US12492231B2 - Multimeric hybrid Fc proteins for replacement of IVIG - Google Patents

Multimeric hybrid Fc proteins for replacement of IVIG

Info

Publication number
US12492231B2
US12492231B2 US17/282,382 US201917282382A US12492231B2 US 12492231 B2 US12492231 B2 US 12492231B2 US 201917282382 A US201917282382 A US 201917282382A US 12492231 B2 US12492231 B2 US 12492231B2
Authority
US
United States
Prior art keywords
hybrid
day
ls41k
igg
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active, expires
Application number
US17/282,382
Other versions
US20220002361A1 (en
Inventor
Naoya Tsurushita
J. Yun Tso
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
JN Biosciences LLC
Original Assignee
JN Biosciences LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by JN Biosciences LLC filed Critical JN Biosciences LLC
Priority to US17/282,382 priority Critical patent/US12492231B2/en
Publication of US20220002361A1 publication Critical patent/US20220002361A1/en
Application granted granted Critical
Publication of US12492231B2 publication Critical patent/US12492231B2/en
Active legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/10Immunoglobulins specific features characterized by their source of isolation or production
    • C07K2317/14Specific host cells or culture conditions, e.g. components, pH or temperature
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41Glycosylation, sialylation, or fucosylation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/524CH2 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the application includes sequences in a txt file named 557167SEQLST.TXT of 88,075 bytes created Mar. 31, 2021, which is incorporated by reference.
  • IVIG Intravenous immunoglobulin
  • IIG Intravenous immunoglobulin
  • IVIG administered with the dosing range of 200 to 500 mg per kg of body weight provides immunodeficient patients with pathogen-specific IgG antibodies derived from the donors for protection against infectious disease. As such protective IgG antibodies are cleared eventually in the circulation, IVIG needs to be administered constantly, typically every three to four weeks, to maintain the protection in the patient.
  • IVIG idiopathic thrombocytopenic purpura
  • the neonatal Fc receptor (FcRn) is a heterodimer that is composed of a transmembrane a chain and ⁇ 2-microglubulin ( ⁇ 2m).
  • FcRn expressed in endothelial cells mediates both transcytosis of maternal IgG to the fetus and IgG homeostasis in adults.
  • Pinocytosed IgG antibodies are captured by FcRn in acidified endosomes, rescued from degradation in lysosomes, recycled back to the cell surface, and returned to the circulation. Binding of IgG to FcRn is saturable.
  • CD22 a member of the Siglec family of type I transmembrane proteins, binds specifically to a sialic acid attached to glycans with the affinity of 32 ⁇ M (Powell et al., J. Biol. Chem. 13:7523-7532, 1995; Fearon et al., Annu. Rev. Immunol. 18:393-442, 2000; Pillai et al., Annu. Rev. Immunol. 30:357-392, 2012; Nitschke, Glycobiol. 24:807-817, 2014).
  • CD22 has a critical regulatory role to establish the threshold of B-cell activation.
  • Multivalent cross-linking of CD22 induces intracellular signaling via the immunoreceptor tyrosine-based inhibition motifs (ITIMs) located in its cytoplasmic domain, which leads to functional suppression of B cells.
  • ITIMs immunoreceptor tyrosine-based inhibition motifs
  • a sialylated portion of IVIG has been shown to bind to CD22 and negatively modulate immune responses of B cells (Mitrevski et al. Int. Trends Immun. 2:67, 2014; Seite et al., Blood 116:1698-1704, 2010).
  • the positive correlation between the level of sialylation of IVIG (or Fc proteins) and its activity of immune suppression has been reported (Schwab et al., Clin. Exp. Immunol. 178:97-99, 2014; Washburn et al., Proc.
  • CD32B also called Fc ⁇ receptor IIB
  • Fc ⁇ receptor IIB a type I transmembrane protein expressed on B cells and myeloid dendritic cells
  • MOA immunoreceptor tyrosine-based activation motifs
  • CD32B contains an ITIM motif in the cytoplasmic domain and functions as a negative regulator of immune responses. Cross-linking of CD32B induces intracellular signal transduction that leads to downregulation of antibody production in B cells.
  • IVIG showed no therapeutic effects in mouse models of ITP, rheumatoid arthritis, and nephrotoxis nephritis when the mice used in the studies were deficient in CD32B. It is still unclear, however, if IVIG directly interacts with CD32B for immune suppression. Instead of CD32B, DC-SIGN (dendritic-cell-specific ICAM-3 grabbing nonintegrin; also known as CD209), a human ortholog of mouse SIGN-R1 (specific ICAM-3 grabbing nonintegrin-related 1), that are expressed on macrophages and dendritic cells, has been reported to be a primary action site of IVIG.
  • DC-SIGN dendritic-cell-specific ICAM-3 grabbing nonintegrin; also known as CD209
  • SIGN-R1 specific ICAM-3 grabbing nonintegrin-related 1
  • IVIG has been used widely for treatment of immunodeficiency and various immune-mediated diseases in humans
  • IVIG has an intrinsic shortcoming that it is derived from human pooled blood.
  • the blood source is screened for infectious disease and other conditions unsuitable for blood donation, there always remains a remote possibility that unknown infectious agents can contaminate IVIG products.
  • batch-to-batch variation of IVIG is unavoidable.
  • decrease of blood donation results in shortage of the supply of IVIG. It is therefore critical to develop a recombinant product, which is clean and supplied constantly, that functionally substitutes IVIG for treatment of the patients of immune-mediated diseases.
  • rozanolixizumab decreased the IgG concentration in the circulation. Severe treatment-emergent adverse events were observed in several human subjects who received 7 mg/kg of rozanolixizumab intravenously. Neither of the Kiessling and Nixon papers show the data of suppression of B cell-mediated immune responses by an anti-FcRn antibody.
  • JCI97911, 2018 used a human IgG1-derived Fc fragment carrying the same five amino acid substitutions (MST-HN) described above (efgartigimod) as an antagonist of FcRn and showed that efgartigimod reduced IgG levels up to 50% in humans.
  • Fc- ⁇ TP-L309C hexameric IgG1 Fc fragments
  • U.S. Pat. No. 9,382,319 reports antibodies or Fc fusion proteins linked to a hybrid heavy chain constant region having IgG or IgA and IgM components.
  • Antibody variable regions or a heterologous polypeptide form a binding site for a target site in a subject, and the hybrid constant region results in multimerization and activation of cells expressing the target on the surface.
  • the invention provides a hybrid Fc protein comprising in order from N- to C-terminus an IgG Fc region comprising at least a portion of a hinge region, CH2 and CH3 regions, each of which is of IgG isotype, and an IgM Fc region comprising C ⁇ 3 and C ⁇ 4 regions, wherein the at least a portion of a hinge region is not linked to (a) an antibody variable region, or (b) a heterologous polypeptide binding a target, wherein molecules of the hybrid Fc protein can form a duplex via interchain disulfide bonding between cysteine residues in the at least a portion of the hinge region, and the duplexes can multimerize with one another via the C ⁇ 3 and C ⁇ 4 regions.
  • the IgG Fc region is of human IgG1, IgG2, IgG3 or IgG4 isotype and the C ⁇ 3 and C ⁇ 4 regions are each human C ⁇ 3 and C ⁇ 4 regions.
  • at least a portion of a hinge region is not linked to a polypeptide of over 25 amino acids.
  • the at least a portion of a hinge region differs from a natural human hinge region by replacement of a cysteine residue not engaged in formation of Fc duplexes in natural antibodies.
  • the protein consists essentially of the at least a portion of a hinge region, the CH2 and CH3 regions, and the C ⁇ 3 and C ⁇ 4 regions and optionally a peptide of up to 25 amino acids linked to the at least a portion of a hinge region.
  • the at least a portion of a hinge region comprises a peptide of Glu-Pro-Lys-Ser-Ser (SEQ ID NO:8) at its N-terminus.
  • the IgG Fc region and/or the IgM Fc region include one or more mutations to reduce ADCC, ADP or CDC.
  • the IgG Fc region includes one or more mutations to increase FcRn binding.
  • the IgG Fc region and/or the IgM Fc region includes one or more mutations to increase sialyation.
  • positions 234 and 235 in the IgG Fc region are alanine residues (e.g., SEQ ID NO:9).
  • positions 433 and 435 in the IgM Fc region are alanine and serine residues, respectively (e.g., SEQ ID NO:10).
  • position 428 in the IgG Fc region is a leucine residue (e.g., SEQ ID NO: 13).
  • position 241 or 243 in the IgG Fc region (Eu numbering) is an alanine residue (e.g., SEQ ID NOS:15 and 16, respectively).
  • molecules of the hybrid Fc protein have formed a duplex via interchain disulfide bonding between cysteine residues in the at least a portion of the hinge region, and the duplexes have multimerized with one another via the C ⁇ 3 and C ⁇ 4 regions.
  • the multimer is a hexamer.
  • the hybrid Fc protein is at least 99% w/w pure.
  • the invention further provides a pharmaceutical composition comprising any of the hybrid Fc proteins described above and a pharmaceutically acceptable carrier.
  • the invention further provides a method of treating an immune disorder comprising administering an effective regime of a hybrid Fc protein of any preceding claim to subject, in need thereof.
  • the hybrid Fc protein reduces the half-life of IgG molecules in the circulation.
  • the hybrid Fc protein reduces the concentration of IgG molecules in the circulation.
  • the hybrid Fc fusion protein suppresses immune responses of B cells.
  • the subject has an immune disorder.
  • the invention further provides for the use of the hybrid Fc protein of any preceding claim in the manufacture of a medicament for treating an inflammatory disorder, rejection following organ transplantation, a hematological disorder, a dermatological disorder, or a neuromuscular disorder.
  • the invention further provides for the use of the hybrid Fc protein of any preceding claim in the manufacture of a medicament for treating an autoimmune disorder.
  • the disorder is idiopathic thrombocytopenic purpura, Kawasaki disease, Guillain-Barre syndrome, or chronic inflammatory demyelinating polyneuropathy.
  • the disorder is systemic lupus erythematosus, multiple sclerosis, or autoimmune neutropenia.
  • FIG. 1 Schematic structure of the expression vector pVF101.
  • FIG. 2 Schematic structure of the hexameric hybrid Fc protein of this invention.
  • FIG. 3 Relative concentrations of mouse monoclonal IgG antibody ABC2 in mouse sera are shown with SEM (standard error of the mean) error bars. ABC2 was administered to three mice with no Fc proteins (Group A), LS41K-Fc.S (Group B), or LS41K-Fc.SL (Group C).
  • FIG. 4 Relative concentrations of mouse IgG in mouse sera from Groups A, B and C are shown with SEM error bars.
  • FIG. 5 Concentrations of LS41K-Fc.S and LS41K-Fc.SL in mouse sera from Groups B and C, respectively, are shown with SEM error bars.
  • FIG. 6 Relative concentrations of ABC2 in mouse sera are shown with SEM error bars. ABC2 was administered to three mice together with 100 ⁇ g (Group D) or 400 ⁇ g of LS41K-Fc.SL (Group E).
  • FIG. 7 Relative concentrations of mouse IgG in mouse sera from Groups D and E are shown with SEM error bars.
  • FIG. 8 Concentrations of LS41K-Fc.SL in mouse sera from Groups D and E are shown with SEM error bars.
  • FIG. 9 A , B Schematic structure of the expression vectors for (A) ST6GAL1 and (B) B4GALT1.
  • FIGS. 10 A , B, C Sequences of (A) gamma-1 (SEQ ID NOS:29-32), gamma-2 (SEQ ID NOS:33-36), gamma-3 (SEQ ID NOS:37-40), (B) gamma-4 (SEQ ID NOS:41-44), alpha-1 (SEQ ID NOS:45-47), alpha-2 (SEQ ID NOS:48-50), and (C) mu heavy chain constant regions (SEQ ID NOS:51-54), and a J chain (SEQ ID NO:55).
  • the 18 amino acid mu tailpiece is underlined in the Cmu sequence.
  • the first 22 amino acids shown of the J chain are a cleaved signal peptide.
  • FIGS. 11 A-D FACS analysis of the binding to human and mouse FcRn: (A) Binding of Erbitux (mouse-human chimeric IgG1 antibody) to human FcRn at pH 6.0 and pH 7.5, (B) binding of LS41K-Fc.SL to human FcRn at pH 6.0 and pH 7.5, (C) binding of Erbitux to mouse FcRn at pH 6.0 and pH 7.5, and (D) binding of LS41K-Fc.SL to mouse FcRn at pH 6.0 and pH 7.5.
  • Erbitux mimouse-human chimeric IgG1 antibody
  • hybrid Fc proteins are typically provided in isolated form. This means that the hybrid Fc proteins are typically at least 50% w/w pure of interfering proteins and other contaminants arising from its production or purification but does not exclude the possibility that the hybrid Fc protein is combined with an excess of pharmaceutical acceptable carrier(s) or other vehicle intended to facilitate its use. Sometimes hybrid Fc proteins are at least 60, 70, 80, 90, 95 or 99% w/w pure of interfering proteins and contaminants from production or purification. Often a hybrid Fc protein is the predominant macromolecular species remaining after its purification.
  • the hybrid Fc proteins specifically bind to FcRn. Specific binding is detectably higher in magnitude and distinguishable from non-specific binding occurring to at least one unrelated target. Specific binding can be the result of formation of bonds between particular functional groups or particular spatial fit (e.g., lock and key type) whereas nonspecific binding is usually the result of van der Waals forces. Specific binding does not however necessarily imply that the hybrid Fc proteins bind one and only one target. For example, they may also specifically bind to CD22 through sialyation.
  • a basic antibody structural unit is a tetramer of subunits.
  • Each tetramer includes two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa).
  • the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. This variable region is initially expressed linked to a cleavable signal peptide.
  • the variable region without the signal peptide is sometimes referred to as a mature variable region.
  • a light chain mature variable region means a light chain variable region without the light chain signal peptide.
  • variable region does not mean that a signal sequence is necessarily present; and in fact signal sequences are cleaved once the antibodies or fusion proteins of the invention have been expressed and secreted.
  • a pair of heavy and light chain variable regions defines a binding region of an antibody. The carboxy-terminal portion of the light and heavy chains respectively defines light and heavy chain constant regions. The heavy chain constant region is primarily responsible for effector function. In IgG antibodies, the heavy chain constant region is divided into CH1, hinge, CH2, and CH3 regions. In IgA, the heavy constant region is divided into CH1, CH2 and CH3. The CH1 region binds to the light chain constant region by disulfide and noncovalent bonding.
  • the hinge region provides flexibility between the binding and effector regions of an antibody and also provides sites for intermolecular disulfide bonding between the two heavy chain constant regions in a tetramer subunit.
  • the CH2 and CH3 regions are the primary site of effector functions and FcRn binding.
  • the ⁇ heavy chain constant region (C ⁇ ) is subdivided into four regions C ⁇ 1, C ⁇ 2, C ⁇ 3 and C ⁇ 4.
  • the C ⁇ 3 and C ⁇ 4 regions sometimes in combination with one or more J chains, provide a multimerization function in natural IgM antibodies and hybrid Fc proteins of the present invention.
  • the mu tailpiece is a 18 amino-acid-long polypeptide located at the C-terminus of a IgM heavy chain constant region. IgM multimerizes to form a pentameric structure in the presence of J chains and a hexameric structure in their absence.
  • Light chains are classified as either kappa or lambda.
  • Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, and define the antibody's isotype as IgG, IgM, IgA, IgD and IgE, respectively.
  • the variable and constant regions are joined by a “J” segment of about 12 or more amino acids, with the heavy chain also including a “D” segment of about 10 or more amino acids.
  • variable regions of each light/heavy chain pair form the antibody binding site.
  • an intact antibody has two binding sites, i.e., is divalent.
  • the binding sites are the same.
  • bispecific antibodies can be made in which the two binding sites are different (see, e.g., Songsivilai and Lachmann, Clin. Exp. Immunol., 79:315-321 (1990); Kostelny et al., J. Immunol., 148:1547-53 (1992)).
  • the variable regions all exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, also called complementarity determining regions or CDRs.
  • FR relatively conserved framework regions
  • both light and heavy chains comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
  • the assignment of amino acids to each domain is in accordance with the definitions of Kabat, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, MD, 1987 and 1991), or Chothia & Lesk, J. Mol. Biol. 196:901-917 (1987); Chothia et al., Nature 342:878-883 (1989).
  • Kabat also provides a widely used numbering convention (Kabat numbering) in which corresponding residues between different heavy chain variable regions or between different light chain variable regions are assigned the same number. Although Kabat numbering can be used for antibody constant regions, the EU index is more commonly used, as is the case in this application.
  • a multimerization unit of the hybrid Fc protein is typically a duplex of two such proteins linked by interchain disulfide bonding between one or more cysteines in their respective hinge regions.
  • Multimerization means the association of at least two multimerization units and more typically five or six such units via the C ⁇ portion of a hybrid constant region. Multimerization of hybrid Fc protein units may sometimes form higher or lower order structures than the pentameric or hexameric structure of normal IgM. Such is sometimes indicated by characterizing a complex formed by multimerization as having at least about five or six units.
  • a heterologous polypeptide in a fusion protein is a polypeptide not naturally linked to an immunoglobulin constant region.
  • a polypeptide can be a full-length protein or any fragment thereof of sufficient length to retain specific binding to the antigen bound by the full-length protein.
  • a heterologous polypeptide can be a receptor extracellular domain or ligand thereto.
  • subject includes humans and non-human animals receiving therapeutic or prophylactic treatment.
  • Other non-human animals include animal models of a human condition (e.g., rodent, non-human primate) and veterinary subjects.
  • target indicates a target molecule (e.g., protein, nucleic acid or carbohydrate) present in a subject to which a drug, such as an antibody or Fc fusion protein, can specifically bind to effect treatment or prophylaxis of a condition in the subject.
  • a drug such as an antibody or Fc fusion protein
  • amino acids are grouped as follows: Group I (hydrophobic side chains): met, ala, val, leu, ile; Group II (neutral hydrophilic side chains): cys, ser, thr; Group III (acidic side chains): asp, glu; Group IV (basic side chains): asn, gln, his, lys, arg; Group V (residues influencing chain orientation): gly, pro; and Group VI (aromatic side chains): trp, tyr, phe. Conservative substitutions involve substitutions between amino acids in the same class. Non-conservative substitutions constitute exchanging a member of one of these classes for a member of another.
  • Percentage sequence identities are determined with antibody sequences maximally aligned by the Kabat numbering convention for a variable region or EU numbering for a constant region. After alignment, if a subject antibody region (e.g., the entire mature variable region of a heavy or light chain) is being compared with the same region of a reference antibody, the percentage sequence identity between the subject and reference antibody regions is the number of positions occupied by the same amino acid in both the subject and reference antibody region divided by the total number of aligned positions of the two regions, with gaps not counted, multiplied by 100 to convert to percentage.
  • a subject antibody region e.g., the entire mature variable region of a heavy or light chain
  • compositions or methods “comprising” one or more recited elements may include other elements not specifically recited.
  • a composition that comprises antibody may contain the antibody alone or in combination with other ingredients.
  • Consisting essentially of is used in accordance with convention to indicate the basic and novel features of a composition or method and does not exclude that other components or steps not materially affecting the basic and novel characteristics may be present.
  • pH-dependent binding of an antibody to an FcRn receptor means that the antibody binds more strongly to such a receptor at pH 6.0 than at pH 7.5. Binding of FcRn at a low pH in endosomes after internalization by pinocytosis rescues IgG antibodies from catabolic degradation in lysosomes. Rescued IgG antibodies are then released from FcRn at a neutral pH and recycled to the circulation. Such pH-dependent FcRn binding is the basis of the molecular mechanism for a long serum half-life of IgG antibodies (Ghetie et al., Annu. Rev. Immunol. 18:739-766, 2000).
  • human IgG antibodies bind to human neonatal Fc receptors (FcRn) at pH 6.0 while they bind only weakly to FcRn at pH 7.5.
  • the FcRn binding site in IgG antibodies lies at the junction of the CH2 and CH3 domains. Because a p heavy chain does not bind to FcRn at pH 6.0 or 7.5, natural IgM cannot take advantage of the FcRn-mediated pathway to rescue antibodies from degradation in lysosomes and therefore in general have shorter half-lives than natural IgG antibodies.
  • Some hybrid Fc proteins of the invention show little if any significant difference in binding to FcRn at pH 6.0 and 7.5, which contributes to their ability to compete with IgG for binding to FcRn.
  • the hybrid Fc proteins of this invention include IgG and IgM Fc components.
  • the IgG Fc component includes at least a portion of a hinge region and CH2 and CH3 regions.
  • the IgM component includes C ⁇ 3 and C ⁇ 4 regions of a C ⁇ constant region.
  • the hybrid Fc proteins can form duplexes by interchain disulfide bonding between cysteines in their hinge regions. The duplexes can in turn multiplex through disulfide bonding of the IgM Fc portion.
  • the IgG portion of the hybrid Fc protein like other IgG molecules has specific affinity for the FcRn receptor. However, the avidity of this binding is increased as a result of the IgM Fc mediated multimerization.
  • the hybrid Fc proteins include an IgG Fc portion and an IgM Fc portion.
  • the IgG Fc portion includes at least a portion of a hinge region and CH2 and CH3 regions.
  • the CH2 and CH3 regions are responsible or at least in part for FcRn binding, protein A and G binding, ADCC (antibody-dependent cellular cytotoxicity), CDC (complement-dependent cytotoxicity) and opsonization.
  • the role of the at least a portion of a hinge region is to supply cysteine residues to form interchain disulfide bonds duplexing IgG Fc regions.
  • the at least a portion of a hinge region includes at least one and usually 2 or more cysteines of a natural hinge region and flanking residues sufficient to support the desired interchain disulfide bonding that forms duplexes.
  • cysteine residues in natural hinge regions contribute to duplex formation between Fc regions, and any or all of such other cysteine residues can be removed or substituted with another residue, such as serine or alanine or glycine, to avoid the cysteine participating in unnatural disulfide bonding.
  • part of the hinge region usually, the N-terminal portion can be replaced with a synthetic peptide, of typically no more than 25, 20, 15, 10 or 5 residues.
  • the hinge region including any synthetic peptide provides flexibility for duplexes and multimers to form.
  • ala and ser are exemplary residues for this purpose.
  • the synthetic peptide is synthetic in the sense that it does not occur as an isolated peptide in nature and has a sequence not naturally linked to the hinge or portion thereof to which it is attached, although the synthetic peptide, can as in the present examples, be a mutant version of part of a hinge region, particularly the N-terminal portion.
  • Synthetic peptides are often overrepresented in ala, gly and/or ser (i.e., at least 25, 35 or 50% of all residues in the synthetic peptide are ala, gly and/or ser).
  • the C ⁇ portion includes C ⁇ 3 and C ⁇ 4 of a C ⁇ constant region.
  • the C ⁇ portion is responsible for multimerizing multiple monovalent or divalent binding units into a multivalent complex.
  • multimerization of the hybrid Fc fusion proteins occurs in similar fashion as in natural IgM antibodies through interchain disulfide bonding between the C ⁇ 3 regions of different monomers and between the mu tailpieces of different monomers.
  • Some multimers of IgM also contain one or more J chains bound to the mu tailpiece. In the presence of one or more J chains IgM can form a pentameric structure and in the absence of J chains can form a hexameric structure.
  • Hexameric IgM has been reported to have stronger CDC than pentameric. Although hybrid Fc proteins of the invention are believed to form pentameric or hexameric complexes as for IgM, other multiplicities greater or smaller may form as well or instead of pentameric and hexameric forms.
  • the components mentioned above are arranged from N-terminus to C-terminus in the order: synthetic peptide (if present), at least a portion of an IgG hinge region, IgG CH2 region, IgG CH3 region, C ⁇ 3 region, and C ⁇ 4 region.
  • all of the IgG regions are of the same isotype and subtype. That is, all IgG regions are either from IgG1, IgG2, IgG3 or IgG4.
  • the IgG CH2 and CH3 regions of the hybrid Fc proteins comprise different isotypes and subtypes.
  • the IgG regions are human IgG.
  • the C ⁇ 3 and C ⁇ 4 regions are preferably human.
  • Exemplary sequences for human IgG1, IgG2, IgG3, IgG4, IgM heavy chain constant regions with delineation into components (CH1, hinge, CH2, CH3, C ⁇ 1, C ⁇ 2, C ⁇ 3 and C ⁇ 4 and a J-chain are shown in FIGS. 10 A, B, C.
  • regions from other species including nonhuman primates, camelids, cartilaginous fish, mice or rats can also be used.
  • Exemplary sequences of human IgG1 hybrid Fc proteins are SEQ ID NOS. 7, 11, 13, 15 and 16.
  • Exemplary sequences of IgG2, IgG3 and IgG4 hybrid Fc proteins are SEQ ID NOS. 26-28 respectively.
  • the hybrid Fc proteins of the invention need not include an IgG CH1 constant region (because there is no light chain to pair with), heavy or light chain variable regions forming a binding site specifically binding to a target present in humans or other subjects, or a heterologous polypeptide, such as a receptor ECD or ligand, typically found in Fc fusion proteins, specifically binding to a target present in humans or other subjects.
  • Reference to a human IgG, IgA or IgM region (i.e., CH1, hinge, CH2, CH3, C ⁇ 3 and C ⁇ 4) or J-chain including hybrid Fc proteins of the invention refers to the exemplified sequences or allotypes or isoallotypes thereof or other variant sequence having at least 90, 95, 98 or 99% sequence identity with an exemplified sequence and/or differing from the exemplified sequence by up to 1, 2, 3, 4, 5, 10 or 15 amino acid deletions, substitution or internal insertions in the case of CH1, CH2, CH3, C ⁇ 3 and C ⁇ 4 and a J-chain and 1, 2 or 3 deletions, substitutions or internal substitutions for IgG1, 2 or 4 hinge regions and up to 1, 2, 3, 4, 5, or 6 deletions for IgG3 hinge.
  • Human constant regions show allotypic variation and isoallotypic variation between different individuals, that is, the constant regions can differ in different individuals at one or more polymorphic positions. Isoallotypes differ from allotypes in that sera recognizing an isoallotype bind to a non-polymorphic region of a one or more other isotypes. Reference to a human constant region includes a constant region with any natural allotype (including isoallotypes) or any permutation of residues occupying polymorphic positions in natural allotypes. Sequences of non-human constant regions are provided by e.g., the Swiss-Prot or Genbank databases.
  • Reference to a non-human constant region likewise includes allotypic or isoallotypic variants, and permutations of the same, or other variants sequences differing from natural sequences.
  • the scope of variations is defined by sequence identity and/or number of substitutions with respect to natural sequences of non-human constant regions in analogous fashion to the above description of variants with respect to human constant regions.
  • the Eu numbering convention is used in defining corresponding positions among isotypes or different species, or defining mutated positions.
  • substitutions can be made in the IgG or IgM Fc regions or both for various purposes.
  • IgG Fe there are many known mutations in IgG Fe that increase FcRn binding.
  • Exemplary substitutions include a Gln at position 250 and/or a Leu at position 428, Ser or Asn at position 434, Tyr at position 252, Thr at position 254, and Glu at position 256 (EU numbering).
  • Increased FcRn binding is advantageous in making the hybrid Fc proteins of the present invention compete more strongly with endogenous IgG for binding to FcRn.
  • numerous mutations are known in both IgG and IgM Fc for reducing any of ADCC, ADP (antibody-dependent phagocytosis) or CDC.
  • positions 234, 235, 236 and/or 237 reduce affinity for Fc ⁇ receptors, particularly Fc ⁇ RI receptor (see, e.g., U.S. Pat. No. 6,624,821).
  • positions 234, 236 and/or 237 in human IgG2 are substituted with alanine and position 235 with glutamine or glutamic acid.
  • substitutions reducing effector function include, Ala at position 268, Gly or Ala at position 297, Leu at position 309, Ala at position 322, Gly at position 327, Ser at position 330, Ser at position 331, Ser at position 238, Ala at position 268, Leu at position 309 (Eu numbering).
  • Other substitutions in IgG or IgM Fc are advantageous in stimulating sialyation, which is useful for increasing binding to CD22.
  • each of the substitutions of Phe by Ala at position 241, Phe by Ala at position 243, Val by Glu at position 262, and Val by Glu at position 264 in the IgG Fc region is known to enhance sialylation of IgG molecules (Yu et al, J. Am. Chem. Soc. 2013 135:9723-9732).
  • Other IgG Fc mutants that enhance sialylation of IgG molecules are reported in U.S. Pat. Nos. 9,187,552, 9,328,170 and 9,663,581.
  • hybrid Fc proteins contain no sequences other than the hinge, CH2, CH3, C ⁇ 3 and C ⁇ 4 regions mentioned above. As previously mentioned, there is no need for a CH1 regions, or heavy or light chain variable regions. Nevertheless, other sequences, such as for example, a hexa-histidine tag, can be added but are not necessary.
  • preferred hybrid Fc proteins consist of or consist essentially of a complete or partial hinge, CH2, CH3, C ⁇ 3 and C ⁇ 4 regions as mentioned above, optionally a further peptide, such as the synthetic peptides discussed above, of up to 5, 10, 15, 20 or 25 residues, and optionally a J-chain.
  • Some hybrid Fc proteins consist of or consist essentially of a complete or partial hinge, optionally modified to remove one or more cysteine residues involved in light chain pairing, CH2, CH3, C ⁇ 3 and C ⁇ 4 regions as mentioned above.
  • hybrid Fc proteins consist of or consistent essentially of entirely human IgG hinge, CH2, CH3 and C ⁇ 3 and C ⁇ 4 regions, and optionally a J-chain, with the possible exception of one or more mutated cysteine residues in the hinge region.
  • Hybrid Fc proteins formed entirely or substantially from human sequences have little if any immunogenic potential in humans. Any additional sequences present preferably do not increase the immunogenicity of the hybrid Fc proteins in humans.
  • a standard immunoglobulin structure including two heavy chains has a maximum of four sialic residues (two per chain).
  • the present hybrid Fc proteins can have more than 2 both because of their multiplicity (e.g., hexamers) and because Cmu3 and Cmu4 regions provide further sialic acid attachment sites.
  • the present hybrid Fc fusions can a mean of 2.1 or more sialic acid per protein molecule (e.g., 2.1-5).
  • hexamers of present hybrid Fc molecules can have a mean of more than 12, 15 or 20 sialic acid molecules per hexamer (e.g. 12.1-30). Higher sialyation is advantageous for immune suppression via binding to CD22.
  • Hybrid Fc proteins are produced by recombinant expression.
  • a hybrid Fc protein is achieved by fusing a DNA segment encoding the IgG Fc portion in-frame with a DNA segment encoding the C ⁇ portion.
  • the last amino acid of a CH3 exon of the IgG is fused in frame to the first amino acid of a C ⁇ 3 exon.
  • the order in which fusions of genetic elements is performed in building a construct encoding several components is not important.
  • the segments can also be linked simultaneously by joining overlapping oligonucleotides encoding the respective segments in an overlapping PCR-type reaction.
  • the same vector can be used to insert any heavy chain variable region or other binding region in the case of a fusion protein (and sometimes a light chain variable region) without recreating the DNA segment encoding the hybrid constant region.
  • Mammalian cells are one host for expressing nucleotide segments encoding hybrid Fc proteins of the invention (see Winnacker, From Genes to Clones, (VCH Publishers, N Y, 1987)).
  • a number of suitable host cell lines capable of secreting intact heterologous proteins have been developed in the art, and include CHO cell lines, various COS cell lines, HeLa cells, HEK293 cells, L cells, and non-antibody-producing myelomas including Sp2/0 and NS0.
  • the cells are nonhuman.
  • the cells used for producing antibodies may or may not endogenously express J chains.
  • host cells can be genetically modified to express J chains (i.e., by introducing a construct encoding such). However, host cells not expressing J chains can also be used. Selection of cells with or without J chains affects valency with which antibodies or fusion proteins are produced (e.g., pentamer with J chains and hexamer without).
  • a hybrid Fc protein is expressed from a monoclonal cell line.
  • Expression vectors for these cells can include expression control sequences, such as an origin of replication, a promoter, an enhancer (Queen et al., Immunol. Rev. 89:49 (1986)), and necessary processing information sites, such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences.
  • Preferred expression control sequences are promoters derived from endogenous genes, cytomegalovirus, SV40, adenovirus, bovine papillomavirus, and the like. See Co et al., J. Immunol. 148:1149 (1992).
  • Hybrid Fc proteins are expressed, processed to remove signal peptides, assembled and secreted from host cells. It is believed that multimerization and association with J chains occur at least predominantly within cells so that hybrid Fc proteins are secreted primarily as multimers, particularly multimers in which five or six units are associated via the C ⁇ portion of the hybrid constant region.
  • Hybrid Fc proteins can be purified from cell culture supernatants by conventional antibody purification methods.
  • the purification can include a chromatography step using protein A or protein G as the affinity reagent.
  • Conventional antibody purification procedures such as ion exchange, hydroxyapatite chromatograph or HPLC can also be used (see generally, Scopes, Protein Purification (Springer-Verlag, N.Y., 1982)).
  • Hybrid Fc proteins of the invention are useful for treating a variety of conditions mediated by antibodies or B cell functions, particularly those previously treated by IVIG as indicated in the Background. Such conditions include immune disorders, inflammatory disorders, rejection following organ transplantation, hematological disorders, dermatological disorders or neuromuscular disorders. The designations of conditions are not mutually exclusive. Thus an immune disorder can also be an inflammatory disorder for example.
  • the hybrid Fc proteins can treat such conditions by reducing half-life of endogenous IgG molecules in the circulation, suppressing immune response of endogenous B cells, reducing the concentration of endogenous IgG molecules in the circulation.
  • hybrid Fc proteins of the invention are useful, inter alia, to block alloantigen-induced immune responses in the donee.
  • a related use for hybrid Fc proteins of the present invention is in modulating the immune response involved in “graft versus host” disease (GVHD).
  • GVHD is a potentially fatal disease that occurs when immunologically competent cells are transferred to an allogeneic recipient. In this situation, the donor's immunocompetent cells may attack tissues in the recipient. Tissues of the skin, gut epithelia and liver are frequent targets and may be destroyed during the course of GVHD.
  • the disease presents an especially severe problem when immune tissue is being transplanted, such as in bone marrow transplantation; but less severe GVHD has also been reported in other cases as well, including heart and liver transplants.
  • a further situation in which immune suppression is desirable is in treatment of autoimmune diseases such as idiopathic thrombocytopenic purpura, Kawasaki disease, Guillain-Barre syndrome, and chronic inflammatory demyelinating systemic lupus erythematosus, multiple sclerosis, and autoimmune neutropenia type 1 diabetes, Crohn's disease, ulcerative colitis, multiple sclerosis, stiff man syndrome, rheumatoid arthritis, myasthenia gravis and lupus erythematosus.
  • disorders which can be treated include acute disseminated encephalomyelitis, acute motor axonal neuropathy, Addison's disease, adiposis dolorosa, adult-onset Still's disease, alopecia areata, ankylosing spondylitis, anti-glomerular basement membrane nephritis, anti-neutrophil cytoplasmic antibody-associated vasculitis, anti-N-methyl-D-aspartate receptor encephalitis, antiphospholipid syndrome, antisynthetase syndrome, aplastic anemia, autoimmune angioedema, autoimmune encephalitis, autoimmune enteropathy, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease, autoimmune lymphoproliferative syndrome, autoimmune oophoritis, autoimmune orchitis, autoimmune pancreatitis, autoimmune polyendocrine syndrome, autoimmune polyendocrine syndrome type 2, autoimmune polyendocrine syndrome type 3, autoimmune progesterone
  • any of these diseases the body develops a humoral immune response against one of its own antigens leading to destruction of cells expressing that antigen, and potentially crippling and/or fatal consequences.
  • Autoimmune diseases are treated by administering a hybrid Fc protein.
  • hybrid Fc proteins of the invention include asthma, allergies, celiac disease, psoriasis, and uveitis.
  • Celiac disease, psoriasis and uveitis are autoimmune diseases.
  • Hybrid Fc proteins are administered in an effective regime meaning a dosage, route of administration and frequency of administration that delays the onset, reduces the severity, inhibits further deterioration, and/or ameliorates at least one sign or symptom of a disorder.
  • the regime can be referred to as a therapeutically effective regime.
  • the subject is at elevated risk of the disorder relative to the general population but is not yet experiencing symptoms, the regime can be referred to as a prophylactically effective regime.
  • therapeutic or prophylactic efficacy can be observed in an individual subject relative to historical controls or past experience in the same patient.
  • therapeutic or prophylactic efficacy can be demonstrated in a preclinical or clinical trial in a population of treated subjects relative to a control population of untreated subjects.
  • Exemplary dosages for hybrid Fc proteins are 0.01-20, or 0.5-5, or 0.01-1, or 0.01-0.5 or 0.05-0.5 mg/kg body weight (e.g., 0.1, 0.5, 1, 2, 3, 4 or 5 mg/kg) or 10-1500 mg as a fixed dosage.
  • the dosage depends on the condition of the patient and response to prior treatment, if any, whether the treatment is prophylactic or therapeutic and whether the disorder is acute or chronic, among other factors.
  • Administration can be parenteral, intravenous, oral, subcutaneous, intra-arterial, intracranial, intrathecal, intraperitoneal, topical, intranasal or intramuscular. Administration into the systemic circulation by intravenous or subcutaneous administration is preferred. Intravenous administration can be, for example, by infusion over a period such as 30-90 min.
  • the frequency of administration depends on the half-life of hybrid Fc protein in the circulation, the condition of the patient and the route of administration among other factors.
  • the frequency can be daily, weekly, monthly, quarterly, or at irregular intervals in response to changes in the patient's condition or progression of the disorder being treated.
  • An exemplary frequency for intravenous administration is between weekly and quarterly over a continuous cause of treatment, although more or less frequent dosing is also possible.
  • an exemplary dosing frequency is daily to monthly, although more or less frequent dosing is also possible.
  • the number of dosages administered depends on whether the disorder is acute or chronic and the response of the disorder to the treatment. For acute disorders or acute exacerbations of chronic disorders between 1 and 10 doses are often sufficient. Sometimes a single bolus dose, optionally in divided form, is sufficient for an acute disorder or acute exacerbation of a chronic disorder. Treatment can be repeated for recurrence of an acute disorder or acute exacerbation.
  • the hybrid Fc protein of the invention can be administered at regular intervals, e.g., weekly, fortnightly, monthly, quarterly, every six months for at least 1, 5 or 10 years, or the life of the patient.
  • compositions are preferably suitable for parenteral administration to humans. Such compositions are preferably sterile and substantially isotonic and manufactured under GMP conditions. Pharmaceutical compositions can be provided in unit dosage form (i.e., the dosage for a single administration). Pharmaceutical compositions can be formulated using one or more pharmaceutically acceptable carriers, diluents, excipients or auxiliaries. Pharmaceutically acceptable means suitable for parenteral administration in humans, e.g., approved or approval by the FDA. The formulation depends on the route of administration chosen.
  • hybrid Fc proteins of the invention can be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological saline or acetate buffer (to reduce discomfort at the site of injection).
  • the solution can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • hybrid Fc proteins of the invention can be in lyophilized form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
  • Treatment with the hybrid Fc proteins of the invention can be combined with other treatments effective against the disorder being treated.
  • conventional treatments include mast cell degranulation inhibitors, corticosteroids, nonsteroidal anti-inflammatory drugs, and stronger anti-inflammatory drugs such as azathioprine, cyclophosphamide, leukeran, FK506 and cyclosporine.
  • Biologic anti-inflammatory agents such as Tysabri® (natalizumab) or Humira® (adalimumab), can also be used.
  • the mammalian expression vector pVF101 ( FIG. 1 ), designed for production of multimeric hybrid Fc proteins comprising, from N- to C-terminus, an artificial signal peptide (sp), and the hinge, CH2 and CH3 regions of the human IgG1 isotype, and then the human C ⁇ 3 and C ⁇ 4 regions, contains the following genetic components. Proceeding clockwise from the SalI site of pVF101 in FIG. 1 , the plasmid contains the human cytomegalovirus (CMV) major immediate early promoter and enhancer (CMV-P in the figure) to initiate transcription of the region encoding LS41A-Fc (defined hereunder).
  • CMV human cytomegalovirus
  • CMV-P major immediate early promoter and enhancer
  • the CMV promoter is followed by an exon encoding the signal peptide (SEQ ID NO:1) fused to the hinge region (Hinge; SEQ ID NO:2), an exon encoding CH2 (SEQ ID NO: 3), an exon encoding CH3 (SEQ ID NO: 4) fused to C ⁇ 3 (SEQ ID NO:5) and C ⁇ 4 (SEQ ID NO:6), and the polyadenylation site with the intervening introns.
  • the hinge (H in the figure), CH2 and CH3 regions and the polyadenylation site are derived from the human gamma-1 heavy chain gene.
  • the transcription unit for the hybrid Fc protein is followed by the SV40 early promoter (SV40-P), the puromycin N-acetyl-transferase gene (puro) for resistance to puromycin, and a segment containing the SV40 polyadenylation site (SV40-A).
  • SV40-P SV40 early promoter
  • puro puromycin N-acetyl-transferase gene
  • SV40-A SV40 polyadenylation site
  • pVF101 contains a part of the plasmid pUC19, comprising the bacterial origin of replication (pUC ori) and the ⁇ lactamase gene ( ⁇ lactamase). Arrows in the figure indicate the orientation of transcription.
  • the amino acid sequence of the mature hybrid Fc protein encoded in pVF101 is EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGKDQDTAIRVFAIPPSFASIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKT HTNISESHPNATFSAVGEASICEDDWNSGERFTCTVTHTDLPSPLKQTISRPKGVALH RPDVYLLPPAREQ
  • the mammalian expression vector pVF101 was modified in the coding region of LS41A-Fc as described below to generate a new expression vector pVF102.
  • the first five amino acid residues in the hinge region of the mature LS41A-Fc sequence were replaced with an artificial pentapeptide EPKSS (SEQ ID NO:8) in pVF102.
  • EPKSS pentapeptide
  • Leucine residues at positions 234 and 235 in CH2 (Eu numbering of Kabat et al. Sequences of Proteins of Immunological Interests, Fifth edition, NIH Publication No. 91-3242, U.S.
  • the mammalian expression vector pVF102 was modified by replacing a methionine residue at position 428 in CH3 with a leucine residue (Eu numbering) (SEQ ID NO:12) to generate a new expression vector pVF103. No other changes were introduced into pVF102 for generation of pVF103.
  • the amino acid sequence of the mature hybrid Fc protein encoded in pVF103 (LS41K-Fc.SL), which is composed of the artificial pentapeptide, portion of Hinge, CH2, CH3, C ⁇ 3 and C ⁇ 4, is
  • LS41A-Fc, LS41K-Fc.S and LS41K-Fc.SL Concentration of LS41A-Fc, LS41K-Fc.S and LS41K-Fc.SL in culture supernatants or mouse serum was measured by sandwich ELISA.
  • an ELISA plate was coated overnight at 4° C. with 100 ⁇ l/well of 1/2,000-diluted goat anti-human IgG Fc ⁇ chain-specific antibody (Jackson ImmunoResearch, West Grove, PA) in PBS (phosphate-buffered saline, pH 7.4), washed with Wash Buffer (PBS containing 0.05% Tween 20), and blocked for 1 hr at room temperature with 200 ⁇ l/well of ELISA Buffer (PBS containing 2% skim milk and 0.05% Tween 20).
  • mice monoclonal anti-human CD122 IgG1/kappa antibody ABC2 (U.S. Pat. No. 9,028,830) in mouse serum was measured by sandwich ELISA as described above, except that (1) human CD122 extracellular region fused to six histidine residues generated at JN Biosciences (CD122-His; SEQ ID NO: 14) was used for coating of an ELISA plate, (2) HRP-conjugated goat anti-mouse kappa chain antibody (Bethyl Laboratories, Montgomery, TX) was used for detection of bound ABC2, and (3) ABC2 was used as a standard.
  • mice IgG Concentration of mouse IgG in mouse serum was measured by sandwich ELISA as described above, except that (1) goat anti-mouse IgG Fc ⁇ chain-specific antibody (Jackson ImmunoResearch) was used for coating, (2) HRP-conjugated goat anti-mouse kappa chain antibody (Bethyl Laboratories) was used for detection, and (3) ABC2 was used as a standard.
  • the expression vectors pVF102 and pVF103 were individually introduced into the chromosomes of a Chinese hamster ovary cell line CHO-K1 to obtain cell lines stably producing LS41K-Fc.S and LS41K-Fc.SL, respectively.
  • CHO-K1 cells were grown in SFM4CHO media (GE Healthcare, Chicago, IL) at 37° C. in a 7.5% CO 2 incubator. Stable transfection into CHO-K1 was carried out by electroporation. Before transfection, each expression vector was linearized using FspI.
  • LS41K-Fc.S and LS41K-Fc.SL were measured by sandwich ELISA as described above. Previously purified LS41K-Fc.S or LS41K-Fc.SL was used as a standard. CHO-K1 stable transfectants producing each of LS41K-Fc.S and LS41K-Fc.SL were expanded in SFM4CHO until the cell viability became less than 50%. After centrifugation and filtration, culture supernatants were loaded onto a Protein A column (HiTrap MABSelect SuRe, GE Healthcare).
  • the molecular size of purified LS41K-Fc.S and LS41K-Fc.SL in the native form was analyzed by gel filtration using the AKTA Basic FPLC system with a Superose 6 10/300 GL column (GE Healthcare). PBS was used as running buffer. A single dominant peak was observed for each of purified LS41K-Fc.S and LS41K-Fc.SL.
  • the size of LS41K-Fc.S and LS41K-Fc.SL in the native form was estimated to be approximately 600 kDa, which is consistent with the size of a hexamer of the disulfide-linked hybrid Fc dimers of this invention comprising the hinge, CH2, CH3, C ⁇ 3 and C ⁇ 4 regions.
  • mice Fifty (50) ⁇ g of mouse monoclonal anti-human CD122 IgG1 antibody ABC2 in the absence and presence of 400 ⁇ g LS41K-Fc.S (Groups A and B, respectively) in 50 ⁇ l of PBS was intracardially administered into three Balb/c mice per group. Serum samples were collected from these mice at one day before administration (Day ⁇ 1) and at two hours (2 HR), one day (Day 1), three days (Day 3), five days (Day 5) and eight days (Day 8) after the administration.
  • Concentration of ABC2 in the serum samples was measured by ELISA as described above.
  • the ABC2 concentration at each time point was normalized to the concentration in the 2 HR sample for each mouse.
  • the data are plotted in FIG. 3 .
  • the average relative concentration of ABC2 in the Group A (ABC2 alone) was 100% (2 HR), 52.0% (Day 1), 36.7% (Day 3) and 29.9% (Day 5) and 19.3% (Day 8).
  • the average percentage concentration of ABC2 in the Group B (ABC2 and LS41K-Fc.S) was 100% (2 HR), 39.1% (Day 1), 20.1% (Day 3), 14.9% (Day 5) and 8.8% (Day 8).
  • mice IgG concentration in the serum samples was measured by ELISA as described above.
  • the mouse IgG concentration at each time point (2 HR, Day 1, Day 3, Day 5 and Day 8) was normalized to the concentration in the Day ⁇ 1 sample for each mouse.
  • the data are plotted in FIG. 4 .
  • the average relative concentration of mouse IgG was mostly unchanged.
  • the average mouse IgG concentration was 100% (Day ⁇ 1), 92.8% (2 HR), 86.2% (Day 1), 90.7% (Day 3), 96.6% (Day 5) and 96.8% (Day 8).
  • Concentration of LS41K-Fc.S in the serum samples was measured by ELISA as described above. The data are plotted in FIG. 5 .
  • the average concentration of LS41K-Fc.S was 230 ⁇ g/ml (2 HR), 144 ⁇ g/ml (Day 1), 76.4 ⁇ g/ml (Day 3), 50.0 ⁇ g/ml (Day 5) and 5.1 ⁇ g/ml (Day 8).
  • the sudden decrease of the concentration on Day 8 is likely due to immune reactions against the human-origin of LS41K-Fc.S in the mice.
  • the half-life of LS41K-Fc.S in the mouse circulation calculated with Day 1, Day 3 and Day 5 samples was 62 hours.
  • a mixture of 50 ⁇ g ABC2 and 400 ⁇ g LS41K-Fc.SL in 50 ⁇ l PBS was intracardially administered into three Balb/c mice (Group C). Serum samples were collected from these mice at one day before administration (Day ⁇ 1) and at two hours (2 HR), one day (Day 1), three days (Day 3), five days (Day 5) and eight days (Day 8) after the administration. This experiment was carried out together with Group A (ABC2 alone) and Group B (ABC2 and LS41K-Fc.S) described above.
  • Concentration of LS41K-Fc.SL in the serum samples was measured by ELISA as described above.
  • the average concentration of LS41K-Fc.SL was 279 ⁇ g/ml (2 HR), 86.0 ⁇ g/ml (Day 1), 20.1 ⁇ g/ml (Day 3) and 7.2 ⁇ g/ml (Day 5).
  • the data are plotted in FIG. 5 .
  • the concentration in the Day 8 samples was below the detection limit.
  • the LS41K-Fc.SL concentration on Day 5 was 2.6% of the concentration at 2 HR in Group C, whereas the LS41K-Fc.S concentration on Day 5 was 21.7% of the concentration at 2 HR in Group B.
  • Concentration of ABC2 in the serum samples was measured by ELISA as described above.
  • the ABC2 concentration at each time point was normalized to the concentration in the 2 HR sample for each mouse.
  • the data are plotted in FIG. 3 .
  • the average relative concentration of ABC2 in Group C (ABC2 and LS41K-Fc.SL) was 37.3% (Day 1), 12.7% (Day 3), 10.2% (Day 5) and 8.0% (Day 8).
  • LS41K-Fc.SL reduced the concentration of ABC2 in the serum samples more drastically than LS41K-Fc.S on Days 3 and 5.
  • mice IgG concentration in the serum samples was measured by ELISA as described above.
  • the mouse IgG concentration at each time point (2 HR, Day 1, Day 3, Day 5 and Day 8) was normalized to the concentration in the Day ⁇ 1 sample for each mouse.
  • the data are plotted in FIG. 4 .
  • the average relative concentration of mouse IgG was 87.2% (2 HR), 68.6% (Day 1), 55.3% (Day 3), 67.1% (Day 5) and 118.8% (Day 8).
  • the mouse IgG concentration on Day 3 reached nearly half of the predose concentration (Day ⁇ 1) by LS41K-Fc.SL in Group C.
  • LS41K-Fc.SL functioned more potently than LS41K-Fc.S to reduce the concentration of ABC2 and mouse IgG in the circulation.
  • mice Fifty (50) ⁇ g of mouse monoclonal IgG1 antibody ABC2 together with either 100 ⁇ g (Group D) or 400 ⁇ g (Group E) of LS41K-Fc.SL was intracardially administered into three Balb/c mice per group. Serum samples were collected from these mice at two hours (2 HR), one day (Day 1), three days (Day 3), five days (Day 5) and eight days (Day 8) after the administration. Concentration of each of ABC2, mouse IgG and LS41K-Fc.SL in the serum samples was measured by ELISA as described above.
  • the ABC2 concentration at each time point was normalized to the concentration in the 2 HR sample for each mouse.
  • the data are plotted in FIG. 6 .
  • the average relative concentration of ABC2 with 100 ⁇ g of LS41K-Fc.SL (Group D) was 100% at 2 HR, 34.0% on Day 1, 19.6% on Day 3, 16.4% on Day 5 and 12.3% on Day 8.
  • the average concentration of ABC2 with 400 ⁇ g of LS41K-Fc.SL (Group E) was 100% at 2 HR, 27.2% on Day 1, 10.7% on Day 3, 8.0% on Day 5, and 5.5% on Day 8.
  • the decrease of the concentration of ABC2 in the serum samples was dependent on the dose of LS41K-Fc.SL.
  • the administration of 400 ⁇ g of LS41K-Fc.SL (Group E) reduced the concentration of ABC2 in the circulation more rapidly than the administration of 100 ⁇ g of LS41K-Fc.SL (Group D).
  • mice IgG concentration Concentration of mouse IgG in the serum samples was measured by ELISA as described above.
  • the mouse IgG concentration at each time point (Day 1, Day 3, Day 5 and Day 8) was normalized to the concentration in the 2 HR sample for each mouse.
  • the data are plotted in FIG. 7 .
  • the average relative mouse IgG concentration in Group D was 100% at 2 HR, 83.6% on Day 1, 73.6% on Day 3, 76.5% on Day 5, and 92.8% on Day 8.
  • the average relative mouse IgG concentration in Group E was 100% at 2 HR, 74.8% on Day 1, 61.4% on Day 3, 63.6% on Day 5, and 88.3% on Day 8.
  • the mouse IgG level decreased on Day 1 and Day 3, and started increasing gradually on Day 5 in both Groups D and E.
  • Mouse IgG concentration was more drastically decreased in Group E (400 ⁇ g of LS41K-Fc.SL) than Group D (100 ⁇ g of LS41K-Fc.SL) on Days
  • FIG. 8 shows the concentration of LS41K-Fc.SL in the serum samples.
  • the average LS41K-Fc.SL concentration in Group D was 72.8 ⁇ g/ml at 2 HR, 21.9 ⁇ g/ml on Day 1, 5.3 ⁇ g/ml on Day 3 and 2.1 ⁇ g/ml on Day 5.
  • the average LS41K-Fc.SL concentration in Group E was 311.3 ⁇ g/ml at 2 HR, 97.4 ⁇ g/ml on Day 1, 23.8 ⁇ g/ml on Day 3 and 9.2 ⁇ g/ml on Day 5.
  • the concentration of LS41K-Fc.SL on Day 8 was below the detection limit in both dosing groups.
  • the average serum half-life of LS41K-Fc.SL calculated using the Day 1, Day 3 and Day 5 data was 28 hrs for both 100 ⁇ g and 400 ⁇ g dosing groups.
  • a variant of LS41K-Fc.SL was generated by substituting a phenylalanine residue at position 241 (Eu numbering) to an alanine residue in CH2 of the human gamma-1 chain in pVF103 to generate pVF104.
  • the amino acid sequence of the mature hybrid Fc protein encoded in pVF104 (LS41K-Fc.SL.F241A), which is composed of the artificial pentapeptide, and a portion of Hinge, CH2, CH3, C ⁇ 3 and C ⁇ 4, is
  • LS41K-Fc.SL was generated by substituting a phenylalanine residue at position 243 to an alanine residue in CH2 of the human gamma-1 chain in pVF103 to generate pVF105.
  • the amino acid sequence of the mature hybrid Fc protein encoded in pVF105 (LS41K-Fc.SL.F243A), which is composed of the artificial pentapeptide, portion of Hinge, CH2, CH3, C ⁇ 3 and C ⁇ 4, is
  • Example 7 Expression of Beta-Galactoside alpha-2,6-sialyltransferase 1 (ST6GAL1) and beta-1,4-galactosyltransferase 1 (B4GALT1)
  • sialylated IVIG has been reported to be responsible for anti-inflammatory activities (Anthony et al., J. Clin. Immunol. 30:9-14, 2010; Seite et al., Arthritis Rheum. 67:595-603, 2015).
  • Terminal sialic acid can be attached to galactose in alpha-2,3-, alpha-2,6-, or alpha-2,8-linkages.
  • CD22 and DC-SIGN binds only to alpha-2,6-linked sialic acid (Powell et al., J. Biol. Chem. 13:7523-7532, 1995; Anthony et al., Proc. Natl. Acad. Sci. 105:9571-19578, 2008).
  • Two beta-galactoside alpha-2,6-sialyltransferases ST6GAL1 and ST6GAL2 are responsible for attachment of alpha-2,6-linked sialic acid to a terminal galactose of N-linked carbohydrates in mammalian cells.
  • Another expression vector for human B4GALT1 (SEQ ID NO:18) (pFCm513; FIG. 9 B ) has the same structure as pVF101 except that (i) the SpeI-EagI fragment encoding LS41A-Fc was replaced with the synthetic gene encoding human B4GALT1 and (ii) the puromycin N-acetyl-transferase gene (puro) was replaced with the Streptoalloteichus hindustanus bleomycin resistant gene (Zeo in the figure).
  • Each of the expression vectors pVF103, pVF104 and pVF105 is transiently transfected into HEK293 cells to express LS41K-Fc.SL, LS41K-Fc.SL.F241A and LS41K-Fc.SL.F243A, respectively, by the polyethylenimine method (Durocher et al. Nucl. Acids Res. 30:e9, 2002).
  • Each of these three expression vectors is also cotransfected with (i) pFCm512 or (ii) pFCm512 and pFCm513 into HEK293 cells.
  • Binding of such expressed LS41K-Fc.SL, LS41K-Fc.SL.F241A and LS41K-Fc.SL.F243A to CD22 is analyzed with human Burkitt lymphoma cell lines Ramos and Raji by flow cytometry.
  • the activity of LS41K-Fc.SL, LS41K-Fc.SL.F241A and LS41K-Fc.SL.F243A to reduce the viability of Ramos cells via cross-linking of CD22 is analyzed by the method described by Seite et al. (Blood 116:1698-1704, 2010).
  • Example 9 PK and PD Analysis of LS41K-Fc.SL, LS41K-Fc.SL.F241A and LS41K-Fc.SL.F243A in Non-Human Primates
  • Humanized anti-CD122 IgG1 antibody HuABC2 (U.S. Pat. No. 9,028,830) is intravenously administered at 5 mg/kg to a group of three cynomolgus monkeys.
  • HuABC2 together with 20 mg/kg of either LS41K-Fc.SL, LS41K-Fc.SL.F241A or LS41K-Fc.SL.F243A is also administered intravenously to another group of three cynomolgus monkeys. Serum samples are collected from these monkeys at one day before administration (Day ⁇ 1) and at two hours (2 HR), one day (Day 1), four days (Day 4), seven days (Day 7), ten days (Day 10) and fourteen days (Day 14) after the administration.
  • Concentration of HuABC2 in the serum samples is measured by ELISA as described above, except that (1) human CD122 extracellular region fused to six histidine residues generated at JN Biosciences (CD122-His; SEQ ID NO: 14) is used for coating of an ELISA plate, (2) HRP-conjugated goat anti-human kappa chain antibody is used for detection of bound antibodies, and (3) HuABC2 is used as a standard, to demonstrate that LS41K-Fc.SL, LS41K-Fc.SL.F241A and LS41K-Fc.SL.F243A have an ability to rapidly clear HuABC2 from the circulation of cynomolgus monkeys.
  • Concentration of total cynomolgus IgG in the serum samples is measured by ELISA as described above, except that (1) goat anti-cynomolgus IgG Fc ⁇ chain-specific antibody is used for coating, (2) HRP-conjugated goat anti-cynomolgus kappa chain antibody is used for detection of bound antibodies, and (3) cynomolgus IgG is used as a standard, to demonstrate that LS41K-Fc.SL, LS41K-Fc.SL.F241A and LS41K-Fc.SL.F243A have an ability to reduce the IgG concentration in the circulation of cynomolgus monkeys.
  • B cells are isolated from the cynomolgus monkeys administered with LS41K-Fc.SL, LS41K-Fc.SL.F241A or LS41K-Fc.SL.F243A.
  • the activity of B cells to respond to antigens, such as endotoxin is monitored by analyzing the production of anti-endotoxin antibodies.
  • the immune response of B cells by conjugation of CD40 on the surface is analyzed by flow cytometry to measure the expression level of CD95 on the surface.
  • Example 10 Sialylation Level of LS41K-Fc.SL.F243A
  • CHO-K1 cells were stably transfected with pFCm512 that expresses human ST6GAL1 by electroporation as described above.
  • CHO-K1 stable transfectants expressing ST6GAL1 (CHO-K1/ST6GAL1), which had been isolated by selection in the presence of blasticidin, were then used for stable transfection with pVF105 that expresses LS41K-Fc.SL.F243A.
  • Puromycin-resistant CHO-K1/ST6GAL1 cells expressing LS41K-Fc.SL.F243A were expanded in SFM4CHO media as described above.
  • LS41K-Fc.SL.F243A was purified using a protein A affinity column as described above. Purified LS41K-Fc.SL.F243A showed a single dominant peak of the expected size (approximately 600 kDa) in the gel filtration analysis with a Superose 6 column.
  • Sialylation of LS41K-Fc.SL.F243A purified from CHO-K1/ST6GAL1 cells was analyzed using EnzyChrom Sialic Acid Assay Kit (BioAssay Systems, Hayward, CA).
  • Herceptin® tacuzumab
  • An average number of sialic acids attached to each LS41K-Fc.SL.F243A molecule was determined to be 21.3.
  • An average number of sialic acids attached to each Herceptin was 0.14.
  • the vector pFCm239 has the same structure as pVF101 ( FIG. 1 ) except that (1) the Spe-EagI fragment was substituted with a DNA fragment encoding, from N-terminus to C-terminus, the signal peptide and extracellular region of human FcRn (SEQ ID NO: 19), a polypeptide linker Thr-Gly-Gly-Gly, the FLAG polypeptide (SEQ ID NO:20), a polypeptide linker Gly-Gly-Gly, and the GPI anchorage signal of human CD55 (SEQ ID NO:21) (hFcRn-FLAG-GPI; SEQ ID NO:22) and (2) the puromycin N-acetyl-transferase gene (puro) was substituted by the E. coli xanthine-guanine phosphoribosyltransferase for selection of transfectants in the
  • the expression vector pFCm240 has the same structure as pVF101 except that the Spe-EagI fragment was substituted with a DNA fragment encoding the entire human 02 microglobulin (SEQ ID NO:23).
  • the mouse myeloma cell line NS0 was maintained in DME medium containing 10% fetal bovine serum (FBS).
  • FBS fetal bovine serum
  • NS0 cells were stably transfected with pFCm239 by electroporation (Bebbington et al. Bio/Technology 10:169-175, 1992), selected in DME medium containing 10% FBS, 1 ⁇ g/ml mycophenolic acid, HT media supplement (Sigma-Aldrich, St.
  • NS0 cells expressing FcRn-FLAG-GPI were further stably transfected with pFCm240 by electroporation.
  • NS0 transfectant cell line expressing hFcRn-FLAG-GPI and human ⁇ 2 microglobulin was named NS0/hFcRn.
  • the expression vector pFCm380 has the same structure as pVF101 ( FIG. 1 ) except that the Spe-EagI fragment was substituted with a DNA fragment encoding, from N-terminus to C-terminus, the signal peptide and extracellular region of mouse FcRn (SEQ ID NO:24), a polypeptide linker Thr-Gly-Gly-Gly, the FLAG polypeptide (SEQ ID NO:20), a polypeptide linker Gly-Gly-Gly, and the GPI anchorage signal of human CD55 (SEQ ID NO:21) (mFcRn-FLAG-GPI; SEQ ID NO:25).
  • NS0 cells were stably transfected with pFCm380 by electroporation.
  • NS0 transfectant cell line expressing mFcRn-FLAG-GPI associated with endogenous mouse 02 microglobulin on the surface was named NS0/mFcRn.
  • NS0/hFcRn cells were incubated with 1 ⁇ g/ml of phycoerythrin-labeled donkey anti-human IgG F(ab′)2 antibody (Bethyl Laboratories, Montgomery, TX) for 30 min at room temperature in FACS Buffer of the same pH used at the initial binding step. Cells were washed with and suspended in FACS Buffer of the same pH used at the initial binding step, and then subjected to flow cytometry.
  • Example 12 Hybrid Fc Proteins Comprising Human IgG2, IgG3 and IgG4 Fc Regions
  • the coding sequences of the hinge, CH2 and CH3 regions in pVF103 which encodes LS41K-Fc.SL, are replaced by the coding sequences of the hinge, CH2 and CH3 regions of human IgG2, respectively, to construct pVF103-G2.
  • the amino acid sequence of human IgG2-based hybrid Fc protein encoded in pVF103-G2 is
  • the coding sequences of the hinge, CH2 and CH3 regions in pVF103 are replaced by the coding sequences of the last repeat of hinge, CH2 and CH3 regions of human IgG3, respectively, to construct pVF103-G3.
  • the amino acid sequence of human IgG3-based hybrid Fc protein encoded in pVF103-G3 is
  • the coding sequences of the hinge, CH2 and CH3 regions in pVF103 are replaced by the coding sequences of the hinge, CH2 and CH3 regions of human IgG4, respectively, to construct pVF103-G4.
  • the amino acid sequence of human IgG4-based hybrid Fc protein encoded in pVF103-G4 is

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The hybrid Fc proteins of this invention include IgG and IgM Fc components. The IgG Fc component includes at least a portion of a hinge region and CH2 and CHS regions. The IgM component includes Cμ3 and Cμ4 regions of a Cμ constant region. The hybrid Fc proteins can form duplexes by interchain disulfide bonding between cysteines in their hinge regions. The hybrid Fc proteins can be used for treating immune disorders mediated by endogenous IgG, such as those previously treated with intravenous immunoglobulin.

Description

CROSS-REFERENCE TO RELATED APPLICATION
This application is a national stage entry of PCT/US2019/061020 filed Nov. 12, 2019, which claims the benefit of U.S. 62/767,303 filed Nov. 14, 2018, which is incorporated by reference in its entirety for all purposes.
SEQUENCE LISTING
The application includes sequences in a txt file named 557167SEQLST.TXT of 88,075 bytes created Mar. 31, 2021, which is incorporated by reference.
BACKGROUND
Intravenous immunoglobulin (IVIG), which is a pooled IgG preparation from thousands of healthy human donors, has been used as human therapeutics for treatment of immunodeficiency and immune-mediated disease (Nimmerjahn et al., Annu. Rev. Immunol. 26:513-533, 2008; Nagelkerke et al., Front. Immunol. 5: Article 674, 2015; Mitrevski et al., Front. Immunol. 6: Article 4, 2015; Seite et al., Arthritis Rheum. 67:595-603, 2015; Afonso et al., Biomolecules 6:15, 2016; Lazarus, Chapter 6 in Imbach (eds), Antibody Therapy, Springer, 2018). IVIG administered with the dosing range of 200 to 500 mg per kg of body weight provides immunodeficient patients with pathogen-specific IgG antibodies derived from the donors for protection against infectious disease. As such protective IgG antibodies are cleared eventually in the circulation, IVIG needs to be administered constantly, typically every three to four weeks, to maintain the protection in the patient.
A high-dose administration of IVIG (typically 1 to 3 g per kg of body weight) has been used as an anti-inflammatory agent for treatment of acute and chronic immune-mediated diseases such as idiopathic thrombocytopenic purpura (ITP), Kawasaki disease, Guillain-Barre syndrome and chronic inflammatory demyelinating polyneuropathy. Off-label use of IVIG for treatment of immune-mediated diseases includes systemic lupus erythematosus, multiple sclerosis and autoimmune neutropenia. The following two MOAs have been proposed and are supported by scientific observations: (i) saturation of neonatal Fc receptors and (ii) suppression of B cell functions (Nagelkerke et al., Front. Immunol. 5: Article 674, 2015; Seite et al., Arthritis Rheum. 67:595-603, 2015).
The neonatal Fc receptor (FcRn) is a heterodimer that is composed of a transmembrane a chain and β2-microglubulin (β2m). FcRn expressed in endothelial cells mediates both transcytosis of maternal IgG to the fetus and IgG homeostasis in adults. Pinocytosed IgG antibodies are captured by FcRn in acidified endosomes, rescued from degradation in lysosomes, recycled back to the cell surface, and returned to the circulation. Binding of IgG to FcRn is saturable. When the serum IgG concentration rises above the normal level, excess IgG unable to bind to FcRn gets degraded in the lysosomes (Roopenian et al., Nat. Rev. Immunol. 7:715-725, 2007; Kuo et al., J. Clin. Immunol. 30:777-789, 2010; Rath et al., Front. Immunol. 5: Article 664, 2015). IVIG administered at a high level (usually 1 to 3 gram/kg) competes for FcRn binding with pathogenic IgG antibodies present in autoimmune disease patients, which results in acceleration of clearance of such pathogenic antibodies in the circulation (Nimmerjahn et al., Annu. Rev. Immunol. 26:513-533, 2008; Seite et al., Arthritis Rheum. 67:595-603, 2015).
CD22, a member of the Siglec family of type I transmembrane proteins, binds specifically to a sialic acid attached to glycans with the affinity of 32 μM (Powell et al., J. Biol. Chem. 13:7523-7532, 1995; Fearon et al., Annu. Rev. Immunol. 18:393-442, 2000; Pillai et al., Annu. Rev. Immunol. 30:357-392, 2012; Nitschke, Glycobiol. 24:807-817, 2014). CD22 has a critical regulatory role to establish the threshold of B-cell activation. Multivalent cross-linking of CD22 induces intracellular signaling via the immunoreceptor tyrosine-based inhibition motifs (ITIMs) located in its cytoplasmic domain, which leads to functional suppression of B cells. A sialylated portion of IVIG has been shown to bind to CD22 and negatively modulate immune responses of B cells (Mitrevski et al. Int. Trends Immun. 2:67, 2014; Seite et al., Blood 116:1698-1704, 2010). The positive correlation between the level of sialylation of IVIG (or Fc proteins) and its activity of immune suppression has been reported (Schwab et al., Clin. Exp. Immunol. 178:97-99, 2014; Washburn et al., Proc. Natl. Acad. Sci. 112: E1297-E1306, 2015; Bruckner et al., Int. Immunol. 29:499-509, 2017), indicating the importance of the engagement of CD22 in the therapeutic activity of IVIG for treatment of inflammatory diseases.
Involvement of CD32B (also called Fcγ receptor IIB), a type I transmembrane protein expressed on B cells and myeloid dendritic cells, has also been implicated in the MOA of IVIG. Unlike CD64 (Fcγ receptor I), CD32A (Fcγ receptor IIA) and CD16 (Fcγ receptor III) that have immunoreceptor tyrosine-based activation motifs (ITAM) in the cytoplasmic domain, CD32B contains an ITIM motif in the cytoplasmic domain and functions as a negative regulator of immune responses. Cross-linking of CD32B induces intracellular signal transduction that leads to downregulation of antibody production in B cells. IVIG showed no therapeutic effects in mouse models of ITP, rheumatoid arthritis, and nephrotoxis nephritis when the mice used in the studies were deficient in CD32B. It is still unclear, however, if IVIG directly interacts with CD32B for immune suppression. Instead of CD32B, DC-SIGN (dendritic-cell-specific ICAM-3 grabbing nonintegrin; also known as CD209), a human ortholog of mouse SIGN-R1 (specific ICAM-3 grabbing nonintegrin-related 1), that are expressed on macrophages and dendritic cells, has been reported to be a primary action site of IVIG. Interaction of sialylated IVIG (or Fc proteins) with DC-SIGN on macrophages and dendritic cells induces expression of certain cytokines, such as IL-33, that leads to upregulation of and signaling through CD32B in antigen-presenting cells to suppress immune responses. For review, see Samuelsson et al., Science 291:484-486, 2001; Crow et al., Blood 102:558-560, 2003; Bruhns et al., Immunity 18:573-581, 2003; Akilesh et al., J. Clin. Invest. 113:1328-1333, 2004; Zhou et al., Cell. Mol. Immunol. 4:279-283, 2006; Kaneko et al., Science 313:670-673, 2006; Kaneko et al., J. Exp. Med. 203:789-797, 2006; Anthony et al., Proc. Natl. Acad. Sci. 105:19571-19578, 2008; Anthony et al., Nature 475:110-113, 2013; Pagan et al., Cell 172:564-577, 2018.
Despite that IVIG has been used widely for treatment of immunodeficiency and various immune-mediated diseases in humans, IVIG has an intrinsic shortcoming that it is derived from human pooled blood. Although the blood source is screened for infectious disease and other conditions unsuitable for blood donation, there always remains a remote possibility that unknown infectious agents can contaminate IVIG products. In addition, batch-to-batch variation of IVIG is unavoidable. Furthermore, decrease of blood donation results in shortage of the supply of IVIG. It is therefore critical to develop a recombinant product, which is clean and supplied constantly, that functionally substitutes IVIG for treatment of the patients of immune-mediated diseases.
There have been several attempts to use a recombinant anti-FcRn monoclonal antibody to block the interaction between IgG and FcRn for enhanced catabolism and reduction of the concentration of IgG molecules in the circulation. Nixon et al. (Front. Immunol. 6: Article 176, 2015) generated a human anti-FcRn antibody that caused a prolonged reduction of IgG levels in cynomolgus monkeys. Kiessling et al. (Sci. Transl. Med. 9: eaan1208, 2017) reported the use of a humanized anti-FcRn monoclonal antibody, rozanolixizumab, as a replacement of IVIG. In both cynomolgus monkeys and humans, rozanolixizumab decreased the IgG concentration in the circulation. Severe treatment-emergent adverse events were observed in several human subjects who received 7 mg/kg of rozanolixizumab intravenously. Neither of the Kiessling and Nixon papers show the data of suppression of B cell-mediated immune responses by an anti-FcRn antibody.
As an alternative approach to block the interaction between IgG and FcRn, Patel et al. (J. Immunol. 187:1015-1022, 2011) reported that an engineered human IgG1 antibody with enhanced FcRn binding, which has substitutions of Met at 252 to Tyr, Ser at 254 to Thr, Thr at 256 to Glu, His at 433 to Lys, and Asn at 434 to Phe (MST-HN; positions are based on Eu numbering) in the Fc region, reduced the serum IgG level in mice. Ulrichts et al. (J. Clin. Invest. JCI97911, 2018) used a human IgG1-derived Fc fragment carrying the same five amino acid substitutions (MST-HN) described above (efgartigimod) as an antagonist of FcRn and showed that efgartigimod reduced IgG levels up to 50% in humans.
Czajkowsky et al. (Sci. Reports 5: 9526, 2015) reported generation of hexameric Fc fragments (Hexa-Fc), in which a leucine residue at position 309 (Eu numbering) was changed to a cysteine residue and the 18-amino acid-long p tail-piece was attached at the end of the human IgG1 Fc fragment for hexamer formation, as a possible antagonist of FcRn. However, no animal data with Hexa-Fc for modulation of serum IgG levels was shown in this paper. The authors also noted a possibility that Hexa-Fc's unique three-dimensional structure could hinder its interaction with FcRn.
Spirig et al. (J. Immunol. 200: 2542-2553, 2018) also generated hexameric IgG1 Fc fragments (Fc-μTP-L309C) by introducing a leucine-to-cysteine substitution at position 309 (Eu numbering) and the μ tail-piece at the end of the Fc region. Although Fc-μTP-L309C was effective for suppression of inflammatory arthritis and ITP in mice, it had a short serum half-life in human FcRn transgenic mice (3.1 hours) and rats (2.5 to 3 hours). In contrast, the serum half-life of human IgG in human FcRn transgenic mice was reported to be roughly 10 days (Tam et al., mAbs 5:397-405, 2013). No data of the effect of Fc-μTP-L309C on the serum IgG level nor the suppression of immune responses were reported in the Spirig paper.
U.S. Pat. No. 9,382,319 reports antibodies or Fc fusion proteins linked to a hybrid heavy chain constant region having IgG or IgA and IgM components. Antibody variable regions or a heterologous polypeptide form a binding site for a target site in a subject, and the hybrid constant region results in multimerization and activation of cells expressing the target on the surface.
SUMMARY OF THE CLAIMED INVENTION
The invention provides a hybrid Fc protein comprising in order from N- to C-terminus an IgG Fc region comprising at least a portion of a hinge region, CH2 and CH3 regions, each of which is of IgG isotype, and an IgM Fc region comprising Cμ3 and Cμ4 regions, wherein the at least a portion of a hinge region is not linked to (a) an antibody variable region, or (b) a heterologous polypeptide binding a target, wherein molecules of the hybrid Fc protein can form a duplex via interchain disulfide bonding between cysteine residues in the at least a portion of the hinge region, and the duplexes can multimerize with one another via the Cμ3 and Cμ4 regions.
Optionally, the IgG Fc region is of human IgG1, IgG2, IgG3 or IgG4 isotype and the Cμ3 and Cμ4 regions are each human Cμ3 and Cμ4 regions. Optionally, at least a portion of a hinge region is not linked to a polypeptide of over 25 amino acids. Optionally, the at least a portion of a hinge region differs from a natural human hinge region by replacement of a cysteine residue not engaged in formation of Fc duplexes in natural antibodies. Optionally, the protein consists essentially of the at least a portion of a hinge region, the CH2 and CH3 regions, and the Cμ3 and Cμ4 regions and optionally a peptide of up to 25 amino acids linked to the at least a portion of a hinge region. Optionally, the at least a portion of a hinge region comprises a peptide of Glu-Pro-Lys-Ser-Ser (SEQ ID NO:8) at its N-terminus. Optionally, the IgG Fc region and/or the IgM Fc region include one or more mutations to reduce ADCC, ADP or CDC. Optionally, the IgG Fc region includes one or more mutations to increase FcRn binding. Optionally, the IgG Fc region and/or the IgM Fc region includes one or more mutations to increase sialyation.
Optionally, positions 234 and 235 in the IgG Fc region (Eu numbering) are alanine residues (e.g., SEQ ID NO:9). Optionally, positions 433 and 435 in the IgM Fc region (Eu numbering) are alanine and serine residues, respectively (e.g., SEQ ID NO:10). Optionally, position 428 in the IgG Fc region (Eu numbering) is a leucine residue (e.g., SEQ ID NO: 13). Optionally position 241 or 243 in the IgG Fc region (Eu numbering) is an alanine residue (e.g., SEQ ID NOS:15 and 16, respectively).
Optionally, molecules of the hybrid Fc protein have formed a duplex via interchain disulfide bonding between cysteine residues in the at least a portion of the hinge region, and the duplexes have multimerized with one another via the Cμ3 and Cμ4 regions. Optionally, the multimer is a hexamer.
Optionally, the hybrid Fc protein is at least 99% w/w pure.
The invention further provides a pharmaceutical composition comprising any of the hybrid Fc proteins described above and a pharmaceutically acceptable carrier.
The invention further provides a method of treating an immune disorder comprising administering an effective regime of a hybrid Fc protein of any preceding claim to subject, in need thereof. Optionally, the hybrid Fc protein reduces the half-life of IgG molecules in the circulation. Optionally, the hybrid Fc protein reduces the concentration of IgG molecules in the circulation. Optionally, the hybrid Fc fusion protein suppresses immune responses of B cells. Optionally, the subject has an immune disorder.
The invention further provides for the use of the hybrid Fc protein of any preceding claim in the manufacture of a medicament for treating an inflammatory disorder, rejection following organ transplantation, a hematological disorder, a dermatological disorder, or a neuromuscular disorder.
The invention further provides for the use of the hybrid Fc protein of any preceding claim in the manufacture of a medicament for treating an autoimmune disorder. Optionally, the disorder is idiopathic thrombocytopenic purpura, Kawasaki disease, Guillain-Barre syndrome, or chronic inflammatory demyelinating polyneuropathy. Optionally, the disorder is systemic lupus erythematosus, multiple sclerosis, or autoimmune neutropenia.
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 : Schematic structure of the expression vector pVF101.
FIG. 2 : Schematic structure of the hexameric hybrid Fc protein of this invention.
FIG. 3 : Relative concentrations of mouse monoclonal IgG antibody ABC2 in mouse sera are shown with SEM (standard error of the mean) error bars. ABC2 was administered to three mice with no Fc proteins (Group A), LS41K-Fc.S (Group B), or LS41K-Fc.SL (Group C).
FIG. 4 : Relative concentrations of mouse IgG in mouse sera from Groups A, B and C are shown with SEM error bars.
FIG. 5 : Concentrations of LS41K-Fc.S and LS41K-Fc.SL in mouse sera from Groups B and C, respectively, are shown with SEM error bars.
FIG. 6 : Relative concentrations of ABC2 in mouse sera are shown with SEM error bars. ABC2 was administered to three mice together with 100 μg (Group D) or 400 μg of LS41K-Fc.SL (Group E).
FIG. 7 : Relative concentrations of mouse IgG in mouse sera from Groups D and E are shown with SEM error bars.
FIG. 8 : Concentrations of LS41K-Fc.SL in mouse sera from Groups D and E are shown with SEM error bars.
FIG. 9A, B: Schematic structure of the expression vectors for (A) ST6GAL1 and (B) B4GALT1.
FIGS. 10A, B, C: Sequences of (A) gamma-1 (SEQ ID NOS:29-32), gamma-2 (SEQ ID NOS:33-36), gamma-3 (SEQ ID NOS:37-40), (B) gamma-4 (SEQ ID NOS:41-44), alpha-1 (SEQ ID NOS:45-47), alpha-2 (SEQ ID NOS:48-50), and (C) mu heavy chain constant regions (SEQ ID NOS:51-54), and a J chain (SEQ ID NO:55). The 18 amino acid mu tailpiece is underlined in the Cmu sequence. The first 22 amino acids shown of the J chain are a cleaved signal peptide.
FIGS. 11A-D: FACS analysis of the binding to human and mouse FcRn: (A) Binding of Erbitux (mouse-human chimeric IgG1 antibody) to human FcRn at pH 6.0 and pH 7.5, (B) binding of LS41K-Fc.SL to human FcRn at pH 6.0 and pH 7.5, (C) binding of Erbitux to mouse FcRn at pH 6.0 and pH 7.5, and (D) binding of LS41K-Fc.SL to mouse FcRn at pH 6.0 and pH 7.5.
DEFINITIONS
The present hybrid Fc proteins are typically provided in isolated form. This means that the hybrid Fc proteins are typically at least 50% w/w pure of interfering proteins and other contaminants arising from its production or purification but does not exclude the possibility that the hybrid Fc protein is combined with an excess of pharmaceutical acceptable carrier(s) or other vehicle intended to facilitate its use. Sometimes hybrid Fc proteins are at least 60, 70, 80, 90, 95 or 99% w/w pure of interfering proteins and contaminants from production or purification. Often a hybrid Fc protein is the predominant macromolecular species remaining after its purification.
The hybrid Fc proteins specifically bind to FcRn. Specific binding is detectably higher in magnitude and distinguishable from non-specific binding occurring to at least one unrelated target. Specific binding can be the result of formation of bonds between particular functional groups or particular spatial fit (e.g., lock and key type) whereas nonspecific binding is usually the result of van der Waals forces. Specific binding does not however necessarily imply that the hybrid Fc proteins bind one and only one target. For example, they may also specifically bind to CD22 through sialyation.
A basic antibody structural unit is a tetramer of subunits. Each tetramer includes two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. This variable region is initially expressed linked to a cleavable signal peptide. The variable region without the signal peptide is sometimes referred to as a mature variable region. Thus, for example, a light chain mature variable region means a light chain variable region without the light chain signal peptide. However, reference to a variable region does not mean that a signal sequence is necessarily present; and in fact signal sequences are cleaved once the antibodies or fusion proteins of the invention have been expressed and secreted. A pair of heavy and light chain variable regions defines a binding region of an antibody. The carboxy-terminal portion of the light and heavy chains respectively defines light and heavy chain constant regions. The heavy chain constant region is primarily responsible for effector function. In IgG antibodies, the heavy chain constant region is divided into CH1, hinge, CH2, and CH3 regions. In IgA, the heavy constant region is divided into CH1, CH2 and CH3. The CH1 region binds to the light chain constant region by disulfide and noncovalent bonding. The hinge region provides flexibility between the binding and effector regions of an antibody and also provides sites for intermolecular disulfide bonding between the two heavy chain constant regions in a tetramer subunit. The CH2 and CH3 regions are the primary site of effector functions and FcRn binding. In IgM antibodies, the μ heavy chain constant region (Cμ) is subdivided into four regions Cμ1, Cμ2, Cμ3 and Cμ4. The Cμ3 and Cμ4 regions, sometimes in combination with one or more J chains, provide a multimerization function in natural IgM antibodies and hybrid Fc proteins of the present invention. The mu tailpiece is a 18 amino-acid-long polypeptide located at the C-terminus of a IgM heavy chain constant region. IgM multimerizes to form a pentameric structure in the presence of J chains and a hexameric structure in their absence.
Light chains are classified as either kappa or lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, and define the antibody's isotype as IgG, IgM, IgA, IgD and IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a “J” segment of about 12 or more amino acids, with the heavy chain also including a “D” segment of about 10 or more amino acids. (See generally, Fundamental Immunology (Paul, W., ed., 2nd ed. Raven Press, N.Y., 1989), Ch. 7) (incorporated by reference in its entirety for all purposes).
The mature variable regions of each light/heavy chain pair form the antibody binding site. Thus, an intact antibody has two binding sites, i.e., is divalent. In natural antibodies, the binding sites are the same. However, bispecific antibodies can be made in which the two binding sites are different (see, e.g., Songsivilai and Lachmann, Clin. Exp. Immunol., 79:315-321 (1990); Kostelny et al., J. Immunol., 148:1547-53 (1992)). The variable regions all exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, also called complementarity determining regions or CDRs. The CDRs from the two chains of each pair are aligned by the framework regions, enabling binding to a specific epitope. From N-terminal to C-terminal, both light and heavy chains comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is in accordance with the definitions of Kabat, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, MD, 1987 and 1991), or Chothia & Lesk, J. Mol. Biol. 196:901-917 (1987); Chothia et al., Nature 342:878-883 (1989). Kabat also provides a widely used numbering convention (Kabat numbering) in which corresponding residues between different heavy chain variable regions or between different light chain variable regions are assigned the same number. Although Kabat numbering can be used for antibody constant regions, the EU index is more commonly used, as is the case in this application.
A multimerization unit of the hybrid Fc protein is typically a duplex of two such proteins linked by interchain disulfide bonding between one or more cysteines in their respective hinge regions.
Multimerization means the association of at least two multimerization units and more typically five or six such units via the Cμ portion of a hybrid constant region. Multimerization of hybrid Fc protein units may sometimes form higher or lower order structures than the pentameric or hexameric structure of normal IgM. Such is sometimes indicated by characterizing a complex formed by multimerization as having at least about five or six units.
A heterologous polypeptide in a fusion protein is a polypeptide not naturally linked to an immunoglobulin constant region. Such a polypeptide can be a full-length protein or any fragment thereof of sufficient length to retain specific binding to the antigen bound by the full-length protein. For example, a heterologous polypeptide can be a receptor extracellular domain or ligand thereto.
The term “subject” includes humans and non-human animals receiving therapeutic or prophylactic treatment. Other non-human animals include animal models of a human condition (e.g., rodent, non-human primate) and veterinary subjects.
The term “target” indicates a target molecule (e.g., protein, nucleic acid or carbohydrate) present in a subject to which a drug, such as an antibody or Fc fusion protein, can specifically bind to effect treatment or prophylaxis of a condition in the subject.
For purposes of classifying amino acids substitutions as conservative or nonconservative, amino acids are grouped as follows: Group I (hydrophobic side chains): met, ala, val, leu, ile; Group II (neutral hydrophilic side chains): cys, ser, thr; Group III (acidic side chains): asp, glu; Group IV (basic side chains): asn, gln, his, lys, arg; Group V (residues influencing chain orientation): gly, pro; and Group VI (aromatic side chains): trp, tyr, phe. Conservative substitutions involve substitutions between amino acids in the same class. Non-conservative substitutions constitute exchanging a member of one of these classes for a member of another.
Percentage sequence identities are determined with antibody sequences maximally aligned by the Kabat numbering convention for a variable region or EU numbering for a constant region. After alignment, if a subject antibody region (e.g., the entire mature variable region of a heavy or light chain) is being compared with the same region of a reference antibody, the percentage sequence identity between the subject and reference antibody regions is the number of positions occupied by the same amino acid in both the subject and reference antibody region divided by the total number of aligned positions of the two regions, with gaps not counted, multiplied by 100 to convert to percentage.
Compositions or methods “comprising” one or more recited elements may include other elements not specifically recited. For example, a composition that comprises antibody may contain the antibody alone or in combination with other ingredients.
“Consisting essentially of” is used in accordance with convention to indicate the basic and novel features of a composition or method and does not exclude that other components or steps not materially affecting the basic and novel characteristics may be present.
pH-dependent binding of an antibody to an FcRn receptor means that the antibody binds more strongly to such a receptor at pH 6.0 than at pH 7.5. Binding of FcRn at a low pH in endosomes after internalization by pinocytosis rescues IgG antibodies from catabolic degradation in lysosomes. Rescued IgG antibodies are then released from FcRn at a neutral pH and recycled to the circulation. Such pH-dependent FcRn binding is the basis of the molecular mechanism for a long serum half-life of IgG antibodies (Ghetie et al., Annu. Rev. Immunol. 18:739-766, 2000). For example, human IgG antibodies bind to human neonatal Fc receptors (FcRn) at pH 6.0 while they bind only weakly to FcRn at pH 7.5. The FcRn binding site in IgG antibodies lies at the junction of the CH2 and CH3 domains. Because a p heavy chain does not bind to FcRn at pH 6.0 or 7.5, natural IgM cannot take advantage of the FcRn-mediated pathway to rescue antibodies from degradation in lysosomes and therefore in general have shorter half-lives than natural IgG antibodies. Some hybrid Fc proteins of the invention show little if any significant difference in binding to FcRn at pH 6.0 and 7.5, which contributes to their ability to compete with IgG for binding to FcRn.
DETAILED DESCRIPTION I. General
The hybrid Fc proteins of this invention include IgG and IgM Fc components. The IgG Fc component includes at least a portion of a hinge region and CH2 and CH3 regions. The IgM component includes Cμ3 and Cμ4 regions of a Cμ constant region. The hybrid Fc proteins can form duplexes by interchain disulfide bonding between cysteines in their hinge regions. The duplexes can in turn multiplex through disulfide bonding of the IgM Fc portion. The IgG portion of the hybrid Fc protein like other IgG molecules has specific affinity for the FcRn receptor. However, the avidity of this binding is increased as a result of the IgM Fc mediated multimerization. Although an understanding of mechanism is not required for practice of the invention, it is believed that binding of the hybrid Fc proteins to FcRn competes with binding of endogenous IgG to FcRn thus decreasing the half-life of endogenous IgG. Reduction of the half-life of endogenous IgG is useful in treatment of immune disorders mediated by endogenous IgG, such as those previously treated with intravenous immunoglobulin. In contrast to the previously described antibodies or fusion proteins of U.S. Pat. No. 9,382,319, this mechanism of action does not require treatment be effected in a subject via target engagement by a binding region provided by antibody variable regions or a heterologous polypeptide linked to a hybrid Fc region. The above advantages can be achieved without in vitro manipulations other than those involved in making nucleic acid constructs for expression of the hybrid Fc proteins.
II. Components of Hybrid Fc Regions
The hybrid Fc proteins include an IgG Fc portion and an IgM Fc portion. The IgG Fc portion includes at least a portion of a hinge region and CH2 and CH3 regions. The CH2 and CH3 regions are responsible or at least in part for FcRn binding, protein A and G binding, ADCC (antibody-dependent cellular cytotoxicity), CDC (complement-dependent cytotoxicity) and opsonization. The role of the at least a portion of a hinge region is to supply cysteine residues to form interchain disulfide bonds duplexing IgG Fc regions. The at least a portion of a hinge region includes at least one and usually 2 or more cysteines of a natural hinge region and flanking residues sufficient to support the desired interchain disulfide bonding that forms duplexes. However, not all cysteine residues in natural hinge regions contribute to duplex formation between Fc regions, and any or all of such other cysteine residues can be removed or substituted with another residue, such as serine or alanine or glycine, to avoid the cysteine participating in unnatural disulfide bonding. Thus, part of the hinge region, usually, the N-terminal portion can be replaced with a synthetic peptide, of typically no more than 25, 20, 15, 10 or 5 residues. As well as providing cysteine residues, the hinge region including any synthetic peptide provides flexibility for duplexes and multimers to form. Gly, ala and ser are exemplary residues for this purpose. The synthetic peptide is synthetic in the sense that it does not occur as an isolated peptide in nature and has a sequence not naturally linked to the hinge or portion thereof to which it is attached, although the synthetic peptide, can as in the present examples, be a mutant version of part of a hinge region, particularly the N-terminal portion. Synthetic peptides are often overrepresented in ala, gly and/or ser (i.e., at least 25, 35 or 50% of all residues in the synthetic peptide are ala, gly and/or ser).
The Cμ portion includes Cμ3 and Cμ4 of a Cμ constant region. The Cμ portion is responsible for multimerizing multiple monovalent or divalent binding units into a multivalent complex. Although understanding of mechanism is not required for practice of the invention, it is believed that multimerization of the hybrid Fc fusion proteins occurs in similar fashion as in natural IgM antibodies through interchain disulfide bonding between the Cμ3 regions of different monomers and between the mu tailpieces of different monomers. Some multimers of IgM also contain one or more J chains bound to the mu tailpiece. In the presence of one or more J chains IgM can form a pentameric structure and in the absence of J chains can form a hexameric structure. Hexameric IgM has been reported to have stronger CDC than pentameric. Although hybrid Fc proteins of the invention are believed to form pentameric or hexameric complexes as for IgM, other multiplicities greater or smaller may form as well or instead of pentameric and hexameric forms.
The components mentioned above are arranged from N-terminus to C-terminus in the order: synthetic peptide (if present), at least a portion of an IgG hinge region, IgG CH2 region, IgG CH3 region, Cμ3 region, and Cμ4 region.
Usually, all of the IgG regions are of the same isotype and subtype. That is, all IgG regions are either from IgG1, IgG2, IgG3 or IgG4. Optionally, the IgG CH2 and CH3 regions of the hybrid Fc proteins comprise different isotypes and subtypes.
Preferably, the IgG regions are human IgG. Likewise, the Cμ3 and Cμ4 regions are preferably human. Exemplary sequences for human IgG1, IgG2, IgG3, IgG4, IgM heavy chain constant regions with delineation into components (CH1, hinge, CH2, CH3, Cμ1, Cμ2, Cμ3 and Cμ4 and a J-chain are shown in FIGS. 10 A, B, C. However, regions from other species including nonhuman primates, camelids, cartilaginous fish, mice or rats can also be used. Exemplary sequences of human IgG1 hybrid Fc proteins are SEQ ID NOS. 7, 11, 13, 15 and 16. Exemplary sequences of IgG2, IgG3 and IgG4 hybrid Fc proteins are SEQ ID NOS. 26-28 respectively.
Other components typically found in therapeutic proteins or fusion proteins may or may not be present but are not necessary. For example, the hybrid Fc proteins of the invention need not include an IgG CH1 constant region (because there is no light chain to pair with), heavy or light chain variable regions forming a binding site specifically binding to a target present in humans or other subjects, or a heterologous polypeptide, such as a receptor ECD or ligand, typically found in Fc fusion proteins, specifically binding to a target present in humans or other subjects.
Reference to a human IgG, IgA or IgM region (i.e., CH1, hinge, CH2, CH3, Cμ3 and Cμ4) or J-chain including hybrid Fc proteins of the invention refers to the exemplified sequences or allotypes or isoallotypes thereof or other variant sequence having at least 90, 95, 98 or 99% sequence identity with an exemplified sequence and/or differing from the exemplified sequence by up to 1, 2, 3, 4, 5, 10 or 15 amino acid deletions, substitution or internal insertions in the case of CH1, CH2, CH3, Cμ3 and Cμ4 and a J-chain and 1, 2 or 3 deletions, substitutions or internal substitutions for IgG1, 2 or 4 hinge regions and up to 1, 2, 3, 4, 5, or 6 deletions for IgG3 hinge. Substitutions, if present, are preferably conservative. Human constant regions show allotypic variation and isoallotypic variation between different individuals, that is, the constant regions can differ in different individuals at one or more polymorphic positions. Isoallotypes differ from allotypes in that sera recognizing an isoallotype bind to a non-polymorphic region of a one or more other isotypes. Reference to a human constant region includes a constant region with any natural allotype (including isoallotypes) or any permutation of residues occupying polymorphic positions in natural allotypes. Sequences of non-human constant regions are provided by e.g., the Swiss-Prot or Genbank databases. Reference to a non-human constant region likewise includes allotypic or isoallotypic variants, and permutations of the same, or other variants sequences differing from natural sequences. The scope of variations is defined by sequence identity and/or number of substitutions with respect to natural sequences of non-human constant regions in analogous fashion to the above description of variants with respect to human constant regions. The Eu numbering convention is used in defining corresponding positions among isotypes or different species, or defining mutated positions.
Various substitutions can be made in the IgG or IgM Fc regions or both for various purposes. For example, there are many known mutations in IgG Fe that increase FcRn binding. Exemplary substitutions include a Gln at position 250 and/or a Leu at position 428, Ser or Asn at position 434, Tyr at position 252, Thr at position 254, and Glu at position 256 (EU numbering). Increased FcRn binding is advantageous in making the hybrid Fc proteins of the present invention compete more strongly with endogenous IgG for binding to FcRn. Also numerous mutations are known in both IgG and IgM Fc for reducing any of ADCC, ADP (antibody-dependent phagocytosis) or CDC. (see, e.g., Winter et al., U.S. Pat. No. 5,624,821; Tso et al., U.S. Pat. No. 5,834,597; and Lazar et al., Proc. Natl. Acad. Sci. USA 103:4005, 2006). For example, substitution any of positions 234, 235, 236 and/or 237 reduce affinity for Fcγ receptors, particularly FcγRI receptor (see, e.g., U.S. Pat. No. 6,624,821). Optionally, positions 234, 236 and/or 237 in human IgG2 are substituted with alanine and position 235 with glutamine or glutamic acid. (See, e.g., U.S. Pat. No. 5,624,821.) Other substitutions reducing effector function include, Ala at position 268, Gly or Ala at position 297, Leu at position 309, Ala at position 322, Gly at position 327, Ser at position 330, Ser at position 331, Ser at position 238, Ala at position 268, Leu at position 309 (Eu numbering). Other substitutions in IgG or IgM Fc are advantageous in stimulating sialyation, which is useful for increasing binding to CD22. For example, each of the substitutions of Phe by Ala at position 241, Phe by Ala at position 243, Val by Glu at position 262, and Val by Glu at position 264 in the IgG Fc region (Eu numbering) is known to enhance sialylation of IgG molecules (Yu et al, J. Am. Chem. Soc. 2013 135:9723-9732). Other IgG Fc mutants that enhance sialylation of IgG molecules are reported in U.S. Pat. Nos. 9,187,552, 9,328,170 and 9,663,581.
With the possible exception of a synthetic linker replacing part or all of a hinge region and one or a few amino acid substitutions to enhance or suppress effector functions or FcRn binding as discussed further below, it is preferred that hybrid Fc proteins contain no sequences other than the hinge, CH2, CH3, Cμ3 and Cμ4 regions mentioned above. As previously mentioned, there is no need for a CH1 regions, or heavy or light chain variable regions. Nevertheless, other sequences, such as for example, a hexa-histidine tag, can be added but are not necessary. Thus, preferred hybrid Fc proteins consist of or consist essentially of a complete or partial hinge, CH2, CH3, Cμ3 and Cμ4 regions as mentioned above, optionally a further peptide, such as the synthetic peptides discussed above, of up to 5, 10, 15, 20 or 25 residues, and optionally a J-chain. Some hybrid Fc proteins consist of or consist essentially of a complete or partial hinge, optionally modified to remove one or more cysteine residues involved in light chain pairing, CH2, CH3, Cμ3 and Cμ4 regions as mentioned above. Some hybrid Fc proteins consist of or consistent essentially of entirely human IgG hinge, CH2, CH3 and Cμ3 and Cμ4 regions, and optionally a J-chain, with the possible exception of one or more mutated cysteine residues in the hinge region. Hybrid Fc proteins formed entirely or substantially from human sequences have little if any immunogenic potential in humans. Any additional sequences present preferably do not increase the immunogenicity of the hybrid Fc proteins in humans.
A standard immunoglobulin structure including two heavy chains has a maximum of four sialic residues (two per chain). The present hybrid Fc proteins can have more than 2 both because of their multiplicity (e.g., hexamers) and because Cmu3 and Cmu4 regions provide further sialic acid attachment sites. For example, the present hybrid Fc fusions can a mean of 2.1 or more sialic acid per protein molecule (e.g., 2.1-5). Thus, hexamers of present hybrid Fc molecules can have a mean of more than 12, 15 or 20 sialic acid molecules per hexamer (e.g. 12.1-30). Higher sialyation is advantageous for immune suppression via binding to CD22.
III. Genetic Engineering and Expression
Hybrid Fc proteins are produced by recombinant expression. A hybrid Fc protein is achieved by fusing a DNA segment encoding the IgG Fc portion in-frame with a DNA segment encoding the Cμ portion. Preferably, the last amino acid of a CH3 exon of the IgG is fused in frame to the first amino acid of a Cμ3 exon.
The order in which fusions of genetic elements is performed in building a construct encoding several components is not important. The segments can also be linked simultaneously by joining overlapping oligonucleotides encoding the respective segments in an overlapping PCR-type reaction. In practice, once an expression vector encoding a hybrid constant region has been produced, the same vector can be used to insert any heavy chain variable region or other binding region in the case of a fusion protein (and sometimes a light chain variable region) without recreating the DNA segment encoding the hybrid constant region.
Mammalian cells are one host for expressing nucleotide segments encoding hybrid Fc proteins of the invention (see Winnacker, From Genes to Clones, (VCH Publishers, N Y, 1987)). A number of suitable host cell lines capable of secreting intact heterologous proteins have been developed in the art, and include CHO cell lines, various COS cell lines, HeLa cells, HEK293 cells, L cells, and non-antibody-producing myelomas including Sp2/0 and NS0. Preferably, the cells are nonhuman. The cells used for producing antibodies may or may not endogenously express J chains. If endogenous J chains are not expressed or are expressed at an insufficient level, host cells can be genetically modified to express J chains (i.e., by introducing a construct encoding such). However, host cells not expressing J chains can also be used. Selection of cells with or without J chains affects valency with which antibodies or fusion proteins are produced (e.g., pentamer with J chains and hexamer without). Preferably, a hybrid Fc protein is expressed from a monoclonal cell line.
Expression vectors for these cells can include expression control sequences, such as an origin of replication, a promoter, an enhancer (Queen et al., Immunol. Rev. 89:49 (1986)), and necessary processing information sites, such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences. Preferred expression control sequences are promoters derived from endogenous genes, cytomegalovirus, SV40, adenovirus, bovine papillomavirus, and the like. See Co et al., J. Immunol. 148:1149 (1992).
Cells are transfected with a vector encoding the hybrid Fc protein to be expressed. Hybrid Fc proteins are expressed, processed to remove signal peptides, assembled and secreted from host cells. It is believed that multimerization and association with J chains occur at least predominantly within cells so that hybrid Fc proteins are secreted primarily as multimers, particularly multimers in which five or six units are associated via the Cμ portion of the hybrid constant region.
Hybrid Fc proteins can be purified from cell culture supernatants by conventional antibody purification methods. The purification can include a chromatography step using protein A or protein G as the affinity reagent. Conventional antibody purification procedures, such as ion exchange, hydroxyapatite chromatograph or HPLC can also be used (see generally, Scopes, Protein Purification (Springer-Verlag, N.Y., 1982)).
IV. Methods of Treatment and Pharmaceutical Compositions
Hybrid Fc proteins of the invention are useful for treating a variety of conditions mediated by antibodies or B cell functions, particularly those previously treated by IVIG as indicated in the Background. Such conditions include immune disorders, inflammatory disorders, rejection following organ transplantation, hematological disorders, dermatological disorders or neuromuscular disorders. The designations of conditions are not mutually exclusive. Thus an immune disorder can also be an inflammatory disorder for example. The hybrid Fc proteins can treat such conditions by reducing half-life of endogenous IgG molecules in the circulation, suppressing immune response of endogenous B cells, reducing the concentration of endogenous IgG molecules in the circulation.
One category of immune disorders treatable by the hybrid Fc proteins of the invention is transplant rejection. When allogeneic cells or organs (e.g., skin, kidney, liver, heart, lung, pancreas and bone marrow) are transplanted into a host (i.e., the donor and donee are different individual from the same species), the host immune system is likely to mount an immune response to foreign antigens in the transplant (host-versus-graft disease) leading to destruction of the transplanted tissue. The hybrid Fc proteins of the present invention are useful, inter alia, to block alloantigen-induced immune responses in the donee.
A related use for hybrid Fc proteins of the present invention is in modulating the immune response involved in “graft versus host” disease (GVHD). GVHD is a potentially fatal disease that occurs when immunologically competent cells are transferred to an allogeneic recipient. In this situation, the donor's immunocompetent cells may attack tissues in the recipient. Tissues of the skin, gut epithelia and liver are frequent targets and may be destroyed during the course of GVHD. The disease presents an especially severe problem when immune tissue is being transplanted, such as in bone marrow transplantation; but less severe GVHD has also been reported in other cases as well, including heart and liver transplants.
A further situation in which immune suppression is desirable is in treatment of autoimmune diseases such as idiopathic thrombocytopenic purpura, Kawasaki disease, Guillain-Barre syndrome, and chronic inflammatory demyelinating systemic lupus erythematosus, multiple sclerosis, and autoimmune neutropenia type 1 diabetes, Crohn's disease, ulcerative colitis, multiple sclerosis, stiff man syndrome, rheumatoid arthritis, myasthenia gravis and lupus erythematosus. Other disorders which can be treated include acute disseminated encephalomyelitis, acute motor axonal neuropathy, Addison's disease, adiposis dolorosa, adult-onset Still's disease, alopecia areata, ankylosing spondylitis, anti-glomerular basement membrane nephritis, anti-neutrophil cytoplasmic antibody-associated vasculitis, anti-N-methyl-D-aspartate receptor encephalitis, antiphospholipid syndrome, antisynthetase syndrome, aplastic anemia, autoimmune angioedema, autoimmune encephalitis, autoimmune enteropathy, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease, autoimmune lymphoproliferative syndrome, autoimmune oophoritis, autoimmune orchitis, autoimmune pancreatitis, autoimmune polyendocrine syndrome, autoimmune polyendocrine syndrome type 2, autoimmune polyendocrine syndrome type 3, autoimmune progesterone dermatitis, autoimmune retinopathy, autoimmune thrombocytopenic purpura, autoimmune thyroiditis, autoimmune urticaria, autoimmune uveitis, Balo concentric sclerosis, Behçet's disease, Bickerstaffs encephalitis, bullous pemphigoid, celiac disease, chronic fatigue syndrome, Churg-Strauss syndrome, cicatricial pemphigoid, Cogan syndrome, cold agglutinin disease, complex regional pain syndrome, CREST syndrome, Crohn's disease, dermatitis herpetiformis, dermatomyositis, diabetes mellitus type 1, discoid lupus erythematosus, endometriosis, enthesitis, enthesitis-related arthritis, eosinophilic esophagitis, eosinophilic fasciitis, epidermolysis bullosa acquisita, erythema nodosum, essential mixed cryoglobulinemia, Evans syndrome, Felty syndrome, fibromyalgia, gastritis, gestational pemphigoid, giant cell arteritis, Goodpasture syndrome, Graves' disease, Graves ophthalmopathy, Hashimoto's encephalopathy, Hashimoto thyroiditis, Henoch-Schonlein purpura, hidradenitis suppurativa, idiopathic dilated cardiomyopathy, idiopathic inflammatory demyelinating diseases, IgA nephropathy, IgG4-related systemic disease, inclusion body myositis, inflammatory bowel disease (IBD), intermediate uveitis, interstitial cystitis, juvenile arthritis, Kawasaki's disease, Lambert-Eaton myasthenic syndrome, leukocytoclastic vasculitis, lichen planus, lichen sclerosus, ligneous conjunctivitis, linear IgA disease, lupus nephritis, lupus vasculitis, Lyme disease, Meniere's disease, microscopic colitis, microscopic polyangiitis, mixed connective tissue disease, Mooren's ulcer, morphea, Mucha-Habermann disease, myasthenia gravis, myocarditis, myositis, neuromyelitis optica, neuromyotonia, opsoclonus myoclonus syndrome, optic neuritis, Ord's thyroiditis, palindromic rheumatism, paraneoplastic cerebellar degeneration, Parry Romberg syndrome, Parsonage-Turner syndrome, pediatric autoimmune neuropsychiatric disorder associated with Streptococcus, pemphigus vulgaris, pernicious anemia, pityriasis lichenoides et varioliformis acuta, POEMS syndrome, polyarteritis nodosa, polymyalgia rheumatica, polymyositis, postmyocardial infarction syndrome, postpericardiotomy syndrome, primary biliary cirrhosis, primary immunodeficiency, primary sclerosing cholangitis, progressive inflammatory neuropathy, psoriasis, psoriatic arthritis, pure red cell aplasia, pyoderma gangrenosum, Raynaud's phenomenon, reactive arthritis, relapsing polychondritis, restless leg syndrome, retroperitoneal fibrosis, rheumatic fever, rheumatoid arthritis, rheumatoid vasculitis, sarcoidosis, Schnitzler syndrome, scleroderma, Sjogren's syndrome, stiff person syndrome, subacute bacterial endocarditis, Susac's syndrome, Sydenham chorea, sympathetic ophthalmia, systemic scleroderma, thrombocytopenia, Tolosa-Hunt syndrome, transverse myelitis, ulcerative colitis, undifferentiated connective tissue disease, urticaria, urticarial vasculitis, vasculitis, and vitiligo.
In any of these diseases, the body develops a humoral immune response against one of its own antigens leading to destruction of cells expressing that antigen, and potentially crippling and/or fatal consequences. Autoimmune diseases are treated by administering a hybrid Fc protein.
Other immune disorders treatable by hybrid Fc proteins of the invention include asthma, allergies, celiac disease, psoriasis, and uveitis. Celiac disease, psoriasis and uveitis are autoimmune diseases.
Hybrid Fc proteins are administered in an effective regime meaning a dosage, route of administration and frequency of administration that delays the onset, reduces the severity, inhibits further deterioration, and/or ameliorates at least one sign or symptom of a disorder. If a subject is already suffering from a disorder, the regime can be referred to as a therapeutically effective regime. If the subject is at elevated risk of the disorder relative to the general population but is not yet experiencing symptoms, the regime can be referred to as a prophylactically effective regime. In some instances, therapeutic or prophylactic efficacy can be observed in an individual subject relative to historical controls or past experience in the same patient. In other instances, therapeutic or prophylactic efficacy can be demonstrated in a preclinical or clinical trial in a population of treated subjects relative to a control population of untreated subjects.
Exemplary dosages for hybrid Fc proteins are 0.01-20, or 0.5-5, or 0.01-1, or 0.01-0.5 or 0.05-0.5 mg/kg body weight (e.g., 0.1, 0.5, 1, 2, 3, 4 or 5 mg/kg) or 10-1500 mg as a fixed dosage. The dosage depends on the condition of the patient and response to prior treatment, if any, whether the treatment is prophylactic or therapeutic and whether the disorder is acute or chronic, among other factors.
Administration can be parenteral, intravenous, oral, subcutaneous, intra-arterial, intracranial, intrathecal, intraperitoneal, topical, intranasal or intramuscular. Administration into the systemic circulation by intravenous or subcutaneous administration is preferred. Intravenous administration can be, for example, by infusion over a period such as 30-90 min.
The frequency of administration depends on the half-life of hybrid Fc protein in the circulation, the condition of the patient and the route of administration among other factors. The frequency can be daily, weekly, monthly, quarterly, or at irregular intervals in response to changes in the patient's condition or progression of the disorder being treated. An exemplary frequency for intravenous administration is between weekly and quarterly over a continuous cause of treatment, although more or less frequent dosing is also possible. For subcutaneous administration, an exemplary dosing frequency is daily to monthly, although more or less frequent dosing is also possible.
The number of dosages administered depends on whether the disorder is acute or chronic and the response of the disorder to the treatment. For acute disorders or acute exacerbations of chronic disorders between 1 and 10 doses are often sufficient. Sometimes a single bolus dose, optionally in divided form, is sufficient for an acute disorder or acute exacerbation of a chronic disorder. Treatment can be repeated for recurrence of an acute disorder or acute exacerbation. For chronic disorders, the hybrid Fc protein of the invention can be administered at regular intervals, e.g., weekly, fortnightly, monthly, quarterly, every six months for at least 1, 5 or 10 years, or the life of the patient.
Pharmaceutical compositions are preferably suitable for parenteral administration to humans. Such compositions are preferably sterile and substantially isotonic and manufactured under GMP conditions. Pharmaceutical compositions can be provided in unit dosage form (i.e., the dosage for a single administration). Pharmaceutical compositions can be formulated using one or more pharmaceutically acceptable carriers, diluents, excipients or auxiliaries. Pharmaceutically acceptable means suitable for parenteral administration in humans, e.g., approved or approval by the FDA. The formulation depends on the route of administration chosen. For injection, hybrid Fc proteins of the invention can be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological saline or acetate buffer (to reduce discomfort at the site of injection). The solution can contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Alternatively, hybrid Fc proteins of the invention can be in lyophilized form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
Treatment with the hybrid Fc proteins of the invention can be combined with other treatments effective against the disorder being treated. For treatment of immune disorders, conventional treatments include mast cell degranulation inhibitors, corticosteroids, nonsteroidal anti-inflammatory drugs, and stronger anti-inflammatory drugs such as azathioprine, cyclophosphamide, leukeran, FK506 and cyclosporine. Biologic anti-inflammatory agents, such as Tysabri® (natalizumab) or Humira® (adalimumab), can also be used.
All patent filings, websites, other publications, accession numbers and the like cited above or below are incorporated by reference in their entirety for all purposes to the same extent as if each individual item were specifically and individually indicated to be so incorporated by reference. If different versions of a sequence are associated with an accession number at different times, the version associated with the accession number at the effective filing date of this application is meant. The effective filing date means the earlier of the actual filing date or filing date of a priority application referring to the accession number if applicable. Likewise if different versions of a publication, website or the like are published at different times, the version most recently published at the effective filing date of the application is meant unless otherwise indicated. Any feature, step, element, embodiment, or aspect of the invention can be used in combination with any other unless specifically indicated otherwise. Although the present invention has been described in some detail by way of illustration and example for purposes of clarity and understanding, it will be apparent that certain changes and modifications may be practiced within the scope of the appended claims.
EXAMPLES Example 1: General Methods and Materials
Manipulation of recombinant DNA and expression, purification and characterization of recombinant proteins were carried out with standard laboratory techniques such as those described by Green and Sambrook (Molecular Cloning, A Laboratory Manual, 4th ed., 2012, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY), Greenfield (Antibodies, A Laboratory Manual, 2nd ed., 2014, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY), Kostelny et al. (Int. J. Cancer 93:556-565, 2001), Cole et al. (J. Immunol. 159:3613-3621, 1997) and Tsurushita et al. (Methods 36:69-83, 2005).
The mammalian expression vector pVF101 (FIG. 1 ), designed for production of multimeric hybrid Fc proteins comprising, from N- to C-terminus, an artificial signal peptide (sp), and the hinge, CH2 and CH3 regions of the human IgG1 isotype, and then the human Cμ3 and Cμ4 regions, contains the following genetic components. Proceeding clockwise from the SalI site of pVF101 in FIG. 1 , the plasmid contains the human cytomegalovirus (CMV) major immediate early promoter and enhancer (CMV-P in the figure) to initiate transcription of the region encoding LS41A-Fc (defined hereunder). The CMV promoter is followed by an exon encoding the signal peptide (SEQ ID NO:1) fused to the hinge region (Hinge; SEQ ID NO:2), an exon encoding CH2 (SEQ ID NO: 3), an exon encoding CH3 (SEQ ID NO: 4) fused to Cμ3 (SEQ ID NO:5) and Cμ4 (SEQ ID NO:6), and the polyadenylation site with the intervening introns. The hinge (H in the figure), CH2 and CH3 regions and the polyadenylation site are derived from the human gamma-1 heavy chain gene. The transcription unit for the hybrid Fc protein is followed by the SV40 early promoter (SV40-P), the puromycin N-acetyl-transferase gene (puro) for resistance to puromycin, and a segment containing the SV40 polyadenylation site (SV40-A). Finally, pVF101 contains a part of the plasmid pUC19, comprising the bacterial origin of replication (pUC ori) and the β lactamase gene (β lactamase). Arrows in the figure indicate the orientation of transcription. The amino acid sequence of the mature hybrid Fc protein encoded in pVF101 (LS41A-Fc), which is composed of the hinge, CH2, CH3, Cμ3 and Cμ4 regions, is EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGKDQDTAIRVFAIPPSFASIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKT HTNISESHPNATFSAVGEASICEDDWNSGERFTCTVTHTDLPSPLKQTISRPKGVALH RPDVYLLPPAREQLNLRESATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMP EPQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEALPNRVTERTVDKSTGKPTLYNV SLVMSDTAGTCY (SEQ ID NO:7). A schematic structure of the hexameric form of disulfide-linked LS41A-Fc dimers is shown in FIG. 2 .
The mammalian expression vector pVF101 was modified in the coding region of LS41A-Fc as described below to generate a new expression vector pVF102. The first five amino acid residues in the hinge region of the mature LS41A-Fc sequence were replaced with an artificial pentapeptide EPKSS (SEQ ID NO:8) in pVF102. Leucine residues at positions 234 and 235 in CH2 (Eu numbering of Kabat et al. Sequences of Proteins of Immunological Interests, Fifth edition, NIH Publication No. 91-3242, U.S. Department of Health and Human Services, 1991) were changed to alanine residues (L234A/L235A) (SEQ ID NO:9) to eliminate the potential of effector functions associated with IgG molecules (Xu et al. 2000 Cell. Immunol. 200:16-26; Hezareh et al. 2001 J. Virol. 75:12161-12168). A proline residue at position 433 and another proline residue at position 435 (Eu numbering) in Cμ3 were changed to alanine and serine residues, respectively (P433A/P435S) (SEQ ID NO:10) to eliminate the potential of the CDC activity associated with IgM molecules (Arya et al., 1994 J. Immunol. 152:1206-1212). No other changes were introduced into pVF101 for generation of pVF102. The amino acid sequence of the mature hybrid Fc protein encoded in pVF102 (LS41K-Fc.S), which is composed of the artificial pentapeptide, portion of Hinge, CH2, CH3, Cμ3 and Cμ4, is
(SEQ ID NO: 11)
EPKSSDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL
TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKDQDTAIRVFAIPPSFASI
FLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSA
VGEASICEDDWNSGERFTCTVTHTDLASSLKQTISRPKGVALHRPDVYLL
PPAREQLNLRESATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMP
EPQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEALPNRVTERTVDKSTG
KPTLYNVSLVMSDTAGTCY.
The mammalian expression vector pVF102 was modified by replacing a methionine residue at position 428 in CH3 with a leucine residue (Eu numbering) (SEQ ID NO:12) to generate a new expression vector pVF103. No other changes were introduced into pVF102 for generation of pVF103. The amino acid sequence of the mature hybrid Fc protein encoded in pVF103 (LS41K-Fc.SL), which is composed of the artificial pentapeptide, portion of Hinge, CH2, CH3, Cμ3 and Cμ4, is
(SEQ ID NO: 13)
EPKSSDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL
TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
RWQQGNVFSCSVLHEALHNHYTQKSLSLSPGKDQDTAIRVFAIPPSFASI
FLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSA
VGEASICEDDWNSGERFTCTVTHTDLASSLKQTISRPKGVALHRPDVYLL
PPAREQLNLRESATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMP
EPQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEALPNRVTERTVDKSTG
KPTLYNVSLVMSDTAGTCY.
Concentration of LS41A-Fc, LS41K-Fc.S and LS41K-Fc.SL in culture supernatants or mouse serum was measured by sandwich ELISA. In a typical experiment, an ELISA plate was coated overnight at 4° C. with 100 μl/well of 1/2,000-diluted goat anti-human IgG Fcγ chain-specific antibody (Jackson ImmunoResearch, West Grove, PA) in PBS (phosphate-buffered saline, pH 7.4), washed with Wash Buffer (PBS containing 0.05% Tween 20), and blocked for 1 hr at room temperature with 200 μl/well of ELISA Buffer (PBS containing 2% skim milk and 0.05% Tween 20). After washing with Wash Buffer, 100 μl/well of test samples appropriately diluted in ELISA Buffer were applied to the ELISA plate. Either purified LS41A-Fc, LS41K-Fc.S or LS41K-Fc.SL was used as a standard. After incubating the ELISA plate for 1 hr at room temperature and washing with Wash Buffer, bound Fc proteins were detected using 100 μl/well of 1/2,000-diluted HRP-conjugated goat anti-human gamma chain antibody (SouthemBiotech, Birmingham, AL) in ELISA buffer. After incubating for 30 min at room temperature and washing with Wash Buffer, color development was initiated with 100 μl/well of ABTS substrate and stopped with 100 μl/well of 2% oxalic acid. Absorbance was read at 405 nm.
Concentration of mouse monoclonal anti-human CD122 IgG1/kappa antibody ABC2 (U.S. Pat. No. 9,028,830) in mouse serum was measured by sandwich ELISA as described above, except that (1) human CD122 extracellular region fused to six histidine residues generated at JN Biosciences (CD122-His; SEQ ID NO: 14) was used for coating of an ELISA plate, (2) HRP-conjugated goat anti-mouse kappa chain antibody (Bethyl Laboratories, Montgomery, TX) was used for detection of bound ABC2, and (3) ABC2 was used as a standard.
Concentration of mouse IgG in mouse serum was measured by sandwich ELISA as described above, except that (1) goat anti-mouse IgG Fcγ chain-specific antibody (Jackson ImmunoResearch) was used for coating, (2) HRP-conjugated goat anti-mouse kappa chain antibody (Bethyl Laboratories) was used for detection, and (3) ABC2 was used as a standard.
Example 2: Expression and Purification of Multimeric Hybrid Fc Proteins
The expression vectors pVF102 and pVF103 were individually introduced into the chromosomes of a Chinese hamster ovary cell line CHO-K1 to obtain cell lines stably producing LS41K-Fc.S and LS41K-Fc.SL, respectively. CHO-K1 cells were grown in SFM4CHO media (GE Healthcare, Chicago, IL) at 37° C. in a 7.5% CO2 incubator. Stable transfection into CHO-K1 was carried out by electroporation. Before transfection, each expression vector was linearized using FspI. In a typical experiment, approximately 107 cells were transfected with 20 μg of linearized plasmid, suspended in SFM4CHO media, and plated into several 96-well plates after appropriate dilutions of cells. After 48 hr, puromycin was added for isolation of stable transfectants. Approximately twelve days after the initiation of selection, culture supernatants of transfectants were assayed for antibody production.
Expression of LS41K-Fc.S and LS41K-Fc.SL was measured by sandwich ELISA as described above. Previously purified LS41K-Fc.S or LS41K-Fc.SL was used as a standard. CHO-K1 stable transfectants producing each of LS41K-Fc.S and LS41K-Fc.SL were expanded in SFM4CHO until the cell viability became less than 50%. After centrifugation and filtration, culture supernatants were loaded onto a Protein A column (HiTrap MABSelect SuRe, GE Healthcare). The column was washed with PBS before the hybrid Fc proteins were eluted with 0.1 M glycine-HCl (pH 3.0) containing 0.1 M NaCl. Buffer of eluted hybrid Fc proteins was neutralized with 1 M Tris-HCl (pH 8.0) and then changed to PBS by dialysis. The concentration of hybrid Fc proteins was determined by measuring absorbance at 280 nm (1 mg/ml=1 OD).
The molecular size of purified LS41K-Fc.S and LS41K-Fc.SL in the native form was analyzed by gel filtration using the AKTA Basic FPLC system with a Superose 6 10/300 GL column (GE Healthcare). PBS was used as running buffer. A single dominant peak was observed for each of purified LS41K-Fc.S and LS41K-Fc.SL. By comparison of the elution pattern with molecular size markers, the size of LS41K-Fc.S and LS41K-Fc.SL in the native form was estimated to be approximately 600 kDa, which is consistent with the size of a hexamer of the disulfide-linked hybrid Fc dimers of this invention comprising the hinge, CH2, CH3, Cμ3 and Cμ4 regions.
Example 3: Analysis of Pharmacokinetics (PK) and Pharmacodynamics (PD) of LS41K-Fc.S in Mice
Fifty (50) μg of mouse monoclonal anti-human CD122 IgG1 antibody ABC2 in the absence and presence of 400 μg LS41K-Fc.S (Groups A and B, respectively) in 50 μl of PBS was intracardially administered into three Balb/c mice per group. Serum samples were collected from these mice at one day before administration (Day −1) and at two hours (2 HR), one day (Day 1), three days (Day 3), five days (Day 5) and eight days (Day 8) after the administration.
Concentration of ABC2 in the serum samples was measured by ELISA as described above. The ABC2 concentration at each time point (Day 1, Day 3, Day 5 and Day 8) was normalized to the concentration in the 2 HR sample for each mouse. The data are plotted in FIG. 3 . The average relative concentration of ABC2 in the Group A (ABC2 alone) was 100% (2 HR), 52.0% (Day 1), 36.7% (Day 3) and 29.9% (Day 5) and 19.3% (Day 8). In contrast, the average percentage concentration of ABC2 in the Group B (ABC2 and LS41K-Fc.S) was 100% (2 HR), 39.1% (Day 1), 20.1% (Day 3), 14.9% (Day 5) and 8.8% (Day 8). Administration of LS41K-Fc.S with ABC2 more rapidly reduced the concentration of ABC2 in mouse serum than the administration of ABC2 alone. This is likely due to the high avidity of LS41K-Fc.S for binding to FcRn, which results in enhanced catabolism of ABC2 in lysosomes.
Concentration of mouse IgG in the serum samples was measured by ELISA as described above. The mouse IgG concentration at each time point (2 HR, Day 1, Day 3, Day 5 and Day 8) was normalized to the concentration in the Day −1 sample for each mouse. The data are plotted in FIG. 4 . In the Group A (ABC2 alone), the average relative concentration of mouse IgG was mostly unchanged. The average mouse IgG concentration was 100% (Day −1), 92.8% (2 HR), 86.2% (Day 1), 90.7% (Day 3), 96.6% (Day 5) and 96.8% (Day 8). In contrast, the average relative IgG concentration in Group B (ABC2 and LS41K-Fc.S) dropped to two-thirds of the Day −1 level on Day 3 and returned to the 80% level on Day 8. The average relative IgG concentration was 100% (Day −1), 88.4% (2 HR), 72.1% (Day 1), 67.6% (Day 3), 74.8% (Day 5) and 80.4% (Day 8). These results indicate that LS41K-Fc.S efficiently competes against mouse IgG for binding to FcRn and blocks recycling of mouse IgG to the circulation.
Concentration of LS41K-Fc.S in the serum samples was measured by ELISA as described above. The data are plotted in FIG. 5 . The average concentration of LS41K-Fc.S was 230 μg/ml (2 HR), 144 μg/ml (Day 1), 76.4 μg/ml (Day 3), 50.0 μg/ml (Day 5) and 5.1 μg/ml (Day 8). The sudden decrease of the concentration on Day 8 is likely due to immune reactions against the human-origin of LS41K-Fc.S in the mice. The half-life of LS41K-Fc.S in the mouse circulation calculated with Day 1, Day 3 and Day 5 samples was 62 hours.
Example 4: PK and PD Analysis of LS41K-Fc.SL in Mice
The substitution of a methionine residue at position 428 (Eu numbering) with a leucine residue (M428L) in the gamma heavy chain of human IgG is known to increase the serum half-life of such modified IgG antibodies (Hinton et al., J. Biol. Chem. 279:6213-6219, 2004; Hinton et al., J. Immunol. 176:346-356, 2006). In an attempt to increase the half-life in the circulation, a variant of LS41K-Fc.S termed LS41K-Fc.SL was generated in which a methionine residue at position 428 in CH3 was substituted by a leucine residue.
A mixture of 50 μg ABC2 and 400 μg LS41K-Fc.SL in 50 μl PBS was intracardially administered into three Balb/c mice (Group C). Serum samples were collected from these mice at one day before administration (Day −1) and at two hours (2 HR), one day (Day 1), three days (Day 3), five days (Day 5) and eight days (Day 8) after the administration. This experiment was carried out together with Group A (ABC2 alone) and Group B (ABC2 and LS41K-Fc.S) described above.
Concentration of LS41K-Fc.SL in the serum samples was measured by ELISA as described above. The average concentration of LS41K-Fc.SL was 279 μg/ml (2 HR), 86.0 μg/ml (Day 1), 20.1 μg/ml (Day 3) and 7.2 μg/ml (Day 5). The data are plotted in FIG. 5 . The concentration in the Day 8 samples was below the detection limit. The LS41K-Fc.SL concentration on Day 5 was 2.6% of the concentration at 2 HR in Group C, whereas the LS41K-Fc.S concentration on Day 5 was 21.7% of the concentration at 2 HR in Group B. The half-life of LS41K-Fc.SL in the circulation calculated with Day 1, Day 3 and Day 5 was 27 hours. Despite the presence of the M428L mutation in the Fc region, LS41K-Fc.SL was more rapidly cleared from the circulation than LS41K-Fc.S.
Concentration of ABC2 in the serum samples was measured by ELISA as described above. The ABC2 concentration at each time point (Day 1, Day 3, Day 5 and Day 8) was normalized to the concentration in the 2 HR sample for each mouse. The data are plotted in FIG. 3 . The average relative concentration of ABC2 in Group C (ABC2 and LS41K-Fc.SL) was 37.3% (Day 1), 12.7% (Day 3), 10.2% (Day 5) and 8.0% (Day 8). LS41K-Fc.SL reduced the concentration of ABC2 in the serum samples more drastically than LS41K-Fc.S on Days 3 and 5.
Concentration of mouse IgG in the serum samples was measured by ELISA as described above. The mouse IgG concentration at each time point (2 HR, Day 1, Day 3, Day 5 and Day 8) was normalized to the concentration in the Day −1 sample for each mouse. The data are plotted in FIG. 4 . The average relative concentration of mouse IgG was 87.2% (2 HR), 68.6% (Day 1), 55.3% (Day 3), 67.1% (Day 5) and 118.8% (Day 8). The mouse IgG concentration on Day 3 reached nearly half of the predose concentration (Day −1) by LS41K-Fc.SL in Group C.
The presence of the M428L mutation in LS41K-Fc.SL resulted in a decrease, rather than an increase as anticipated, of the serum half-life when compared to its parental LS41K-Fc.S. In addition, LS41K-Fc.SL functioned more potently than LS41K-Fc.S to reduce the concentration of ABC2 and mouse IgG in the circulation.
Example 5: Dose Dependence of LS41K-Fc.SL
Fifty (50) μg of mouse monoclonal IgG1 antibody ABC2 together with either 100 μg (Group D) or 400 μg (Group E) of LS41K-Fc.SL was intracardially administered into three Balb/c mice per group. Serum samples were collected from these mice at two hours (2 HR), one day (Day 1), three days (Day 3), five days (Day 5) and eight days (Day 8) after the administration. Concentration of each of ABC2, mouse IgG and LS41K-Fc.SL in the serum samples was measured by ELISA as described above.
The ABC2 concentration at each time point (Day 1, Day 3, Day 5 and Day 8) was normalized to the concentration in the 2 HR sample for each mouse. The data are plotted in FIG. 6 . The average relative concentration of ABC2 with 100 μg of LS41K-Fc.SL (Group D) was 100% at 2 HR, 34.0% on Day 1, 19.6% on Day 3, 16.4% on Day 5 and 12.3% on Day 8. The average concentration of ABC2 with 400 μg of LS41K-Fc.SL (Group E) was 100% at 2 HR, 27.2% on Day 1, 10.7% on Day 3, 8.0% on Day 5, and 5.5% on Day 8. The decrease of the concentration of ABC2 in the serum samples was dependent on the dose of LS41K-Fc.SL. The administration of 400 μg of LS41K-Fc.SL (Group E) reduced the concentration of ABC2 in the circulation more rapidly than the administration of 100 μg of LS41K-Fc.SL (Group D).
Concentration of mouse IgG in the serum samples was measured by ELISA as described above. The mouse IgG concentration at each time point (Day 1, Day 3, Day 5 and Day 8) was normalized to the concentration in the 2 HR sample for each mouse. The data are plotted in FIG. 7 . The average relative mouse IgG concentration in Group D was 100% at 2 HR, 83.6% on Day 1, 73.6% on Day 3, 76.5% on Day 5, and 92.8% on Day 8. The average relative mouse IgG concentration in Group E was 100% at 2 HR, 74.8% on Day 1, 61.4% on Day 3, 63.6% on Day 5, and 88.3% on Day 8. The mouse IgG level decreased on Day 1 and Day 3, and started increasing gradually on Day 5 in both Groups D and E. Mouse IgG concentration was more drastically decreased in Group E (400 μg of LS41K-Fc.SL) than Group D (100 μg of LS41K-Fc.SL) on Days 1, 3 and 5.
FIG. 8 shows the concentration of LS41K-Fc.SL in the serum samples. The average LS41K-Fc.SL concentration in Group D was 72.8 μg/ml at 2 HR, 21.9 μg/ml on Day 1, 5.3 μg/ml on Day 3 and 2.1 μg/ml on Day 5. The average LS41K-Fc.SL concentration in Group E was 311.3 μg/ml at 2 HR, 97.4 μg/ml on Day 1, 23.8 μg/ml on Day 3 and 9.2 μg/ml on Day 5. The concentration of LS41K-Fc.SL on Day 8 was below the detection limit in both dosing groups. The average serum half-life of LS41K-Fc.SL calculated using the Day 1, Day 3 and Day 5 data was 28 hrs for both 100 μg and 400 μg dosing groups.
Example 6: Fc Mutations to Enhance Sialylation
An amino acid substitution of a phenylalanine residue at each of positions 241 and 243 (Eu numbering) to an alanine residue in the IgG Fc region (F241A and F243A, respectively) have been shown to enhance sialylation of N-linked glycans in IgG molecules and Fc proteins (Yu et al., J. Am. Chem. Soc. 135:9723-9732, 2013; Ahmed et al., J. Mol. Biol. 426: 3166-3179; Fiebiger et al. Proc. Natl. Acad. Sci. 112: E2385-E2394, 2015; Mimura et al., J. Immunol. Methods 428:30-36, 2016).
A variant of LS41K-Fc.SL was generated by substituting a phenylalanine residue at position 241 (Eu numbering) to an alanine residue in CH2 of the human gamma-1 chain in pVF103 to generate pVF104. The amino acid sequence of the mature hybrid Fc protein encoded in pVF104 (LS41K-Fc.SL.F241A), which is composed of the artificial pentapeptide, and a portion of Hinge, CH2, CH3, Cμ3 and Cμ4, is
(SEQ ID NO: 15)
EPKSSDKTHTCPPCPAPEAAGGPSVALFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL
TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
RWQQGNVFSCSVLHEALHNHYTQKSLSLSPGKDQDTAIRVFAIPPSFASI
FLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSA
VGEASICEDDWNSGERFTCTVTHTDLASSLKQTISRPKGVALHRPDVYLL
PPAREQLNLRESATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMP
EPQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEALPNRVTERTVDKSTG
KPTLYNVSLVMSDTAGTCY.
Another variant of LS41K-Fc.SL was generated by substituting a phenylalanine residue at position 243 to an alanine residue in CH2 of the human gamma-1 chain in pVF103 to generate pVF105. The amino acid sequence of the mature hybrid Fc protein encoded in pVF105 (LS41K-Fc.SL.F243A), which is composed of the artificial pentapeptide, portion of Hinge, CH2, CH3, Cμ3 and Cμ4, is
(SEQ ID NO: 16)
EPKSSDKTHTCPPCPAPEAAGGPSVFLAPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL
TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
RWQQGNVFSCSVLHEALHNHYTQKSLSLSPGKDQDTAIRVFAIPPSFASI
FLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSA
VGEASICEDDWNSGERFTCTVTHTDLASSLKQTISRPKGVALHRPDVYLL
PPAREQLNLRESATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMP
EPQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEALPNRVTERTVDKSTG
KPTLYNVSLVMSDTAGTCY.
Example 7: Expression of Beta-Galactoside alpha-2,6-sialyltransferase 1 (ST6GAL1) and beta-1,4-galactosyltransferase 1 (B4GALT1)
Although IgG molecules expressed in mammalian cells are poorly sialylated (Wang et al. Biotech. Bioeng. 2018 115:1378-1393; Friedman et al. 1988 Cancer Lett. 43:79), sialylated IVIG has been reported to be responsible for anti-inflammatory activities (Anthony et al., J. Clin. Immunol. 30:9-14, 2010; Seite et al., Arthritis Rheum. 67:595-603, 2015). Terminal sialic acid can be attached to galactose in alpha-2,3-, alpha-2,6-, or alpha-2,8-linkages. CD22 and DC-SIGN binds only to alpha-2,6-linked sialic acid (Powell et al., J. Biol. Chem. 13:7523-7532, 1995; Anthony et al., Proc. Natl. Acad. Sci. 105:9571-19578, 2008). Two beta-galactoside alpha-2,6-sialyltransferases (ST6GAL1 and ST6GAL2) are responsible for attachment of alpha-2,6-linked sialic acid to a terminal galactose of N-linked carbohydrates in mammalian cells.
Raymond et al. (mAbs 7:571-583, 2015) reported that expression of recombinant ST6GAL1 in CHO-K1 cells increased the level of alpha-2,6-sialylated recombinant human IgG1 antibodies.
Coexpression of recombinant B4GALT1 (beta-1,4-galactosyltransferase 1), which catalyzes the addition of a galactose molecule to a terminal N-acetylglucosamine of the N-linked glycans, with recombinant ST6GAL1 in CHO-K1 cells further increased the level of alpha-2,6 sialylation of IgG molecules.
Genes encoding each of human ST6GAL1 and B4GALT1 were synthesized at Synbio Technologies (Monmouth Junction, NJ) as SpeI-EagI fragments. An expression vector for human ST6GAL1 (SEQ ID NO:17) (pFCm512; FIG. 9A) has the same structure as pVF101 (FIG. 1 ) except that (i) the SpeI-EagI fragment encoding LS41A-Fc was replaced with the synthetic gene encoding human ST6GAL1 and (ii) the puromycin N-acetyl-transferase gene (puro) was replaced with the blasticidin-S deaminase gene (Bsr in the figure). Another expression vector for human B4GALT1 (SEQ ID NO:18) (pFCm513; FIG. 9B) has the same structure as pVF101 except that (i) the SpeI-EagI fragment encoding LS41A-Fc was replaced with the synthetic gene encoding human B4GALT1 and (ii) the puromycin N-acetyl-transferase gene (puro) was replaced with the Streptoalloteichus hindustanus bleomycin resistant gene (Zeo in the figure).
Example 8: Engagement of CD22
Each of the expression vectors pVF103, pVF104 and pVF105 is transiently transfected into HEK293 cells to express LS41K-Fc.SL, LS41K-Fc.SL.F241A and LS41K-Fc.SL.F243A, respectively, by the polyethylenimine method (Durocher et al. Nucl. Acids Res. 30:e9, 2002). Each of these three expression vectors is also cotransfected with (i) pFCm512 or (ii) pFCm512 and pFCm513 into HEK293 cells.
Binding of such expressed LS41K-Fc.SL, LS41K-Fc.SL.F241A and LS41K-Fc.SL.F243A to CD22 is analyzed with human Burkitt lymphoma cell lines Ramos and Raji by flow cytometry. The activity of LS41K-Fc.SL, LS41K-Fc.SL.F241A and LS41K-Fc.SL.F243A to reduce the viability of Ramos cells via cross-linking of CD22 is analyzed by the method described by Seite et al. (Blood 116:1698-1704, 2010).
Example 9: PK and PD Analysis of LS41K-Fc.SL, LS41K-Fc.SL.F241A and LS41K-Fc.SL.F243A in Non-Human Primates
Humanized anti-CD122 IgG1 antibody HuABC2 (U.S. Pat. No. 9,028,830) is intravenously administered at 5 mg/kg to a group of three cynomolgus monkeys. HuABC2 together with 20 mg/kg of either LS41K-Fc.SL, LS41K-Fc.SL.F241A or LS41K-Fc.SL.F243A is also administered intravenously to another group of three cynomolgus monkeys. Serum samples are collected from these monkeys at one day before administration (Day −1) and at two hours (2 HR), one day (Day 1), four days (Day 4), seven days (Day 7), ten days (Day 10) and fourteen days (Day 14) after the administration.
Concentration of HuABC2 in the serum samples is measured by ELISA as described above, except that (1) human CD122 extracellular region fused to six histidine residues generated at JN Biosciences (CD122-His; SEQ ID NO: 14) is used for coating of an ELISA plate, (2) HRP-conjugated goat anti-human kappa chain antibody is used for detection of bound antibodies, and (3) HuABC2 is used as a standard, to demonstrate that LS41K-Fc.SL, LS41K-Fc.SL.F241A and LS41K-Fc.SL.F243A have an ability to rapidly clear HuABC2 from the circulation of cynomolgus monkeys.
Concentration of total cynomolgus IgG in the serum samples is measured by ELISA as described above, except that (1) goat anti-cynomolgus IgG Fcγ chain-specific antibody is used for coating, (2) HRP-conjugated goat anti-cynomolgus kappa chain antibody is used for detection of bound antibodies, and (3) cynomolgus IgG is used as a standard, to demonstrate that LS41K-Fc.SL, LS41K-Fc.SL.F241A and LS41K-Fc.SL.F243A have an ability to reduce the IgG concentration in the circulation of cynomolgus monkeys.
B cells are isolated from the cynomolgus monkeys administered with LS41K-Fc.SL, LS41K-Fc.SL.F241A or LS41K-Fc.SL.F243A. For demonstration of the ability of LS41K-Fc.SL, LS41K-Fc.SL.F241A and LS41K-Fc.SL.F243A to suppress immune reactions, the activity of B cells to respond to antigens, such as endotoxin, is monitored by analyzing the production of anti-endotoxin antibodies. In addition, the immune response of B cells by conjugation of CD40 on the surface is analyzed by flow cytometry to measure the expression level of CD95 on the surface.
Example 10: Sialylation Level of LS41K-Fc.SL.F243A
CHO-K1 cells were stably transfected with pFCm512 that expresses human ST6GAL1 by electroporation as described above. CHO-K1 stable transfectants expressing ST6GAL1 (CHO-K1/ST6GAL1), which had been isolated by selection in the presence of blasticidin, were then used for stable transfection with pVF105 that expresses LS41K-Fc.SL.F243A. Puromycin-resistant CHO-K1/ST6GAL1 cells expressing LS41K-Fc.SL.F243A were expanded in SFM4CHO media as described above. LS41K-Fc.SL.F243A was purified using a protein A affinity column as described above. Purified LS41K-Fc.SL.F243A showed a single dominant peak of the expected size (approximately 600 kDa) in the gel filtration analysis with a Superose 6 column.
Sialylation of LS41K-Fc.SL.F243A purified from CHO-K1/ST6GAL1 cells was analyzed using EnzyChrom Sialic Acid Assay Kit (BioAssay Systems, Hayward, CA). Herceptin® (trastuzumab), a humanized IgG1 monoclonal antibody, was used as a reference in this assay. An average number of sialic acids attached to each LS41K-Fc.SL.F243A molecule was determined to be 21.3. An average number of sialic acids attached to each Herceptin was 0.14.
Example 11: Binding to FcRn
For expression of human FcRn on the cell surface, a new vector pFCm239 was constructed. The vector pFCm239 has the same structure as pVF101 (FIG. 1 ) except that (1) the Spe-EagI fragment was substituted with a DNA fragment encoding, from N-terminus to C-terminus, the signal peptide and extracellular region of human FcRn (SEQ ID NO: 19), a polypeptide linker Thr-Gly-Gly-Gly, the FLAG polypeptide (SEQ ID NO:20), a polypeptide linker Gly-Gly-Gly, and the GPI anchorage signal of human CD55 (SEQ ID NO:21) (hFcRn-FLAG-GPI; SEQ ID NO:22) and (2) the puromycin N-acetyl-transferase gene (puro) was substituted by the E. coli xanthine-guanine phosphoribosyltransferase for selection of transfectants in the presence of mycophenolic acid.
The expression vector pFCm240 has the same structure as pVF101 except that the Spe-EagI fragment was substituted with a DNA fragment encoding the entire human 02 microglobulin (SEQ ID NO:23).
The mouse myeloma cell line NS0 was maintained in DME medium containing 10% fetal bovine serum (FBS). NS0 cells were stably transfected with pFCm239 by electroporation (Bebbington et al. Bio/Technology 10:169-175, 1992), selected in DME medium containing 10% FBS, 1 μg/ml mycophenolic acid, HT media supplement (Sigma-Aldrich, St. Louis, MO) and 0.25 mg/ml xanthine, and then tested for expression of hFcRn-FLAG-GPI on the surface by flow cytometry using rat anti-FLAG peptide antibody L5 (BioLegend, San Diego, CA) and phycoerythrin-labeled goat anti-rat IgG antibody (SouthemBiotech, Birmingham, AL). NS0 cells expressing FcRn-FLAG-GPI were further stably transfected with pFCm240 by electroporation. Puromycin-resistant NS0 transfectants were tested for expression of human 32 microglobulin by flow cytometry using mouse anti-human 02 microglobulin antibody 2M2 (BioLegend) and phycoerythrin-labeled goat anti-mouse IgG antibody (SouthernBiotech). NS0 transfectant cell line expressing hFcRn-FLAG-GPI and human β2 microglobulin was named NS0/hFcRn. Human IgG antibodies bound to NS0/hFcRn at pH 6.0.
The expression vector pFCm380 has the same structure as pVF101 (FIG. 1 ) except that the Spe-EagI fragment was substituted with a DNA fragment encoding, from N-terminus to C-terminus, the signal peptide and extracellular region of mouse FcRn (SEQ ID NO:24), a polypeptide linker Thr-Gly-Gly-Gly, the FLAG polypeptide (SEQ ID NO:20), a polypeptide linker Gly-Gly-Gly, and the GPI anchorage signal of human CD55 (SEQ ID NO:21) (mFcRn-FLAG-GPI; SEQ ID NO:25). NS0 cells were stably transfected with pFCm380 by electroporation. Puromycin-resistant NS0 cells were tested for expression of mFcRn-FLAG-GPI on the surface by flow cytometry using rat anti-FLAG peptide antibody L5 and phycoerythrin-labeled goat anti-rat IgG antibody. NS0 transfectant cell line expressing mFcRn-FLAG-GPI associated with endogenous mouse 02 microglobulin on the surface was named NS0/mFcRn. Mouse IgG antibodies bound to NS0/mFcRn cells at pH 6.0.
Binding of Erbitux (cetuximab; mouse-human chimeric anti-EGFR IgG1 antibody) and LS41K-Fc.SL to NS0/hFcRn cells was tested in PBS with 0.5% BSA and 0.05% sodium azide at pH 7.5 (FACS Buffer (pH 7.5)) and pH 6.0 (FACS Buffer (pH 6.0). For FcRn binding, each of Erbitux and LS41K-SL was incubated at 2,000 ng/ml, 400 ng/ml and 80 ng/ml with approximately one hundred thousand NS0/hFcRn cells in 200 μl of FACS Buffer (pH7.5) or FACS Buffer (pH 6.0) for 30 min at room temperature. After washing, NS0/hFcRn cells were incubated with 1 μg/ml of phycoerythrin-labeled donkey anti-human IgG F(ab′)2 antibody (Bethyl Laboratories, Montgomery, TX) for 30 min at room temperature in FACS Buffer of the same pH used at the initial binding step. Cells were washed with and suspended in FACS Buffer of the same pH used at the initial binding step, and then subjected to flow cytometry.
Erbitux showed binding to human FcRn in a dose-dependent manner at pH 6.0. The binding of Erbitux to human FcRn was severely reduced at pH 7.5 when compared to FcRn binding at pH 6.0 (FIG. 11A). This is consistent with the reported observation that the binding of human IgG antibodies to human FcRn is pH-dependent; strong binding at pH 6.0 and little binding at pH 7.5 (Hinton et al. 2006 J. Immunol. 176: 346-356). In contrast, the hybrid Fc fusion protein of this invention (LS41K-Fc.SL) bound to human FcRn in a dose-dependent manner at both pH 6.0 and 7.5 (FIG. 11B). No major difference was observed with the binding of LS41K-Fc.SL to human FcRn between pH 6.0 and pH 7.5.
Binding of Erbitux and LS41K-Fc.SL to mouse FcRn was also tested at pH 6.0 and pH 7.5 using NS0/mFcRn cells as shown above. Erbitux showed binding to mouse FcRn in a dose-dependent manner at pH 6.0 whereas its binding to mouse FcRn was nearly undetectable at pH 7.5 (FIG. 11C). LS41K-Fc.SL bound to mouse FcRn in a dose-dependent manner at both pH 6.0 and pH 7.5 (FIG. 11D). No major difference was observed with the binding of LS41K-Fc.SL to mouse FcRn between pH 6.0 and pH 7.5.
Example 12: Hybrid Fc Proteins Comprising Human IgG2, IgG3 and IgG4 Fc Regions
The coding sequences of the hinge, CH2 and CH3 regions in pVF103, which encodes LS41K-Fc.SL, are replaced by the coding sequences of the hinge, CH2 and CH3 regions of human IgG2, respectively, to construct pVF103-G2. The amino acid sequence of human IgG2-based hybrid Fc protein encoded in pVF103-G2 is
(SEQ ID NO: 26)
ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTWVVVDVSHE
DPEVQFNWYVDGVEVHNAKTKPREEQFNSTFCVVSVLTVVHQDWLNGKEY
KCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLV
KGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGKDQDTAIRVFAIPPSFASIFLTK
STKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSAVGEA
SICEDDWNSGERFTCTVTHTDLASSLKQTISRPKGVALHRPDVYLLPPAR
EQLNLRESATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQA
PGRYFAHSILTVSEEEWNTGETYTCVVAHEALPNRVTERTVDKSTGKPTL
YNVSLVMSDTAGTCY.
The coding sequences of the hinge, CH2 and CH3 regions in pVF103 are replaced by the coding sequences of the last repeat of hinge, CH2 and CH3 regions of human IgG3, respectively, to construct pVF103-G3. The amino acid sequence of human IgG3-based hybrid Fc protein encoded in pVF103-G3 is
(SEQ ID NO: 27)
EPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLN
GKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSL
TCPVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKS
RWQQGNIFSCSVMHEALHNRFTQKSLSLSPGKDQDTAIRVFAIPPSFASI
FLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSA
VGEASICEDDWNSGERFTCTVTHTDLASSLKQTISRPKGVALHRPDVYLL
PPAREQLNLRESATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMP
EPQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEALPNRVTERTVDKSTG
KPTLYNVSLVMSDTAGTCY.
The coding sequences of the hinge, CH2 and CH3 regions in pVF103 are replaced by the coding sequences of the hinge, CH2 and CH3 regions of human IgG4, respectively, to construct pVF103-G4. The amino acid sequence of human IgG4-based hybrid Fc protein encoded in pVF103-G4 is
(SEQ ID NO: 28)
ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQ
EDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVRVLTVLHQDWLNGKE
YKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL
VKGFYPSDIAVEWESNGQPEDNYKTTPPVLDSDGSFFLYSRLTVDKSRWQ
EGNVFSCSVMHEALHNHYTQKSLSLSPGKDQDTAIRVFAIPPSFASIFLT
KSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSAVGE
ASICEDDWNSGERFTCTVTHTDLASSLKQTISRPKGVALHRPDVYLLPPA
REQLNLRESATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQ
APGRYFAHSILTVSEEEWNTGETYTCVVAHEALPNRVTERTVDKSTGKPT
LYNVSLVMSDTAGTCY.
SEQUENCE LIST
Amino acid sequence of the signal
peptide used for LS41A-Fc
encoded in pVF101
SEQ ID NO: 1
MGWSWIFFFLLSGTASVLS
Amino acid sequence of the hinge
region of human gamma-1 heavy
chain encoded in pVF101
SEQ ID NO: 2
EPKSCDKTHTCPPCP
Amino acid sequence of the CH2
region of human gamma-1 heavy
chain encoded in pVF101
SEQ ID NO: 3
APELLGGPSVFLFPPKPKDTLMISRTPEVIC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV
SNKALPAPIEKTISKAK
Amino acid sequence of the CH3
region of human gamma-1 heavy
chain encoded in pVF101
SEQ ID NO: 4
GQPREPQVYTLPPSRDELTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLYSKLTVDKSRWQQGNVFSCSVMHEALH
NHYTQKSLSLSPGK
Amino acid sequence of the Cμ3
region of human mu heavy chain
encoded in pVF101
SEQ ID NO: 5
DQDTAIRVFAIPPSFASIFLTKSTKLTCLVT
DLTTYDSVTISWTRQNGEAVKTHTNISESHP
NATFSAVGEASICEDDWNSGERFTCTVTHTD
LPSPLKQTISRPK
Amino acid sequence of the Cμ4
region of human mu heavy chain
encoded in pVF101
SEQ ID NO: 6
GVALHRPDVYLLPPAREQLNLRESATITCLV
TGFSPADVFVQWMQRGQPLSPEKYVTSAPMP
EPQAPGRYFAHSILTVSEEEWNTGETYTCVV
AHEALPNRVTERTVDKSTGKPTLYNVSLVMS
DTAGTCY
Amino acid sequence of the mature
LS41A-Fc protein encoded in
pVF101
SEQ ID NO: 7
EPKSCDKTHTCPPCPAPELLGGPSVFLFPPK
PKDTLMISRTPEVTCVVVDVSHEDPEVKFNW
YVDGVEVHNAKTKPREEQYNSTYRVVSVLTV
LHQDWLNGKEYKCKVSNKALPAPIEKTISKA
KGQPREPQVYTLPPSRDELTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL
HNHYTQKSLSLSPGKDQDTAIRVFAIPPSFA
SIFLTKSTKLTCLVTDLTTYDSVTISWTRQN
GEAVKTHTNISESHPNATFSAVGEASICEDD
WNSGERFTCTVTHTDLPSPLKQTISRPKGVA
LHRPDVYLLPPAREQLNLRESATITCLVTGF
SPADVFVQWMQRGQPLSPEKYVTSAPMPEPQ
APGRYFAHSILTVSEEEWNTGETYTCVVAHE
ALPNRVTERTVDKSTGKPTLYNVSLVMSDTA
GTCY
Amino acid sequence of the
pentapeptide fused to the portion
of the hinge regions encoded in
pVF102
SEQ ID NO: 8
EPKSS
Amino acid sequence of the modified
CH2 region of human gamma-
1 heavy chain encoded in pVF102
SEQ ID NO: 9
APEAAGGPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV
SNKALPAPIEKTISKAK
Amino acid sequence of the Cμ3
region of human mu heavy chain
encoded in pVF102
SEQ ID NO: 10
DQDTAIRVFAIPPSFASIFLTKSTKLTCLVT
DLTTYDSVTISWTRQNGEAVKTHTNISESHP
NATFSAVGEASICEDDWNSGERFTCTVTHTD
LASSLKQTISRPK
Amino acid sequence of the mature
LS41K-Fc.S protein encoded
in pVF102
SEQ ID NO: 11
EPKSSDKTHTCPPCPAPEAAGGPSVFLFPPK
PKDTLMISRTPEVTCVVVDVSHEDPEVKFNW
YVDGVEVHNAKTKPREEQYNSTYRVVSVLTV
LHQDWLNGKEYKCKVSNKALPAPIEKTISKA
KGQPREPQVYTLPPSRDELTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL
HNHYTQKSLSLSPGKDQDTAIRVFAIPPSFA
SIFLTKSTKLTCLVTDLTTYDSVTISWTRQN
GEAVKTHTNISESHPNATFSAVGEASICEDD
WNSGERFTCTVTHTDLASSLKQTISRPKGVA
LHRPDVYLLPPAREQLNLRESATITCLVTGF
SPADVFVQWMQRGQPLSPEKYVTSAPMPEPQ
APGRYFAHSILTVSEEEWNTGETYTCVVAHE
ALPNRVTERTVDKSTGKPTLYNVSLVMSDTA
GTCY
Amino acid sequence of the
modified CH3 region of human
gamma-1 heavy chain encoded
in pVF103
SEQ ID NO: 12
GQPREPQVYTLPPSRDELTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLYSKLTVDKSRWQQGNVFSCSVLHEALH
NHYTQKSLSLSPGK
Amino acid sequence of the mature
LS41K-Fc.SL protein encoded
in pVF103
SEQ ID NO: 13
EPKSSDKTHTCPPCPAPEAAGGPSVFLFPPK
PKDTLMISRTPEVTCVVVDVSHEDPEVKFNW
YVDGVEVHNAKTKPREEQYNSTYRVVSVLTV
LHQDWLNGKEYKCKVSNKALPAPIEKTISKA
KGQPREPQVYTLPPSRDELTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVLHEAL
HNHYTQKSLSLSPGKDQDTAIRVFAIPPSFA
SIFLTKSTKLTCLVTDLTTYDSVTISWTRQN
GEAVKTHTNISESHPNATFSAVGEASICEDD
WNSGERFTCTVTHTDLASSLKQTISRPKGVA
LHRPDVYLLPPAREQLNLRESATITCLVTGF
SPADVFVQWMQRGQPLSPEKYVTSAPMPEPQ
APGRYFAHSILTVSEEEWNTGETYTCVVAHE
ALPNRVTERTVDKSTGKPTLYNVSLVMSDTA
GTCY
Amino acid sequence of the mature
form of the human CD122
extracellular region fused at
the C-terminus to six histidine
residues (CD122-His)
SEQ ID NO: 14
SAAVNGTSQFTCFYNSRANISCVWSQDGALQ
DTSCQVHAWPDRRRWNQICELLPVSQASWAC
NLILGAPDSQKLTTVDIVTLRVLCREGVRWR
VMAIQDFKPFENLRLMAPISLQVVHVETHRC
NISWEISQASHYFERHLEFEARTLSPGHTWE
EAPLLTLKQKQEWICLETLTPDTQYEFQVRV
KPLQGEFTTWSPWSQPLAFRTKPAALGKDTT
GGGAHHHHHH
Amino acid sequence of the mature
LS41K-Fc.SL.F241A protein
encoded in pVF104
SEQ ID NO: 15
EPKSSDKTHTCPPCPAPEAAGGPSVALFPPK
PKDTLMISRTPEVTCVVVDVSHEDPEVKFNW
YVDGVEVHNAKTKPREEQYNSTYRVVSVLTV
LHQDWLNGKEYKCKVSNKALPAPIEKTISKA
KGQPREPQVYTLPPSRDELTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVLHEAL
HNHYTQKSLSLSPGKDQDTAIRVFAIPPSFA
SIFLTKSTKLTCLVTDLTTYDSVTISWTRQN
GEAVKTHTNISESHPNATFSAVGEASICEDD
WNSGERFTCTVTHTDLASSLKQTISRPKGVA
LHRPDVYLLPPAREQLNLRESATITCLVTGF
SPADVFVQWMQRGQPLSPEKYVTSAPMPEPQ
APGRYFAHSILTVSEEEWNTGETYTCVVAHE
ALPNRVTERTVDKSTGKPTLYNVSLVMSDTA
GTCY
Amino acid sequence of the mature
LS41K-Fc.SL.F243A protein
encoded in pVF105
SEQ ID NO: 16
EPKSSDKTHTCPPCPAPEAAGGPSVFLAPPK
PKDTLMISRTPEVTCVVVDVSHEDPEVKFNW
YVDGVEVHNAKTKPREEQYNSTYRVVSVLTV
LHQDWLNGKEYKCKVSNKALPAPIEKTISKA
KGQPREPQVYTLPPSRDELTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVLHEAL
HNHYTQKSLSLSPGKDQDTAIRVFAIPPSFA
SIFLTKSTKLTCLVTDLTTYDSVTISWTRQN
GEAVKTHTNISESHPNATFSAVGEASICEDD
WNSGERFTCTVTHTDLASSLKQTISRPKGVA
LHRPDVYLLPPAREQLNLRESATITCLVTGF
SPADVFVQWMQRGQPLSPEKYVTSAPMPEPQ
APGRYFAHSILTVSEEEWNTGETYTCVVAHE
ALPNRVTERTVDKSTGKPTLYNVSLVMSDTA
GTCY
Amino acid sequence of human
beta-galactoside alpha-2,6-
sialyltransferases 1 (ST6GAL1)
encoded in pFCm512
SEQ ID NO: 17
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKK
GSYYDSFKLQTKEFQVLKSLGKLAMGSDSQS
VSSSSTQDPHRGRQTLGSLRGLAKAKPEASF
QVWNKDSSSKNLIPRLQKIWKNYLSMNKYKV
SYKGPGPGIKFSAEALRCHLRDHVNVSMVEV
TDFPFNTSEWEGYLPKESIRTKAGPWGRCAV
VSSAGSLKSSQLGREIDDHDAVLRFNGAPTA
NFQQDVGTKTTIRLMNSQLVTTEKRFLKDSL
YNEGILIVWDPSVYHSDIPKWYQNPDYNFFN
NYKTYRKLHPNQPFYILKPQMPWELWDILQE
ISPEEIQPNPPSSGMLGIIIMMTLCDQVDIY
EFLPSKRKTDVCYYYQKFFDSACTMGAYHPL
LYEKNLVKHLNQGTDEDIYLLGKATLPGFRT
IHC
Amino acid sequence of human
beta-1,4-galactosyltransferase 1
(B4GALT1) encoded in pFCm513
SEQ ID NO: 18
MRLREPLLSGSAAMPGASLQRACRLLVAVCA
LHLGVTLVYYLAGRDLSRLPQLVGVSTPLQG
GSNSAAAIGQSSGELRTGGARPPPPLGASSQ
PRPGGDSSPVVDSGPGPASNLTSVPVPHTTA
LSLPACPEESPLLVGPMLIEFNMPVDLELVA
KQNPNVKMGGRYAPRDCVSPHKVAIIIPFRN
RQEHLKYWLYYLHPVLQRQQLDYGIYVINQA
GDTIFNRAKLLNVGFQEALKDYDYTCFVFSD
VDLIPMNDHNAYRCFSQPRHISVAMDKFGFS
LPYVQYFGGVSALSKQQFLTINGFPNNYWGW
GGEDDDIFNRLVFRGMSISRPNAVVGRCRMI
RHSRDKKNEPNPQRFDRIAHTKETMLSDGLN
SLTYQVLDVQRYPLYTQITVDIGTPS
Amino acid sequence of the signal
peptide and extracellular
region of human FcRn
SEQ ID NO: 19
MGVPRPQPWALGLLLFLLPGSLGAESHLSLL
YHLTAVSSPAPGTPAFWVSGWLGPQQYLSYN
SLRGEAEPCGAWVWENQVSWYWEKETTDLRI
KEKLFLEAFKALGGKGPYTLQGLLGCELGPD
NTSVPTAKFALNGEEFMNFDLKQGTWGGDWP
EALAISQRWQQQDKAANKELTFLLFSCPHRL
REHLERGRGNLEWKEPPSMRLKARPSSPGFS
VLTCSAFSFYPPELQLRFLRNGLAAGTGQGD
FGPNSDGSFHASSSLTVKSGDEHHYCCIVQH
AGLAQPLRVELESPAKSS
Amino acid sequence of the
FLAG peptide
SEQ ID NO: 20
DYKDDDDK
Amino acid sequence of the GPI
anchorage signal of human CD55
SEQ ID NO: 21
PNKGSGTTSGTTRLLSGHTCFTLTGLLGTLV
TMGLLT
Amino acid sequence of
hFcRn-FLAG-GPI encoded in pFCm239
SEQ ID NO: 22
MGVPRPQPWALGLLLFLLPGSLGAESHLSLL
YHLTAVSSPAPGTPAFWVSGWLGPQQYLSYN
SLRGEAEPCGAWVWENQVSWYWEKETTDLRI
KEKLFLEAFKALGGKGPYTLQGLLGCELGPD
NTSVPTAKFALNGEEFMNFDLKQGTWGGDWP
EALAISQRWQQQDKAANKELTFLLFSCPHRL
REHLERGRGNLEWKEPPSMRLKARPSSPGFS
VLTCSAFSFYPPELQLRFLRNGLAAGTGQGD
FGPNSDGSFHASSSLTVKSGDEHHYCCIVQH
AGLAQPLRVELESPAKSSTGGGDYKDDDDKG
GGPNKGSGTTSGTTRLLSGHTCFTLTGLLGT
LVTMGLLT
Amino acid sequence of human β2
microglobulin
SEQ ID NO: 23
MSRSVALAVLALLSLSGLEAIQRTPKIQVYS
RHPAENGKSNFLNCYVSGFHPSDIEVDLLKN
GERIEKVEHSDLSFSKDWSFYLLYYTEFTPT
EKDEYACRVNHVTLSQPKIVKWDRDM
Amino acid sequence of the signal
peptide and extracellular
region of mouse FcRn
SEQ ID NO: 24
MGMPLPWALSLLLVLLPQTWGSETRPPLMYH
LTAVSNPSTGLPSFWATGWLGPQQYLTYNSL
RQEADPCGAWMWENQVSWYWEKETTDLKSKE
QLFLEALKTLEKILNGTYTLQGLLGCELASD
NSSVPTAVFALNGEEFMKFNPRIGNWTGEWP
ETEIVANLWMKQPDAARKESEFLLNSCPERL
LGHLERGRRNLEWKEPPSMRLKARPGNSGSS
VLTCAAFSFYPPELKFRFLRNGLASGSGNCS
TGPNGDGSFHAWSLLEVKRGDEHHYQCQVEH
EGLAQPLTVDLDSSARSS
Amino acid sequence of mFcRn-FLAG-
GPI encoded in pFCm380
SEQ ID NO: 25
MGMPLPWALSLLLVLLPQTWGSETRPPLMYH
LTAVSNPSTGLPSFWATGWLGPQQYLTYNSL
RQEADPCGAWMWENQVSWYWEKETTDLKSKE
QLFLEALKTLEKILNGTYTLQGLLGCELASD
NSSVPTAVFALNGEEFMKFNPRIGNWTGEWP
ETEIVANLWMKQPDAARKESEFLLNSCPERL
LGHLERGRRNLEWKEPPSMRLKARPGNSGSS
VLTCAAFSFYPPELKFRFLRNGLASGSGNCS
TGPNGDGSFHAWSLLEVKRGDEHHYQCQVEH
EGLAQPLTVDLDSSARSSTGGGDYKDDDDKG
GGPNKGSGTTSGTTRLLSGHTCFTLTGLLGT
LVTMGLLT
Amino acid sequence of human
IgG2-based hybrid Fc protein
SEQ ID NO: 26
ERKCCVECPPCPAPPVAGPSVFLFPPKPKDT
LMISRTPEVTWVVVDVSHEDPEVQFNWYVDG
VEVHNAKTKPREEQFNSTFCVVSVLTVVHQD
WLNGKEYKCKVSNKGLPAPIEKTISKTKGQP
REPQVYTLPPSREEMTKNQVSLTCLVKGFYP
SDIAVEWESNGQPENNYKTTPPMLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHY
TQKSLSLSPGKDQDTAIRVFAIPPSFASIFL
TKSTKLTCLVTDLTTYDSVTISWTRQNGEAV
KTHTNISESHPNATFSAVGEASICEDDWNSG
ERFTCTVTHTDLASSLKQTISRPKGVALHRP
DVYLLPPAREQLNLRESATITCLVTGFSPAD
VFVQWMQRGQPLSPEKYVTSAPMPEPQAPGR
YFAHSILTVSEEEWNTGETYTCVVAHEALPN
RVTERTVDKSTGKPTLYNVSLVMSDTAGTCY
Amino acid sequence of human
IgG3-based hybrid Fc protein
SEQ ID NO: 27
EPKSCDTPPPCPRCPAPELLGGPSVFLFPPK
PKDTLMISRTPEVTCVVVDVSHEDPEVQFKW
YVDGVEVHNAKTKPREEQYNSTFRVVSVLTV
LHQDWLNGKEYKCKVSNKALPAPIEKTISKT
KGQPREPQVYTLPPSREEMTKNQVSLTCPVK
GFYPSDIAVEWESSGQPENNYNTTPPMLDSD
GSFFLYSKLTVDKSRWQQGNIFSCSVMHEAL
HNRFTQKSLSLSPGKDQDTAIRVFAIPPSFA
SIFLTKSTKLTCLVTDLTTYDSVTISWTRQN
GEAVKTHTNISESHPNATFSAVGEASICEDD
WNSGERFTCTVTHTDLASSLKQTISRPKGVA
LHRPDVYLLPPAREQLNLRESATITCLVTGF
SPADVFVQWMQRGQPLSPEKYVTSAPMPEPQ
APGRYFAHSILTVSEEEWNTGETYTCVVAHE
ALPNRVTERTVDKSTGKPTLYNVSLVMSDTA
GTCY
Amino acid sequence of human
IgG4-based hybrid Fc protein
SEQ ID NO: 28
ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKD
TLMISRTPEVTCVVVDVSQEDPEVQFNWYVD
GVEVHNAKTKPREEQFNSTYRVVRVLTVLHQ
DWLNGKEYKCKVSNKGLPSSIEKTISKAKGQ
PREPQVYTLPPSQEEMTKNQVSLTCLVKGFY
PSDIAVEWESNGQPEDNYKTTPPVLDSDGSF
FLYSRLTVDKSRWQEGNVFSCSVMHEALHNH
YTQKSLSLSPGKDQDTAIRVFAIPPSFASIF
LTKSTKLTCLVTDLTTYDSVTISWTRQNGEA
VKTHTNISESHPNATFSAVGEASICEDDWNS
GERFTCTVTHTDLASSLKQTISRPKGVALHR
PDVYLLPPAREQLNLRESATITCLVTGFSPA
DVFVQWMQRGQPLSPEKYVTSAPMPEPQAPG
RYFAHSILTVSEEEWNTGETYTCVVAHEALP
NRVTERTVDKSTGKPTLYNVSLVMSDTAGTC
Y

Claims (11)

What is claimed is:
1. A hybrid Fc protein, the amino acid sequence of which consists essentially of any one of SEQ ID NOS: 11, 13, 15 and 16.
2. The hybrid Fc protein of claim 1, the amino acid sequence of which consists of any one of SEQ ID NOS: 11, 13, 15 and 16.
3. The hybrid Fc protein of claim 1, wherein molecules of the hybrid Fc protein have formed a duplex via interchain disulfide bonding between cysteine residues in a portion of the hinge region of SEQ ID NO: 11, 13, 15 or 16, and the duplexes have multimerized with one another via Cμ3 and Cμ4 regions of SEQ ID NOS: 11, 13, 15 or 16 to form a multimer.
4. The hybrid Fc protein of claim 3, wherein the multimer is a hexamer.
5. The hybrid Fc protein of claim 4 having more than 12 sialic acid molecules per hexamer.
6. The hybrid Fc protein of claim 1 that is at least 99% by weight pure.
7. A pharmaceutical composition comprising a hybrid Fc protein of claim 1 and a pharmaceutically acceptable carrier.
8. The hybrid Fc protein of claim 1, the amino acid sequence of which consists of SEQ ID NO:11.
9. The hybrid Fc protein of claim 1, the amino acid sequence of which consists of SEQ ID NO:13.
10. The hybrid Fc protein of claim 1, the amino acid sequence of which consists of SEQ ID NO:15.
11. The hybrid Fc protein of claim 1, the amino acid sequence of which consists of SEQ ID NO:16.
US17/282,382 2018-11-14 2019-11-12 Multimeric hybrid Fc proteins for replacement of IVIG Active 2042-08-29 US12492231B2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/282,382 US12492231B2 (en) 2018-11-14 2019-11-12 Multimeric hybrid Fc proteins for replacement of IVIG

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US201862767303P 2018-11-14 2018-11-14
US17/282,382 US12492231B2 (en) 2018-11-14 2019-11-12 Multimeric hybrid Fc proteins for replacement of IVIG
PCT/US2019/061020 WO2020102251A1 (en) 2018-11-14 2019-11-12 Multimeric hybrid fc proteins for replacement of ivig

Publications (2)

Publication Number Publication Date
US20220002361A1 US20220002361A1 (en) 2022-01-06
US12492231B2 true US12492231B2 (en) 2025-12-09

Family

ID=70730840

Family Applications (1)

Application Number Title Priority Date Filing Date
US17/282,382 Active 2042-08-29 US12492231B2 (en) 2018-11-14 2019-11-12 Multimeric hybrid Fc proteins for replacement of IVIG

Country Status (6)

Country Link
US (1) US12492231B2 (en)
EP (1) EP3880248A4 (en)
JP (1) JP7576844B2 (en)
CN (1) CN113271972B (en)
CA (1) CA3115547A1 (en)
WO (1) WO2020102251A1 (en)

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12492231B2 (en) 2018-11-14 2025-12-09 Jn Biosciences Llc Multimeric hybrid Fc proteins for replacement of IVIG
WO2022080912A1 (en) * 2020-10-16 2022-04-21 주식회사 아이엠바이오로직스 Fusion protein platform using igm region
EP4330383A1 (en) * 2021-04-29 2024-03-06 Novartis AG Hypersialylating cells
WO2023200311A1 (en) * 2022-04-15 2023-10-19 주식회사 아이엠바이오로직스 Fusion protein platform with improved half-life
KR20250112747A (en) * 2022-09-13 2025-07-24 누빅 테라퓨틱스, 인크. Modified FC polypeptides with improved sialylation
WO2025193823A1 (en) * 2024-03-13 2025-09-18 Nuvig Therapeutics, Inc. Methods of treating autoimmune disorders using modified fc polypeptides with enhanced sialylation

Citations (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003040311A2 (en) 2001-10-25 2003-05-15 The Government Of The United States Of America As Represented By The Secretary Of Health And Human Services Efficient inhibition of hiv-1 viral entry through a novel fusion protein including of cd4
US20050202538A1 (en) 1999-11-12 2005-09-15 Merck Patent Gmbh Fc-erythropoietin fusion protein with improved pharmacokinetics
US7217797B2 (en) * 2002-10-15 2007-05-15 Pdl Biopharma, Inc. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US7217798B2 (en) * 2003-10-15 2007-05-15 Pdl Biopharma, Inc. Alteration of Fc-fusion protein serum half-lives by mutagenesis
US7361740B2 (en) * 2002-10-15 2008-04-22 Pdl Biopharma, Inc. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US7365168B2 (en) * 2002-10-15 2008-04-29 Pdl Biopharma, Inc. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
WO2011073692A1 (en) 2009-12-18 2011-06-23 The University Of Nottingham Proteins, nucleic acid molecules and compositions
US20140294825A1 (en) 2011-09-26 2014-10-02 Jn Biosciences Llc Hybrid constant regions
JP2015501291A (en) 2011-09-26 2015-01-15 ジェイエヌ バイオサイエンシーズ エルエルシー Hybrid stationary region
CN104870055A (en) 2012-10-17 2015-08-26 利物浦热带医学院 Immunomodulatory proteins
WO2016024021A1 (en) 2014-08-15 2016-02-18 Merck Patent Gmbh Sirp-alpha immunoglobulin fusion proteins
JP2017509335A (en) 2014-03-05 2017-04-06 ユーシービー バイオファルマ エスピーアールエル Multimeric Fc protein
JP2017512063A (en) 2014-03-05 2017-05-18 ユーシービー バイオファルマ エスピーアールエル Multimeric Fc protein
US20170137530A1 (en) 2011-03-29 2017-05-18 Roche Glycart Ag Antibody fc variants
WO2017129737A1 (en) 2016-01-27 2017-08-03 Csl Behring Recombinant Facility Ag Recombinant igg fc multimers
WO2020102251A1 (en) 2018-11-14 2020-05-22 Jn Biosciences Llc Multimeric hybrid fc proteins for replacement of ivig

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3172691A4 (en) * 2014-07-21 2018-04-11 Hewlett-Packard Enterprise Development LP Security indicator linkage determination

Patent Citations (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050202538A1 (en) 1999-11-12 2005-09-15 Merck Patent Gmbh Fc-erythropoietin fusion protein with improved pharmacokinetics
WO2003040311A2 (en) 2001-10-25 2003-05-15 The Government Of The United States Of America As Represented By The Secretary Of Health And Human Services Efficient inhibition of hiv-1 viral entry through a novel fusion protein including of cd4
US7217797B2 (en) * 2002-10-15 2007-05-15 Pdl Biopharma, Inc. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US7361740B2 (en) * 2002-10-15 2008-04-22 Pdl Biopharma, Inc. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US7365168B2 (en) * 2002-10-15 2008-04-29 Pdl Biopharma, Inc. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US7217798B2 (en) * 2003-10-15 2007-05-15 Pdl Biopharma, Inc. Alteration of Fc-fusion protein serum half-lives by mutagenesis
WO2011073692A1 (en) 2009-12-18 2011-06-23 The University Of Nottingham Proteins, nucleic acid molecules and compositions
US20170137530A1 (en) 2011-03-29 2017-05-18 Roche Glycart Ag Antibody fc variants
JP2015501291A (en) 2011-09-26 2015-01-15 ジェイエヌ バイオサイエンシーズ エルエルシー Hybrid stationary region
US8952134B2 (en) * 2011-09-26 2015-02-10 Jn Biosciences Llc Hybrid constant regions
US9382319B2 (en) 2011-09-26 2016-07-05 Jn Biosciences Llc Hybrid constant regions
US20140294825A1 (en) 2011-09-26 2014-10-02 Jn Biosciences Llc Hybrid constant regions
CN104870055A (en) 2012-10-17 2015-08-26 利物浦热带医学院 Immunomodulatory proteins
JP2017509335A (en) 2014-03-05 2017-04-06 ユーシービー バイオファルマ エスピーアールエル Multimeric Fc protein
JP2017512063A (en) 2014-03-05 2017-05-18 ユーシービー バイオファルマ エスピーアールエル Multimeric Fc protein
WO2016024021A1 (en) 2014-08-15 2016-02-18 Merck Patent Gmbh Sirp-alpha immunoglobulin fusion proteins
WO2017129737A1 (en) 2016-01-27 2017-08-03 Csl Behring Recombinant Facility Ag Recombinant igg fc multimers
WO2020102251A1 (en) 2018-11-14 2020-05-22 Jn Biosciences Llc Multimeric hybrid fc proteins for replacement of ivig

Non-Patent Citations (46)

* Cited by examiner, † Cited by third party
Title
Anthony et al., "Identification of a receptor required for the anti-inflammatory activity of IVIG," PNAS, vol. 105, No. 50, pp. 19571-19578, (Dec. 2008).
Buckner et al., "Sweet SIGNs: IgG glycosylation leads the way in IVIG-mediated resolution of inflammation," International Immunology, vol. 29, No. 11, pp. 499-509, (Oct. 2017).
Crow et al., "The neonatal F receptor (FcRN) is not required for IVIg or anti-CD44 monoclonal antibody-mediated amelioration of murine immune thrombocytopenia," Blood, vol. 118, No. 24, (Dec. 2018).
Czajkowsky et al., "Developing the IVIG biomimetic, Hexa-Fc, for drug and vaccine applications," Scientific Reports, 5: 9526, DOI: 10.1038/srep09526, (Apr. 2015).
EP 19885952.2 Extended European Search Report mailed Jul. 11, 2022.
Kaneko et al., "Anti-Inflammatory Activity of Immunoglobulin G Resulting from Fc Sialylation," Science, vol. 313, pp. 670-673, (Aug. 2006).
Kiessling et al., "The FcRn inhibitor rozanolixizumab reduces human serum IgG concentration: A randomized phase 1 study," Science Translational Medicine, 9: eaan1208, (2017).
Mitrevski et al., "Immunomodulatory Effects of Intravenous Immunoglobulin—Assembling a Jigsaw Puzzle," International Trends in Immunity, vol. 2, No. 2, 67-73, (2014).
Nitschke "CD22 and Siglec-G regulate inhibition of B-cell signaling by sialic acid ligand binding and control B-cell tolerance," Glycobiology, 24:807-817, (2014).
Nixon et al., "Fully human monoclonal antibody inhibitors of the neonatal Fc receptor reduce circulating IgG in non-human primates," Frontiers in Immunology, 6: Article 176, (2015).
Patel et al., "Neonatal Fc Receptor Blockade by Fc Engineering Ameliorates Arthritis in a Murine Model," Journal of Immunology, 187:1015-1022, (2011).
Rath et al, "Regulation of immune responses by the neonatal Fc receptor and its therapeutic implications," Frontiers in Immunology, 5: Article 664, (2015).
Rowley, et al., "Engineered hexavaInt Fc proteins with enhanced Fc-gamma recetor avidity provide insights into immune-complex interactions," Communications Biology, 1:146, pp. 1-12, (2018).
Seite et al., "Intravenous Immunoglobulin and B Cells," Arthritis and Rheumatology, 67:595-603, (2015).
Sorensen et al., "Structural requirements for incorporation of J chain into human IgM and IgA," International Immunology, vol. 12, No. 1, pp. 19-27, (2000).
Sorensen, et al., "Effect of th eIgM and IgA Secretory Tailpices on Polymerization and Secretion of IgM and IgG1," The Journal of Immunology, vol. 156, No. 8, pp. 2858-2865, (Apr. 1996).
Sorensen, et al., "Effect of th elgM and IgA Secretory Tailpices on Polymerization and Secretion of IgM and IgG1," The Journal of Immunology, vol. 156, No. 8, pp. 2858-2865, (Apr. 1996).
Spirig et al., "rlgG1 Fc Hexamer Inhibits Antibody-Mediated Autoimmune Disease via Effects on Complement and FcgRs," Journal of Immunology, 200: 2542-2553, (2018).
Tam et al., "Correlations between pharmacokinetics of IgG antibodies in primates vs. FcRn-transgenic mice reveal a rodent model with predictive capabilities," mAbs, 5:397-405, (2013).
Ulrichts et al., "Neonatal Fc receptor antagonist efgartigimod safely and sustainably reduces IgGs in humans," Journal of Clinical Investigation, 128:4372-4386, (2018).
Washburn et al., "Controlled tetra-Fc sialylation of IVIg results in a drug candidate with consistent enhanced anti-inflammatory activity," Procedures of the National Academy of Science, U.S.A., 112:E1297-E1306, (2015).
WIPO Application No. PCT/US2019/061020, PCT International Preliminary Report on Patentability mailed May 18, 2021.
WIPO Application No. PCT/US2019/061020, PCT International Search Report and Written Opinion of the International Searching Authority mailed Feb. 27, 2020.
Anthony et al., "Identification of a receptor required for the anti-inflammatory activity of IVIG," PNAS, vol. 105, No. 50, pp. 19571-19578, (Dec. 2008).
Buckner et al., "Sweet SIGNs: IgG glycosylation leads the way in IVIG-mediated resolution of inflammation," International Immunology, vol. 29, No. 11, pp. 499-509, (Oct. 2017).
Crow et al., "The neonatal F receptor (FcRN) is not required for IVIg or anti-CD44 monoclonal antibody-mediated amelioration of murine immune thrombocytopenia," Blood, vol. 118, No. 24, (Dec. 2018).
Czajkowsky et al., "Developing the IVIG biomimetic, Hexa-Fc, for drug and vaccine applications," Scientific Reports, 5: 9526, DOI: 10.1038/srep09526, (Apr. 2015).
EP 19885952.2 Extended European Search Report mailed Jul. 11, 2022.
Kaneko et al., "Anti-Inflammatory Activity of Immunoglobulin G Resulting from Fc Sialylation," Science, vol. 313, pp. 670-673, (Aug. 2006).
Kiessling et al., "The FcRn inhibitor rozanolixizumab reduces human serum IgG concentration: A randomized phase 1 study," Science Translational Medicine, 9: eaan1208, (2017).
Mitrevski et al., "Immunomodulatory Effects of Intravenous Immunoglobulin—Assembling a Jigsaw Puzzle," International Trends in Immunity, vol. 2, No. 2, 67-73, (2014).
Nitschke "CD22 and Siglec-G regulate inhibition of B-cell signaling by sialic acid ligand binding and control B-cell tolerance," Glycobiology, 24:807-817, (2014).
Nixon et al., "Fully human monoclonal antibody inhibitors of the neonatal Fc receptor reduce circulating IgG in non-human primates," Frontiers in Immunology, 6: Article 176, (2015).
Patel et al., "Neonatal Fc Receptor Blockade by Fc Engineering Ameliorates Arthritis in a Murine Model," Journal of Immunology, 187:1015-1022, (2011).
Rath et al, "Regulation of immune responses by the neonatal Fc receptor and its therapeutic implications," Frontiers in Immunology, 5: Article 664, (2015).
Rowley, et al., "Engineered hexavaInt Fc proteins with enhanced Fc-gamma recetor avidity provide insights into immune-complex interactions," Communications Biology, 1:146, pp. 1-12, (2018).
Seite et al., "Intravenous Immunoglobulin and B Cells," Arthritis and Rheumatology, 67:595-603, (2015).
Sorensen et al., "Structural requirements for incorporation of J chain into human IgM and IgA," International Immunology, vol. 12, No. 1, pp. 19-27, (2000).
Sorensen, et al., "Effect of th eIgM and IgA Secretory Tailpices on Polymerization and Secretion of IgM and IgG1," The Journal of Immunology, vol. 156, No. 8, pp. 2858-2865, (Apr. 1996).
Sorensen, et al., "Effect of th elgM and IgA Secretory Tailpices on Polymerization and Secretion of IgM and IgG1," The Journal of Immunology, vol. 156, No. 8, pp. 2858-2865, (Apr. 1996).
Spirig et al., "rlgG1 Fc Hexamer Inhibits Antibody-Mediated Autoimmune Disease via Effects on Complement and FcgRs," Journal of Immunology, 200: 2542-2553, (2018).
Tam et al., "Correlations between pharmacokinetics of IgG antibodies in primates vs. FcRn-transgenic mice reveal a rodent model with predictive capabilities," mAbs, 5:397-405, (2013).
Ulrichts et al., "Neonatal Fc receptor antagonist efgartigimod safely and sustainably reduces IgGs in humans," Journal of Clinical Investigation, 128:4372-4386, (2018).
Washburn et al., "Controlled tetra-Fc sialylation of IVIg results in a drug candidate with consistent enhanced anti-inflammatory activity," Procedures of the National Academy of Science, U.S.A., 112:E1297-E1306, (2015).
WIPO Application No. PCT/US2019/061020, PCT International Preliminary Report on Patentability mailed May 18, 2021.
WIPO Application No. PCT/US2019/061020, PCT International Search Report and Written Opinion of the International Searching Authority mailed Feb. 27, 2020.

Also Published As

Publication number Publication date
CA3115547A1 (en) 2020-05-22
EP3880248A1 (en) 2021-09-22
WO2020102251A1 (en) 2020-05-22
EP3880248A4 (en) 2022-08-10
US20220002361A1 (en) 2022-01-06
JP2022514187A (en) 2022-02-10
CN113271972B (en) 2025-06-17
JP7576844B2 (en) 2024-11-01
CN113271972A (en) 2021-08-17

Similar Documents

Publication Publication Date Title
US20220251214A1 (en) Bispecific Antibodies for Activation of Immune Cells
JP7576844B2 (en) Multimeric hybrid Fc proteins for replacement of IVIG
US12559555B2 (en) Anti-LILRB4 antibodies and derivative products
CN114026122B (en) Multifunctional molecules that bind to T cell-associated cancer cells and their uses
EP2760891B1 (en) Hybrid constant regions
US9540442B2 (en) Antibodies or fusion proteins multimerized via cysteine mutation and a mu tailpiece
WO2020063787A1 (en) Anti-b7-h3 monoclonal antibody and use thereof in cell therapy
US20210214434A1 (en) Variants with fc fragment having an increased affinity for fcrn and an increased affinity for at least one receptor of the fc fragment
RU2725807C2 (en) Soluble universal reinforcing adcc synthetic fused gene, peptide technology and use thereof
WO2023160260A1 (en) Cd7-car-t cell, and preparation method therefor and use thereof
WO2021129775A1 (en) Anti-ctla-4 monoclonal antibody, preparation method therefor, and application thereof
US20240317870A1 (en) Bifunctional molecules for treatment of immune disorders
JP7574692B2 (en) Bispecific antibodies
EP4619028A2 (en) Anti-cd3 antibodies
CN120152989A (en) Combination therapy of anti-CD19/anti-CD28 bispecific antibodies
JP7862028B2 (en) Bispecific antibodies for immune cell activation
US20260022174A1 (en) Trispecific Antibodies for Activation of Immune Cells

Legal Events

Date Code Title Description
FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

AS Assignment

Owner name: JN BIOSCIENCES LLC, CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:TSURUSHITA, NAOYA;TSO, J. YUN;REEL/FRAME:055933/0153

Effective date: 20210406

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE AFTER FINAL ACTION FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: ADVISORY ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: ALLOWED -- NOTICE OF ALLOWANCE NOT YET MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

STPP Information on status: patent application and granting procedure in general

Free format text: AWAITING TC RESP., ISSUE FEE NOT PAID

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED

STCF Information on status: patent grant

Free format text: PATENTED CASE

CC Certificate of correction