CROSS REFERENCE TO RELATED APPLICATIONS
This application is the U.S. National Stage of International Application No. PCT/US2020/050903, filed Sep. 15, 2020, which was published in English under PCT Article 21(2), which claims the benefit of U.S. Provisional Application No. 62/901,397, filed Sep. 17, 2019, which is herein incorporated by reference in its entirety.
FIELD
This disclosure concerns modified platelet-derived growth factor receptor a (PDGFRα) proteins that retain binding to the cytomegalovirus gH/gL/gO trimer, but exhibit reduced binding to PDGF ligands and methods of their use, particularly for inhibiting replication of cytomegalovirus.
BACKGROUND
Human cytomegalovirus (CMV; or human herpesvirus 5, HHV-5) is a ubiquitous pathogen that has infected most of the global adult population at some point, and typically causes asymptomatic infections that go unnoticed (Cannon et al., Rev Med Virol. 2010 July; 20(4):202-213; Staras et al., Clin Infect Dis. 2006 Nov. 1; 43(9):1143-1151). In some cases, individuals will experience mononucleosis-like symptoms, and severe disease can occur in immunocompromised or immunosuppressed adults (Emery, J Clin Pathol. 2001 February; 54(2):84-88). CMV infection may also have an oncomodulatory effect and is associated with tumor progression, most notably in glioblastoma (Cobbs et al., Cancer Res. 2002 Jun. 15; 62(12):3347-3350; Mitchell et al., Neuro-oncology. 2008 February; 10(1):10-18; Scheurer et al., Acta Neuropathol. 2008 July; 116(1):79-86; Michaelis et al., Neoplasia. 2009 January; 11(1):1-9). However, it is amongst pregnant women and newborns that CMV poses an outsized impact on public health (Cannon and Davis, BMC Public Health. 4 ed. 2005 Jun. 20; 5(1):70). Just over 1 in 200 infants born in the United States have congenital infection, and approximately one-fifth of these infants will suffer life-long neurological complications (Dollard et al., Rev Med Virol. 2007 September; 17(5):355-363; Kenneson and Cannon, Rev Med Virol. 2007 July; 17(4):253-276), which can include hearing and vision loss, seizures, behavioral disorders, and developmental delays (Grosse et al., J Clin Virol. 2008 February; 41(2):57-62; Suzuki et al., Brain Dev. 2008 June; 30(6):420-424; Zhang et al., J Clin Virol. 2007 November; 40(3):180-185; Coats et al., J AAPOS. 2000 April; 4(2):110-116; Gentile et al., In Vivo. 2017 May; 31(3):467-473). Ideally, infection during pregnancy would be avoided, but this is challenging. The high prevalence of CMV (especially in families with young children (Staras et al., J Clin Virol. 2008 November; 43(3) 266-271; Lanzieri et al., Clin Vaccine Immunol. 2015 February; 22(2):245-247)), easy transmission through contact with bodily fluids, recurrence of latent endogenous infections (Dupont and Reeves, Rev Med Virol. 2016 March; 26(2):75-89), reinfection by different exogenous strains (Ross et al., J Infect Dis. 2010 Feb. 1; 201(3):386-389), and difficulties recognizing asymptomatic infected individuals, mean that preventing virus spread is often impractical. Furthermore, antivirals have not been approved by the U.S. Food and Drug Administration for routine use in the treatment of congenital CMV where there are unique concerns regarding toxicity, and drug resistance is widely reported (Lurain and Chou, Clin Microbiol Rev. 2010 October; 23(4):689-712). Faced with this reality, the American College of Obstetricians and Gynecologists does not make any specific recommendations for counseling or treating pregnant women for the prevention of CMV (American College of Obstetricians and Gynecologists. Practice bulletin no. 151: Cytomegalovirus, parvovirus B19, varicella zoster, and toxoplasmosis in pregnancy. Obstetrics and gynecology. 2015. p. 1510-1525). Thus, a need exists for an effective antiviral therapeutic for the prevention and treatment of CMV.
SUMMARY
Described herein are modified human PDGFRα polypeptides that retain the capacity to bind a cytomegalovirus (CMV) trimer comprised of glycoprotein H (gH), gL and gO, but exhibit reduced binding to one or more platelet-derived growth factor (PDGF) ligands, such as PDGF-AA, PDGF-AB, PDGF-BB and/or PDGF-CC. The modified polypeptides can be used as diagnostic or therapeutic agents for the detection, prophylaxis, or treatment of CMV infection.
Provided herein are modified PDGFRα polypeptides that include a human PDGFRα or an extracellular fragment thereof. The polypeptides comprise at least one amino acid substitution relative to wild-type human PDGFRα, and retain the capacity to bind a CMV trimer comprised of gH, gL and gO (or exhibit increased binding to the trimer), but exhibit reduced binding (or do not bind) to one or more PDGF ligands. In some embodiments, the at least one amino acid substitution is selected from any of the substitutions shown in Table 1. In some examples, the at least one amino acid substitution is a residue located at the binding interface of PDGFRα and PDGF.
Also provided herein are fusion proteins that include a modified PDGFRα polypeptide disclosed herein and a heterologous polypeptide. In some embodiments, the heterologous polypeptide is an Fc protein or a protein that can be used as a diagnostic/detection reagent, such as a fluorescent protein (for example, GFP) or an enzyme.
Further provided is an in vitro method of inhibiting CMV replication by contacting the CMV with a modified PDGFRα polypeptide or fusion protein disclosed herein. Methods of inhibiting CMV replication and/or spread in a subject are also provided. In some embodiments, the method includes administering to the subject a therapeutically effective amount of a modified PDGFRα polypeptide or fusion protein disclosed herein. Also provided is a method of treating a CMV infection in a subject by administering to the subject a therapeutically effective amount of a modified PDGFRα polypeptide or fusion protein disclosed herein.
Also provided are nucleic acid molecules and vectors that encode a modified PDGFRα polypeptide or fusion protein disclosed herein. Methods of inhibiting CMV replication and/or spread (or treating a CMV infection) in subject by administering the nucleic acid molecule or vector are further provided.
The foregoing and other objects and features of the disclosure will become more apparent from the following detailed description, which proceeds with reference to the accompanying figures.
BRIEF DESCRIPTION OF THE DRAWINGS
FIGS. 1A-1F: A selection strategy for identifying PDGFRα mutants selective for the CMV trimer. (FIG. 1A) Expi293F cells expressing PDGFRα were incubated with dilutions of gH/gL/gO-superfolder GFP (sfGFP)-containing medium, and binding (shown as change in mean fluorescence units, ΔMFU) was measured by flow cytometry. (FIGS. 1B and 1C) Cells were transfected with wild-type (WT) PDGFRα (FIG. 1B) or the D2-D3 site-saturation mutagenesis (SSM) library (FIG. 1C) under conditions where typically no more than a single sequence variant is expressed by any given cell. Under these conditions, most cells are negative for PDGFRα expression. Cells were incubated with a subsaturating (12-fold) dilution of gH/gL/gO-sfGFP medium and analyzed by flow cytometry. (FIG. 1D) Cells were co-incubated with a 2-fold dilution of gH/gL/gO-sfGFP medium and different concentrations of PDGF (an equimolar mixture of PDGF-AA, AB, BB, and CC). The fluorescent signal of gH/gL/gO-sfGFP binding was compared to a sample without competing PDGF. (FIGS. 1E and 1F) Cells expressing WT PDGFRα (FIG. 1E) or the D2-D3 SSM library (FIG. 1F) were incubated with a 3-fold dilution of gH/gL/gO-sfGFP medium and 100 nM PDGF (25 nM of each subtype). During sorting of the D2-D3 library, the top 15% of PDGFRα-expressing cells that bind trimer were collected (UL74-High sort). Simultaneously, the bottom 15% of PDGFRα-expressing cells that bind trimer were also collected (UL74-Low sort).
FIGS. 2A-2G: A deep mutational scan of PDGFRα D2-D3 domains for CMV trimer interactions in the presence of PDGFs. (FIG. 2A) Log2 enrichment ratios for individual mutations in the UL74-High sort are plotted from −3 (depleted) to +3 (enriched). Amino acid position is on the horizontal axis, and substitutions are on the vertical axis. *, stop codon. (FIG. 2B) Agreement between log2 enrichment ratios from independent replicates of the UL74-High sort (positive selection). R2 values were calculated for nonsynonymous mutations and nonsense mutations. (FIG. 2C) Agreement between log2 enrichment ratios from replicates of the UL74-Low sort (negative selection). (FIG. 2D) Log2 enrichment ratios for nonsynonymous mutations were anticorrelated between the negative and positive selections. Nonsense mutations were depleted from both sorts due to lost surface expression. (FIGS. 2E-2G) High correlation between conservation scores (calculated by averaging the log2 enrichment ratios for all nonsynonymous mutations at a given amino acid position) from independent replicates of the UL74-High (FIG. 2E) and UL74-Low (FIG. 2F) sorts. Conservation scores were anticorrelated between the two sorted populations (FIG. 2G).
FIGS. 3A-3E: Hot spots in PDGFRα for mutations that increase CMV trimer binding in the presence of competing PDGFs. (FIG. 3A) Model of PDGFRα D2-D3 domains bound to PDGF-BB (protruding subunit B1, receding subunit B2). Conservation scores from the UL74-High sort are mapped to the PDGFRα surface, showing residues where mutations tend to be depleted, and residues where mutations tend to be enriched. (FIG. 3B) A cross section through PDGFRα highlights that enriched mutations are concentrated in the protein interior/core. (FIGS. 3C-3E) Log2 enrichment ratios for individual mutations from the UL74-High sort are plotted from −3 (depleted) to +3 (enriched). Amino acid substitutions are indicated on the vertical axis, * is stop codon. The wild-type amino acid is black. Structural views are shown at right. Regions shown are the D2 core (FIG. 3C), PDGF-BB interface (FIG. 3D), and PDGF-BB interface and underlying D3 core (FIG. 3E).
FIGS. 4A-4C: Validation of selected mutants in PDGFRα that block PDGF competition. (FIG. 4A) Expi293F cells expressing wild-type PDGFRα were co-incubated without or with competing PDGFs, and binding of TB40/E trimer (1/3 dilution of medium containing gH/gL/gO-sfGFP) was assessed by flow cytometry. Cells were gated (box) to compare binding at equivalent receptor expression levels. (FIG. 4B) Binding of TB40/E trimer to PDGFRα variants. Data are mean±SD, n=3. (FIG. 4C) Cells expressing PDGFRα variants were incubated with Merlin gH/gL/gO-sfGFP containing medium (1/3 dilution) in the absence or presence of PDGFs. Data are mean±SD, n=4.
FIGS. 5A-5B: Soluble PDGFRα variants that no longer inhibit PDGF signaling. (FIG. 5A) Flow cytometry analysis of mock-transfected Expi293F cells, or cells transfected with a plasmid driving myc-tagged PDGFRα expression and carrying a SRE-regulated GFP reporter. Signaling activity was quantified by measuring mean GFP fluorescence (vertical axis) of responsive cells in the gate (boxed). Shown are background PDGFRα signaling (left), PDGF-BB stimulated expression (center), and inhibition of PDGF-BB stimulation by sPDGFRα-Fc (right). (FIG. 5B) Stimulation of transfected Expi293F cells with 5 nM PDGF ligands. PDGF ligands were pre-incubated with 0.2% BSA (negative) or with a 3-fold molar excess of wild-type sPDGFRα-Fc, sPDGFRα-Fc Y206S, or sPDGFRα-Fc V242K. Data are mean±SD, n=3 independent replicates.
FIG. 6 : Soluble orthogonal receptors for HCMV trimer neutralize virus. MRC-5 (left), ARPE-19 (middle) and ARPE-19RA (right) cells were infected with HCMV strains AD169 (grown in MRC-5; top) and TB40/E (grown in ARPE-19; bottom). Infection by the trimer-only AD169 strain is restricted to PDGFRα-positive MRC-5 and ARPE-19RA lines. Viral inoculum was pre-incubated with sPDGFRα-Fc WT, sPDGFRα-Fc Y206S, sPDGFRα-Fc V242K, sPDGFRβ-Fc (at a single concentration of 100 nM), or hyperimmune globulin (HIG) prior to adding to cells. Data represent mean±SD, n=2 independent titrations.
FIGS. 7A-7C: Binding of gO-sfGFP to PDGFRα-positive cells is dependent on co-expression of gH and gL. Expi293F cells were incubated with medium from cells expressing (FIG. 7A) gO-sfGFP, (FIG. 7B) gO(C343S)-sfGFP or (FIG. 7C) gH/gL/gO-sfGFP, washed and analyzed by flow cytometry. Cells were either untransfected, expressing PDGFRβ or expressing PDGFRα. High binding signal that was specific for PDGFRα-positive cells was only observed for medium containing all three components of the HCMV trimer.
FIG. 8 : No hot spots for enriched mutations in the negative selection for loss of HCMV trimer binding. Log2 enrichment ratios for single amino acid substitutions of PDGFRα are plotted based on their enrichment in the UL74-Low sort, from −3 (depleted) to +3 (enriched). Amino acid position is on the horizontal axis, and substitutions are on the vertical axis. *, stop codon. Mutations to critical residues for HCMV trimer binding are expected to be enriched in this negative selection. Compare to the positive selection shown in FIG. 2A, which uses the same scale.
FIG. 9 : PDGFRα mutations that increase HCMV trimer binding in the presence of competing PDGFs are biased to structurally connected residues. Residue conservation scores in the UL74-High deep mutational scan were calculated by averaging the log2 enrichment ratios for all 20 possible amino acids at each diversified position. PDGFRα residues where mutations tend to increase HCMV trimer binding in the presence of competing PDGFs have higher positive scores. A residue's conservation score is correlated with its connectivity in the modeled PDGF-bound PDGFRα structure, where connectivity is quantified by the number of neighboring residues within a 12 Å radius. Highly connected residues are either buried in the hydrophobic cores of the D2-D3 domains, or are buried at the PDGF binding interface.
FIGS. 10A-10C: Purification of soluble IgG1 Fc-fused PDGFRα. (FIG. 10A) The extracellular domain of PDGFRα (Gln24-Glu524) was fused via a short linker (IEGRMD, SEQ ID NO: 9; or GGGS, SEQ ID NO: 10) to the Fc region of IgG1 (PKSCDKTH, residues 225-232 of SEQ ID NO: 11; or DKTH, residues 229-232 of SEQ ID NO: 11). The “Legacy” sequence corresponds to the commercially supplied protein (R&D Systems) used in prior publications. The sequence was redesigned for this study. (FIG. 10B) Coomassie-stained SDS gel (run under denaturing and reducing conditions) of wild-type sPDGFRα-Fc eluted from a protein A column. The monomeric protein MW is predicted to be 82 kD. Additional weight may come from glycosylation and/or anomalous electrophoretic mobility. (FIG. 10C) SEC elution of wild-type, Y206S and V242K sPDGFRα-Fc. UV absorbance (y-axis) is scaled.
FIGS. 11A-11B: Chemical stress tests of sPDGFRα-Fc. (FIG. 11A) Engineered orthogonal receptor sPDGFRα-Fc V242K was incubated at 40° C. for 7 days in 20 mM Tris pH 8.5 with 10 mM EDTA to promote Asn deamidation, or at 40° C. for 14 days in 50 mM sodium acetate pH 5.5 to promote Asn isomerization. The control sample in PBS (pH 7.4) was flash frozen and stored at −80° C. until analysis. SDS-polyacrylamide gel electrophoresis with Coomassie blue staining showed chemical instability of sPDGFRα-Fc V242K in the harsher pH 5.5 stress test. (FIG. 11B) Stressed proteins were analyzed by SEC on a Superdex 200 Increase 10/300 GL column with PBS pH 7.4 as the running buffer.
FIGS. 12A-12C: Soluble PDGFRα-Fc V242K binds HCMV trimer with comparable affinity to wild-type sPDGFRα-Fc. (FIG. 12A) Data were replicated using independent preparations of sPDGFRα WT (solid line) and V242K (dashed line) fused to the Fc region of IgG1. Binding to Expi293F cells expressing full-length gH, gL and gO from the HCMV TB40/E strain was assessed by flow cytometry. (FIGS. 12B and 12C) Soluble PDGFRα WT (solid line) and V242K (broken line) were purified as fusions to the Fc region of IgG3, matching the redesigned linker described in FIG. 6A. Binding to trimer from (FIG. 12B) TB40/E and (FIG. 12C) Merlin strains expressed on Expi293F cells was measured by flow cytometry. Data are mean±SD, n=3 (sPDGFRα-Fc WT and V242K) or 2 (sPDGFRβ-Fc).
FIG. 13 : Gamma globulin has no effect on PDGF signaling in culture. PDGF signaling was assessed in Expi293F cells transiently transfected with a PDGFRα reporter plasmid as outlined in FIG. 5A. A 3-fold molar excess of wild-type sPDGFRα-Fc blocks 5 nM PDGF-AB signaling. Orthogonal engineered sPDGFRα-Fc V242K does not block signaling and the mutation shows no interactions with PDGFs in competitive binding experiments (see FIG. 4 ). Furthermore, wild-type or mutant sPDGFRα-Fc up to 100 nM shows no binding to PDGFRα-positive cells, and unanticipated interactions between receptor chains were excluded. However, sPDGFRα-Fc V242K does cause an increase in signaling of PDGF-A ligands (AA and AB). A non-specific carrier effect in which the orthogonal receptor stabilizes the hydrophobic ligand in solution is suspected, especially because the more hydrophobic variant sPDGFRα-Fc Y206S promotes an even bigger increase in PDGF-A signaling (see FIG. 5B). Human gamma globulin at the same concentration has no effect in this assay. Data are mean±SD, n=2 independent replicates.
SEQUENCE LISTING
The nucleic and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand. The Sequence Listing is submitted as an ASCII text file, created on Mar. 9, 2022, 62,500 bytes, which is incorporated by reference herein. In the accompanying sequence listing:
SEQ ID NO: 1 is the amino acid sequence of human PDGFRA isoform 1 (deposited under GenBank Accession No. NM_006206.4).
SEQ ID NO: 2 is the nucleotide sequence of human PDGFRA isoform 1 (deposited under GenBank Accession No. NM_006206.4).
SEQ ID NO: 3 is the amino acid sequence of glycoprotein O from CMV strain
TB40/E (deposited under GenBank Accession No. ABV71596.1).
SEQ ID NO: 4 is the amino acid sequence of glycoprotein H from CMV strain TB40/E (deposited under GenBank Accession No. ABV71597.1).
SEQ ID NO: 5 is the amino acid sequence of glycoprotein L from CMV strain TB40/E (deposited under GenBank Accession No. ABV71629.1).
SEQ ID NO: 6 is the amino acid sequence of glycoprotein O from CMV strain Merlin (deposited under GenBank Accession No. AJY56739.1).
SEQ ID NO: 7 is the amino acid sequence of glycoprotein H from CMV strain Merlin (deposited under GenBank Accession No. YP_081523.1).
SEQ ID NO: 8 is the amino acid sequence of glycoprotein L from CMV strain Merlin (deposited under GenBank Accession No. YP_081555.1).
SEQ ID NO: 9 is the amino acid sequence of a peptide linker.
SEQ ID NO: 10 is the amino acid sequence of a peptide linker.
SEQ ID NO: 11 is the amino acid sequence of human IgG1 (deposited under GenBank KY432415.1).
SEQ ID NO: 12 is the amino acid sequence of a hemagglutinin (HA) leader sequence.
SEQ ID NO: 13 is the amino acid sequence of a peptide linker.
SEQ ID NO: 14 is the amino acid sequence of human PDGFRβ isoform 1 (deposited under GenBank NM_002609.3).
SEQ ID NO: 15 is the amino acid sequence of human IgG3 (deposited under GenBank P01860.2).
SEQ ID NO: 16 is the nucleotide sequence of a PDGFRA gene-specific oligonucleotide.
SEQ ID NO: 17 is the amino acid sequence of a fusion protein that includes the PDGFRα signal peptide and ectodomain, a linker and human IgG1 Fc.
DETAILED DESCRIPTION
I. Terms and Methods
Unless otherwise noted, technical terms are used according to conventional usage. Definitions of common terms in molecular biology may be found in Benjamin Lewin, Genes X, published by Jones & Bartlett Publishers, 2009; and Meyers et al. (eds.), The Encyclopedia of Cell Biology and Molecular Medicine, published by Wiley-VCH in 16 volumes, 2008; and other similar references.
As used herein, the singular forms “a,” “an,” and “the,” refer to both the singular as well as plural, unless the context clearly indicates otherwise. For example, the term “a polypeptide” includes single or plural polypeptides and can be considered equivalent to the phrase “at least one polypeptide.” As used herein, the term “comprises” means “includes.” It is further to be understood that any and all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for descriptive purposes, unless otherwise indicated. Although many methods and materials similar or equivalent to those described herein can be used, particular suitable methods and materials are described herein. In case of conflict, the present specification, including explanations of terms, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. To facilitate review of the various embodiments, the following explanations of terms are provided:
Administration: To provide or give a subject an agent, such as a modified human PDGFR-α polypeptide, by any effective route. Exemplary routes of administration include, but are not limited to, oral, injection (such as subcutaneous, intramuscular, intradermal, intraperitoneal, intratumoral, and intravenous), transdermal, intranasal, and inhalation routes.
Contacting: Placement in direct physical association; includes both in solid and liquid form.
CMV (cytomegalovirus): A genus of viruses in the family Herpesviridae and subfamily Betaherpesviriniae having a large (˜230 kB) double-stranded DNA genome. In most people, CMV infection is asymptomatic, but this virus can cause severe disease in immunocompromised or immunosuppressed subjects. Additionally, CMV infection of newborns can cause life-long neurological complications (Dollard et al., Rev Med Virol. 2007 September; 17(5):355-363; Kenneson and Cannon, Rev Med Virol. 2007 July; 17(4):253-276), including hearing and vision loss, seizures, behavioral disorders, and developmental delays (Grosse et al., J Clin Virol. 2008 February; 41(2):57-62; Suzuki et al., Brain Dev. 2008 June; 30(6):420-424; Zhang et al., J Clin Virol. 2007 November; 40(3):180-185; Coats et al., J AAPOS. 2000 April; 4(2):110-116; Gentile et al., In Vivo. 2017 May; 31(3):467-473). Human CMV is also known as human herpesvirus 5 (HHV-5). Human CMV expresses a trimeric glycoprotein complex comprised of gL, gH and gO, which is required for entry into fibroblasts cells, as well as a pentameric complex comprised of gH, gL, pUL128, pUL130 and pUL131A, which is required for entry into endothelial/epithelial cells.
Fusion protein: A protein comprising at least a portion of two different (heterologous) proteins. In some embodiments herein, a fusion protein includes a modified PDGFR-α polypeptide and a heterologous protein, such as an Fc protein.
Heterologous: Originating from a separate genetic source or species.
Pharmaceutically acceptable carriers: The pharmaceutically acceptable carriers of use are conventional. Remington: The Science and Practice of Pharmacy, The University of the Sciences in Philadelphia, Editor, Lippincott, Williams, & Wilkins, Philadelphia, Pa., 21st Edition (2005), describes compositions and formulations suitable for pharmaceutical delivery of the polypeptides and other compositions disclosed herein. In general, the nature of the carrier will depend on the particular mode of administration being employed. For instance, parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle. For solid compositions (such as powder, pill, tablet, or capsule forms), conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate. In addition to biologically neutral carriers, pharmaceutical compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
Platelet-derived growth factor receptor alpha (PDGFRα): A cell-surface tyrosine kinase receptor for members of the PDGF growth factor family. Exemplary amino acid and nucleic acid sequences of human PDGFRα are publicly accessible, such as under NCBI Gene ID 5156 (for example, GenBank Accession No. NM_006206), and include the sequences set forth herein as SEQ ID NO: 1 (amino acid) and SEQ ID NO: 2 (nucleic acid).
Polypeptide, peptide and protein: Refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component. As used herein the term “amino acid” includes natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics.
Preventing, treating or ameliorating a disease: “Preventing” a disease refers to inhibiting the full development of a disease. “Treating” refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition after it has begun to develop. “Ameliorating” refers to the reduction in the number or severity of signs or symptoms of a disease.
Replication: The ability of a virus to produce progeny, including mature infectious progeny. Methods that can be used to determine replication of a virus include but are not limited to infectious center assays, viral titer by TCID50 (tissue-culture infectious doses 50%) or plaque assay, replication in single-step growth curves, or expression measurement of viral nucleic acids or proteins.
Subject: Living multi-cellular vertebrate organisms, a category that includes both human and veterinary subjects, including human and non-human mammals.
Therapeutically effective amount: A quantity of a specific substance (such as a modified human PDGFR-α, polypeptide) sufficient to achieve a desired effect in a subject being treated. For instance, this can be the amount necessary to inhibit CMV replication or reduce CMV titer in a subject. In one embodiment, a therapeutically effective amount is the amount necessary to inhibit CMV replication by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% (as compared to the absence of treatment). In another embodiment, a therapeutically effective amount is the amount necessary to reduce CMV titer in a subject by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% (as compared to the absence of treatment). The therapeutically effective amount can also be the amount necessary to reduce or eliminate one of more symptoms of CMV infection, or reduce or eliminate transmission of CMV from a pregnant female to an infant. For example, in some embodiments, a therapeutically effect amount is the amount necessary to reduce the risk of transmission of CMV by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% (as compared to the absence of treatment).
Vector: A nucleic acid molecule as introduced into a host cell, thereby producing a transformed host cell. A vector may include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication. A vector may also include one or more selectable marker genes and other genetic elements known in the art. In some embodiments, the vector is a virus vector, such as a lentivirus vector.
II. Introduction
The identification of platelet-derived growth factor receptor a (PDGFRα) as a CMV receptor has generated excitement towards the discovery of new therapeutics that inhibit virus-host cell attachment and entry. Two glycoprotein complexes on the CMV surface drive broad host cell tropism (Gerna et al., Vaccines (Basel). 2019 Jul. 22; 7(3):70; Sinzger et al., Curr Top Microbiol Immunol. 2008; 325:63-83). A pentameric complex of glycoprotein H (gH; UL75), gL (UL115), UL128, UL130 and UL131A mediates entry into epithelial and endothelial cells (Hahn et al., J Virol. 2004 September; 78(18):10023-10033; Wang and Shenk, Proc Natl Acad Sci USA. 2005 Dec. 13; 102(50):18153-18158; Wang and Shenk, J Virol. 2005 August; 79(16):10330-10338; Ryckman et al., Proc Natl Acad Sci USA. 2008 Sep. 16; 105(37):14118-14123; Ryckman et al., J Virol. 2008 January; 82(1):60-70; Adler et al., J Gen Virol. 2006 September; 87(Pt 9):2451-2460), possibly through engagement of neuropilin-2 (Martinez-Martin et al., Cell. 2018 Aug. 23; 174(5):1158-1171.e19) or the olfactory receptor OR14I1 (Xiaofei et al., Proc Natl Acad Sci USA. 2019 Apr. 2; 116(14):7043-7052) on the host cell.
A trimeric complex of gH, gL and gO (UL74) is sufficient for CMV entry into fibroblasts, and is also necessary for entry into other cell types by promoting membrane fusion (Huber and Compton, J Virol. 1998 October; 72(10):8191-8197; Huber and Compton, J Virol. 1999 May; 73(5):3886-3892; Zhou et al, J Virol. 2015 September; 89(17):8999-9009). Multiple lines of evidence indicate that PDGFRα is the receptor for the trimer. Decreased PDGFRα expression reduces CMV entry into fibroblasts (Kabanova et al., Nat Microbiol. 2016 Jun. 6; 1(8):16082; Soroceanu and Akhavan, Nature. 2008 Sep. 18; 455(7211):391-395; Wu et al., PLoS Pathog. 2017 April; 13(4):e1006281; Wu et al., Proc Natl Acad Sci USA. 2018 Oct. 16; 115(42):E9889—E9898); gO can specifically bind PDGFRα-expressing cells (Wu et al., PLoS Pathog. 2017 April; 13(4):e1006281); a quaternary complex of soluble extracellular regions (gH-gL-gO-PDGFRα) can be purified in vitro and the components bind with high nanomolar affinity (Martinez-Martin et al., Cell. 2018 Aug. 23; 174(5):1158-1171.e19; Kabanova et al., Nat Microbiol. 2016 Jun. 6; 1(8):16082); CMV strains lacking the trimer do not use PDGFRα to infect cells (Wu et al., PLoS Pathog. 2017 April; 13(4):e1006281; Stegmann et al., PLoS Pathog. 2017 April; 13(4):e1006273); and the extracellular domain of PDGFRα blocks virus entry (Martinez-Martin et al., Cell. 2018 Aug. 23; 174(5):1158-1171.e19; Wu et al., PLoS Pathog. 2017 April; 13(4):e1006281; Stegmann et al., PLoS Pathog. 2017 April; 13(4):e1006273). This has led to the soluble domain of PDGFRα or derivative fragments thereof being explored as antiviral biological agents (Wu et al., PLoS Pathog. 2017 April; 13(4):e1006281; Stegmann et al., PLoS Pathog. 2017 April; 13(4):e1006273), as any mutations in CMV to escape receptor-based inhibitors would likely decrease binding to the natural receptor and attenuate virulence. Soluble PDGFRα ectodomain effectively blocks virus entry whether applied pre- or post-cell attachment, due to inhibition of both early attachment and fusion steps (Wu et al., PLoS Pathog. 2017 April; 13(4):e1006281; Stegmann et al., PLoS Pathog. 2017 April; 13(4):e1006273). Furthermore, soluble PDGFRα inhibits cell entry at low concentrations when only a minor fraction of glycoprotein trimer is bound, and blocks entry by multiple CMV strains that express both trimer and pentamer complexes (Wu et al., PLoS Pathog. 2017 April; 13(4):e1006281; Stegmann et al., PLoS Pathog. 2017 April; 13(4):e1006273).
While appealing, the use of soluble PDGFRα to treat CMV in a human patient comes with associated risks. PDGFRα is an important receptor for platelet-derived growth factors (PDGFs), and regulates cellular proliferation, differentiation and development of multiple tissues during embryogenesis and onwards through adulthood (Andrae et al., Genes Dev. 2008 May 15; 22(10):1276-1312). The PDGF ligands are small polypeptides that covalently associate in disulfide-bonded homo- and heterodimers, which display differing activities towards PDGFRα and its close relative PDGFRβ (Chen et al., Biochim Biophys Acta. 2013 October; 1834(10):2176-2186). Four ligands interact with PDGFRα with high affinity—PDGF-AA, AB, BB, and CC (Fretto et al., J Biol Chem. 1993 Feb. 15; 268(5):3625-3631; Li et al., Nat Cell Biol. 2000 May; 2(5):302-309)—and bind two receptor chains at opposing ends to form a receptor-ligand dimer-receptor signaling complex (Shim et al., Proc Natl Acad Sci USA. 2010 Jun. 22; 107(25):11307-11312; Chen et al., J Mol Biol. 2015 Dec. 4; 427(24):3921-3934). PDGFs compete with the CMV trimer for PDGFRα binding and block infection (Soroceanu and Akhavan, Nature. 2008 Sep. 18; 455(7211):391-395; Wu et al., PLoS Pathog. 2017 April; 13(4):e1006281), indicating that either there is steric hinderance, the respective interaction sites are at least partially overlapping, or binding-induced conformational effects are incompatible with multiple ligands binding simultaneously. Treatment with soluble PDGFRα therefore risks disrupting essential physiological signaling with potentially severe consequences for a developing infant, while sequestration of the administered protein by endogenous PDGFs will further limit efficacy. Ideally, mutations in the receptor will exist that knock out PDGF interactions while keeping intact the site or sites engaged by CMV.
A high resolution crystal structure of PDGF-BB-bound PDGFRβ has illuminated atomic details of ligand-receptor interactions in the family, revealing a predominantly hydrophobic interface at the crevice between the second (D2) and third (D3) extracellular domains of the receptor (Shim et al., Proc Natl Acad Sci USA. 2010 Jun. 22; 107(25):11307-11312). However, the binding site for gO is ambiguous. Cryo-electron microscopy suffers from conformational diversity and low resolution (Kabanova et al., Nat Microbiol. 2016 Jun. 6; 1(8):16082); PDGFRα peptide fragment analysis failed to discover any one peptide solely responsible for high affinity binding (Stegmann et al., PLoS Pathog. 2017 April; 13(4):e1006273); and while domain deletions have shown PDGFRα-D3 is important (Wu et al., Proc Natl Acad Sci USA. 2018 Oct. 16; 115(42):E9889—E9898), such studies have coarse resolution. The absence of detailed structural information on the CMV trimer-PDGFRα complex means the engineering of CMV-specific receptors orthogonal to human biology remains an unmet need.
The present disclosure solves this problem through the use of mutagenesis and in vitro selection. By tracking the enrichment or depletion of sequence variants in a diverse library using next generation sequencing, the relative phenotypes of thousands of mutations can be simultaneously assessed in a single experiment, referred to as deep mutagenesis (Fowler and Fields, Nat Methods. 2014 August; 11(8):801-807). Deep mutational scans have been used to address and engineer specificity in proteins that promiscuously bind multiple ligands (Berger et al., Elife. 2016 Nov. 2; 5:1422; Procko et al., Cell. 2014 Jun. 19; 157(7):1644-1656; Wrenbeck et al., Nat Commun. 2017 Jun. 6; 8(1):15695), and methods for deep mutagenesis of membrane proteins expressed in human cells have been optimized (Park et al., J Biol Chem. 2019; 294(13):4759-4774; Heredia et al., J Immunol. 2018 Apr. 20; 200(11):ji1800343-3839; Heredia et al., J Virol. 2019 Jun. 1; 93(11):e00219-19). By screening through all possible single amino acid substitutions in the D2-D3 domains, it was discovered that, unlike PDGF binding, CMV trimer interactions persist when PDGFRα conformation is disrupted by mutations within the folded core. And more relevant to therapeutic design, specific mutations are also identified on the PDGFRα surface that enhance trimer binding in the presence of high PDGF concentrations.
III. Overview of Embodiments
Described herein are modified human PDGFRα polypeptides that retain the capacity to bind a CMV trimer comprised of gH, gL and gO, but exhibit reduced binding to one or more PDGF ligands, such as PDGF-AA, PDGF-AB, PDGF-BB and/or PDGF-CC compared to wild type PDGFRα. In particular, provided herein are modified PDGFRα polypeptides that include a human PDGFRα or an extracellular fragment thereof. The polypeptides include at least one amino acid substitution relative to a wild-type human PDGFRα (such as isoform 1 of human PDGFRα set forth herein as SEQ ID NO: 1) and retain the capacity to bind a CMV trimer comprised of gH, gL and gO (or exhibit increased binding to the trimer), but exhibit reduced binding (or lack the ability to bind) to one or more PDGF ligands compared to wild type PDGFRα.
In some embodiments, the at least one (e.g., at least one, at least two, at least three, at least four, at least five, or more) amino acid substitution is selected from any of the substitutions shown in Table 1.
In some embodiments, the at least one amino acid substitution is a residue located at the binding interface of PDGFRα and PDGF. In some examples, the at least one amino acid substitution is at a residue corresponding to residue 137, 139, 185, 206, 208, 242, 261 or 271 of human PDGFRα of SEQ ID NO: 1. In specific non-limiting examples, the at least one amino acid substitution is selected from the group consisting of L137A, L137S, L137T, L137N, L137Q, L137D, L137E, L137K, L137R, L137G, L137C, I139E, G185K, G185R, Y206S, Y206T, Y206Q, Y206D, Y206E, Y206K, Y206R, Y206P, Y206G, Y206C, L208N, L208Q, L208D, L208E, L208K, L208R, L208C, V242A, V242S, V242T, V242N, V242Q, V242D, V242E, V242K, V242R, V242P, V242G, V242C, L261K, L261R, L261P, L261C, L271V, L271A, L271S, L271T, L271N, L271Q, L271D, L271E, L271K, L271R, L271H, L271W, L271Y, L271F, L271P, L271G and L271C, with reference to SEQ ID NO: 1. In particular non-limiting examples, the amino acid substitution is selected from the group consisting of L137K, L137Q, Y206S, V242K and V242T.
In some embodiments, the modified polypeptides contain only a single amino acid substitution relative to a wild-type human PDGFRα (such as isoform 1 of human PDGFRα set forth herein as SEQ ID NO: 1), such as one amino acid substitution listed in Table 1. In other examples, the modified polypeptides include two, three, four, five or more amino acid substitutions, such as two, three, four, five or more amino acid substitutions listed in Table 1. In specific examples, the modified polypeptide includes only a single substitution at residue 137, 139, 185, 206, 208, 242, 261 or 271 of human PDGFRα of SEQ ID NO: 1. In other specific examples, the modified polypeptide includes two, three, four or five amino acid substitutions at residues selected from the group consisting of residues 137, 139, 185, 206, 208, 242, 261 and 271 of human PDGFRα of SEQ ID NO: 1. In particular non-limiting examples, the single substitution is selected from the group consisting of L137K, L137Q, Y206S, V242K and V242T.
In some embodiments, the modified polypeptides are full-length human PDGFRα polypeptides. In some examples, the amino acid sequence of the polypeptide is at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8% or at least 99.9% identical to SEQ ID NO: 1 and includes at least one amino acid substitution disclosed herein.
In other embodiments, the modified polypeptides consist of an extracellular fragment of human PDGFRα. For example, the modified polypeptide can consist of the complete extracellular domain of human PDGFRα, such as domains D2 and D3, for example corresponding to amino acid residues 24-524 of SEQ ID NO: 1, or the modified polypeptides can consist of a portion of the extracellular domain, such as about 200 amino acids, about 250 amino acids, about 300 amino acids, about 350 amino acids, about 400 amino acids or about 450 amino acids of the extracellular domain. In some examples, the amino acid sequence of the extracellular fragment is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95% at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8% or at least 99.9% identical to residues 24 to 524 of SEQ ID NO: 1 and includes at least one amino acid substitution disclosed herein.
Also provided are fusion proteins that include a modified PDGFRα polypeptide disclosed herein and a heterologous polypeptide. In some embodiments, the heterologous polypeptide is an Fc protein or a protein that can be used as a diagnostic/detection reagent, such as a fluorescent protein (for example, GFP) or an enzyme (for example, alkaline phosphatase, horse radish peroxidase or luciferase). In some embodiments, the heterologous polypeptide is an antibody or antigen-binding protein for avid binding to a second CMV antigen. In some embodiments, the heterologous polypeptide is an antibody or antigen-binding protein for tethering to cells or cellular surroundings (for example, to recruit immune cells). In some embodiments, the heterologous polypeptide is a cytokine, ligand or receptor for evoking a biological response. In some embodiments, the heterologous polypeptide is a protein that increases the serum half-life (for example, antibody Fc or serum albumin). In some examples, the heterologous polypeptide comprises an Fc protein, such as IgG1 Fc or a portion thereof. In specific examples, the fusion protein comprises or consists of SEQ ID NO: 17.
Compositions that include a modified PDGFRα polypeptide or fusion protein thereof and a pharmaceutically acceptable carrier are also provided.
Further provided is an in vitro method of inhibiting CMV replication by contacting the CMV with a modified PDGFRα polypeptide or fusion protein disclosed herein. In some examples, CMV-infected cells (such as cultured cell lines or primary cells) are contacted with the modified PDGFRα polypeptide, such as to test the effect of the modified polypeptide on CMV replication.
Methods of inhibiting CMV replication and/or spread in a subject are also provided. In some embodiments, the method includes administering to the subject a therapeutically effective amount of a modified PDGFRα polypeptide, fusion protein or composition disclosed herein. Also provided is a method of treating a CMV infection in a subject, comprising administering to the subject a therapeutically effective amount of a modified PDGFRα polypeptide, fusion protein, or composition disclosed herein. In some examples, the subject is a female subject who is pregnant. In some examples, the subject is an infant, such as an infant whose mother is positive for CMV. In some examples, the subject has an immunodeficiency or is immunosuppressed. In other examples, the subject is a transplant recipient.
Also provided are nucleic acid molecules and vectors that encode a modified PDGFRα polypeptide or fusion protein disclosed herein. In some examples, the nucleic acid molecules and vectors have different codon usage or may be codon optimized for expression in human cells. In some examples, the nucleic acid molecules and vectors encode different isoforms of PDGFRα polypeptide. In some examples, the nucleic acid molecules and vectors carry natural human polymorphisms.
Further provided are compositions that include a nucleic acid molecule or vector disclosed herein and a pharmaceutically acceptable carrier.
Methods of inhibiting CMV replication and/or spread in a subject by administering a therapeutically effective amount of a nucleic acid molecule, vector, or composition disclosed herein are further provided. Further provided are methods of treating a CMV infection in a subject, comprising administering to the subject a therapeutically effective amount of a nucleic acid molecule, vector or composition disclosed herein. In some examples, the subject is a female subject who is pregnant. In some embodiments, the subject is an infant, such as an infant whose mother is positive for CMV. In some examples, the subject has an immunodeficiency or is immunosuppressed. In other examples, the subject is a transplant recipient.
IV. Embodiments
Embodiment 1. A modified platelet-derived growth factor receptor alpha (PDGFRα) polypeptide, comprising a human PDGFRα or an extracellular fragment thereof, wherein the polypeptide comprises at least one amino acid substitution relative to wild-type human PDGFRα, and retains the capacity to bind a cytomegalovirus (CMV) trimer comprised of glycoprotein H (gH), gL and gO, but exhibits reduced binding to one or more platelet-derived growth factor (PDGF) ligands compared to wild type PDGFRα.
Embodiment 2. The modified polypeptide of embodiment 1, wherein the at least one amino acid substitution is a substitution selected from Table 1.
Embodiment 3. The modified polypeptide of embodiment 1 or embodiment 2, wherein the at least one amino acid substitution is a residue located at the interface of PDGFRα and PDGF.
Embodiment 4. The modified polypeptide of embodiment 3, wherein the at least one amino acid substitution is at residue 137, 139, 185, 206, 208, 242, 261 or 271 of human PDGFRα of SEQ ID NO: 1.
Embodiment 5. The modified polypeptide of embodiment 3 or embodiment 4, wherein the at least one amino acid substitution is selected from the group consisting of L137A, L137S, L137T, L137N, L137Q, L137D, L137E, L137K, L137R, L137G, L137C, I139E, G185K, G185R, Y206S, Y206T, Y206Q, Y206D, Y206E, Y206K, Y206R, Y206P, Y206G, Y206C, L208N, L208Q, L208D, L208E, L208K, L208R, L208C, V242A, V242S, V242T, V242N, V242Q, V242D, V242E, V242K, V242R, V242P, V242G, V242C, L261K, L261R, L261P, L261C, L271V, L271A, L271S, L271T, L271N, L271Q, L271D, L271E, L271K, L271R, L271H, L271W, L271Y, L271F, L271P, L271G and L271C, with reference to SEQ ID NO: 1.
Embodiment 6. The modified polypeptide of any one of embodiments 1-5, having a single amino acid substitution relative to human PDGFRα of SEQ ID NO: 1.
Embodiment 7. The modified polypeptide of embodiment 6, wherein the single amino acid substitution is selected from the group consisting of L137K, L137Q, Y206S, V242K and V242T.
Embodiment 8. The modified polypeptide of any one of embodiments 1-7, comprising full-length human PDGFRα.
Embodiment 9. The modified polypeptide of embodiment 8, wherein the amino acid sequence of the polypeptide is at least 95% identical to SEQ ID NO: 1.
Embodiment 10. The modified polypeptide of embodiment 8, wherein the amino acid sequence of the polypeptide is at least 99% identical to SEQ ID NO: 1.
Embodiment 11. The modified polypeptide of any one of embodiments 1-7, wherein the polypeptide consists of an extracellular fragment of human PDGFRα.
Embodiment 12. The modified polypeptide of embodiment 11, wherein the extracellular fragment corresponds to residues 24 to 524 of human PDGFRα.
Embodiment 13. The modified polypeptide of embodiment 11 or embodiment 12, wherein the amino acid sequence of the extracellular fragment is at least 95% identical to residues 24 to 524 of SEQ ID NO: 1.
Embodiment 14. The modified polypeptide of embodiment 11 or embodiment 12, wherein the amino acid sequence of the extracellular fragment is at least 99% identical to residues 24 to 524 of SEQ ID NO: 1.
Embodiment 15. A fusion protein comprising the modified polypeptide of any one of embodiments 1-14 and a heterologous polypeptide.
Embodiment 16. The fusion protein of embodiment 15, wherein the heterologous polypeptide is an Fc protein, a fluorescent protein, an enzyme, an antibody or antigen-binding protein, a cytokine, a cellular ligand or receptor, or serum albumin.
Embodiment 17. The fusion protein of embodiment 15 or embodiment 16, comprising the amino acid sequence of SEQ ID NO: 17.
Embodiment 18. A composition comprising the modified polypeptide of any one of embodiments 1-14, or the fusion protein of any one of embodiments 15-17, and a pharmaceutically acceptable carrier.
Embodiment 19. An in vitro method of inhibiting CMV replication, comprising contacting the CMV with the modified polypeptide of any one of embodiments 1-14, the fusion protein of any one of embodiments 15-17, or the composition of embodiment 18.
Embodiment 20. A method of inhibiting CMV replication and/or spread in a subject, comprising administering to the subject a therapeutically effective amount of the modified polypeptide of any one embodiments 1-14, the fusion protein of any one of embodiments 15-17, or the composition of embodiment 18, thereby inhibiting CMV replication and/or spread in the subject.
Embodiment 21. A method of treating or inhibiting CMV infection in a subject, comprising administering to the subject a therapeutically effective amount of the modified polypeptide of any one embodiments 1-14, the fusion protein of any one of embodiments 15-17, or the composition of embodiment 18, thereby treating or inhibiting CMV infection in the subject.
Embodiment 22. A nucleic acid molecule encoding the modified polypeptide of any one of embodiments 1-14 or the fusion protein of any one of embodiments 15-17.
Embodiment 23. A vector comprising the nucleic acid molecule of embodiment 22.
Embodiment 24. A composition comprising the nucleic acid molecule of embodiment 22 or the vector of embodiment 23, and a pharmaceutically acceptable carrier.
Embodiment 25. A method of inhibiting CMV replication and/or spread in a subject, comprising administering to the subject a therapeutically effective amount of the nucleic acid molecule of embodiment 22, the vector of embodiment 23, or the composition of embodiment 24, thereby inhibiting CMV replication and/or spread in the subject.
Embodiment 26. A method of treating or inhibiting CMV infection in a subject, comprising administering to the subject a therapeutically effective amount of the nucleic acid molecule of embodiment 22, the vector of embodiment 23, or the composition of embodiment 24, thereby treating or inhibiting CMV infection in the subject.
Embodiment 27. The method of any one of embodiments 19, 20, 25 and 26, wherein the subject is (i) a female subject who is pregnant; (ii) an infant whose mother is positive for CMV; (iii) a subject with an immunodeficiency; (iv) a transplant recipient; or (v) a subject who is immunosuppressed.
The following examples are provided to illustrate certain particular features and/or embodiments. These examples should not be construed to limit the disclosure to the particular features or embodiments described.
EXAMPLES
Example 1: A Deep Mutational Scan of PDGFRα D2-D3 Domains for Trimer Binding in the Presence of PDGFs
The glycoprotein trimer from CMV strain TB40/E (BAC4 clone, Sinzger et al., J Gen Virol. 2008 February; 89(Pt 2):359-368) was expressed in Expi293F cells, a suspension derivative of human HEK 293. The transmembrane helix of gH was deleted to produce a soluble complex, and the gO subunit, which directly contacts PDGFRα (Kabanova et al., Nat Microbiol. 2016 Jun. 6; 1(8):16082; Wu et al., PLoS Pathog. 2017 April; 13(4):e1006281; Stegmann et al., J Virol. 2019 Jun. 1; 93(11):93), was fused at its C-terminus to superfolder GFP (sfGFP; Pédelacq et al., Nat Biotechnol. 2006 January; 24(1):79-88) for fluorescence detection. Medium from gH/gL/gO-sfGFP expressing cells was incubated with Expi293F cells transfected with an episomal plasmid encoding PDGFRα. Trimer binding was proportional to PDGFRα surface expression (determined by flow cytometry using antibody staining of an extracellular c-myc epitope tag at the PDGFRα N-terminus; FIGS. 1A and 1B), and was inhibited by co-incubation with an equimolar mixture of PDGF-AA, AB, BB, and CC (FIG. 1D). Medium from cells expressing gO-sfGFP alone, either the wild-type sequence or carrying the mutation C351S (C343S based on numbering of gO from the TB40/E strain) to remove the exposed cysteine that would ordinarily form a disulfide to gL-C144 (Ciferri et al., Proc Natl Acad Sci USA 112: 1767-1772, 2015), failed to display high binding signal to PDGFRα positive cells (FIG. 7 ). The binding signal is therefore dependent on co-expression with gH and gL, suggesting that it is trimer as opposed to monomeric gO that engages the receptor.
A single site-saturation mutagenesis (SSM) library of PDGFRα was constructed encompassing all single amino acid mutations in the D2-D3 domains (a.a. D123-E311), and transfected into Expi293F cells under conditions that typically yield no more than one sequence variant per cell, providing a tight link between genotype and phenotype (Heredia et al., J Immunol. 2018 Apr. 20; 200(11):ji1800343-3839). When incubated with gH/gL/gO-sfGFP medium at subsaturating dilutions, cells expressing the SSM library were indistinguishable from cells expressing wild-type PDGFRα (FIGS. 1B and 1C). Typically, many mutations adversely impact protein activity through destabilization of folded structure or damage to functional sites, and loss-of-function variants tend to dominate naïve libraries prior to any selection. The finding that deleterious mutations were not prevalent in the naïve SSM library indicated that CMV trimer binding is resistant to most single non-synonymous mutations in the PDGFRα D2-D3 domains.
By comparison, many cells expressing the SSM library displayed higher trimer binding in the presence of PDGFs than cells expressing wild-type PDGFRα (FIGS. 1E and 1F). Thus, there appeared to be many PDGFRα mutations that selectively lost PDGF affinity. To identify these mutations, PDGFRα-expressing cells that had elevated CMV trimer binding in the presence of competing PDGFs were collected by fluorescence-activated cell sorting (FACS). This is referred to as the UL74-High sort (see green gate in FIG. 1F). Within the same experiment, cells expressing PDGFRα but displaying low trimer binding were also collected, referred to as the UL74-Low sort (see FIG. 1F). PDGFRα mutants that lose affinity for trimer, or have enhanced affinity for competing PDGFs, were preferentially enriched in the UL74-Low sort. PDGFRα mutants that fail to express were depleted from both sorted populations. Following Illumina sequencing of the naïve plasmid library and transcripts from the sorted populations, the enrichment ratios for all 3,780 substitutions in the D2-D3 domains were calculated to define a local mutational landscape (FIG. 2A). Data from independent replicates are highly correlated (FIGS. 2B-2G), indicating the data are accurate.
Example 2: PDGF Interactions are Uniquely Sensitive to Mutational Disruption of Folded Structure in the D2-D3 Domains
Enrichment ratios for nonsynonymous mutations are anticorrelated between the UL74-High and UL74-Low sorts, with few mutations other than premature stop codons being depleted in both selections. Hence, substitution mutations in PDGFRα D2-D3 domains suffer little cost to surface localization, even though many mutations will almost certainly destabilize the domain fold. This differs markedly from a prior mutational scan of a multidomain membrane protein expressed in human cells, where nonconservative mutations buried within folded structure prevented protein trafficking to the plasma membrane due to intracellular retention by quality control machinery (Park et al., J Biol Chem. 2019; 294(13):4759-4774). When mapping experimental conservation scores to the structure of PDGF-bound PDGFRα (modeled from the crystal structure of PDGF-BB-bound PDGFRβ; PDB ID 3MJG; Shim et al., Proc Natl Acad Sci USA. 2010 Jun. 22; 107(25):11307-11312), enriched mutations are found to cluster to buried core positions and the PDGF interface (FIGS. 3A-3E). These include substitutions that create cavities, steric clashes, and/or introduce buried ionizable groups; these mutations are incompatible with biophysical principles governing protein folding and will destabilize folded structure. PDGFRα mutants with disrupted structure have therefore preferentially lost affinity to PDGFs, thereby reducing competition and enhancing binding of the CMV trimer. The epitope bound by the HCMV trimer is ambiguous from the data (FIG. 8 ), but must be at least partially independent of proper D2-D3 conformation, although partial structure may remain. This is consistent with either key contacts to the HCMV trimer residing on linear PDGFRα segments and loops, similar to how many antibodies recognize conformation-independent epitopes, or with favorable interactions to the HCMV trimer being distributed over a broad surface (possibly even beyond the D2-D3 domains) such that localized disruptions are tolerated. Libraries encompassing double or higher order PDGFRα, mutations may further resolve details of the binding mechanism.
Table 1 provides a list of PDGFRα mutations that exhibited reduced competition from PDGF for binding to CMV.
| TABLE 1 |
| |
| PDGFRα mutants with |
| reduced competition from PDGF for binding to CMV |
| |
| |
| V126P |
R151A |
C189M |
L214S |
N239I |
L261K * |
| F128A |
R151P |
C189L |
L214N |
N239V |
L261R * |
| F128D |
R151C |
C189I |
L214Q |
N239A |
L261P * |
| F128E |
T153C |
C189V |
L214R |
N239S |
L261C * |
| K128K |
D154T |
C189A |
L214H |
N239T |
E262P |
| F128P |
P155C |
C189S |
L214Y |
N239P |
K270P |
| D135M |
E156P |
C189T |
L214P |
N240D |
L271V * |
| D135L |
T157E |
C189N |
L214C |
N240E |
L271A * |
| D135I |
T157C |
C189Q |
L216D |
N240K |
L271S * |
| D135V |
V159D |
C189D |
L216E |
N240R |
L271T * |
| L137A * |
V159E |
C189E |
L216K |
N240W |
L271N * |
| L137S * |
V159W |
C189K |
L216R |
N240Y |
L271Q * |
| L137T * |
V159G |
C189R |
L216G |
N240F |
L271D * |
| L137N * |
V159C |
C189H |
L216C |
N240P |
L271E * |
| L137Q * |
T160P |
C189W |
E217P |
E241G |
L271K * |
| L137D * |
L161A |
C189P |
M218D |
V242A * |
L271R * |
| L137E * |
L161T |
C189G |
M218K |
V242S * |
L271H * |
| L137K * |
L161Q |
A191P |
M218R |
V242T * |
L271W* |
| L137R * |
L161D |
G195P |
M218P |
V242N * |
L271Y * |
| L137G * |
L161E |
F203D |
V224G |
V242Q * |
L271F* |
| L137C * |
L161R |
F203E |
Y225S |
V242D * |
L271P* |
| V138D |
L161W |
F203K |
Y225E |
V242E * |
L271G * |
| V138E |
L161G |
F203R |
Y225K |
V242K * |
L271C * |
| V138H |
L161C |
F203P |
Y225R |
V242R * |
V272P |
| V138P |
N163P |
F203G |
Y225P |
V242P * |
Y273E |
| V138G |
Y172M |
V205Q |
Y225G |
V242G * |
Y273K |
| V138C |
Y172V |
V205R |
K226D |
V242C * |
Y273R |
| I139E * |
Y172D |
V205H |
K226W |
V243S |
L275T |
| I147C |
Y172E |
V205C |
K226P |
V243T |
V277T |
| I148R |
R175C |
Y206S * |
E229T |
V243N |
C290L |
| I148H |
G177T |
Y206T * |
I231A |
V243Q |
C290V |
| C150M |
G177Q |
Y206Q * |
I231K |
V243D |
C290A |
| C150L |
G177K |
Y206D * |
I231C |
V243E |
A292M |
| C150I |
G177R |
Y206E * |
V233K |
V243K |
A292K |
| C150V |
G177P |
Y206K * |
C235A |
V243R |
A292R |
| C150A |
F178D |
Y206R * |
C235D |
V243W |
A292H |
| C150S |
F178R |
Y206P * |
A236P |
V243Y |
A292Y |
| C150T |
F178P |
Y206G * |
V237N |
V243F |
A292F |
| C150N |
G180P |
Y206C * |
V237Q |
V243P |
Q294W |
| C150Q |
F182A |
L208N * |
V237D |
V243G |
Q294Y |
| C150D |
F182T |
L208Q * |
V237E |
V243C |
K303P |
| C150E |
F182P |
L208D * |
V237K |
D244P |
I307Q |
| C150K |
G185K * |
L208E * |
V237R |
L245K |
|
| C150R |
G185R * |
L208K * |
V237H |
L245R |
|
| C150H |
Y187T |
L208R * |
V237W |
L245P |
|
| C150W |
Y187K |
L208C * |
V237Y |
Q246P |
|
| C150Y |
Y187R |
|
V237F |
W247P |
|
| C150F |
I188P |
|
V237P |
W247G |
|
| C150P |
|
|
F238P |
|
|
| C150G |
| |
| * Mutations residing at the PDGFRα-PDGF interface. Other mutations most likely have indirect structural effects. Amino acid numbering is with respect to SEQ ID NO: 1. |
Example 3: Surface Mutations at the PDGF Binding Site Favor PDGFRα Specificity Towards the CMV Trimer
The PDGFRα mutational landscape for high trimer binding in the presence of competing PDGF reveals key surface residues as hot spots for enriched mutations, especially PDGFRα residues L137, L208 and V242 that contact the protruding PDGF subunit, and Y206 which packs between the protruding and receding PDGF subunits (FIGS. 3D and 3E; residue numbers are based on SEQ ID NO: 1). Mutations to these residues will disrupt the PDGFRα-PDGF interface, especially by the addition of polar substitutions that invert the chemical properties of the highly hydrophobic binding site. CMV trimer interactions are persisting in these PDGFRα mutants. Overall, enrichment of mutations for increased HCMV trimer binding in the presence of competing PDGFs is highly correlated to the mutated residue's connectivity within the D2-D3 core or across the PDGFRα-PDGF interface (FIG. 9), emphasizing the selective importance of PDGFRα conformation and surface contacts in the D2-D3 cleft for high affinity PDGF interactions.
Five mutations on the PDGFRα surface (L137K, L137Q and Y206S in D2, and V242K and V242T in D3, with respect to SEQ ID NO: 1) were validated as having desirable binding properties by targeted mutagenesis. As predicted from the deep mutational scan, these PDGFRα variants maintain wild-type levels of binding to CMV trimer from the TB40/E strain, yet have diminished sensitivity to the addition of competing PDGFs, demonstrating successful engineering of specificity towards the viral target (FIGS. 4A and 4B). Since the mechanism of trimer binding to receptor has not been resolved at atomic or even residue-level resolution, it remains uncertain whether the viral genome could mutate to distinguish wild-type from engineered PDGFRα. This concern is partially alleviated by the observation that the engineered PDGFRα mutants maintain high binding to the CMV trimer from the Merlin clinical strain (Stanton et al., J Clin Invest. 2010 September; 120(9):3191-3208) (FIG. 4C), which has relatively high natural sequence variation compared to TB40/E (79% identity between glycoproteins O; compare SEQ ID NO: 3 and SEQ ID NO: 6), especially in the N-terminus of glycoprotein O where important interactions to PDGFRα reside (Stegmann et al., J Virol. 2019 Jun. 1; 93(11):93).
Fusion of soluble proteins to immunoglobulin Fc confers multiple desirable properties for a therapeutic (Czajkowsky et al., EMBO Mol Med 4: 1015-1028, 2012). Multimerized Fc chains impose avidity for enhanced apparent affinity, and Fc moieties are engaged by multiple receptors to enhance serum half-life or evoke effector functions, including complement activation and antibody-dependent cell-mediated cytotoxicity (Czajkowsky et al., EMBO Mol Med 4: 1015-1028, 2012). Soluble PDGFRα fused to the Fc region of human IgG1 was shown to bind HCMV trimer when first identified as its receptor (Kabanova et al., Nat Microbiol 1: 16082, 2016), and the neutralization properties of Fc-fused soluble PDGFRα (sPDGFRα-Fc) have been explored since in greater detail (Wu et al., PLoS Pathog 13: e1006281, 2017). These prior studies used commercially supplied sPDGFRα-Fc featuring a random linker of mixed amino acids that connects to the upper hinge of IgG1, upstream of Cys-220 that would ordinarily form a disulfide to the antibody light chain (FIG. 10A). The nature of this Fc fusion may cause manufacturing liabilities if Cys-220 is exposed and free (this construct is referred to herein as “legacy” sPDGFRα-Fc).
An alternative sPDGFRα-Fc construct was designed that includes the PDGFRα signal peptide (a.a. 1-23 of SEQ ID NO: 1), ectodomain (a.a. 24-524 of SEQ ID NO: 1), a GGGS linker (SEQ ID NO: 10), and human IgG1 Fc beginning at Asp-221 (see SEQ ID NO: 11 and FIG. 10A), yielding the following amino acid sequence:
| (SEQ ID NO: 17) |
| MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCF |
| |
| GESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTC |
| |
| YYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPC |
| |
| RTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQT |
| |
| IPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYP |
| |
| GEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK |
| |
| EMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWL |
| |
| KNNLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNED |
| |
| AVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMIC |
| |
| KDIKKCNNETSWTILANNVSNIITEIHSRDRSTVEGRVTFAKVEETIAVR |
| |
| CLAKNLLGAENRELKLVAPTLRSEGGGSDKTHTCPPCPAPELLGGPSVFL |
| |
| FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR |
| |
| EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ |
| |
| PREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK |
| |
| TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS |
| |
| LSPGK |
Both sPDGFRα-Fc constructs bind membrane-localized HCMV trimer with equal affinity, and subsequent studies focused exclusively on the redesigned fusion protein.
Soluble PDGFRα-Fc was expressed in Expi293F culture, and was isolated by affinity capture and size exclusion chromatography (SEC) to very high purity (FIGS. 10B and 10C). The purified protein was monodisperse by SEC, and the final yield was high (>25 mg/L of transfected culture without any optimization). Soluble PDGFRα-Fc V242K was stressed for 7 days at 40° C., pH 8.5, to promote asparagine deamidation and protein denaturation (Lu et al., MAbs 11: 45-57, 2019), yet remained mostly stable based on the SEC profile (FIG. 11 ). A harsher stress for 14 days at 40° C., pH 5.5, to promote asparagine isomerization and protein denaturation (Lu et al., MAbs 11: 45-57, 2019) caused sPDGFRα-Fc V242K to form soluble aggregates (FIG. 11 ). It was concluded that the protein has moderate stability and is suitable for further manufacturing development.
Two PDGFRα mutations, Y206S and V242K, were explored as Fc-fused soluble orthogonal receptors. Binding of the soluble receptors was measured towards HCMV trimer expressed at the cell surface, with gL and gO subunits tagged at their C-termini with short peptide epitopes, and gH expressed as full-length protein with its native transmembrane domain. The Y206S mutant had reduced binding to HCMV trimer compared to wild-type receptor, but sPDGFRα-Fc V242K bound HCMV trimer from Merlin and TB40/E strains with equal low nanomolar affinity. Aspects of these experiments were replicated with independent protein preparations (FIG. 12A). Furthermore, fusions of wild-type and V242K sPDGFRα with the Fc region of IgG3 also bound similarly to trimer from the TB40/E and Merlin strains (FIGS. 12B and 12C). Compared to IgG1, IgG3 has lower affinity for the neonatal Fc receptor (FcRn), which is associated with reduced serum half-life and placental transfer (Vidarsson et al., Front Immunol 5: 520, 2014; Roopenian et al., J Immunol 170: 3528-3533, 2003). It was speculated that these features may be advantageous in the treatment of pregnant women during acute HCMV infection to achieve a lower dose in the developing fetus, thereby further addressing safety concerns.
To further validate that the engineered receptors have lost growth factor interactions, their ability to inhibit PDGF signaling was assessed. Expi293F cells were transfected with a reporter plasmid encoding wild-type PDGFRα and a destabilized fluorescent protein (EGFP-PEST) (Li et al., J Biol Chem 273: 34970-34975, 1998) under the control of a serum response element (SRE) (Reichhart et al., Angew Chem Int Ed Engl 55: 6339-6342, 2016). Treatment with PDGFs upregulates EGFP-PEST expression, which is inhibited by wild-type sPDGFRα-Fc acting as a decoy receptor (FIG. 5 ). As intended, both sPDGFRα-Fc Y206S and V242K failed to inhibit PDGF signaling (FIG. 5B). However, the engineered receptors, in particular sPDGFRα-Fc Y206S, enhanced the response to PDGF-A ligands, which may be due to a generic ‘carrier protein’ effect (PDGF ligands and their receptors are highly hydrophobic (Shim et al., Proc Natl Acad Sci USA 107: 11307-11312, 2010) and are generally formulated with a carrier such as serum albumin), and non-specific gamma globulin has no such effect (FIG. 13 ).
Human PDGFRα coding sequence (SEQ ID NO: 2) and its translation (SEQ ID NO: 1). Numbers correspond to amino acid residues. Residues at the PDGFRα-PDGF interface that were mutated and found to preferentially retain CMV trimer binding are in bold and underlined.
| |
| atg ggg act tcc cat ccg gcg ttc ctg gtc tta ggc tgt ctt ctc aca ggg ctg agc cta |
|
| M G T S H P A F L V L G C L T G L S L |
20 |
| |
| atc ctc tgc cag ctt tca tta ccc tct atc ctt cca aat gaa aat gaa aag gtt gtg cag |
|
| I L C Q L S L P S I L P N E N E K V Q |
40 |
| |
| ctg aat tca tcc ttt tct ctg aga tgc ttt ggg gag agt gaa gtg agc tgg cag tac ccc |
|
| L N S S F S L R C F G E S E V S W Q Y P |
60 |
| |
| atg tct gaa gaa gag agc tcc gat gtg gaa atc aga aat gaa gaa aac aac agc ggc ctt |
|
| M S E E E S S D V E I R N E E N N S G L |
80 |
| |
| ttt gtg acg gtc ttg gaa gtg agc agt gcc tcg gcg gcc cac aca ggg ttg tac act tgc |
|
| F V T V L E V S S A S A A H T G L Y T C |
100 |
| |
| tat tac aac cac act cag aca gaa gag aat gag ctt gaa ggc agg cac att tac atc tat |
|
| Y Y N H T Q T E E N E L E G R H I Y I Y |
120 |
| |
| gtg cca gac cca gat gta gcc ttt gta cct cta gga atg acg gat tat tta gtc atc gtg |
|
| V P D P D V A F V P L G M T D Y L V I V |
140 |
| |
| gag gat gat gat tct gcc att ata cct tgt cgc aca act gat ccc gag act cct gta acc |
|
| E D D D S A I I P C R T T D P E T P V T |
160 |
| |
| tta cac aac agt gag ggg gtg gta cct gcc tcc tac gac agc aga cag ggc ttt aat ggg |
|
| L H N S E G V V P A S Y D S R Q G F N G |
180 |
| |
| acc ttc act gta ggg ccc tat atc tgt gag gcc acc gtc aaa gga aag aag ttc cag acc |
|
| T F T V G P Y I C E A T V K G K K F Q T |
200 |
| |
| atc cca ttt aat gtt tat gct tta aaa gca aca tca gag ctg gat cta gaa atg gaa gct |
|
| I P F N V Y A L K A T S E L D L E M E A |
220 |
| |
| ctt aaa acc gtg tat aag tca ggg gaa acg att gtg gtc acc tgt gct gtt ttt aac aat |
|
| L K T V Y K S G E T I V V T C A V F N N |
240 |
| |
| gag gtg gtt gac ctt caa tgg act tac cct gga gaa gtg aaa ggc aaa ggc atc aca atg |
|
| E V V D L Q W T Y P G E V K G K G I T M |
260 |
| |
| ctg gaa gaa atc aaa gtc cca tcc atc aaa ttg gtg tac act ttg acg gtc ccc gag gcc |
|
| L E E I K V P S I K L V Y T L T V P E A |
280 |
| |
| acg gtg aaa gac agt gga gat tac gaa tgt gct gcc cgc cag gct acc agg gag gtc aaa |
|
| T V K D S G D Y E C A A R Q A T R E V K |
300 |
| |
| gaa atg aag aaa gtc act att tct gtc cat gag aaa ggt ttc att gaa atc aaa ccc acc |
|
| E M K K V T I S V H E K G F I E I K P T |
320 |
| |
| ttc agc cag ttg gaa gct gtc aac ctg cat gaa gtc aaa cat ttt gtt gta gag gtg cgg |
|
| F S Q L E A V N L H E V K H F V V E V R |
340 |
| |
| gcc tac cca cct ccc agg ata tcc tgg ctg aaa aac aat ctg act ctg att gaa aat ctc |
|
| A Y P P P R I S W L K N N L T L I E N L |
360 |
| |
| act gag atc acc act gat gtg gaa aag att cag gaa ata agg tat cga agc aaa tta aag |
|
| T E I T T D V E K I Q E I R Y R S K L K |
380 |
| |
| ctg atc cgt gct aag gaa gaa gac agt ggc cat tat act att gta gct caa aat gaa gat |
|
| L I R A K E E D S G H Y T I V A Q N E D |
400 |
| |
| gct gtg aag agc tat act ttt gaa ctg tta act caa gtt cct tca tcc att ctg gac ttg |
|
| A V K S Y T F E L L T Q V P S S I L D L |
420 |
| |
| gtc gat gat cac cat ggc tca act ggg gga cag acg gtg agg tgc aca gct gaa ggc acg |
|
| V D D H H G S T G G Q T V R C T A E G T |
440 |
| |
| ccg ctt cct gat att gag tgg atg ata tgc aaa gat att aag aaa tgt aat aat gaa act |
|
| P L P D I E W M I C K D I K K C N N E T |
460 |
| |
| tcc tgg act att ttg gcc aac aat gtc tca aac atc atc acg gag atc cac tcc cga gac |
|
| S W T I L A N N V S N I I T E I H S R D |
480 |
| |
| agg agt acc gtg gag ggc cgt gtg act ttc gcc aaa gtg gag gag acc atc gcc gtg cga |
|
| R S T V E G R V T F A K V E E T I A V R |
500 |
| |
| tgc ctg gct aag aat ctc ctt gga gct gag aac cga gag ctg aag ctg gtg gct ccc acc |
|
| C L A K N L L G A E N R E L K L V A P T |
520 |
| |
| ctg cgt tct gaa ctc acg gtg gct gct gca gtc ctg gtg ctg ttg gtg att gtg atc atc |
|
| L R S E L T V A A A V L V L L V I V I I |
540 |
| |
| tca ctt att gtc ctg gtt gtc att tgg aaa cag aaa ccg agg tat gaa att cgc tgg agg |
|
| S L I V L V V I W K Q K P R Y E I R W R |
560 |
| |
| gtc att gaa tca atc agc cca gat gga cat gaa tat att tat gtg gac ccg atg cag ctg |
|
| V I E S I S P D G H E Y I Y V D P M Q L |
580 |
| |
| cct tat gac tca aga tgg gag ttt cca aga gat gga cta gtg ctt ggt cgg gtc ttg ggg |
|
| P Y D S R W E F P R D G L V L G R V L G |
600 |
| |
| tct gga gcg ttt ggg aag gtg gtt gaa gga aca gcc tat gga tta agc cgg tcc caa cct |
|
| S G A F G K V V E G T A Y G L S R S Q P |
620 |
| |
| gtc atg aaa gtt gca gtg aag atg cta aaa ccc acg gcc aga tcc agt gaa aaa caa gct |
|
| V M K V A V K M L K P T A R S S E K Q A |
640 |
| |
| ctc atg tct gaa ctg aag ata atg act cac ctg ggg cca cat ttg aac att gta aac ttg |
|
| L M S E L K I M T H L G P H L N I V N L |
660 |
| |
| ctg gga gcc tgc acc aag tca ggc ccc att tac atc atc aca gag tat tgc ttc tat gga |
|
| L G A C T K S G P I Y I I T E Y C F Y G |
680 |
| |
| gat ttg gtc aac tat ttg cat aag aat agg gat agc ttc ctg agc cac cac cca gag aag |
|
| D L V N Y L H K N R D S F L S H H P E K |
700 |
| |
| cca aag aaa gag ctg gat atc ttt gga ttg aac cct gct gat gaa agc aca cgg agc tat |
|
| P K K E L D I F G L N P A D E S T R S Y |
720 |
| |
| gtt att tta tct ttt gaa aac aat ggt gac tac atg gac atg aag cag gct gat act aca |
|
| V I L S F E N N G D Y M D M K Q A D T T |
740 |
| |
| cag tat gtc ccc atg cta gaa agg aaa gag gtt tct aaa tat tcc gac atc cag aga tca |
|
| Q Y V P M L E R K E V S K Y S D I Q R S |
760 |
| |
| ctc tat gat cgt cca gcc tca tat aag aag aaa tct atg tta gac tca gaa gtc aaa aac |
|
| L Y D R P A S Y K K K S M L D S E V K N |
780 |
| |
| ctc ctt tca gat gat aac tca gaa ggc ctt act tta ttg gat ttg ttg agc ttc acc tat |
|
| L L S D D N S E G L T L L D L L S F T Y |
800 |
| |
| caa gtt gcc cga gga atg gag ttt ttg gct tca aaa aat tgt gtc cac cgt gat ctg gct |
|
| Q V A R G M E F L A S K N C V H R D L A |
820 |
| |
| gct cgc aac gtc ctc ctg gca caa gga aaa att gtg aag atc tgt gac ttt ggc ctg gcc |
|
| A R N V L L A Q G K I V K I C D F G L A |
840 |
| |
| aga gac atc atg cat gat tcg aac tat gtg tcg aaa ggc agt acc ttt ctg ccc gtg aag |
|
| R D I M H D S N Y V S K G S T F L P V K |
860 |
| |
| tgg atg gct cct gag agc atc ttt gac aac ctc tac acc aca ctg agt gat gtc tgg tct |
|
| W M A P E S I F D N L Y T T L S D V W S |
880 |
| |
| tat ggc att ctg ctc tgg gag atc ttt tcc ctt ggt ggc acc cct tac ccc ggc atg atg |
|
| Y G I L L W E I F S L G G T P Y P G M M |
900 |
| |
| gtg gat tct act ttc tac aat aag atc aag agt ggg tac cgg atg gcc aag cct gac cac |
|
| V D S T F Y N K I K S G Y R M A K P D H |
920 |
| |
| gct acc agt gaa gtc tac gag atc atg gtg aaa tgc tgg aac agt gag ccg gag aag aga |
|
| A T S E V Y E I M V K C W N S E P E K R |
940 |
| |
| ccc tcc ttt tac cac ctg agt gag att gtg gag aat ctg ctg cct gga caa tat aaa aag |
|
| P S F Y H L S E I V E N L L P G Q Y K K |
960 |
| |
| agt tat gaa aaa att cac ctg gac ttc ctg aag agt gac cat cct gct gtg gca cgc atg |
|
| S Y E K I H L D F L K S D H P A V A R M |
980 |
| |
| cgt gtg gac tca gac aat gca tac att ggt gtc acc tac aaa aac gag gaa gac aag ctg |
|
| R V D S D N A Y I G V T Y K N E E D K L |
1000 |
| |
| aag gac tgg gag ggt ggt ctg gat gag cag aga ctg agc gct gac agt ggc tac atc att |
|
| K D W E G G L D E Q R L S A D S G Y I I |
1020 |
| |
| cct ctg cct gac att gac cct gtc cct gag gag gag gac ctg ggc aag agg aac aga cac |
|
| P L P D I D P V P E E E D L G K R N R H |
1040 |
| |
| agc tcg cag acc tct gaa gag agt gcc att gag acg ggt tcc agc agt tcc acc ttc atc |
|
| S S Q T S E E S A I E T G S S S S T F I |
1060 |
| |
| aag aga gag gac gag acc att gaa gac atc gac atg atg gat gac atc ggc ata gac tct |
|
| K R E D E T I E D I D M M D D I G I D S |
1080 |
| |
| tca gac ctg gtg gaa gac agc ttc ctg taa |
|
| S D L V E D S F L - |
1089 |
| |
Example 4: Orthogonal PDGFRα-Based Receptors Targeting HCMV Trimer Potently Neutralize Virus
The two representative orthogonal receptors, PDGFRα Y206S and V242K, were evaluated for their efficacy to neutralize virus infection. HCMV trimer-only lab strain AD169 (Wang and Shenk, J Virol 79: 10330-10338, 2005; Yu et al, J Virol 76: 2316-2328, 2002) and trimer/pentamer-expressing clinical strain TB40/E (Sinzger et al., J Gen Virol 89: 359-368, 2008) were grown on PDGFRα-positive MRC-5 fibroblasts and PDGFRα-negative ARPE-19 epithelial cells. Three cell lines were infected by both HCMV strains: MRC-5, ARPE-19, and ARPE-19RA, which are stably transfected with PDGFRα to confer susceptibility to AD169 (Wu et al., Proc Natl Acad Sci USA 115: E9889—E9898, 2018).
Soluble PDGFRα-Fc potently neutralized both HCMV strains at nanomolar concentrations (FIG. 6 ). Neutralization by orthogonal sPDGFRα-Fc V242K was mostly indistinguishable from wild-type receptor and nearly complete at 1 to 10 nM (FIG. 6 ), demonstrating that virus binding and neutralization can indeed be successfully separated from growth factor interactions by just a single amino acid substitution. Soluble PDGFRα-Fc Y206S also neutralized but with reduced potency, consistent with the biochemical binding studies.
Discussion
Soluble PDGFRα as a prophylactic or treatment for HCMV is particularly promising due to exceptionally tight affinity for glycoprotein trimer and its ability to neutralize both trimer- and pentamer-mediated host cell entry. As described herein, deep mutagenesis was carried out to inform the engineering of PDGFRα variants that maintain tight virus binding but have lost growth factor interactions, and are thereby orthogonal to normal human signaling pathways. This is expected to improve both efficacy and safety in vivo, especially for the treatment of pregnant women and neonates.
Example 5: Materials and Methods
This example describes the materials and experimental procedures for the studies described in Examples 1-4.
Plasmids
Human PDGFRα isoform 1 (GenBank NM_006206.4; SEQ ID NO: 2) was cloned in to the NheI-XhoI sites of pCEP4 (Invitrogen) with a N-terminal HA leader (MKTIIALSYIFCLVFA; SEQ ID NO: 12), myc-tag, linker (GSPGGASG; SEQ ID NO: 13), and followed by the mature polypeptide (a.a. 24-1,089 of SEQ ID NO: 1). For measuring signaling activity, a minimal promoter under the control of tandem serum response elements was subcloned from SRE reporter vector 559 (Addgene #82686) (Reichhart et al., Angew Chem Int Ed Engl 55: 6339-6342, 2016), a GFP-PEST fluorescent reporter (Li et al., J Biol Chem 273: 34970-34975, 1998) was inserted at the AscI site, and the entire reporter cassette was inserted at the NruI site of pCEP4-myc-PDGFRα by Gibson assembly. As a negative control, human PDGFRβ isoform 1 (GenBank NM_002609.3; SEQ ID NO: 14) was similarly cloned between the NheI-XhoI sites of pCEP4 with a N-terminal HA leader, myc-tag, and linker that connects to the mature protein (a.a. 33-1,106 of SEQ ID NO: 14). No interactions between PDGFRβ and HCMV trimer were observed. Soluble PDGFRα-Fc was cloned into the NheI-XhoI sites of pcDNA3.1(+) (Invitrogen), and encompassed PDGFRα a.a. 1-524, a short connecting linker as outlined in FIG. 10A, and the C-terminus of human IgG1 (GenBank KY432415.1) beginning at either C220 or D221 as described in the Examples above. Alternatively, PDGFRα a.a. 1-524 were fused via linker GGGS (SEQ ID NO: 10) to D221-K447 of human IgG3 (GenBank P01860.2, SEQ ID NO: 15; this is an R435 allele with reduced binding to FcRn). Synthetic human codon-optimized gene fragments (Integrated DNA Technologies) for HCMV gO (GenBank ABV71596.1 for TB40/E strain, AJY56739.1 for Merlin strain) were genetically fused at the C-terminus to superfolder GFP (Pédelacq et al., Nat Biotechnol 24: 79-88, 2006) (for detection of soluble HCMV trimer binding to PDGFRα-positive cells) or to an 8-histidine tag (for expression of membrane-tethered HCMV trimer), and were ligated in to the NheI-XhoI sites of pcDNA3.1(+). Codon-optimized gene fragments for full-length HCMV gH (GenBank ABV71597.1 for TB40/E strain, YP 081523.1 for Merlin Strain) were cloned in to the NheI-XhoI sites of pcDNA3.1(+) for expression of membrane-tethered HCMV trimer. For production of soluble trimer, the extracellular region of gH with the leader peptide (a.a. 1-717 for TB40/E, a.a. 1-716 for Merlin) was subcloned with a 8-histidine tag. Codon-optimized synthetic genes for gL (GenBank ABV71629.1 for TB40/E strain, YP 081555.1 for Merlin) were cloned with C-terminal FLAG tags in to the NheI-XhoI sites of pcDNA3.1(+). Targeted mutations were made by overlap extension PCR. All plasmids were sequence verified (ACGT, Inc) and are deposited with Addgene.
Cells and Viruses
Expi293F cells (ThermoFisher), a suspension culture derivative of HEK293, were cultured in Expi293 Expression Medium (ThermoFisher) at 125 rpm, 8% CO2, 37° C. MRC-5 embryonic lung fibroblasts and ARPE-19 adult retinal pigment epithelial cells from the American Type Culture Collection were grown at 37° C., 5% CO2, in DMEM supplemented with 10% fetal bovine serum, 1 mM sodium pyruvate, 2 mM glutamax (Gibco), 10 mM Hepes pH 7.4, 0.1 mM MEM non-essential amino acids (Gibco), 100 units/ml penicillin G, and 100 μg/ml streptomycin sulfate. ARPE-19 ectopically expressing PDGFRα (“ARPE19-RA” cells) were generated by lentiviral transduction with pLV-EF1a-PDGFRα-IRES-PURO. HCMV virus stocks were prepared by electroporating purified bacmid DNA into either MRC-5 fibroblasts (AD169; (Yu et al., J Virol 76: 2316-2328, 2002) or ARPE-19 retinal pigment epithelial cells (TB40/E, clone BAC4; Sinzger et al., J Gen Virol 89: 359-368, 2008). Stocks were amplified twice by infecting cell monolayers in 15 cm tissue culture plates followed by 850 cm2 roller bottles. Virions were concentrated 100× by centrifugation through a 20% sorbitol cushion, resuspended in phosphate-buffered saline (PBS) containing 1% BSA and 7% sucrose, and frozen at −80° C. Virus stocks were titered on MRC-5 and ARPE-19 cells by Immediate-Early Protein 1 (IE1) fluorescent focus assay (Zhu et al., J Virol 69: 7960-7970, 1995).
Flow Cytometry Analysis of Soluble HCMV Trimer Binding to Receptor
Soluble HCMV trimer was prepared by transfecting Expi293F cells at a density of 2×106/ml with 400 ng pcDNA3-gO-sfGFP, 400 ng pcDNA3-gH-8his and 400 ng pcDNA3-gL-FLAG per ml culture using Expifectamine (ThermoFisher). Transfection Enhancers (ThermoFisher) were added 18 hours later, and 4 days post-transfection the culture was centrifuged (1,000×g, 10 minutes, followed by a second spin of the supernatant at 21,000×g, 5 minutes). The medium supernatant was stored at −20° C. and used directly in binding experiments. Expi293F cells at 2×106/ml were transfected with plasmids encoding receptors (500 ng DNA per ml of culture) using Expifectamine. 24 hours post-transfection the cells were washed with PBS supplemented with 0.2% bovine serum albumin (PBS-BSA), incubated for 30 minutes on ice with anti-myc Alexa 647 (clone 9B11, 1/250 dilution; Cell Signaling Technology) and the indicated dilutions of gH/gL/gO-sfGFP-containing medium, washed twice with PBS-BSA, then analyzed on a BD LSR II flow cytometer. For competition assays, washed cells were pre-incubated with PDGF ligands (R&D Systems) for 2 minutes on ice prior to addition of gH/gL/gO-sfGFP-containing medium.
Deep Mutagenesis
The D2-D3 domains (a.a. D123-E311) within plasmid pCEP4-myc-PDGFRα were mutagenized by overlap extension PCR (Procko et al., J Mol Biol 2013; 425: 3563-3575) using primers with degenerate NNK codons. The plasmid library was transfected in to Expi293F cells using Expifectamine under conditions previously shown to typically give no more than a single coding variant per cell; 1 ng coding plasmid was diluted with 1,500 ng pCEP4-ACMV carrier plasmid per ml of cell culture at 2×106/ml, and the medium was replaced 2 hours post-transfection. The cells were collected after 24 hours, washed with ice-cold PBS-BSA, and incubated for 2 minutes on ice with PDGF-AA, -AB, -BB, and -CC (25 nM of each after addition of soluble trimer-containing medium) and anti-myc Alexa 647 (clone 9B11, 1/250 dilution; Cell Signaling Technology). Medium from cells expressing gH/gL/gO-sfGFP was then added to a final dilution of 1/3, and the cells were incubated on ice for 20 minutes. Cells were washed twice with PBS-BSA, and sorted on a BD FACS Aria II. The main cell population was gated by forward/side scattering to remove debris and doublets, and propidium iodide (1 μg/ml final) was added to the sample to exclude dead cells. Of the myc-positive (Alexa 647) population, the 15% of cells with the highest and lowest GFP fluorescence were collected (FIG. 1F) in tubes coated overnight with fetal bovine serum and containing Expi293 Expression Medium. Total RNA was extracted from the collected cells using a GeneJET RNA purification kit (Thermo Scientific), and cDNA was reverse transcribed with high fidelity Accuscript primed with a gene-specific oligonucleotide (RevTrans_PDGFRA_992R, TCATGCAGGTTGACAGCTTC; SEQ ID NO: 16). The diversified region of PDGFRα was PCR amplified as 3 fragments to provide full coverage of the D2-D3 domains during Illumina sequencing. During PCR, flanking sequences on the primers added adapters to the ends of the products for annealing to Illumina sequencing primers, unique barcoding, and for binding the flow cell. Amplicons were sequenced on an Illumina NovaSeq 6000 using a 2×250 nucleotide paired end protocol. Data were analyzed using Enrich (Fowler et al., Bioinformatics 2011; 27: 3430-3431), and commands are provided in the GEO deposit. Briefly, the frequencies of PDGFRα variants in the transcripts of the sorted populations were compared to their frequencies in the naive plasmid library to calculate an enrichment ratio.
Production of Soluble PDGFRα-Fc
Per ml of 2×106 Expi293F cells, 500 ng of pcDNA3-sPDGFRα-Fc (IgG1) and 3 μg of polyethylenimine (MW 25,000; Polysciences) were mixed in 100 μl of OptiMEM (Gibco) and incubated for 20 minutes at room temperature prior to adding to cells. Transfection Enhancers were added 18 hours post-transfection, and cells were cultured for six to seven days. Cells were removed by centrifugation at 600×g for 20 minutes at 4° C. Cell debris and precipitates were removed by centrifugation at 18,000×g for 25 minutes at 4° C. Supernatant was loaded on to KANEKA KanCapA 3G Affinity sorbent (Pall), and the resin was washed with PBS. Soluble PDGFRα-Fc was eluted with 60 mM sodium acetate pH 3.7, and 1 M Tris pH 8.0 was added to the eluate to neutralize the pH. Eluted sPDGFRα-Fc was concentrated with a centrifugal device (MWCO 100 kDa; Sartorius) and NaCl was added to 150 mM final. The protein was separated on a Superdex 200 Increase 10/300 GL (GE Healthcare Life Sciences) size exclusion chromatography column equilibrated with PBS. Peak fractions were pooled, concentrated, and stored at −80° C. after snap freezing in liquid nitrogen. The proteins were quantified by absorbance at 280 nm using calculated molar extinction coefficients for the monomeric mature polypeptides.
Fusions of sPDGFRα to the Fc region of IgG3 were expressed as described above, and the expression medium was dialyzed against water. Cell debris was removed by centrifugation at 18,000×g for 25 minutes at 4° C. Supernatant was loaded on to protein G HTC agarose beads (GoldBio) equilibrated with PBS. Protein was eluted with 100 mM glycine pH 2.5 and the eluate was neutralized by addition of 1 M Tris pH 9.0. Protein was further purified as described for the IgG1 fusions.
Flow Cytometry Analysis of PDGFRα-Fc Binding to HCMV Trimer on the Cell Surface
400 ng of each of pcDNA3-gH (full-length), pcDNA3-gL-FLAG and pcDNA3-gO-8his were transfected in to Expi293F cells at 2×106/ml using Expifectamine. Transfection Enhancers were added 22 hours later, and cells were harvested 46 hours post-transfection. Cells were washed with PBS-BSA and incubated with PDGFRα-Fc (purified as described) or PDGFRβ-Fc (R&D Systems) for 40 minutes on ice. Cells were then washed 3 times with PBS-BSA and stained with anti-FLAG M2-Cy3 (Sigma), chicken anti-HIS-FITC (polyclonal, Immunology Consultants Laboratory), and anti-human IgG-APC (clone HP6017, BioLegend) for 30 minutes on ice. Cells were washed three times with PBS-BSA and analyzed by flow cytometry. To compare data across different experiments, the change in ΔMFU for each condition was normalized to the ΔMFU at the maximum concentration of WT sPDGFRα-Fc: Relative binding=(MFUsample−MFUbackground)/(MFUmax WT−MFUbackground).
PDGFRα Signaling Assay
500 ng of PDGFRα reporter plasmid was transfected into 1 ml Expi293F cells at 2×106/ml using Expifectamine. 7.5 μl of 6 μM sPDGFRα-Fc (concentration based on monomer) and 7.5 μl of 2 μM PDGF were mixed, incubated at room temperature for 40 minutes, and then added to 1 ml cells at transfection. Human gamma globulin was from Jackson Immuno Research Labs, and PDGFs were from R&D Systems. Cells were collected 24 hours post-transfection and stained with anti-myc-Alexa 647 to detect PDGFRα expression. GFP-PEST reporter expression was measured by flow-cytometry.
Virus Neutralization Assays
Neutralization assays were performed similarly to Stegmann et al. (PLoS Pathog. 2017 April; 13(4):e1006273) by serially diluting Fc-fused PDGFRα proteins or anti-HCMV immunoglobulin (Cytogam, CSL Behring) in PBS (vehicle) and incubating diluted proteins with HCMV virions for 1 hour at 37° C. Virion-protein mixtures were adsorbed onto target cells for 2 hours at 37° C., 5% CO2, washed once with PBS, and infected cells were allowed to recover for 18 hours. The ability of each treatment to neutralize HCMV infection was measured using indirect-immunofluorescence by determining the number of cells expressing viral IE1, using anti-IE1 clone 1B12 (Zhu et al., J Virol 1995; 69: 7960-7970) and counterstaining nuclei with DAPI. A multiplicity of infection of 1 was used for AD169 infections, and a multiplicity of infection of 0.5 was used for TB40/E infections (based on stock titers acquired on MRC-5 fibroblasts).
Structural Modeling
The sequence of human PDGFRα was threaded onto the structure of PDGF-BB-bound PDGFRβ (PDB ID 3MJG; Shim et al., Proc Natl Acad Sci USA. 2010 Jun. 22; 107(25):11307-11312), with one of the two receptor chains and the D1 domain removed. The model was minimized with ROSETTA using FastRelax (Leaver-Fay et al., Meth Enzymol 2011; 487: 545-574). Connectivity was determined using the AverageDegree filter in ROSETTA (Fleishman et al., J Mol Biol. 2011; 414: 289-302). Images were rendered with PyMOL (Schrödinger, LLC).
Reagent and Data Availability
Plasmids were deposited with Addgene. Raw and processed deep sequencing data were deposited in NCBI's Gene Expression Omnibus (GEO) under series accession number GSE138169.
In view of the many possible embodiments to which the principles of the disclosed subject matter may be applied, it should be recognized that the illustrated embodiments are only examples of the disclosure and should not be taken as limiting the scope of the disclosure. Rather, the scope of the disclosure is defined by the following claims. We therefore claim all that comes within the scope and spirit of these claims.