining mechanism or inverting mechanism (Henrissat B., (1991) supra).
- Mannanases belong to the GH family of enzymes. Mannanases are produced by a variety of bacteria and fungi to degrade the β-1,4 linkages in mannans, glucomannans, galactomannans, and galactoglucomannans and to so produce oligosaccharides. At present, mannanases are found within either the GH5 or GH26 family of glycoside hydrolases (Hilge et al., (1998) Structure 6(11):1433-1444).
- Mannanases are characterized by having a multiple domain unit within their overall structure, a GH or catalytic domain is joined to a carbohydrate binding type domain (CBD) by a glycosylated linker peptide (see FIG. 1) (Koivula et al., (1996) Protein Expression and Purification 8:391-400). The catalytic domain hydrolysis the mannan, the CBD type domain increases the concentration of the enzyme on the substrate, in this case hemicellulose, and the linker peptide provides flexibility for both larger domains.
- Conversion of hemicellulose to oligosaccharides by mannanases elevates the value of the complex substrate, such as in foods, feeds and paper pulp. For example, mannan polymers from the hemicellulose fraction of softwood are known to contaminate the cellulose fibers in paper pulp. Addition of a mannanases to the paper pulp can reduce the amounts of these contaminants and provide a higher quality product.
- In addition, mannanase released oligosaccharides from hemicellulose may be used as bulking agents or stabilizers, for example mannan-oligomers released from palm seed mannan, in food or feeds.
- Finally, mannanases can be useful in the production of biofuels from plant biomass, where the mannanases participate in the hydrolysis of the hemicellulose fraction to oligosaccharides, which can be further reduced to sugars and converted to ethanol via fermentation.
- ManA:
- As described more fully in the Examples below, ManA, a novel thermostable mannanase, has now been identified and characterized. The predicted amino acid sequence of ManA (SEQ ID NO:1) has an organization characteristic of a mannanase enzyme. ManA contains a GH5 catalytic domain (about amino acid 37 to 411)-linker domain-carbohydrate binding type domain (about amino acid 455 to 608) organization, as well as a second carbohydrate binding type domain (about amino acid 662 to 762). As discussed in more detail below, significant amino acid similarity of ManA to other mannanases identifies ManA as a mannanase.
- ManA, as noted above, has a catalytic domain belonging to the GH5 family of glycoside hydrolases. The GH5 domain family includes a number of β-mannanases, for example, β-mannanase isolated from Agaricus bisporus, and β-mannanase isolated from Trichoderma reesei (Hypocrea jecorina). The GH5 members degrade substrate using a retaining mechanism.
- Being a mannanase member of the GH5 family of glycoside hydrolases identifies ManA as having β-mannanase (EC 3.2.1.78) activity. In addition, the predicted amino acid sequence (SEQ ID NO: 1) indicates that CBD type II and CBD type II domains are present as characterized by Tomme P. et al. (1995), in Enzymatic Degradation of Insoluble Polysaccharides (Saddler J N & Penner M, eds.), at 142-163, American Chemical Society, Washington. See also Tomme, P. & Claeyssens, M. (1989) FEBS Lett. 243, 239-2431; Gilkes, N. R et al., (1988) J.Biol.Chem. 263, 10401-10407.
- ManA is also a thermostable mannanase as it is produced by the thermophile Acidothermus cellulolyticus. ManA can have other thermostable associated characteristics—for example, resistance to acidity, resistance to protein degredation, and the like (Cowan D., (1992) supra). Like other members of the mannanase family, and in particular thermostable mannanases, ManA is useful in converting hemicellulose to oligosaccharides and thereby elevating the value of the complex substrate, for example in foods, feeds and paper pulp. Oligosaccharides produced by ManA may also be used as a bulking agent or stabilizer in foods and feeds. In addition, ManA is useful in the conversion of biofuels from biomass, and in particular, biofuels from hemicellulose. It is envisioned that ManA could be used alone or in combination with one or more other mannanase or other relevant glycoside hydrolase to perform the uses described herein or known within the relevant art, all of which are within the scope of the present disclosure.
- ManA Polypeptides:
- ManA polypeptides of the invention include isolated polypeptides having an amino acid sequence as shown below in Example 1; Table 1 and in SEQ ID NO:1, as well as variants and derivatives, including fragments, having substantial identity to the amino acid sequence of SEQ ID NO:1 and that retain any of the functional activities of ManA. ManA polypeptide activity can be determined, for example, by subjecting the variant, derivative, or fragment to a substrate binding assay or a mannanase activity assay such as those described for cellulases in Irwin D et al., J. Bacteriology 180(7): 1709-1714 (April 1998) or U.S. Pat. No. 6,060,299.
TABLE 1 ManA amino acid sequence (SEQ ID NO:1) MGLVRRPARAFVATAAGTAVAAAATLGSITMPSATAAPAGFVTASGGQFV LNGLPYRYGGTNNYYLSYQSHADVDDVLAKAQAMNLSVIRTWGFIDIGSL DGSVPTIDGNKNGFYFQYWDPSTGAPAYNDGPTGLQGLDYAIASAAAHGL RVIVVLTNDWKEFGGMDQYDKWYGLPYHDNFYTDPRTQQAYKNWVNHLLN RVNSITGVTYKNDPTIFAWELANEPRCVGSGTLPTSGTCTQATIVNWVDQ MSAYVKSIDPNHMVSVGDEGFYIGSTQGSGWPYNDPSDGVDNNALLRVKN IDFGTYHLYPNYWGQNADWGTQWIKDHIANAAAIGKPTILEEFGWQTPDR DSVYQTWTQTVRTNGEAGWNFWMLAGNVNGQPYPNYDGFNVYYPSSTATV LASEALAISTGTSPPPSPSSSPSSSPSPSPSPSASPSASPSASSSPSPSP SSSPVSGGVKVQYKNNDSAPGDNQIKPGLQLVNTGSSSVDLSTVTVRYWF TRDGGSSTLVYNCDWAAMGCGNIRASFGSVNPATPTADTYLQLSFTGGTL AAGGSTGEIQNRVNKSDWSNFDETNDYSYGTNTAFQDWTKVTVYVNGRLV WGTEPSGTSPSPTPSPSPTPSPSPSPTPSPSSSPSPSPSPSPSPTPSPSP SPSPSPSVSSSGVGCRATYVVNSDWGSGFTATVTVTNTGSRATSGWTVAW SFGGNQTVTNYWNTALTQSGASVTATNLSYNNVIQPGQSTTFGFNGSYSG TNTAPTLTCTAS - As listed and described in Tables 1 and 4, the isolated ManA polypeptide includes an N-terminal hydrophobic region that functions as a signal peptide, having an amino acid sequence that begins with M1 and extends to approximately A36; a catalytic domain having significant sequence similarity to a GH5 family domain that begins at about A37 and extends to about G411, a carbohydrate binding domain type III region that begins at about V455 and extends to about T608, and a carbohydrate binding domain type II that begins at about G662 and extends to about S762. Variants and derivatives of ManA include, for example, ManA polypeptides modified by covalent or aggregative conjugation with other chemical moieties, such as glycosyl groups, polyethylene glycol (PEG) groups, lipids, phosphate, acetyl groups, and the like.
- The amino acid sequence of ManA polypeptides of the invention is preferably at least about 60% identical, more preferably at least about 70% identical, or in some embodiments at least about 90% identical, to the ManA amino acid sequence shown above in Table 1 and SEQ ID NO:1. The percentage identity, also termed homology (see definition above) can be readily determined, for example, by comparing the two polypeptide sequences using any of the computer programs commonly employed for this purpose, such as the Gap program (Wisconsin Sequence Analysis Package,
Version 8 for Unix, Genetics Computer Group, University Research Park, Madison Wis.), which uses the algorithm of Smith and Waterman, 1981, Adv. Appl. Math. 2: 482-489. - Variants and derivatives of the ManA polypeptide may further include, for example, fusion proteins formed of a ManA polypeptide and a heterologous polypeptide. Preferred heterologous polypeptides include those that facilitate purification, oligomerization, stability, or secretion of the ManA polypeptides.
- Fragments of the ManA polypeptide may include, but are not limited to, the GH5 catalytic domain (SEQ ID NO:3), the carbohydrate binding domain type III (SEQ ID NO:4) and the carbohydrate binding domain type II (SEQ ID NO:5).
- ManA polypeptide variants and derivatives, as used in the description of the invention, can contain conservatively substituted amino acids, meaning that one or more amino acid can be replaced by an amino acid that does not alter the secondary and/or tertiary structure of the polypeptide. Such substitutions can include the replacement of an amino acid, by a residue having similar physicochemical properties, such as substituting one aliphatic residue (Ile, Val, Leu, or Ala) for another, or substitutions between basic residues Lys and Arg, acidic residues Glu and Asp, amide residues Gln and Asn, hydroxyl residues Ser and Tyr, or aromatic residues Phe and Tyr. Phenotypically silent amino acid exchanges are described more fully in Bowie et al., 1990, Science 247:1306-1310. In addition, functional ManA polypeptide variants include those having amino acid substitutions, deletions, or additions to the amino acid sequence outside functional regions of the protein, for example, outside the catalytic and carbohydrate binding domains. These would include, for example, the various linker sequences that connect functional domains as defined herein.
- The ManA polypeptides of the present invention are preferably provided in an isolated form, and preferably are substantially purified. The polypeptides may be recovered and purified from recombinant cell cultures by known methods, including, for example, ammonium sulfate or ethanol precipitation, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography, and lectin chromatography. Preferably, high performance liquid chromatography (HPLC) is employed for purification.
- Another preferred form of ManA polypeptides is that of recombinant polypeptides as expressed by suitable hosts. Furthermore, the hosts can simultaneously produce other mannanases or glycoside hydrolases such that a mixture is produced comprising a ManA polypeptide and one or more other glycoside hydrolases. Such a mixture can be effective in crude fermentation processing or other industrial processing (see below).
- ManA polypeptides can be fused to heterologous polypeptides to facilitate purification. Many available heterologous peptides (peptide tags) allow selective binding of the fusion protein to a binding partner. Non-limiting examples of peptide tags include 6-His, thioredoxin, hemaglutinin, GST, and the OmpA signal sequence tag. A binding partner that recognizes and binds to the heterologous peptide can be any molecule or compound, including metal ions (for example, metal affinity columns), antibodies, antibody fragments, or any protein or peptide that preferentially binds the heterologous peptide to permit purification of the fusion protein.
- ManA polypeptides can be modified to facilitate formation of ManA oligomers. For example, ManA polypeptides can be fused to peptide moieties that promote oligomerization, such as leucine zippers and certain antibody fragment polypeptides, for example, Fc polypeptides. Techniques for preparing these fusion proteins are known, and are described, for example, in WO 99/31241 and in Cosman et.al., 2001 Immunity 14:123-133. Fusion to an Fc polypeptide offers the additional advantage of facilitating purification by affinity chromatography over Protein A or Protein G columns. Fusion to a leucine-zipper (LZ), for example, a repetitive heptad repeat, often with four or five leucine residues interspersed with other amino acids, is described in Landschultz et al., 1988, Science, 240:1759.
- It is also envisioned that an expanded set of variants and derivatives of ManA polynucleotides and/or polypeptides can be generated to select for useful molecules, where such expansion is achieved not only by conventional methods such as site-directed mutagenesis (SDM) but also by more modem techniques, either independently or in combination.
- Site-directed-mutagenesis is considered an informational approach to protein engineering and can rely on high-resolution crystallographic structures of target proteins and some stratagem for specific amino acid changes (Van Den Burg, B.; Vriend, G.; Veltman, O. R.; Venema, G.; Eijsink, V. G. H. Proc. Nat. Acad. Sci. U.S. 1998, 95, 2056-2060). For example, modification of the amino acid sequence of ManA polypeptides can be accomplished as is known in the art, such as by introducing mutations at particular locations by oligonucleotide-directed mutagenesis (Walder et al.,1986, Gene, 42:133; Bauer et al., 1985, Gene 37:73; Craik, 1985, BioTechniques, 12-19; Smith et al., 1981, Genetic Engineering: Principles and Methods, Plenum Press; and U.S. Pat. No. 4,518,584 and U.S. Pat. No. 4,737,462). SDM technology can also employ the recent advent of computational methods for identifying site-specific changes for a variety of protein engineering objectives (Hellinga, H. W. Nature Structural. Biol. 1998, 5, 525-527).
- The more modern techniques include, but are not limited to, non-informational mutagenesis techniques (referred to generically as “directed evolution”). Directed evolution, in conjunction with high-throughput screening, allows testing of statistically meaningful variations in protein conformation (Arnold, F. H. Nature Biotechnol. 1998, 16, 617-618). Directed evolution technology can include diversification methods similar to that described by Crameri A. et al. (1998, Nature 391: 288-291), site-saturation mutagenesis, staggered extension process (StEP) (Zhao, H.; Giver, L.; Shao, Z.; Affholter, J. A.; Arnold, F. H. Nature Biotechnol. 1998, 16, 258-262), and DNA synthesis/reassembly (U.S. Pat. No. 5,965,408).
- Fragments of the ManA polypeptide can be used, for example, to generate specific anti-ManA antibodies. Using known selection techniques, specific epitopes can be selected and used to generate monoclonal or polyclonal antibodies. Such antibodies have utlilty in the assay of ManA activity as well as in purifying recombinant ManA polypeptides from genetically engineered host cells.
- ManA Polynucleotides:
- The invention also provides polynucleotide molecules encoding the ManA polypeptides discussed above. ManA polynucleotide molecules of the invention include polynucleotide molecules having the nucleic acid sequence shown in Table 2 and SEQ ID NO:2, polynucleotide molecules that hybridize to the nucleic acid sequence of Table 2 and SEQ ID NO:2 under high stringency hybridization conditions (for example, 42°, 2.5 hr., 6× SCC, 0.1%SDS); and polynucleotide molecules having substantial nucleic acid sequence identity with the nucleic acid sequence of Table 2 and SEQ ID NO:2, particularly with those nucleic acids encoding the catalytic domain, GH5 (from amino acid 37 to 411), the carbohydrate binding domain III (from amino acid 455 to 608) and carbohydrate binding domain II (from amino acid 662 to 762).
TABLE 2 ManA nucleotide sequence. (SEQ ID NO:2) ATGGGTCTAGTGCGTCGCCCTGCGCGAGCATTTGTTGCGACCGCGGCCGG CACTGCCGTTGCTGCCGCGGCGACGCTCGGCTCAATCACCATGCCGTCAG CCACGGCAGCGCCGGCGGGATTCGTCACCGCATCCGGCGGTCAGTTCGTT CTGAACGGCCTTCCCTATCGTTACGGGGGAACGAACAACTATTACCTCAG CTATCAGTCGCACGCCGACGTCGATGACGTGTTGGCCAAGGCTCAAGCGA TGAATCTTTCTGTCATCCGGACCTGGGGTTTCATCGACATCGGCTCTCTT GACGGCTCCGTGCCCACAATCGATGGCAACAAGAACGGCTTCTACTTTCA GTACTGGGACCCGTCGACCGGCGCTCCGGCGTACAACGACGGGCCGACCG GCTTGCAAGGCCTTGACTACGCGATCGCGAGCGCGGCCGCGCACGGCCTT CGGGTGATTGTCGTCCTCACCAACGACTGGAAAGAATTTGGGGGAATGGA TCAATACGACAAGTGGTACGGCCTTCCTTACCACGACAACTTCTACACCG ACCCCCGGACCCAGCAGGCGTACAAGAATTGGGTCAATCATCTACTGAAC CGGGTCAACAGCATTACCGGCGTGACGTACAAGAACGATCCAACGATCTT TGCTTGGGAACTTGCCAATGAGCCGCGCTGCGTAGGAAGCGGCACATTAC CAACCTCGGGCACGTGCACTCAGGCGACCATTGTCAACTGGGTCGATCAA ATGTCGGCGTACGTCAAAAGCATAGACCCTAACCATATGGTCTCGGTCGG CGACGAAGGGTTCTACATTGGGTCAACGCAGGGAAGCGGCTGGCCATACA ACGACCCGTCCGACGGCGTCGACAACAATGCTCTTCTCCGTGTCAAGAAC ATTGACTTTGGCACGTATCACCTGTACCCGAATTACTGGGGCCAGAACGC GGACTGGGGAACGCAATGGATCAAGGATCATATTGCGAATGCCGCAGCGA TCGGCAAGCCGACCATTCTCGAAGAATTCGGCTGGCAGACACCGGACCGC GATTCCGTCTATCAGACGTGGACCCAGACTGTGCGTACGAACGGTGAAGC AGGCTGGAACTTCTGGATGCTCGCTGGGAATGTCAACGGCCAGCCATATC CGAACTATGACGGCTTCAACGTCTACTACCCAAGTTCAACAGCGACCGTC CTCGCCAGCGAGGCGCTCGCAATCAGTACCGGCACATCGCCTCCGCCGTC GCCGAGCTCGAGTCCATCCTCGTCGCCGTCTCCGTCGCCGTCTCCGTCGG CGTCTCCGTCGGCGTCTCCGTCGGCGTCTTCGTCGCCGAGCCCGTCTCCG TCGTCGTCGCCGGTGTCGGGTGGGGTGAAGGTGCAGTACAAGAACAATGA TTCGGCGCCGGGTGATAACCAGATCAAACCGGGTCTCCAGTTGGTGAATA CGGGGTCGTCGTCGGTGGATTTGTCGACGGTGACGGTGCGGTACTGGTTC ACCCGGGATGGTGGGTCGTCGACACTGGTGTACAACTGTGACTGGGCGGC GATGGGGTGTGGGAATATCCGCGCCTCGTTCGGCTCGGTGAACCCGGCGA CGCCGACGGCGGACACCTACCTGCAGTTGTCGTTCACTGGTGGAACGTTG GCCGCTGGTGGGTCGACGGGTGAGATTCAAAACCGGGTGAATAAGAGTGA CTGGTCGAACTTTGATGAGACCAATGACTACTCGTATGGGACGAACACCG CCTTCCAGGATTGGACGAAGGTGACGGTGTATGTCAATGGCCGGCTGGTG TGGGGGACTGAACCGTCCGGCACCAGCCCCAGCCCCACACCCAGCCCCAG CCCAACCCCGTCCCCGAGCCCGAGCCCGACCCCAAGCCCCAGCTCCTCCC CATCCCCGTCCCCGAGCCCCAGCCCCAGCCCTACGCCGTCCCCGTCGCCG AGCCCGTCGCCGTCGCCGAGTGTGTCGTCGTCGGGTGTGGGGTGCCGGGC GACGTATGTGGTGAATAGTGATTGGGGTTCTGGGTTTACGGCGACGGTGA CGGTGACGAATACCGGGAGCCGGGCGACGAGCGGGTGGACGGTGGCGTGG TCGTTTGGTGGGAATCAGACGGTCACGAACTACTGGAACACTGCGTTGAC CCAATCAGGTGCATCGGTGACGGCGACGAACCTGAGCTACAACAACGTGA TCCAACCGGGTCAGTCGACCACCTTCGGATTCAACGGAAGTTACTCAGGA ACAAACACCGCACCTACACTCACCTGCACGGCTAGTTGA - The ManA polynucleotide molecules of the invention are preferably isolated molecules encoding the ManA polypeptide having an amino acid sequence as shown in Table 1 and SEQ ID NO:1, as well as derivatives, variants, and useful fragments of the ManA polynucleotide. The ManA polynucleotide sequence can include deletions, substitutions, or additions to the nucleic acid sequence of Table 2 and SEQ ID NO:2.
- The ManA polynucleotide molecule of the invention can be cDNA, chemically synthesized DNA, DNA amplified by PCR, RNA, or combinations thereof. Due to the degeneracy of the genetic code, two DNA sequences may differ and yet encode identical amino acid sequences. The present invention thus provides an isolated polynucleotide molecule having a ManA nucleic acid sequence encoding ManA polypeptide, where the nucleic acid sequence encodes a polypeptide having the complete amino acid sequences as shown in Table 1 and SEQ ID NO:1, or variants, derivatives, and fragments thereof.
- The ManA polynucleotides of the invention have a nucleic acid sequence that is at least about 60% identical to the nucleic acid sequence shown in Table 2 and SEQ ID NO:2, in some embodiments at least about 70% identical to the nucleic acid sequence shown in Table 2 and SEQ ID NO:2, and in other embodiments at least about 90% identical to the nucleic acid sequence shown in Table 2 and SEQ ID NO:2. Nucleic acid sequence identity is determined by known methods, for example by aligning two sequences in a software program such as the BLAST program (Altschul, S. F et al. (1990) J. Mol. Biol. 215:403-410, from the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/BLAST/).
- The ManA polynucleotide molecules of the invention also include isolated polynucleotide molecules having a nucleic acid sequence that hybridizes under high stringency conditions (as defined above) to a the nucleic acid sequence shown in Table 2 and SEQ ID NO:2. Hybridization of the polynucleotide is to at least about 15 contiguous nucleotides, or at least about 20 contiguous nucleotides, and in other embodiments at least about 30 contiguous nucleotides, and in still other embodiments at least about 100 contiguous nucleotides of the nucleic acid sequence shown in Table 2 and SEQ ID NO:2.
- Useful fragments of the ManA-encoding polynucleotide molecules described herein, include probes and primers. Such probes and primers can be used, for example, in PCR methods to amplify and detect the presence of ManA polynucleotides in vitro, as well as in Southern and Northern blots for analysis of ManA. Cells expressing the ManA polynucleotide molecules of the invention can also be identified by the use of such probes. Methods for the production and use of such primers and probes are known. For PCR, 5′ and 3′ primers corresponding to a region at the termini of the ManA polynucleotide molecule can be employed to isolate and amplify the ManA polynucleotide using conventional techniques.
- Other useful fragments of the ManA polynucleotides include antisense or sense oligonucleotides comprising a single-stranded nucleic acid sequence capable of binding to a target ManA mRNA (using a sense strand), or DNA (using an antisense strand) sequence.
- Vectors and Host Cells:
- The present invention also provides vectors containing the polynucleotide molecules of the invention, as well as host cells transformed with such vectors. Any of the polynucleotide molecules of the invention may be contained in a vector, which generally includes a selectable marker and an origin of replication, for propagation in a host. The vectors further include suitable transcriptional or translational regulatory sequences, such as those derived from a mammalian, microbial, viral, or insect genes, operably linked to the ManA polynucleotide molecule. Examples of such regulatory sequences include transcriptional promoters, operators, or enhancers, mRNA ribosomal binding sites, and appropriate sequences which control transcription and translation. Nucleotide sequences are operably linked when the regulatory sequence functionally relates to the DNA encoding the target protein. Thus, a promoter nucleotide sequence is operably linked to a ManA DNA sequence if the promoter nucleotide sequence directs the transcription of the ManA sequence.
- Selection of suitable vectors for the cloning of ManA polynucleotide molecules encoding the target ManA polypeptides of this invention will depend upon the host cell in which the vector will be transformed, and, where applicable, the host cell from which the target polypeptide is to be expressed. Suitable host cells for expression of ManA polypeptides include prokaryotes, yeast, and higher eukaryotic cells, each of which is discussed below.
- The ManA polypeptides to be expressed in such host cells may also be fusion proteins that include regions from heterologous proteins. As discussed above, such regions may be included to allow, for example, secretion, improved stability, or facilitated purification of the ManA polypeptide. For example, a nucleic acid sequence encoding an appropriate signal peptide can be incorporated into an expression vector. A nucleic acid sequence encoding a signal peptide (secretory leader) may be fused in-frame to the ManA sequence so that ManA is translated as a fusion protein comprising the signal peptide. A signal peptide that is functional in the intended host cell promotes extracellular secretion of the ManA polypeptide. Preferably, the signal sequence will be cleaved from the ManA polypeptide upon secretion of ManA from the cell. Non-limiting examples of signal sequences that can be used in practicing the invention include the yeast I-factor and the honeybee melatin leader in Sf9 insect cells.
- Suitable host cells for expression of target polypeptides of the invention include prokaryotes, yeast, and higher eukaryotic cells. Suitable prokaryotic hosts to be used for the expression of these polypeptides include bacteria of the genera Escherichia, Bacillus, and Salmonella, as well as members of the genera Pseudomonas, Streptomyces, and Staphylococcus. For expression in prokaryotic cells, for example, in E. coli, the polynucleotide molecule encoding ManA polypeptide preferably includes an N-terminal methionine residue to facilitate expression of the recombinant polypeptide. The N-terminal Met may optionally be cleaved from the expressed polypeptide.
- Expression vectors for use in prokaryotic hosts generally comprise one or more phenotypic selectable marker genes. Such genes encode, for example, a protein that confers antibiotic resistance or that supplies an auxotrophic requirement. A wide variety of such vectors are readily available from commercial sources. Examples include pSPORT vectors, pGEM vectors (Promega, Madison, Wis.), pPROEX vectors (LTI, Bethesda, Md.), Bluescript vectors (Stratagene), and pQE vectors (Qiagen).
- ManA can also be expressed in yeast host cells from genera including Saccharomyces, Pichia, and Kluveromyces. Preferred yeast hosts are S. cerevisiae and P. pastoris. Yeast vectors will often contain an origin of replication sequence from a 2T yeast plasmid, an autonomously replicating sequence (ARS), a promoter region, sequences for polyadenylation, sequences for transcription termination, and a selectable marker gene. Vectors replicable in both yeast and E. coli (termed shuttle vectors) may also be used. In addition to the above-mentioned features of yeast vectors, a shuttle vector will also include sequences for replication and selection in E. coli. Direct secretion of the target polypeptides expressed in yeast hosts may be accomplished by the inclusion of nucleotide sequence encoding the yeast I-factor leader sequence at the 5′ end of the ManA-encoding nucleotide sequence.
- Insect host cell culture systems can also be used for the expression of ManA polypeptides. The target polypeptides of the invention are preferably expressed using a baculovirus expression system, as described, for example, in the review by Luckow and Summers, 1988 Bio/Technology 6:47.
- The choice of a suitable expression vector for expression of ManA polypeptides of the invention will depend upon the host cell to be used. Examples of suitable expression vectors for E. coli include pET, pUC, and similar vectors as is known in the art. Preferred vectors for expression of the ManA polypeptides include the shuttle plasmid pIJ702 for Streptomyces lividans, pGAPalpha-A, B, C and pPICZalpha-A, B, C (Invitorgen) for Pichia pastoris, and pFE-1 and pFE-2 for filamentous fungi and similar vectors as is known in the art.
- Modification of a ManA polynucleotide molecule to facilitate insertion into a particular vector (for example, by modifying restriction sites), ease of use in a particular expression system or host (for example, using preferred host codons), and the like, are known and are contemplated for use in the invention. Genetic engineering methods for the production of ManA polypeptides include the expression of the polynucleotide molecules in cell free expression systems, in cellular hosts, in tissues, and in animal models, according to known methods.
- Compositions
- The invention provides compositions containing a substantially purified ManA polypeptide of the invention and an acceptable carrier. Such compositions are administered to biomass, for example, to degrade the hemicellulose in the biomass into simpler carbohydrate units and ultimately, to sugars. These released sugars from the hemicellulose are converted into ethanol by any number of different catalysts. Such compositions may also be included in detergents for removal, for example, of hemicellulose containing stains within fabrics, or compositions used in the pulp and paper industry to address conditions associated with hemicellulose contamination of the cellulose fraction. Compositions of the present invention can be used in degrading the hemicellulose fraction in the food and feed industry to result in a lower content of hemicellulose in food or feed. Compositions of the present invention can also be used to produce oligosaccharide bulking agents and stabilizers from hemicellulose for use in the food and feed industry. Compositions of the present invention that include either the carbohydrate binding domain type III or II polypeptides can be used as linking agents, for example, to link a target molecule fused to the CBD II or III to a carbohydrate containing target, including pharmaceutical compositions where the CBD II or III is used to target drugs to target carbohydrate expressing cells (see below).
- The invention provides pharmaceutical compositions containing a substantially purified ManA polypeptide of the invention and if necessary a pharmaceutically acceptable carrier. Such pharmaceutical compositions are administered to cells, tissues, or patients, for example, to aid in delivery or targeting of other pharmaceutical compositions. For example, ManA polypeptides, and in particular the carbohydrate binding domains of ManA, may be used where carbohydrate-mediated liposomal interactions are involved with target cells. Vyas SP et al. (2001), J. Pharmacy & Pharmaceutical Sciences May-August 4(2): 138-58.
- The invention also provides reagents, compositions, and methods that are useful for analysis of ManA activity and for the analysis of hemicellulose breakdown.
- Compositions of the present invention may also include other known glycoside hydrolases, and preferably, other known thermal tolerant glycoside hydrolases for enhanced treatment of hemicellulose.
- Antibodies
- The polypeptides of the present invention, in whole or in part, may be used to raise polyclonal and monoclonal antibodies that are useful in purifying ManA, or detecting ManA polypeptide expression, as well as a reagent tool for characterizing the molecular actions of the ManA polypeptide. Preferably, a peptide containing a unique epitope of the ManA polypeptide is used in preparation of antibodies, using conventional techniques. Methods for the selection of peptide epitopes and production of antibodies are known. See, for example, Antibodies: A Laboratory Manual, Harlow and Land (eds.), 1988 Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Kennet et al. (eds.), 1980 Plenum Press, New York.
- Assays
- Agents that modifiy, for example, increase or decrease, ManA hydrolysis or degradation of hemicellulose can be identified, for example, by assay of ManA mannanase activity and/or analysis of ManA binding to a carbohydrate substrate. Incubation of hemicellulose in the presence of ManA and in the presence or absence of a test agent and correlation of mannanase activity or carbohydrate binding permits screening of such agents. For example, mannanase activity and binding assays may be performed in a manner similar to those described for cellulases in Irwin et al., J. Bacteriology 180(7): 1709-1714 (April 1998).
- The ManA stimulated activity is determined in the presence and absence of a test agent and then compared. A lower ManA activated test activity in the presence of the test agent, than in the absence of the test agent, indicates that the test agent has decreased the activity of the ManA. A higher ManA activated test activity in the presence of the test agent than in the absence of the test agent indicates that the test agent has increased the activity of the ManA. Stimulators and inhibitors of ManA may be used to augment, inhibit, or modify ManA mediated activity, and therefore may have potential industrial uses as well as potential use in the further elucidation of ManA's molecular actions.
- Therapeutic Applications
- The ManA polypeptides of the invention are effective in adding in delivery or targeting of other pharmaceutical compositions within a host. For example, ManA polypeptides, and in particular the ManA carbohydrate binding domains, may be used where carbohydrate-mediated liposomal interactions are involved with target cells. Vyas SP et al. (2001), J. Pharm Pharm Sci May-August 4(2): 138-58.
- ManA polynucleotides and polypeptides, including vectors expressing ManA, of the invention can be formulated as pharmaceutical compositions and administered to a host, preferably mammalian host, including a human patient, in a variety of forms adapted to the chosen route of administration. The compounds are preferably administered in combination with a pharmaceutically acceptable carrier, and may be combined with or conjugated to specific delivery agents, including targeting antibodies and/or cytokines.
- ManA can be administered by known techniques, such as orally, parentally (including subcutaneous injection, intravenous, intramuscular, intrasternal or infusion techniques), by inhalation spray, topically, by absorption through a mucous membrane, or rectally, in dosage unit formulations containing conventional non-toxic pharmaceutically acceptable carriers, adjuvants or vehicles. Pharmaceutical compositions of the invention can be in the form of suspensions or tablets suitable for oral administration, nasal sprays, creams, sterile injectable preparations, such as sterile injectable aqueous or oleagenous suspensions or suppositories.
- For oral administration as a suspension, the compositions can be prepared according to techniques well-known in the art of pharmaceutical formulation. The compositions can contain microcrystalline cellulose for imparting bulk, alginic acid or sodium alginate as a suspending agent, methylcellulose as a viscosity enhancer, and sweeteners or flavoring agents. As immediate release tablets, the compositions can contain microcrystalline cellulose, starch, magnesium stearate and lactose or other excipients, binders, extenders, disintegrants, diluents and lubricants known in the art.
- For administration by inhalation or aerosol, the compositions can be prepared according to techniques well-known in the art of pharmaceutical formulation. The compositions can be prepared as solutions in saline, using benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons or other solubilizing or dispersing agents known in the art.
- For administration as injectable solutions or suspensions, the compositions can be formulated according to techniques well-known in the art, using suitable dispersing or wetting and suspending agents, such as sterile oils, including synthetic mono- or diglycerides, and fatty acids, including oleic acid.
- For rectal administration as suppositories, the compositions can be prepared by mixing with a suitable non-irritating excipient, such as cocoa butter, synthetic glyceride esters or polyethylene glycols, which are solid at ambient temperatures, but liquefy or dissolve in the rectal cavity to release the drug.
- Preferred administration routes include orally, parenterally, as well as intravenous, intramuscular or subcutaneous routes. More preferably, the compounds of the present invention are administered parenterally, i.e., intravenously or intraperitoneally, by infusion or injection.
- Solutions or suspensions of the compounds can be prepared in water, isotonic saline (PBS) and optionally mixed with a nontoxic surfactant. Dispersions may also be prepared in glycerol, liquid polyethylene, glycols, DNA, vegetable oils, triacetin and mixtures thereof. Under ordinary conditions of storage and use, these preparations may contain a preservative to prevent the growth of microorganisms.
- The pharmaceutical dosage form suitable for injection or infusion use can include sterile, aqueous solutions or dispersions or sterile powders comprising an active ingredient which are adapted for the extemporaneous preparation of sterile injectable or infusible solutions or dispersions. In all cases, the ultimate dosage form should be sterile, fluid and stable under the conditions of manufacture and storage. The liquid carrier or vehicle can be a solvent or liquid dispersion medium comprising, for example, water, ethanol, a polyol such as glycerol, propylene glycol, or liquid polyethylene glycols and the like, vegetable oils, nontoxic glyceryl esters, and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the formation of liposomes, by the maintenance of the required particle size, in the case of dispersion, or by the use of nontoxic surfactants. The prevention of the action of microorganisms can be accomplished by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be desirable to include isotonic agents, for example, sugars, buffers, or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the inclusion in the composition of agents delaying absorption—for example, aluminum monosterate hydrogels and gelatin.
- Sterile injectable solutions are prepared by incorporating the compounds in the required amount in the appropriate solvent with various other ingredients as enumerated above and, as required, followed by filter sterilization. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying techniques, which yield a powder of the active ingredient plus any additional desired ingredient present in the previously sterile-filtered solutions.
- Industrial Applications
- The ManA polypeptides of the invention are effective thermostable mannanases. In the methods of the invention, the mannanase degrading effects of ManA are achieved by treating biomass at a ratio of about 1 to about 50 of ManA:biomass. ManA may be used under extreme conditions, for example, elevated temperatures and acidic pH. Treated biomass is degraded into simpler forms of carbohydrates, which is then used in the formation of ethanol or other industrial chemicals, as is known in the art. Other methods are envisioned to be within the scope of the present invention, including methods for treating fabrics to remove hemicellulose-containing stains and other methods already discussed. In addition, ManA polypeptides can be used to degrade the hemicellulose content of a substrate source in the food, feed and paper pulp industries, or alternatively, be used to produce useful oligosaccharides to be added to food and feed as bulking agents or stabilizing agents. ManA polypeptides can be used in any known application currently utilizing a mannanases, all of which are within the scope of the present invention. Having generally described the invention, the same will be more readily understood by reference to the following examples, which are provided by way of illustration and are not intended as limiting.
- Genomic DNA was isolated from Acidothermus cellulolyticus and purified by banding on cesium chloride gradients. Genomic DNA was partially digested with Sau 3A and separated on agarose gels. DNA fragments in the range of 9-20 kilobase pairs were isolated from the gels. This purified Sau 3A digested genomic DNA was ligated into the Bam H1 acceptor site of purified EMBL3 lambda phage arms (Clontech, San Diego, Calif.). Phage DNA was packaged according to the manufacturer's specifications and plated with E. coli LE392 in top agar which contained the soluble cellulose analog, carboxymethylcellulose (CMC). The plates were incubated overnight (12-24 hours) to allow transfection, bacterial growth, and plaque formation. Plates were stained with Congo Red followed by destaining with 1 M NaCl. Lambda plaques harboring endoglucanase clones showed up as unstained plaques on a red background.
- Lambda clones which screened positive on CMC-Congo Red plates were purified by successive rounds of picking, plating and screening. Individual phage isolates were named SL-1, SL-2, SL-3 and SL-4. Subsequent subcloning efforts employed the SL-3 clone which contained an approximately 14.2 kb fragment of A. cellulolyticus genomic DNA.
- Template DNA was constructed using a 9 kb BamH1 fragment obtained from the 14.2 kb lambda clone SL3 prepared from Acidothermus cellulolyticus genomic DNA. The 9-kb BamHI fragment from SL3 was subcloned into pDR540 to generate a plasmid NREL501. NREL501 was first sequenced by the primer walking method as is known in the art. NREL501 was then subcloned into pUC19 using restriction enzymes PstI and EcoRI and transformed into E. coli XL1-blue (Stratagene, La Jolla, Calif.) for the production of template DNA for sequencing. Each subclone was sequenced from both forward and reverse directions. DNA for sequencing was prepared from an overnight growth in 500 mL LB broth using a megaprep DNA purification kit from Promega. The template DNA was PEG precipitated and suspended in de-ionized water and adjusted to a final concentration of 0.25 mg/mL.
- Custom primers were designed by reading upstream known sequence and selecting segments of an appropriate length to function, as is well known in the art. Primers for cycle sequencing were synthesized at the Macromolecular Resources facility located at Colorado State University in Fort Collins, Colo. Typically the sequencing primers were 26-30 nucleotides in length, but were sometimes longer or shorter to accommodate a melting temperature appropriate for cycle sequencing. The sequencing primers were diluted in de-ionized water, the concentration measured using UV absorbance at 260 nm, and then adjusted to a final concentration of 5 pmol/μL.
- Templates and sequencing primers were shipped to the Iowa State University DNA Sequencing facility at Ames, Iowa for sequencing using standard chemistries for cycle sequencing. In some cases, regions of the template that sequenced poorly using the standard protocols and dye terminators were repeated with the addition of 2 μL DMSO and by using nucleotides optimized for the sequencing of high GC content DNA. The high frequency of reoccurring small domains, i.e., CBDs and linkers, with high sequence similarity caused initial difficulties in sequence assignments which were only resolved through extensive review of the data and repeated analysis.
- Sequencing data from primer walking and subclones were assembled together to verify that all SL3 regions had been sequenced from both strands. An open reading frames (ORF) was found in the 9-kb BamHI fragment, C-terminal of E1 (U.S. Pat. No. 5,536,655), termed ManA.
- An ORF of 2289 bp [SEQ ID NO: 2] and deduced amino acid sequence [SEQ ID NO: 1] are shown in Tables 2 and 1, respectively. The amino acid sequence predicted by SEQ ID NO: 1 was determined to have significant homology to known mannanases, as shown below in Example 2 and in Table 3.
- The amino acid sequence represents a novel member of the family of proteins with mannanase activity. Due to the source of isolation from the thermophilic organism Acidothermus, ManA is a novel member of the mannanase family with properties including thermal tolerance. It is also known that thermal tolerant enzymes may have other properties (see definition above).
- Sequence alignments and comparisons of the amino acid sequences of the Acidothermus cellulolyticus ManA catalytic domain (aa 37 to 411), Agaricus bisporus (β-mannanase) and Trichoderma reesei (β-mannanase) polypeptides were prepared, using the ClustalW program (Thompson J. D et al. (1994), Nucleic Acids Res. 22:4673-4680 from EMBL European Bioinformatics Institute website (http://www.ebi.ac.uk/).
- An examination of the amino acid sequence alignment of the GH5 domains indicates that the amino acid sequence of the ManA catalytic domain is homologous to the amino acid sequences of known GH5 family catalytic domains for A. bisporus β-mannanase and T. reesei β-mannanase (See Table 3). In Table 3, the notations are as follows: an asterisk “*” indicates identical or conserved residues in all sequences in the alignment; a colon “:” indicates conserved substitutions; a period “.” indicates semi-conserved substitutions; and a hyphen “-” indicates a gap in the sequence. The amino acid sequence predicted for the ManA GH5 domain is approximately 39% identical to the A. bisporus β-mannanase GH5 domain and approximately 35% identical to the T. reesei β-mannanase GH5 domain, indicating that the ManA catalytic domain is a member of the GH5 family (Henrissat et al. (1991), supra).
Table 3 Multiple amino acid sequence alignment of a ManA catalytic domain and polypeptides with Glycoside Hydrolase Family 5 catalytic domains.Multialignment of related Glycoside Hydrolase Family 5 catalytic domainGH5_Ace: Acidothermus cellulolyticus ManA catalytic domain GH5 Ce14A_Abi: Agaridus bisporus Ce14 (beta-mannanase). GeneBank Acc. #CAA90423 Man_Tre: Trichoderma reesei beta-mannanase. GeneBank Acc. #11514387 GH5_Ace APAGFVTASGGQFVLNGLPYRYCGTNNYYLSYQ--SHA Ce14a_Abi VSTCFVKASGTRFTLNGQKYTVVGGNSYWVCLTGLSTS Man_Tre RASSFVTISGTQFNTDCKVCYFAGTNCYWCSFLT-NHA :.**. ** :* ::* * * *: . . : GH5_Ace DVDDVLAKAQAMNLSVIRTWGFIDIGSLDGSVPTIDGNKNGFYFQYWDPSTGAPAYNDGP Ce14a_Abi AMNQAFSDIANAGGTTVRTWGFNEVTSP-----------NGNYYQSWSGAR--PTTNTGA Man_Tre DVDSTFSHISSSCLKVVRVWGFNDVNTQPSP--------GQIWFQKLSATG--STINTGA ::..::. . ..:*.*** :: : . ::* . : .: * *. GH5_Ace TGLQGLDYAIASAAAHGLRVIVVLTNDWKEFGGMDQYD-KWYG-LPYHDNFYTDPRTQQA Ce14a_Abi SGLLNFDNVIAAAKANGIRLIVALTNNWADYGGMDVYVNQMVGNGQPHDLPYTNTAIKDA Man_Tre DGLQTLDYVVQSAEQHNLKLIIPFVNNWSDYGGINAYVNAFGG---NATTWYTNTAAQTQ ** :* .: :* :.:::*: :.*: :.*: :.* ::**:: * * :**:. : GH5_Ace YKNWVNHLLNRVNSITGVTYKNDPTIFAWELANEPRCVGSGTLPTSGTCTQATIVNWVDQ Ce14a_Abi FKSYVRTFVSR--------YANEPTVMAWELANEPRCKGS-TGTTSGTCTTTTVTNWAKE Man_Tre YRKYVQAVVSR--------YANSTAIFAWELCNEPRCNGC---------STDVIVQWATS ::.:*. .:.* * *..:::****.***** *. : .:.:*. . GH5_Ace MSAYVKSIDPNHMVSVGDEGFYIGSTQGSGWPYNDPSDGVDNNALLRVKNIDFGTYHLYP Ce14a_Abi MSAFIKTIDSNHLVAIGDEGFYN-QPGAPTYPYQG-SEGVDFEANLAISSVDFATFHSYP Man_Tre VSQYVKSLDSNHLVTLGDEGLGLSTGDG-AYPYTY-GEGTDFAKNVQIKSLDFGTFHLYP :* ::*::*.**:*::****: . :** .:*.* : :..:**.*:* ** GH5_Ace NYWOONAD---WGTQWIKDHIANAAAIGKPTILEEFGWQTPDRDSVYQTWTQTVRTNGEA Ce14a_Abi EPWGQGADAKAWGTQWITDHAASMKRVNKPVILEEFGVTTNQPD-TYAEWFNEVESSCLT Man_Tre DSWGTNYT---WGNGWIQTHAAACLAAGKPCVFEEYGAQQNPCTNEAPWQTTSLTTRGMG : ** . **. ** * * .** .:*.* : :..:**.*:* ** GE5_Ace GWNFWMLAGNVNGQPYPNYDGFNVYYPSSTATVLASEALAISTG Ce14a_Abi GDLIWQAGSHLSTGDTHN-DGYAVYPDGPVYPLMKSHASAMKNR Man_Tre GDMFWQWGDTFANGAQSNSDPYTVWYNSSNWQCLVKNHVDAING * :* .. . * * : *: .. : .. . - From the putative locations of the domains in the ManA sequence given above and in comparable cloned mannanase sequences from other species, one can separate individual domains and combine them with one or more domains from different sequences. The significant similarity between mannanase genes permit one by recombinant techniques to arrange one or more domains from the Acidothermus cellulolyticus ManA gene with one or more domains from a mannanase gene from one or more other microorganisms. Other representative endoglucanase genes include Bacillus polymyxa beta-(1,4) endoglucanase (Baird et al, Journal of Bacteriology, 172: 1576-86 (1992)) Xanthomonas campestris beta-(1,4)-endoglucanase (Gough et al, Gene 89:53-59 (1990)) and Trichoderma harzianum endo-1,3(4)-beta-glucanase (U.S. Pat. No. 6,140,096). The result of the fusion of any two or more domains will, upon expression, be a hybrid polypeptide. Such hybrid polypeptides can have one or more catalytic or binding domains. For ease of manipulation, recombinant techniques may be employed such as the addition of restriction enzyme sites by site-specific mutagenesis. If one is not using one domain of a particular gene, any number of any type of change including complete deletion may be made in the unused domain for convenience of manipulation.
- It is understood for purposes of this disclosure, that various changes and modifications may be made to the invention that are well within the scope of the invention. Numerous other changes may be made which will readily suggest themselves to those skilled in the art and which are encompassed in the spirit of the invention disclosed herein and as defined in the appended claims.
- This specification contains numerous citations to references such as patents, patent applications, and publications. Each is hereby incorporated by reference for all purposes.
Claims (67)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US09/917,378 US7112429B2 (en) | 2001-07-28 | 2001-07-28 | Thermal tolerant mannanase from acidothermus cellulolyticus |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US09/917,378 US7112429B2 (en) | 2001-07-28 | 2001-07-28 | Thermal tolerant mannanase from acidothermus cellulolyticus |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20030119093A1 true US20030119093A1 (en) | 2003-06-26 |
| US7112429B2 US7112429B2 (en) | 2006-09-26 |
Family
ID=25438708
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US09/917,378 Expired - Fee Related US7112429B2 (en) | 2001-07-28 | 2001-07-28 | Thermal tolerant mannanase from acidothermus cellulolyticus |
Country Status (1)
| Country | Link |
|---|---|
| US (1) | US7112429B2 (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2404929A1 (en) | 2003-07-02 | 2012-01-11 | Verenium Corporation | Glucanases, nucleic acids encoding them and methods for making and using them |
| EP2444413A1 (en) | 2006-08-04 | 2012-04-25 | Verenium Corporation | Methods for oil or gas well drilling, washing and/or fracturing |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7364890B2 (en) * | 2001-07-28 | 2008-04-29 | Midwest Research Institute | Thermal tolerant avicelase from Acidothermus cellulolyticus |
| AU2008318505A1 (en) * | 2007-11-02 | 2009-05-07 | Ceres, Inc. | Materials and methods for use in biomass processing |
| WO2012058223A1 (en) | 2010-10-27 | 2012-05-03 | Ceres, Inc. | Transgenic plants having altered biomass composition |
| BR112014013853A2 (en) | 2011-12-09 | 2020-01-14 | Ceres, Inc. | use of an isolated nucleic acid, method of obtaining a transgenic plant cell, method of obtaining a transgenic plant, method of producing a plant, method of producing biomass, method of biomass processing, method of altering the composition of biomass , biomass composition modulation method, production method of a forage product |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6126698A (en) * | 1997-12-19 | 2000-10-03 | Novo Nordisk Biochem North America, Inc. | Continuous biopolishing of cellulose-containing fabrics |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5110735A (en) | 1989-09-26 | 1992-05-05 | Midwest Research Institute | Thermostable purified endoglucanase from thermophilic bacterium acidothermus cellulolyticus |
| US5366884A (en) | 1989-09-26 | 1994-11-22 | Midwest Research Institute | Thermostable purified endoglucanase II from Acidothermus cellulolyticus ATCC |
| US5432075A (en) | 1989-09-26 | 1995-07-11 | Midwest Research Institute | Low molecular weight thermostable β-D-glucosidase from acidothermus cellulolyticus |
| US5712142A (en) | 1989-09-26 | 1998-01-27 | Midwest Research Institute | Method for increasing thermostability in cellulase ennzymes |
| US5536655A (en) | 1989-09-26 | 1996-07-16 | Midwest Research Institute | Gene coding for the E1 endoglucanase |
| US5514584A (en) | 1993-06-11 | 1996-05-07 | Midwest Research Institute | Cloning of cellulase genes from acidothermus cellulolyticus |
| US6060299A (en) | 1998-06-10 | 2000-05-09 | Novo Nordisk A/S | Enzyme exhibiting mannase activity, cleaning compositions, and methods of use |
| US6013860A (en) | 1998-07-24 | 2000-01-11 | Calgene Llc | Expression of enzymes involved in cellulose modification |
-
2001
- 2001-07-28 US US09/917,378 patent/US7112429B2/en not_active Expired - Fee Related
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6126698A (en) * | 1997-12-19 | 2000-10-03 | Novo Nordisk Biochem North America, Inc. | Continuous biopolishing of cellulose-containing fabrics |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2404929A1 (en) | 2003-07-02 | 2012-01-11 | Verenium Corporation | Glucanases, nucleic acids encoding them and methods for making and using them |
| EP2404928A1 (en) | 2003-07-02 | 2012-01-11 | Verenium Corporation | Glucanases, nucleic acids encoding them and methods for making and using them |
| EP2404931A1 (en) | 2003-07-02 | 2012-01-11 | Verenium Corporation | Glucanases, nucleic acids encoding them and methods for making and using them |
| EP2404930A1 (en) | 2003-07-02 | 2012-01-11 | Verenium Corporation | Glucanases, nucleic acids encoding them and methods for making and using them |
| EP2409981A1 (en) | 2003-07-02 | 2012-01-25 | Verenium Corporation | Glucanases, nucleic acids encoding them and methods for making and using them |
| EP2444413A1 (en) | 2006-08-04 | 2012-04-25 | Verenium Corporation | Methods for oil or gas well drilling, washing and/or fracturing |
| US10329549B2 (en) | 2006-08-04 | 2019-06-25 | Bp Corporation North America Inc. | Glucanases, nucleic acids encoding them and methods for making and using them |
Also Published As
| Publication number | Publication date |
|---|---|
| US7112429B2 (en) | 2006-09-26 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7932054B2 (en) | Methods of using thermal tolerant avicelase from Acidothermus cellulolyticus | |
| Hogg et al. | The modular architecture of Cellvibrio japonicus mannanases in glycoside hydrolase families 5 and 26 points to differences in their role in mannan degradation | |
| Okada et al. | Molecular characterization and heterologous expression of the gene encoding a low-molecular-mass endoglucanase from Trichoderma reesei QM9414 | |
| CN102947442B (en) | Compositions for saccharification of cellulosic materials | |
| Politz et al. | A highly thermostable endo-(1, 4)-β-mannanase from the marine bacterium Rhodothermus marinus | |
| ES2182818T5 (en) | Improved saccharification of cellulose by cloning and amplification of the Trichoderma reesei beta-glucosidase gene | |
| US7059993B2 (en) | Thermal tolerant cellulase from Acidothermus cellulolyticus | |
| CN109136114A (en) | The method of a variety of recombinant polypeptides is generated in filamentous fungal host cell | |
| EP3421597A1 (en) | Chrysosporium lucknowense protein production system | |
| CN102803482A (en) | Cellulase variants with improved expression, activity and/or stability, and uses thereof | |
| KR20150113170A (en) | Carbohydrate degrading polypeptide and uses thereof | |
| CN108179139A (en) | Cellulose decomposition enzymatic compositions and application thereof | |
| Black et al. | Xylanase B from Neocallimastix patriciarum contains a non-catalytic 455-residue linker sequence comprised of 57 repeats of an octapeptide | |
| US7393673B2 (en) | Thermal tolerant exoglucanase from Acidothermus cellulolyticus | |
| BR112012011596B1 (en) | talaromyces transformant, processes for producing a talaromyces transformant, a multiple talaromyces transformant and a polypeptide composition comprising one or more cellulases, and processes for saccharifying lignocellulosic material and preparing a fermentation product | |
| BR112012033404B1 (en) | recombinant cell, method for preparing a polypeptide, composition, method for treating a substrate comprising carbohydrate material and use of a polypeptide | |
| CN109072208A (en) | Paenibacillus sp. mannanase | |
| CN102041251B (en) | Glucosidase/xylosidase difunctional cellulose degradation enzyme RuGBGX2 as well as coding gene and application thereof | |
| WO2003012109A1 (en) | Thermal tolerant cellulase from acidothermus cellulolyticus | |
| US7112429B2 (en) | Thermal tolerant mannanase from acidothermus cellulolyticus | |
| US20150275255A1 (en) | Endoglucanase For Reducing The Viscosity Of A Plant Materials Slurry | |
| WO2003012110A1 (en) | Thermal tolerant mannanase from acidothermus cellulolyticus | |
| WO2003012095A1 (en) | Thermal tolerant exoglucanase from acidothermus cellulolyticus | |
| US6190189B1 (en) | Cellulases and coding sequences | |
| JPH07507928A (en) | recombinant cellulase |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: MIDWEST RESEARCH INSTITUTE, MISSOURI Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:DING, SHI-YOU;ADNEY, WILLIAM S.;VINZANT, TODD B.;AND OTHERS;REEL/FRAME:012044/0741 Effective date: 20010726 |
|
| AS | Assignment |
Owner name: ENERGY, UNITED STATES DEPARTMENT OF, DISTRICT OF C Free format text: CONFIRMATORY LICENSE;ASSIGNOR:MIDWEST RESEARCH INSTITUTE;REEL/FRAME:012415/0413 Effective date: 20010829 |
|
| AS | Assignment |
Owner name: ALLIANCE FOR SUSTAINABLE ENERGY, LLC, COLORADO Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:MIDWEST RESEARCH INSTITUTE;REEL/FRAME:021603/0337 Effective date: 20080912 Owner name: ALLIANCE FOR SUSTAINABLE ENERGY, LLC,COLORADO Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:MIDWEST RESEARCH INSTITUTE;REEL/FRAME:021603/0337 Effective date: 20080912 |
|
| FEPP | Fee payment procedure |
Free format text: PAT HOLDER CLAIMS SMALL ENTITY STATUS, ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: LTOS); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY |
|
| FPAY | Fee payment |
Year of fee payment: 4 |
|
| FPAY | Fee payment |
Year of fee payment: 8 |
|
| FEPP | Fee payment procedure |
Free format text: MAINTENANCE FEE REMINDER MAILED (ORIGINAL EVENT CODE: REM.) |
|
| LAPS | Lapse for failure to pay maintenance fees |
Free format text: PATENT EXPIRED FOR FAILURE TO PAY MAINTENANCE FEES (ORIGINAL EVENT CODE: EXP.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY |
|
| STCH | Information on status: patent discontinuation |
Free format text: PATENT EXPIRED DUE TO NONPAYMENT OF MAINTENANCE FEES UNDER 37 CFR 1.362 |
|
| FP | Lapsed due to failure to pay maintenance fee |
Effective date: 20180926 |