US12295973B2 - Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells - Google Patents

Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells Download PDF

Info

Publication number
US12295973B2
US12295973B2 US18/208,490 US202318208490A US12295973B2 US 12295973 B2 US12295973 B2 US 12295973B2 US 202318208490 A US202318208490 A US 202318208490A US 12295973 B2 US12295973 B2 US 12295973B2
Authority
US
United States
Prior art keywords
seq
sequence
cells
set forth
particular embodiments
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
US18/208,490
Other versions
US20240091265A1 (en
Inventor
Jarrod Dudakov
Marcel van den Brink
Enrico Velardi
Hans-Peter Kiem
Stefan Radtke
Scott James
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Memorial Sloan Kettering Cancer Center
Fred Hutchinson Cancer Center
Original Assignee
Memorial Sloan Kettering Cancer Center
Fred Hutchinson Cancer Center
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Memorial Sloan Kettering Cancer Center, Fred Hutchinson Cancer Center filed Critical Memorial Sloan Kettering Cancer Center
Priority to US18/208,490 priority Critical patent/US12295973B2/en
Assigned to FRED HUTCHINSON CANCER CENTER reassignment FRED HUTCHINSON CANCER CENTER MERGER AND CHANGE OF NAME (SEE DOCUMENT FOR DETAILS). Assignors: FRED HUTCHINSON CANCER RESEARCH CENTER, SEATTLE CANCER CARE ALLIANCE
Assigned to MEMORIAL SLOAN-KETTERING CANCER CENTER reassignment MEMORIAL SLOAN-KETTERING CANCER CENTER ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: JAMES, SCOTT
Assigned to FRED HUTCHINSON CANCER RESEARCH CENTER reassignment FRED HUTCHINSON CANCER RESEARCH CENTER ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: DUDAKOV, JARROD, KIEM, HANS-PETER, RADTKE, Stefan
Assigned to MEMORIAL SLOAN-KETTERING CANCER CENTER reassignment MEMORIAL SLOAN-KETTERING CANCER CENTER ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: VELARDI, Enrico, VAN DEN BRINK, MARCEL
Publication of US20240091265A1 publication Critical patent/US20240091265A1/en
Application granted granted Critical
Publication of US12295973B2 publication Critical patent/US12295973B2/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/28—Bone marrow; Haematopoietic stem cells; Mesenchymal stem cells of any origin, e.g. adipose-derived stem cells
    • A61K39/461—
    • A61K39/4621—
    • A61K39/46431—
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00—Cellular immunotherapy
    • A61K40/10—Cellular immunotherapy characterised by the cell type used
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00—Cellular immunotherapy
    • A61K40/20—Cellular immunotherapy characterised by the effect or the function of the cells
    • A61K40/22—Immunosuppressive or immunotolerising
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00—Cellular immunotherapy
    • A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41—Vertebrate antigens
    • A61K40/412—Contraceptive or sex hormones
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86—Viral vectors
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C12N5/0602—Vertebrate cells
    • C12N5/0634—Cells from the blood or the immune system
    • C12N5/0647—Haematopoietic stem cells; Uncommitted or multipotent progenitors
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment

Definitions

  • LHR luteinizing hormone receptor
  • LH luteinizing hormone
  • the methods can be used to prepare therapeutic hematopoietic stem cell (HSC) populations, to prepare patients for therapeutic HSC transplants or genetic cell therapies, and/or to treat malignancies, such as those associated with hyperproliferative HSC.
  • Hematopoietic stem cells are stem cells that can give rise to all blood cell types such as white blood cells and red blood cells.
  • the therapeutic administration of HSC can be used to treat a variety of side-effects of radiation exposure (e.g., cancer treatment or accidental), cancers (e.g., malignant blood cancers), and genetic blood disorders.
  • HSC can be administered to reconstitute the immune systems of individuals following radiation exposure.
  • HSC can be used as transplants.
  • the existing malignant hematopoietic system of an individual is ablated and HSC are provided as a therapeutic treatment to generate a properly functioning hematopoietic system.
  • HSC hematopoietic stem cell
  • the current gold standard for isolation of HSC is through the use of molecules that bind to the CD34 protein on the cellular surface of HSC.
  • Singular use of the CD34 HSC cell surface marker leads to a mixed or heterogeneous population of cells that have distinct phenotypes and characteristics because cells in addition to the most primitive HSC express CD34, including downstream progenitor cells. Due to the heterogeneity of these cell populations, there are several major limitations with using CD34 to identify HSCs. For example, the numbers of CD34-expressing cells isolated from blood and bone marrow products require large volumes of reagents for manipulation, which can be cost prohibitive if genetic manipulation of the HSCs is required. Thus, the field has widely recognized that there continues to be an unmet need to identify a more enriched, true (i.e., most primitive) HSC population, as well as methods to expand these cell populations for therapeutic uses.
  • HSCs are administered for therapeutic purposes, in many treatment regimens it is important to remove existing HSCs within a patient before the therapeutic administration.
  • hematopoietic stem cell transplant HSCT
  • HSCT hematopoietic stem cell transplant
  • Current non-targeted conditioning methods include, for example, irradiation (e.g., total body irradiation (TBI)) and DNA alkylating/modifying agents.
  • TBI total body irradiation
  • DNA alkylating/modifying agents are highly toxic to multiple organ systems, and completely wipe out the hematopoietic and immune systems, frequently leading to life-threatening complications precluding the use of HSCT for less dire, but still severe, conditions such as autoimmune diseases.
  • the current disclosure addresses many drawbacks of the prior art.
  • the current disclosure describes use of luteinizing hormone/choriogonadotropin receptor (LHR) binding agents and luteinizing hormone agonists to isolate, enrich and/or expand stem cell populations including the most primitive populations of human hematopoietic stem cells (pHSC).
  • LHR binding agents can be used to enrich for and isolate pHSC.
  • LH agonists can be used to expand pHSC.
  • the current disclosure provides targeting LHR-expressing HSC for selective ablation during conditioning before a HSC transplant and/or genetic cell therapy.
  • the described targeted and selective ablation reduces undesirable toxicity and minimizes the incidence of serious adverse reactions observed with currently utilized non-targeted conditioning methods.
  • selective ablation of HSC from HSC microenvironments i.e., the HSC niche
  • the efficiency of engraftment can be significantly enhanced by selective ablation, as compared to engraftment without selective ablation.
  • the current disclosure provides targeting LHR-expressing hyperproliferative HSC.
  • Such embodiments can be used to treat malignancies associated with hyperproliferative HSC, such as hematopoietic cancers. These treatments can be performed independently of or in conjunction with selective ablation during conditioning before a HSC transplant or infusion of genetically modified cells.
  • LHR binding agents that result in selective ablation of LHR-expressing HSC.
  • LHR binding agents include, for example, an LHR-binding antibody conjugated to a toxin, a bi-specific antibody, an LHR-binding bispecific T cell engaging (BiTE) antibody, or a chimeric antigen receptor (CAR)-modified immune cell.
  • FIGS. 1 A- 1 D A lethal total body irradiation (L-TBI) dose of 840cGy mediated lethality in more than 90% of mice.
  • L-TBI lethal total body irradiation
  • Mouse lethality was a result of bone marrow failure, as transplant of BM Lin ⁇ Sca1 + ckit + (LSK) cells 3 days after L-TBI completely rescued all mice.
  • LSK BM Lin ⁇ Sca1 + ckit +
  • a statistically significant benefit in survival in female mice given LHRH-Ant was also found.
  • FIGS. 2 A- 2 I FIGS. 2 A- 2 I .
  • 2 A Mice receiving LHRH-Ant 24 h after L-TBI exposure showed a significant increase in survival compared to control animals treated with vehicle alone.
  • 2 B Complete blood counts analysis revealed that only mice treated with LHRH-Ant recovered after L-TBI.
  • 2 C Treatment with LHRH-Ant significantly enhanced mouse survival even when administered 48 h after L-TBI.
  • 2 D In keeping with the peripheral blood (PB) recovery shown in FIG. 2 B ), BM cellularity of mice treated with the LHRH-Ant started to separate significantly from the vehicle group by day 14 after radiation.
  • PB peripheral blood
  • FIG. 3 Host mice receiving cells from LHRH-Ant-treated L-TBI mice had significantly better hematopoietic reconstitution than recipients of cells from vehicle-treated control L-TBI mice.
  • FIGS. 4 A- 4 H Surgical castration did not protect mice from radiation injury, but only the simultaneous treatment of the castrated mice with the LHRH-Ant restored the benefits in mouse survival.
  • 4 B Consistent with the data in surgically castrated mice, MDV3100 alone did not mediate any survival benefit but in groups treated with both MDV3100 and LHRH-Ant there was a significant increase in mouse survival.
  • 4 C Radiation by itself drastically reduced the levels of testosterone in both groups, and treatment with LHRH-Ant did not significantly lower the level of testosterone after radiation showing that the beneficial effects of LHRH-Ant on hematopoiesis and survival post irradiation were sex steroid independent.
  • FIGS. 5 A- 5 D ( 5 A) Cell populations and phenotypes. ( 5 B) LHCGR expression pattern in HSCPs derived from female mice. ( 5 C) LHCGR expression was a peculiarity of LT-HSCs with little or no expression found on purified BM stromal cells. ( 5 D) These findings were consistent with publicly accessible gene expression databases.
  • FIGS. 6 A- 6 G LH significantly enhanced colony formation in cobblestone area-forming cell ( 6 A; CAFC) and colony-forming cell ( 6 B; CFC) assays.
  • 6 C LH was also able to significantly expand human HSC1 in vitro (CD34+ CD38 ⁇ CD45RA ⁇ CD90+) in a stroma-free culture system.
  • 6 D When cell cycle status of HSCs in LHRH-Ant treated mice after L-TBI was analyzed, a significantly higher proportion of Ki-67 ⁇ quiescent LT-HSCs in the LHRH-Ant-treated group with fewer proliferative HSCs compared to the vehicle group was found.
  • FIG. 7 When cell cycle status of HSCs in LHRH-Ant treated mice after L-TBI was analyzed, a significantly higher proportion of Ki-67 ⁇ quiescent LT-HSCs in the LHRH-Ant-treated group with fewer proliferative HSCs compared to the vehicle group was found.
  • 8 B Abrogation of LH production significantly improved survival after serial 5-FU challenge.
  • 8 C Ablation of LH can limit HSC entry into cell cycle thus promoting their quiescence and survival during hematopoietic insult.
  • 8 D Constitutive LHCGR signaling in kiLHR HSCs significantly promoted reduction in LT-HSC survival after radiation exposure, as measured by higher proportion of apoptotic cells.
  • Pharmacological inhibition of LH signaling using a single dose of an LHRH-Ant represents a rational and feasible approach to preserve the HSC pool after high dose radiation, thereby mitigating acute hematopoietic radiation syndrome.
  • FIGS. 9 A, 9 B Schematics of mouse and human LH-CAR designs.
  • FIGS. 10 A- 10 D LH-CAR redirects T cells to kill primary mouse Leydig testis cell tumors cell lines and LHCGR-transduced C1498 leukemia.
  • 10 A Chimeric antigen receptor (CAR) designed based on natural ligand for the LHCGR receptor (luteinizing hormone) comprised by glycoprotein hormones alpha chain, linker, and luteinizing hormone beta subunit ( 10 A, left panel was used to generate described experimental results).
  • 10 B Mouse T cells were transduced with a retrovirus encoding myc tagged mouse LH-CAR containing CD28 costimulatory domain and CD3 zeta followed by a Thyl.1 reporter.
  • CAR myc tag
  • 10C Mouse T cells were transduced with the LH-CAR or mock transduced and incubated overnight with firefly luciferase-transduced MLTC1 and MA10 Leydig cell lines expressing LHCGR. Viable targets were assessed via luciferase assay.
  • 10 D Mouse T cells were transduced with the LH-CAR or mock transduced and incubated overnight with firefly luciferase-transduced C1498 leukemia cell line also transduced to express LHCGR. Viable targets were assessed via luciferase assay after three days of co-culture.
  • FIG. 11 Luetenizing hormone receptor sequences (SEQ ID NOs: 1-3).
  • FIG. 12 Signaling domain including a variant of CD3 zeta and a portion of the 4-1BB intracellular signaling domain (DNA (SEQ ID NO: 4) and protein (SEQ ID NO: 5).
  • FIGS. 13 A, 13 B LH-CAR.
  • 13 A Mouse LH-CAR cDNA (SEQ ID NO: 6), Mouse LH-CAR translation (SEQ ID NO: 7) and subcomponents thereof including signal peptide (SEQ ID NO: 8), LH beta subunit (SEQ ID NO: 9), linker (SEQ ID NO: 10), LH alpha subunit (SEQ ID NO: 11), Myc (SEQ ID NO: 12), CD8 hinge (SEQ ID NO: 13), CD8 transmembrane domain (SEQ ID NO: 14), CD28 cytoplasmic (SEQ ID NO: 15), CD3 zeta (SEQ ID NO: 16), 2A (SEQ ID NO: 17), and Thyl.1 (SEQ ID NO: 18);
  • 13B human LH-CAR cDNA (SEQ ID NO: 19), human LH-CAR translation (SEQ ID NO: 20) and subcomponents thereof including signal peptide (SEQ ID NO: 21), LH beta
  • the current disclosure provides improvements through the use of luteinizing hormone/choriogonadotropin receptor (LHR) binding agents to generate populations of the most primitive populations of human stem cells; use of LH agonists to promote HSC expansion; targeting LHR-expressing HSC for selective ablation during conditioning before a HSC transplant and/or infusion of genetically modified cells; and/or as an independent or complementary treatment to ablate hyperproliferative HSC associated with hematopoietic cancers.
  • Particular embodiments may also use LH agonists to enhance HSC transfection/transduction in treatments utilizing genetic modification.
  • LHR Luteinizing Hormone/Choriogonadotropin Receptor
  • Hematopoietic stem cells refer to stem cells that can differentiate into the hematopoietic lineage and give rise to all blood cell types such as white blood cells and red blood cells, including myeloid (e.g., monocytes and macrophages, neutrophils, basophils, eosinophils, erythrocytes, megakaryocytes/platelets, dendritic cells), and lymphoid lineages (e.g., T-cells, B-cells, NK-cells).
  • myeloid e.g., monocytes and macrophages, neutrophils, basophils, eosinophils, erythrocytes, megakaryocytes/platelets, dendritic cells
  • lymphoid lineages e.g., T-cells, B-cells, NK-cells.
  • the current disclosure provides use of the luteinizing hormone/choriogonadotropin receptor (LHR) binding agents to generate and expand populations of human and mouse pHSC including: human HSC1 and/or HSC2 and mouse long-term HSCs (LT-HSCs).
  • LHR luteinizing hormone/choriogonadotropin receptor
  • human HSC1 can be identified by the following profile: CD34+/CD38 ⁇ /CD45RA ⁇ /CD90+ or CD34+/CD45RA ⁇ /CD90+ and mouse LT-HSC can be identified by Lin-Scal+ckit+CD150+CD48-F1t3-CD34 ⁇ (where Lin represents the absence of expression of any marker of mature cells including CD3, Cd4, CD8, CD11 b, CD11 c, NK1.1, and TER119).
  • HSC1 can include the marker profile: LHR+/CD34+/CD38 ⁇ /CD45RA/CD90+.
  • HSC1 can be identified by the following profile: Lin ⁇ /CD34+/CD38 ⁇ /CD45RA ⁇ /CD90+/CD49f+.
  • HSC1 can include the marker profile: LHR+/Lin ⁇ /CD34+/CD38 ⁇ /CD45RA ⁇ /CD90+/CD49f+.
  • HSC2 can be identified by the following profile: CD34+/CD38/CD45RA ⁇ /CD90 ⁇ /CD49f+.
  • HSC2 can include the marker profile: LHR+/CD34+/CD38 ⁇ /CD45RA ⁇ /CD90 ⁇ /CD49f+. Based on the foregoing profiles, expression of LHR can be combined with presence or absence of the following one or more markers to prepare HSC1 and/or HSC2 cell populations: Lin/CD34/CD38/CD45RA/CD90/CD49f as well as CD133. Various other combinations may also be used so long as the marker combination reliably isolates HSC1 or HSC2.
  • Sources of HSC to generate pHSC populations include cord blood, mobilized peripheral blood and bone marrow. Methods regarding collection, anti-coagulation and processing, etc. of blood samples are well known in the art. See, for example, Alsever et al., 1941, N.Y. St. J. Med. 41:126; De Gowin, et al., 1940, J. Am. Med. Ass. 114:850; Smith, et al., 1959, J. Thorac. Cardiovasc. Surg. 38:573; Rous and Turner, 1916, J. Exp. Med. 23:219; and Hum, 1968, Storage of Blood, Academic Press, New York, pp. 26-160.
  • Peripheral blood HSC in peripheral blood are preferably mobilized prior to collection.
  • Peripheral blood HSC can be mobilized by any method.
  • Peripheral blood HSC can be mobilized by treating the subject with any agent(s), described herein or known in the art, that increase the number of HSC circulating in the peripheral blood of the subject.
  • peripheral blood is mobilized by treating the subject with one or more cytokines or growth factors (e.g., G-CSF, kit ligand (KL), IL-I, IL-7, IL-8, IL-11, Flt3 ligand, SCF, thrombopoietin, or GM-CSF (such as sargramostim)).
  • cytokines or growth factors e.g., G-CSF, kit ligand (KL), IL-I, IL-7, IL-8, IL-11, Flt3 ligand, SCF, thrombopoietin, or GM-CSF (such as
  • peripheral blood is mobilized by treating the subject with one or more chemokines (e.g., macrophage inflammatory protein-1 ⁇ (MIP1 ⁇ /CCL3)), chemokine receptor ligands (e.g., chemokine receptor 2 ligands GRO ⁇ and GRO ⁇ ⁇ 4 , chemokine receptor analogs (e.g., stromal cell derived factor-1 ⁇ (SDF-1 ⁇ ) protein analogs such as CTCE-0021, CTCE-0214, or SDF-1 ⁇ such as Met-SDF-1 ⁇ ), or chemokine receptor antagonists (e.g., chemokine (C-X-C motif) receptor 4 (CXCR4) antagonists such as AMD3100).
  • chemokines e.g., macrophage inflammatory protein-1 ⁇ (MIP1 ⁇ /CCL3)
  • chemokine receptor ligands e.g., chemokine receptor 2 ligands GRO ⁇ and GRO ⁇ ⁇ 4
  • chemokine receptor analogs
  • peripheral blood is mobilized by treating the subject with one or more anti-integrin signaling agents (e.g., function blocking anti-very late antigen 4 (VLA-4) antibody, or anti-vascular cell adhesion molecule 1 (VCAM-1)).
  • one or more anti-integrin signaling agents e.g., function blocking anti-very late antigen 4 (VLA-4) antibody, or anti-vascular cell adhesion molecule 1 (VCAM-1)).
  • VLA-4 function blocking anti-very late antigen 4
  • VCAM-1 anti-vascular cell adhesion molecule 1
  • peripheral blood is mobilized by treating the subject with one or more cytotoxic drugs such as cyclophosphamide, etoposide or paclitaxel.
  • cytotoxic drugs such as cyclophosphamide, etoposide or paclitaxel.
  • peripheral blood can be mobilized by administering to a subject one or more of the agents listed above for a certain period of time.
  • the subject can be treated with one or more agents (e.g., G-CSF) via injection (e.g., subcutaneous, intravenous or intraperitoneal), once daily or twice daily, for 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days prior to collection of HSC.
  • agents e.g., G-CSF
  • injection e.g., subcutaneous, intravenous or intraperitoneal
  • HSC are collected within 1, 2, 3, 4, 5, 6, 7, 8, 12, 14, 16, 18, 20 or 24 hours after the last dose of an agent used for mobilization of HSC into peripheral blood.
  • HSC are mobilized by treating the subject with two or more different types of agents described above or known in the art, such as a growth factor (e.g., G-CSF) and a chemokine receptor antagonist (e.g., CXCR4 receptor antagonist such as AMD3100), or a growth factor (e.g., G-CSF or KL) and an anti-integrin agent (e.g., function blocking VLA-4 antibody).
  • agents described above or known in the art such as a growth factor (e.g., G-CSF) and a chemokine receptor antagonist (e.g., CXCR4 receptor antagonist such as AMD3100), or a growth factor (e.g., G-CSF or KL) and an anti-integrin agent (e.g., function blocking VLA-4 antibody).
  • agents described above or known in the art such as a growth factor (e.g., G-CSF) and a chemokine receptor antagonist (e.g., CXCR4 receptor antagonist such as AMD3100
  • HSC from peripheral blood can be collected from the blood through a syringe or catheter inserted into a subject's vein.
  • the peripheral blood can be collected using an apheresis machine. Blood flows from the vein through the catheter into an apheresis machine, which separates the white blood cells, including HSC from the rest of the blood and then returns the remainder of the blood to the subject's body. Apheresis can be performed for several days (e.g., 1 to 5 days) until enough HSC have been collected.
  • HSC from bone marrow can be obtained, e.g., directly from bone marrow from the posterior iliac crest by needle aspiration (see, e.g., Kodo et al., 1984, J. Clin Invest. 73:1377-1384), or from the blood following pre-treatment with cytokines (such as G-CSF and/or AM D3100) that induce cells to be released from the bone marrow compartment.
  • cytokines such as G-CSF and/or AM D3100
  • Enrichment/isolation of pHSC can be performed using any appropriate technique that is not unduly detrimental to the viability of the enriched for/isolated cells.
  • Examples include magnetic separation using, for example, antibody-coated magnetic beads; fluorescence activated cell sorting (FACS; Williams et al., 1985, J. Immunol. 135:1004; Lu et al., 1986, Blood 68(1):126-133); affinity chromatography; cytotoxic agents joined to a monoclonal antibody or used in conjunction with a monoclonal antibody, e.g., complement and cytotoxins; “panning” with antibody attached to a solid matrix, e.g., plate, or other convenient technique (Broxmeyer et al., 1984, J. Clin.
  • Enrichment/isolation thus refers to a process wherein the percentage of target cells (i.e., HSC1 and/or HSC2 for human samples; LT-HSGs and ST-HSGs for mouse samples) in the sample is increased (relative to the percentage in the sample before the enrichment/isolation procedure).
  • the increase in the number of target cells is an increase in the percentage of target cells in the enriched sample, relative to the sample prior to the enrichment/isolation procedure, for example at least a 25-, 50-, 75-, 100-, 150, 200-, 250-, 300-, 350-fold increase.
  • LHR+HSC1 and/or LHR+HSC2 human cells are enriched for/isolated using a binding agent specific for LHR, which binding agent is conjugated to a magnetic bead, and a magnetic cell separation device to separate out the LHR+ HSC1 and/or LHR+ HSC2 cells.
  • binding agents for other pHSC markers can also be used in combination with LHR (e.g., LH R+/CD34+; LH R+/CD34+/CD38 ⁇ /CD45RA ⁇ /CD90+; LH R+/Li n ⁇ /CD34+/CD38 ⁇ /CD45RA ⁇ /CD90+/CD49f; LHR+/CD34+/CD38 ⁇ /CD45RA ⁇ /CD90 ⁇ /CD49f+).
  • LHR e.g., LH R+/CD34+; LH R+/CD34+/CD38 ⁇ /CD45RA ⁇ /CD90+; LH R+/Li n ⁇ /CD34+/CD38 ⁇ /CD45RA ⁇ /CD90+/CD49f; LHR+/CD34+/CD38 ⁇ /CD45RA ⁇ /CD90 ⁇ /CD49f+).
  • using anti-LHR binding agents in combination with other HSC1 and/or HSC2 markers results in target cells enriched to >80% of the population; >85% of the population; >90% of the population; >95% of the population; >99% of the population; or 100% of the population.
  • binding agents to assist in the preparation of pHSC populations include the LH alpha subunit and the LH beta subunit.
  • the alpha subunit includes DCPECTLQEN PFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRV TVMGGFKVENHTACHCSTCYYHKS (SEQ ID NO: 23 (human)) or GCPECKLKEN KYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKAT VMGNARVENHTECHCSTCYYHKS (SEQ ID NO: 11 (mouse)).
  • the LH beta subunit includes SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQA VLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTC DHPQLSGLLFL (SEQ ID NO: 22 (human)) or SRGPLRPLCRPVNATLAAENEFCPVC ITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPIVSFPVALSCRC GPCRLSSSDCGGPRTQPMACDLPHLPGLLLL (SEQ ID NO: 9 (mouse)).
  • binding agents to assist in the preparation of pHSC populations include antibodies or binding fragments thereof.
  • Numerous antibodies that bind LHR or other HSC1/HSC2 markers are commercially available.
  • anti-LHR antibodies are commercially available from Abcam, Invitrogen, Alomone Labs, Novus Biologicals, Origene Technologies, Bio-Rad, Abbexa, St. John's Laboratory, Millipore Sigma, LifeSpan Biosciences, etc.
  • Anti-LHR antibodies utilized or produced according to the methods disclosed herein have high affinity for LHR. The same is true for antibodies that bind to other HSC1 and/or HSC2 markers.
  • affinity refers to the strength of the sum total of noncovalent interactions between a single binding site of an antibody and its target marker. Unless indicated otherwise, “binding affinity” refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (i.e., antibody and target marker).
  • the affinity of an antibody for its target marker can generally be represented by the dissociation constant (Kd) or the association constant (K A ). Affinity can be measured by common methods known in the art.
  • binding affinities can be assessed in relevant in vitro conditions, such as a buffered salt solution approximating physiological pH (7.4) at room temperature or 37° C.
  • “bind” means that the antibody associates with its target marker with a dissociation constant (1(D) of 10 ⁇ 8 M or less, in particular embodiments of from 10 ⁇ 5 M to 10 ⁇ 13 M, in particular embodiments of from 10 ⁇ 5 M to 10 ⁇ 10 M, in particular embodiments of from 10 ⁇ 5 M to 10 ⁇ 7 M, in particular embodiments of from 10 ⁇ 8 M to 10 ⁇ 13 M, or in particular embodiments of from 10 ⁇ 9 M to 10 ⁇ 13 M.
  • a dissociation constant (1(D) of 10 ⁇ 8 M or less in particular embodiments of from 10 ⁇ 5 M to 10 ⁇ 13 M, in particular embodiments of from 10 ⁇ 5 M to 10 ⁇ 10 M, in particular embodiments of from 10 ⁇ 5 M to 10 ⁇ 7 M, in particular embodiments of from 10 ⁇ 8 M to 10 ⁇ 13 M, or in particular embodiments of from 10 ⁇ 9 M to 10 ⁇ 13 M.
  • the term can be further used to indicate that the antibody does not bind to other biomolecules present, (e.g., it binds to other biomolecules with a dissociation constant (KD) of 10 ⁇ 4 M or more, in particular embodiments of from 10 ⁇ 4 M to 1 M).
  • KD dissociation constant
  • “bind” means that the antibody associates with its target marker with an affinity constant (i.e., association constant, K A ) of 10 7 M ⁇ 1 or more, in particular embodiments of from 10 5 M ⁇ 1 to 10 13 M ⁇ 1 , in particular embodiments of from 10 5 M ⁇ 1 to 10 10 M ⁇ 1 , in particular embodiments of from 10 5 M ⁇ 1 to 10 8 M ⁇ 1 , in particular embodiments of from 10 7 M ⁇ 1 to 10 13 M ⁇ 1 , or in particular embodiments of from 10 7 M ⁇ 1 to 10 8 M ⁇ 1 .
  • affinity constant i.e., association constant, K A
  • the term can be further used to indicate that the antibody does not bind to other biomolecules present, (e.g., it binds to other biomolecules with an association constant (K A ) of 10 4 M ⁇ 1 or less, in particular embodiments of from 10 4 M ⁇ 1 to 1 M ⁇ 1 ).
  • K A association constant
  • Naturally occurring antibody structural units include a tetramer.
  • Each tetramer includes two pairs of polypeptide chains, each pair having one light chain and one heavy chain.
  • each chain includes a variable region that is responsible for target marker recognition and epitope binding.
  • the variable regions exhibit the same general structure of relatively conserved framework regions (FR) joined by three hyper variable regions, also called complementarity determining regions (CDRs).
  • the CDRs from the two chains of each pair are aligned by the framework regions, which enables binding to a specific target marker epitope.
  • both light and heavy chain variable regions include the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
  • the assignment of amino acids to each domain is typically in accordance with the definitions of Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)), or Chothia & Lesk, J. Mol. Biol., 196:901-917 (1987); Chothia et al., Nature, 342:878-883 (1989).
  • variable and constant regions are joined by a “J” region of amino acids, with the heavy chain also including a “D” region of amino acids. See, e.g., Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)).
  • Human light chains are classified as kappa and lambda light chains. Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
  • IgG has several subclasses, including, IgG1, IgG2, IgG3, and IgG4. IgA is similarly subdivided into subclasses including IgA1 and IgA2.
  • CDRs from antibodies that bind target markers can be utilized to aid in the preparation of pHSC populations in a variety of binding domain formats.
  • particular embodiments can include binding fragments of an antibody, e.g., Fv, Fab, Fab′, F(ab′) 2 , Fc, and single chain Fv fragments (scFvs) or any effective binding fragments of an antibody that bind specifically to the targeted marker.
  • a single chain variable fragment is a fusion protein of the variable regions of the heavy and light chains of immunoglobulins connected with a short linker peptide.
  • Fv fragments include the V L and V H domains of a single arm of an antibody, but lack the constant regions.
  • the two domains of the Fv fragment, V L and V H are coded by separate genes, they can be joined, using, for example, recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (single chain Fv (scFv)).
  • a Fab fragment is a monovalent antibody fragment including V L , V H , CL and CH1 domains.
  • a F(ab′) 2 fragment is a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region.
  • Diabodies include two epitope-binding sites that may be bivalent. See, for example, EP 0404097; WO1993/01161; and Holliger, et al., Proc. Natl. Acad. Sci. USA 90 (1993) 6444-6448.
  • Dual affinity retargeting antibodies (DARTTM; based on the diabody format but featuring a C-terminal disulfide bridge for additional stabilization (Moore et al., Blood 117, 4542-51 (2011)) can also be formed.
  • Antibody fragments can also include isolated CDRs. For a review of antibody fragments, see Hudson, et al., Nat. Med. 9 (2003) 129-134.
  • antibody includes antibodies including two full-length heavy chains and two full-length light chains, the fragments as described above, and variants described more fully below.
  • antibodies can include monoclonal antibodies, human or humanized antibodies, bispecific antibodies, polyclonal antibodies, linear antibodies, minibodies, domain antibodies, synthetic antibodies, chimeric antibodies, antibody fusions, and fragments thereof, respectively.
  • a monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies including the population are identical and/or bind the same target marker epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
  • polyclonal antibody preparations which include different antibodies directed against different epitopes of an antigen
  • each monoclonal antibody of a monoclonal antibody preparation is directed against a single epitope on an antigen.
  • the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • monoclonal antibodies can be made by a variety of techniques, including the hybridoma method, recombinant DNA methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci.
  • an anti-LHR binding agent includes a CDRH1 including GYSITSGYG (SEQ ID NO: 28); a CDRH2 including IHYSGST (SEQ ID NO: 29); a CDRH3 including ARSLRY (SEQ ID NO: 30); and a CDRL1 including SSVNY (SEQ ID NO: 31); a CDRL2 including DTS; and a CDRL3 including HQWSSYPYT (SEQ ID NO: 32).
  • an anti-LHR binding agent includes a CDRH1 including GFSLTTYG (SEQ ID NO: 33); a CDRH2 including IWGDGST (SEQ ID NO: 34); and a CDRH3 including AEGSSLFAY (SEQ ID NO: 35); and a CDRL1 including QSLLNSGNQKNY (SEQ ID NO: 36); a CDRL2 including WAS; and a CDRL3 including QNDYSYPLT (SEQ ID NO: 37).
  • an anti-LHR binding agent includes a CDRH1 including GYSFTGYY (SEQ ID NO: 38); a CDRH2 including IYPYNGVS (SEQ ID NO: 39); and a CDRH3 including ARERGLYQLRAMDY (SEQ ID NO: 40); and a CDRL1 including QSISNN (SEQ ID NO: 41); a CDRL2 including NAS; and a CDRL3 including QQSNSWPYT (SEQ ID NO: 42).
  • an anti-LHR binding agent includes a heavy chain including EVQLQESGPDLVKPSQSLSLTCTVTGYSITSGYGWHRQFPGNKLEWMGYIHYSGSTTYNPSLK SRISISRDTSKNQFFLQLNSVTTEDTATYYCARSLRYWGQGTTLTVSS (SEQ ID NO: 43) and a light chain including DIVMTQTPAIMSASPGQKVTITCSASSSVNYMHVVYQQKLGSSP KLWIYDTSKLAPG VPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSYPYTFGSGTKLEIK (SEQ ID NO: 44).
  • an anti-LHR binding agent includes a heavy chain including QVQLKESGPGLVAPSQSLSrrCTVSGFSLTTYGVSVVVRQPPGKGLEWLGVIWGDGSTYYHSAL ISRLSISKDNSKSQVFLKLNSLQTDDTATYYCAEGSSLFAYWGQGTLVTVS A (SEQ ID NO: 45) and a light chain including DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQ QKPGQPPKLLIYWASTRQSGVPDRFTGSGSGTDFTLTISSVQAEDXAVYYCQNDYSYPLTFGS GTKLEIK (SEQ ID NO: 46).
  • an anti-LHR binding agent includes a heavy chain including EVQLEQSGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTLHYA DTVKGRFTISRDNPKNTLFLQMKLPSLCYGLLGSRNLSHRLL (SEQ ID NO: 47) and a light chain including DIVLTQTPSSLSASLG DTITITCHASQN I NVWLFVVYQQKPGN I PKLLIYKASN LLTGVPSRFSGSGSG SGTGFTLTISSLQPEDIATYYCQQGQSFPVVTFGGGTKLEIK (SEQ ID NO: 48).
  • an anti-LHR binding agent includes a heavy chain including QVKLQQSG PELVKPGASVKI SCKASGYSFTGYYM HVVVKQSHG N I LDWIGYIYPYNGVSSYNQK FKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARERGLYQLRAMDYW GQGTSVTVSS (SEQ ID NO: 49) and a light chain including DIVLTQTPATLSVTPGDSVSLSCRASQ SISNNLHVVYQQKSHESPRLLI KNASQSISGI PSKFSGSGSGTDFTLRI NSVETEDFGMYFCQQS NSWPYTFGSGTKLEIK (SEQ ID NO: 50).
  • LH Agonists to Promote pHSC Expansion.
  • Particular embodiments include expanding LHR+ HSC1 and/or LHR+ HSC2 cells (or LHR+ LT-HSCs and/or LHR+ ST-HSCs mouse cells) by contacting the cells with an LH agonist to aid in the preparation of pHSC populations with sufficient numbers for a therapeutic use.
  • LH agonists include natural LH agonists and functional LH agonists.
  • Natural LH agonists can include the native mammalian LH.
  • the native mammalian LH is a gonadotropin secreted by the anterior lobe of the pituitary.
  • LH is a heterodimer including non-covalently bound alpha and beta subunits. The alpha subunit is common among LH, FSH and hCG, and the beta subunit is specific for each hormone.
  • the LH agonist is LH (see, for example, U.S. Pat. No. 5,444,167).
  • an LH agonist is recombinantly produced human LH.
  • an LH agonist includes the sequence: EHWSYGLRPG (SEQ ID NO: 51).
  • a natural LH agonist is a protein which (1) includes a polypeptide that shares at least 90% sequence identity to the native human LH; and (2) possesses the biological activity of the native mammalian LH.
  • a functional LH agonist is a compound that binds to and activates LHR, although it does not necessarily share at least 90% sequence identity with LH.
  • a functional LH agonist useful in the present disclosure may have the native alpha subunit, with the beta subunit having mutations.
  • the LH may have the native beta subunit, with the alpha subunit having mutations.
  • the functional LH agonist may also have both the alpha and beta subunit sharing a substantial sequence similarity with a native, corresponding subunit, but the entire sequence including less than 90% sequence identity with LH.
  • LH analogs include a deletional, insertional, or substitutional mutants of a native LH subunit.
  • LH orthologues encompass LH from other species and the naturally occurring variants thereof.
  • LH and human chorionic gonadotropin bind to the same LH receptor.
  • hCG is used clinically as a surrogate for LH.
  • fresh LH can be added to culture conditions on a daily basis, every other day, every third day, or every fourth day at a dose of, for example, 0.05, 0.5, 5, 50 and/or 500 nM.
  • Particular embodiments include expansion in culture conditions including StemSpan supplemented with penicillin/streptomycin and 50-150 ng/ml (e.g., 100 ng/ml) stem cell factor (SCF; also known as the c-kit ligand or mast cell growth factor), thrombopoietin (TPO) and Flt-3 ligand (Flt-3L).
  • SCF stem cell factor
  • TPO thrombopoietin
  • Flt-3 ligand Flt-3 ligand
  • Additional culture conditions can include expansion in the presence of one more growth factors, such as: angiopoietin-like proteins (Angptls, e.g., Angptl2, Angptl3, Angptl7, Angpt15, and Mfap4); erythropoietin; fibroblast growth factor-1 (FGF-1); granulocyte colony stimulating factor (G-CSF); granulocyte-macrophage colony stimulating factor (GM-CSF); insulin growth factor-2 (IFG-2); interleukin-3 (IL-3); interleukin-6 (IL-6); interleukin-7 (IL-7); interleukin-11 (IL-11); and analogs thereof (wherein the analogs include any structural variants of the growth factors having the biological activity of the naturally occurring growth factor; see, e.g., WO 2007/1145227 and U.S. Patent Publication No. 2010/0183564).
  • Angptls angiopoietin-like
  • the amount or concentration of growth factors suitable for expanding HSC is the amount or concentration effective to promote expansion of HSC, but substantially no differentiation of the HSC.
  • the amount or concentration of growth factors suitable for expanding HSC depends on the activity of the growth factor preparation, and the species correspondence between the growth factors and HSC, etc. Generally, when the growth factor(s) and HSC are of the same species, the total amount of growth factor in the culture medium ranges from 1 ng/ml to 5 ⁇ g/ml, from 5 ng/ml to 1 ⁇ g/ml, or from 5 ng/ml to 250 ng/ml. In additional embodiments, the amount of growth factors can be in the range of 5-1000 or 50-100 ng/ml.
  • the foregoing growth factors are present in the culture condition for expanding HSC at the following concentrations: 25-300 ng/ml SCF, 25-300 ng/ml Flt-3L, 25-100 ng/ml TPO, 25-100 ng/ml IL-6 and 10 ng/ml IL-3.
  • 50, 100, or 200 ng/ml SCF; 50, 100, or 200 ng/ml of Flt-3L; 50 or 100 ng/ml TPO; 50 or 100 ng/ml IL-6; and 10 ng/ml IL-3 can be used.
  • HSC expansion disclosed herein does not utilize an extracellular matrix protein such as fibronectin (FN), or a fragment thereof (e.g., CH-296 (Dao et. al., 1998, Blood 92(12):4612-21)) or RetroNectin® (a recombinant human fibronectin fragment; (Clontech Laboratories, Inc., Madison, WI).
  • FN extracellular matrix protein
  • RetroNectin® a recombinant human fibronectin fragment; (Clontech Laboratories, Inc., Madison, WI.
  • the culture system is a stroma-free culture system.
  • expansion results in (or more than) a 50-, 75-, 100- 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 1000-, 2000-, 3000-, 4000-, 5000-fold increase in the number of HSC in the expanded sample, relative to the unexpanded sample.
  • cell populations are also preferably expanded until a sufficient number of cells are obtained to provide for at least one infusion into a human subject, typically around 10 4 cells/kg to 10 9 cells/kg or 2 ⁇ 10 6 cells/kg subject body weight.
  • the methods disclosed herein do not induce neutropenia, thrombocytopenia and/or anemia and/or induces less neutropenia, thrombocytopenia and/or anemia than conditioning regimens currently used in the clinical setting.
  • the reduced side effects associated with HSC ablation methods disclosed herein can be especially beneficial for pediatric patients.
  • selective ablation of endogenous HSC can provide a treatment for malignancies associated with hyperproliferative HSC, such as leukemias, lymphomas, and myelomas.
  • Particular embodiments utilize LHR binding agents that result in ablation of LHR-expressing pHSC.
  • Particular embodiments include ablating pHSC within a niche. In mammals, endogenous HSC reside in the bone marrow, and thus ablative agents will reduce the numbers of pHSC resident in bone marrow.
  • “Ablate” and “ablation” generally refer to the partial or complete removal of a population of cells (e.g., HSC) from target tissues (e.g., bone marrow tissues of a subject).
  • target tissues e.g., bone marrow tissues of a subject.
  • such ablation includes a complete removal or depletion of such cells from the target tissue.
  • such ablation is a partial removal or depletion of such cells (e.g., HSCs) from the target tissue.
  • the methods disclosed herein result in at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97.5%, 98% or 99% depletion of pHSC.
  • ablation results in a pHSC reduction of at least 75%, at least 80% at least 90%, at least 95%, at least 99% or more.
  • LHR binding agents include anti-LHR antibodies conjugated to a toxin such as Saporin. As indicated previously, numerous anti-LHR antibodies are commercially available.
  • each antibody chain defines a constant region that can be responsible for effector function in vivo.
  • effector functions include: C1q binding and complement dependent cytotoxicity (CDC); antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptors); and B cell activation.
  • Antibodies of interest for ablation may be tested for their ability to induce ADCC.
  • Assays for apoptosis may be performed by the terminal deoxynucleotidyl transferase-mediated digoxigenin-11-dUTP nick end labeling (TUNEL) assay (Lazebnik et al., Nature: 371, 346 (1994)). Cytotoxicity may also be detected directly by detection kits known in the art, such as Cytotoxicity Detection Kit from Roche Applied Science (Indianapolis, Ind.).
  • the antibodies utilized within the present disclosure induce at least 10%, 20%, 30%, 40%, 50%, 60%, 80%, 90%, 95%, or 100% cytotoxicity of targeted pHSC.
  • Antibodies lacking fucose have been correlated with enhanced ADCC activity, especially at low doses of antibody.
  • Methods of preparing fucose-less antibodies include growth in rat myeloma YB2/0 cells (ATCC CRL 1662).
  • YB2/0 cells express low levels of FUT8 mRNA, which encodes an enzyme (a1,6-fucosyltransferase) necessary for fucosylation of polypeptides.
  • Alternative embodiments for promoting cytotoxicity of cells with antibody treatment include antibody-mediated stimulation of signaling cascades resulting in cell death to the antibody bound cell.
  • antibody-mediated stimulation of the innate immune system e.g. through NK cells
  • the antibody is of an isotype that can bind Fc receptors on macrophages and drive opsonization (Rashid et al., J. Immunol. 1992, 148:1382-1388).
  • the antibody is of an IgG isotype, e.g. IgG1, IgG2, IgG3, IgG4, etc.
  • the antibody is a rodent antibody of the IgG2b type.
  • the isotype is a human or humanized antibody of the IgG3 isotype (for review, see Davies and Metzger, Ann Rev Immunol 1983 1:87-117).
  • a candidate antibody is of an isotype that does not bind Fc receptors and/or drive opsonization
  • the antibody may be modified through various methods known in the art to change the isotype to one that does bind Fc receptors and/or drive opsonization.
  • human antibodies can be used.
  • a human antibody is one which includes an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences.
  • Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001) and Lonberg, Curr. Opin. Immunol. 20:450-459 (2008). Human antibodies may be prepared by administering LHR (or a fragment thereof) to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic mice, the endogenous immunoglobulin loci have generally been inactivated.
  • Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described. (See, e.g., Kozbor J. Immunol., 133: 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al., J. Immunol., 147: 86 (1991).) Human antibodies generated via human B-cell hybridoma technology are also described in Li et al., Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006).
  • Additional methods include those described, for example, in U.S. Pat. No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26(4):265-268 (2006) (describing human-human hybridomas).
  • Human hybridoma technology Trioma technology
  • Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) and Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3):185-91 (2005).
  • mice Traditional strategies for hybridoma development using mice, llamas, chicken, rats, hamsters, rabbits, etc. can also be used.
  • a “humanized” antibody refers to a chimeric antibody including amino acid residues from non-human CDRs and amino acid residues from human FRs.
  • a humanized antibody will include substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDRs correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
  • a humanized antibody optionally may include at least a portion of an antibody constant region derived from a human antibody.
  • a “humanized form” of an antibody, e.g., a non-human antibody refers to an antibody that has undergone humanization.
  • Human framework regions that may be used for humanization include: framework regions selected using the “best-fit” method (see, e.g., Sims et al., J. Immunol. 151:2296 (1993)); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al., Proc. Nati. Acad. Sci. USA, 89:4285 (1992); and Presta et al., J. Immunol., 151:2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci.
  • a human consensus framework is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin variable light (V L ) or variable heavy (V H ) framework sequences.
  • V L variable light
  • V H variable heavy
  • the subgroup of sequences can be a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda Md. (1991), vols. 1-3.
  • the subgroup is subgroup kappa I as in Kabat et al., supra.
  • the subgroup is subgroup III as in Kabat et al., supra.
  • antibody variants have been modified from a reference sequence to produce an administration benefit.
  • exemplary administration benefits can include (1) reduced susceptibility to proteolysis, (2) reduced susceptibility to oxidation, (3) altered binding affinity for forming protein complexes, (4) altered binding affinities, (5) reduced immunogenicity; and/or (6) extended half-live.
  • Fab and F(ab′) 2 fragments having increased in vivo half-life, see U.S. Pat. No. 5,869,046.
  • variants of anti-LHR antibodies can include those having one or more conservative amino acid substitutions or one or more non-conservative substitutions that do not adversely affect the binding of the antibody to LHR.
  • a V L region can include one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions), or a combination of the above-noted changes, when compared to an antibody produced and characterized according to methods disclosed herein.
  • An insertion, deletion or substitution may be anywhere in the V L region, including at the amino- or carboxy-terminus or both ends of this region, provided that each CDR includes zero changes or at most one, two, or three changes and provided an antibody including the modified V L region can still specifically bind LHR with an affinity similar to the reference antibody.
  • a V H region can be derived from or based on a disclosed V H and can include one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions or non-conservative amino acid substitutions), or a combination of the above-noted changes, when compared with when compared to an antibody produced and characterized according to methods disclosed herein.
  • one or more e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions or non-conservative amino acid substitutions), or a combination of the above-noted changes, when compared with when
  • An insertion, deletion or substitution may be anywhere in the V H region, including at the amino- or carboxy-terminus or both ends of this region, provided that each CDR includes zero changes or at most one, two, or three changes and provided an antibody including the modified V H region can still specifically bind its target epitope with an affinity similar to the reference antibody.
  • one or more amino acid modifications may be introduced into the Fc region of an antibody, thereby generating an Fc region variant.
  • the Fc region variant may include a human Fc region sequence (e.g., a human IgG1 (EPKSCDKTHTCPPCP (SEQ ID NO: 52)), IgG2 (ERKCCVECPPCP (SEQ ID NO: 53)), IgG3 (ELKTPLGDTHTCPRCP (SEQ ID NO: 54); or IgG4 (ESKYGPPCPSCP (SEQ ID NO: 55)) Fc region) including an amino acid modification (e.g. a substitution) at one or more amino acid positions.
  • Exemplary human IgG4 modifications include ESKYGPPCPPCP (SEQ ID NO: 56); YGPPCPPCP (SEQ ID NO: 57); KYGPPCPPCP (SEQ ID NO: 58); and EVVKYGPPCPPCP (SEQ ID NO: 59).
  • antibodies can be coupled to a toxin.
  • Toxins can include molecules that inactivate ribosomes, inhibit RNA polymerase II and/or III, and/or inhibits protein synthesis.
  • Toxins include anti-tubulin agents (e.g. maytansines) or tubulin inhibitors, DNA crosslinking agents, DNA alkylating agents and cell cycle or mitotic disrupters.
  • toxins include abrin A chain, abrin toxin, amatoxin (e.g., ⁇ -amanitin, ⁇ -amanitin, ⁇ -amanitin, £-amanitin, amanin, amaninamide, amanullin, amanullinic acid), auristatin-E, crotin, curcin, diphtheria A chain, diphtheria toxin, enomycin, exotoxin A chain, gelonin toxin, luffin toxin, modeccin toxin, momordin toxin, phenomycin, pseudomonas exotoxin A, radiochemicals (e.g., radioisotopes), Ricin A chain, saporin, and trichosanthin toxin. Particular embodiments utilize saporin.
  • amatoxin e.g., ⁇ -amanitin, ⁇ -amanitin, ⁇ -amanitin, £
  • the toxic agent is a selective inhibitor of growth factor signaling required for stem cell maintenance or growth.
  • agents are those that inhibit c-kit mediated signaling, which is required for maintenance of HSC.
  • agents include antibodies that bind to and interfere with c-kit signaling; and drugs that selectively inhibit c-kit signaling, e.g.
  • CAR-modified immune cells can also be used as LHR binding agents to target LHR-expressing pHSC for ablation.
  • immune cells e.g., T cells, natural killer cells
  • CAR chimeric antigen receptors
  • CAR refer to synthetically designed receptors including at least a binding domain that binds LHR and an effector domain and optionally a spacer domain and/or a transmembrane domain.
  • CAR-modified immune cells can mediate the ablation of cells bound by the CAR-binding domain.
  • CAR binding domains for LHR can be generated from the CDRs of existing or prepared anti-LHR antibodies and variants thereof as described above.
  • CAR binding domains can include the LH alpha subunit and the LH beta subunit.
  • Effector domains are capable of transmitting functional signals to an immune cell.
  • an effector domain will directly or indirectly promote a cellular response by associating with one or more other proteins that directly promote a cellular response.
  • Effector domains can provide for activation of at least one function of a transduced lymphocyte expressing the CAR upon binding to LHR expressed on a targeted HSC. Activation of the lymphocyte can include one or more of proliferation, differentiation, activation or other effector functions.
  • An effector domain may include one, two, three or more receptor signaling domains, intracellular signaling domains, costimulatory domains, or combinations thereof. Any intracellular effector domain, costimulatory domain or both from any of a variety of signaling molecules (e.g., signal transduction receptors) may be used in the CARs for purposes described herein.
  • signaling molecules e.g., signal transduction receptors
  • Exemplary effector domains include those from 4-1BB, CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , CD27, CD28, CD79A, CD79B, CARD11, DAP10, FcR ⁇ , FcR ⁇ , FcR ⁇ , Fyn, HVEM, ICOS, Lck, LAG3, LAT, LRP, NOTCH1, Wnt, NKG2D, OX40, ROR2, Ryk, SLAMF1, Slp76, pT ⁇ , TCR ⁇ , TCR ⁇ , TRIM, Zap70, PTCH2, or any combination thereof.
  • 4-1BB includes KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCR FPEEEEGGCEL (SEQ ID NO: 26).
  • Uniprot Q07011 provides 4-1BB including residues 1-23 (signal peptide); 24-186 (extracellular domain); 187-213 (transmembrane domain); and 214-255 (intracellular domain).
  • a CD28 signaling region includes MLRLLLALNLFPSIQ VTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQV YSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCP SPLFPGPSKPFVVVLVVVGGVLACYSLLVTVAFIIFVVVRSKRSRLLHSDYMNMTPRRPGPTRKH YQPYAPPRD FAAYRS (SEQ ID NO: 60).
  • Uniprot P10747 includes CD28 including residues 1-18 (signal peptide); 19-152 (extracellular domain); 153-179 (transmembrane domain); and 180-220 (intracellular domain) wherein residues 186 and 187 can be LL or GG.
  • a CD3 zeta signaling region includes RVKFSRSADA PAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEA YSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 27).
  • a CD3 zeta signaling region includes AKFSRSAETAANLQ DPNQLYNELN LGRREEYDVLEKKRARDPEMGGKQQRRRN PQEGVYNALQKDKMAEAYSEIG TKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLAPR (SEQ ID NO: 16).
  • Uniprot P20963 provides human CD3 zeta isoform 3 including residues 1-21 (signal peptide); 22-30 (extracellular domain); 31-51 (transmembrane domain); 52-164 (intracellular domain); 61-89 (ITAM1); 100-128 (ITAM2); and 131-159 (ITAM3).
  • T cell activation particularly can be said to be mediated by two distinct classes of cytoplasmic signaling sequence: those that initiate antigen-dependent primary activation and provide a T cell receptor like signal (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signaling sequences).
  • Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as receptor tyrosine-based activation motifs or iTAMs.
  • ITAM1 refers to APAYQQGQNQLYNELNLGRREEYDVLDKR (SEQ ID NO: 61); ITAM2 refers to PQRRKNPQEGLYNELQKDKMAEAYSEIGM (SEQ ID NO: 62); and ITAM3 refers to ERRRGKGHDGLYQGLSTATKDTYDALHMQ (SEQ ID NO: 63).
  • an effector domain includes a cytoplasmic portion that associates with a cytoplasmic signaling protein, wherein the cytoplasmic signaling protein is a lymphocyte receptor or signaling domain thereof, a protein including a plurality of ITAMs, a costimulatory factor, or any combination thereof.
  • intracellular signaling domains include the cytoplasmic sequences of the CD3 zeta chain, and/or co-receptors that act in concert to initiate signal transduction following CAR engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability.
  • an intracellular signaling domain of a CAR can be designed to include an intracellular signaling domain combined with any other desired cytoplasmic domain(s).
  • the intracellular signaling domain of a CAR can include an intracellular signaling domain and a costimulatory signaling region.
  • the costimulatory signaling region refers to a portion of the CAR including the intracellular domain of a costimulatory molecule.
  • a costimulatory molecule is a cell surface molecule other than the expressed marker ligand that is required for a response of lymphocytes to a marker.
  • examples of such molecules include CD27, CD28, 4-1BB (CD 137), OX40, CD30, CD40, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83.
  • CAR polynucleotides can include a sequence encoding for a spacer region.
  • the length of the spacer region can be customized to optimize LHR recognition.
  • a spacer length can be selected based upon the location of a marker epitope, affinity of an antibody for the epitope, and/or the ability of the lymphocytes expressing the CAR to proliferate in vivo in response to LHR recognition.
  • a spacer region is found between the binding domain and a transmembrane domain of the CAR. Spacer regions can provide for flexibility of the binding domain and allows for high expression levels in the modified cells.
  • a spacer region can have at least 10 to 250 amino acids, at least 10 to 200 amino acids, at least 10 to 150 amino acids, at least 10 to 100 amino acids, at least 10 to 50 amino acids or at least 10 to 25 amino acids and including any integer between the endpoints of any of the listed ranges.
  • a spacer region has 250 amino acids or less; 200 amino acids or less, 150 amino acids or less; 100 amino acids or less; 50 amino acids or less; 40 amino acids or less; 30 amino acids or less; 20 amino acids or less; or 10 amino acids or less.
  • spacer regions can be derived from a hinge region of an immunoglobulin like molecule, for example all or a portion of the hinge region from a human IgG1, human IgG2, a human IgG3, or a human IgG4.
  • a hinge region includes a CD8 hinge and/or a CD28 hinge.
  • An exemplary hinge sequence derived from the IgG1 heavy chain is encoded by CTCGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCG (SEQ ID NO: 64).
  • CD8 hinge domains include AAASTTTKPVLRTPSPVHPTGTSQPQRPEDC RPRGSVKGTGLDFACDIY (SEQ ID NO: 13); PAKPTTTPAPRPPTPAPTIASQP LSLRPEACRPAAGGAVHTRGLDFACDIY (SEQ ID NO: 65); KVNSTTTKPVLRTPSPV HPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY (SEQ ID NO: 66); and PVKPTTTPAPR PPTQAPITTSQRVSLRPGTCQPSAGST VEASGLDLSCDIY (SEQ ID NO: 67).
  • An exemplary CD28 hinge includes AAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFP GPSKP (SEQ ID NO: 24).
  • Hinge regions can be modified to avoid undesirable structural interactions such as dimerization.
  • all or a portion of a hinge region can be combined with one or more domains of a constant region of an immunoglobulin.
  • a portion of a hinge region can be combined with all or a portion of a CH2 or CH3 domain or variant thereof.
  • An example of an intermediate length spacer including an IgG4 hinge and a CH3 region includes ESKYGPPCPPCPGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSD IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY TQKSLSLSLGK (SEQ ID NO: 68).
  • An example of a longer spacer including an IgG4 hinge and a CH3 region includes ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTP EVTCVVVDVSQEDPEVQFNVVYVDGVEVH NAKTKPREEQFNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQK SLSLSLGK (SEQ ID NO: 69).
  • Uniprot P0861 includes a IgG4-Fc with residues 1-98 (CH1), 99-110 (hinge), 111-220 (CH2), 221-327 (CH3) wherein residue 108 can be S or P.
  • CARs disclosed herein can also include transmembrane domains.
  • the CAR polynucleotide encodes the transmembrane domain.
  • the transmembrane domain provides for anchoring of the CAR in a lymphocyte membrane.
  • the transmembrane domain may be derived either from a natural or a synthetic source. When the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
  • Transmembrane regions include at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD8, CD28, CD3, CD45, CD4, CD6, CD9, CD16, CD22; CD33, CD37, CD64, CD80, CD86, CD134, CD137 and CD154.
  • the CD8 transmembrane domain includes IWAPLAGICVALLLSLIITLI (SEQ ID NO: 14); IYIWAPLAGTCGVLLLSLVIT (SEQ ID NO: 70); or IWAPLAGICAVLLLSLVITLI (SEQ ID NO: 71).
  • the CD28 transmembrane domain includes FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 25).
  • synthetic or variant transmembrane domains include predominantly hydrophobic residues such as leucine and valine.
  • CAR can also include linkers, tags, reporters, and/or expression modulators.
  • a linker can be an amino acid sequence having from one up to 500 amino acids, which can provide flexibility and room for conformational movement between two regions, domains, motifs, cassettes or modules connected by the linker.
  • Exemplary linker sequences include those having from one to ten repeats of Gly x Ser y , wherein x and y are independently an integer from 0 to 10 provided that x and y are not both 0 (e.g., (Gly 4 Ser) 3 (SEQ ID NO: 10), (Gly 3 Ser) 2 (SEQ ID NO: 72), Gly 2 Ser, or a combination thereof such as (Gly 3 Ser) 2 Gly 2 Ser)(SEQ ID NO: 73).
  • a linker sequence can include one or more immunoglobulin heavy chain constant regions, such as a CH3 alone or a CH2CH3 sequence.
  • a CH2 sequence includes APEFLGGPS
  • VFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNVVYVDGVEVHNAKTKPREEQFNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAK (SEQ ID NO: 74) and a CH3 sequence includes
  • Exemplary tags include Myc tag (EQKLISEEDL (SEQ ID NO:12)), Strep tag (which refers the original STREP® tag (WRHPQFGG (SEQ ID NO: 76)), STREP TAG® II (WSHPQFEK (SEQ ID NO: 77)), or any variant thereof; see, e.g., U.S. Pat. No.
  • Particular embodiments can include 2A (GTGQCTNYALLKLAGDVESNPGPGS (SEQ ID NO: 17)); T2A (LEGGGEGRGSLLTCGDVEENPGPR (SEQ ID NO: 86)); T2A (GSG)EGRGSLLTCGD VEENPGP (SEQ ID NO: 87); P2A (GSG)ATNFSLLKQAGDVEENPGP (SEQ ID NO: 88); E2A (GSG) QCTNYALLKLAGDVESNPGPP (SEQ ID NO: 89); and F2A (GSG)VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 90).
  • FIG. 13 A SEQ ID NO: 7
  • FIG. 13 B SEQ ID NO: 20
  • FIG. 13 A SEQ ID NO: 6
  • FIG. 13 B SEQ ID NO: 19
  • pHSC populations enriched or expanded according to a method disclosed herein to express a CAR.
  • the pHSC populations differentiate into a more committed cell line before or after the modification.
  • the pHSC populations differentiate into a more committed cell line before or after administration to a subject.
  • T cells are genetically modified to express CAR.
  • T cells can refer to all types of immune cells expressing CD3 including T-helper cells (CD4+ cells), cytotoxic T-cells (CD8+ cells), natural killer T-cells, T-regulatory cells (Treg) and gamma-delta T cells.
  • CD4+ cells T-helper cells
  • CD8+ cells cytotoxic T-cells
  • Treg T-regulatory cells
  • gamma-delta T cells gamma-delta T cells.
  • T cell types such as CD4+ T cells and CD8+ T cells.
  • T cells are derived from a pHSC population enriched or expanded according to a method disclosed herein.
  • T cells modified to express a CAR are obtained from a subject who will receive the modified T cells as a treatment.
  • T cells are autologous T cells.
  • T cells include autologous and allogeneic primary patient cells.
  • T-cell lines examples include lines BCL2 (AAA) Jurkat (ATCC® CRL-2902TM), BCL2 (S70A) Jurkat (ATCC® CRL-2900TM), BCL2 (S87A) Jurkat (ATCC® CRL-2901TM), BCL2 Jurkat (ATCC® CRL-2899TM), Neo Jurkat (ATCC® CRL-2898TM), TALL-104 cytotoxic human T cell line (ATCC #CRL-11386).
  • T-cell lines e.g., such as Deglis, EBT-8, HPB-MLp-W, HUT 78, HUT 102, Karpas 384, Ki 225, My-La, Se-Ax, SKW-3, SMZ-1 and T34; and immature T-cell lines, e.g., ALL-SIL, Be13, CCRF-CEM, CML-T1, DND-41, DU.528, EU-9, HD-Mar, HPB-ALL, H-SB2, HT-1, JK-T1, Jurkat, Karpas 45, KE-37, KOPT-K1, K-T1, L-KAW, Loucy, MAT, MOLT-1, MOLT 3, MOLT-4, MOLT 13, MOLT-16, MT-1, MT-ALL, P12/Ichikawa, Peer, PER0117, PER-255, PF-382, PFI-285, RPMI-8402, ST-4, SUP-T1 to T14, TALL-1
  • NK cells are activated in response to interferons or macrophage-derived cytokines. They serve to contain viral infections while the adaptive immune response is generating antigen-specific cytotoxic T cells that can clear the infection.
  • NK cells express CD8, CD16 and CD56 but do not express CD3.
  • NK cells are genetically modified to express CAR.
  • NK cells are derived from a pHSC population enriched or expanded according to a method disclosed herein.
  • NK cells modified to express a CAR are obtained from a subject who will receive the modified NK cells as a treatment.
  • NK cells are autologous NK cells.
  • NK cells include autologous and allogeneic primary patient cells.
  • NK cell lines examples include lines NK-92 (ATCC® CRL-2407TM), NK-92MI (ATCC® CRL-2408TM), HANK1, KHYG-1, NKL, NK-YS, NOI-90, and YT.
  • Particular embodiments may also utilize mixtures of pHSC, HSC, HSPC, T cells, and/or NK cells.
  • some cells within a mixture are genetically modified and some are not.
  • some classes of cells within a mixture are genetically modified and other classes are not.
  • particular embodiments include use of an antibody directed against LHR wherein the antibody is conjugated to a toxin to clear HSCs from a niche.
  • Particular embodiments include use of a CAR immune cell directed against LHR. HSC clearance from a niche improves subsequent engraftment of therapeutically-administered HSC.
  • the present disclosure combines the use of selective ablation of endogenous HSC, in combination with the administration to the recipient of exogenous therapeutic HSC, resulting in efficient, long-term engraftment and tolerance.
  • exogenous HSC are introduced to the patient, where the exogenous HSC occupy the same niche as the ablated endogenous HSC.
  • Exogenous HSC may be autologous, allogeneic, or xenogeneic relative to the patient.
  • the period of time required for clearance of the ablative agent may be empirically determined, or may be based on prior experience of the pharmacokinetics of the agent. Where the agent is an antibody, determination can be conveniently monitored by containing HSC with recipient serum, and determining the presence of antibodies that bind to the HSC. Alternatively, patient serum may be monitored for the presence of HSC selective growth inhibition.
  • the time for clearance is usually the time sufficient for the level of ablative agent to decrease at least 10-fold from peak levels, usually at least 100-fold, 1000-fold, 10,000-fold, or more. It is preferable to introduce the therapeutic HSC within the empty niche “window” following ablation, usually within 3 days, 2 days, 1 day, or at the time of clearance.
  • HSC are administered to the subject after the ablative agent has cleared or dissipated from the subject's target tissues such that the level of ablative agent remaining in the target tissue of the subject does not induce significant cell death in the transplanted HSC population.
  • the HSC population is administered to the subject two to eighteen days after the administration of the ablative agent.
  • administered HSC can be genetically-modified or non-genetically modified.
  • the following discussion of methods to genetically-modify HSC for a therapeutic purpose can also apply to genetically-modifying immune cells to express CAR.
  • administered HSC may be genetically altered in order to introduce genes useful in the differentiated cell, e.g. repair of a genetic defect in an individual, selectable marker, etc., or genes useful in selection against undifferentiated cells.
  • Cells may also be genetically modified to enhance survival, control proliferation, and the like.
  • Cells may be genetically altered by transfection or transduction with a suitable vector, homologous recombination, or other appropriate technique, so that they express a gene of interest.
  • cells are transfected with genes encoding a telomerase catalytic component (TERT), typically under a heterologous promoter that increases telomerase expression beyond what occurs under the endogenous promoter, (see International Patent Application WO 98/14592).
  • TERT telomerase catalytic component
  • a selectable marker is introduced, to provide for greater purity of the desired differentiating cell.
  • Cells may be genetically altered using vector containing supernatants over an 8-16 h period, and then exchanged into growth medium for 1-2 days. Genetically altered cells are selected using a drug selection agent such as puromycin, G418, or blasticidin, and then recultured.
  • a drug selection agent such as puromycin, G418, or blasticidin
  • the technique should provide for the stable transfer of nucleic acid to the cell, so that the nucleic acid is expressible by the cell and preferably heritable and expressible by its cell progeny.
  • Exemplary methods include transfection, electroporation, microinjection, liposomes/lipofection (Tarahovsky and lvanitsky, 1998, Biochemistry (Mosc) 63:607-618), ribozymes (Branch and Klotman, 1998, Exp. Nephrol. 6:78-83), calcium phosphate mediated transfection, infection with a viral or bacteriophage vector containing the gene sequences, cell fusion, chromosome-mediated gene transfer, microcell-mediated gene transfer, sheroplast fusion, administration of naked DNA, DNA complexes and/or triplex DNA (Chan and Glazer, 1997, J. Mol. Med. 75:267-282), transposons/transposases, etc.
  • a “vector” is a nucleic acid molecule that is capable of transporting another nucleic acid.
  • Vectors may be, e.g., viruses, phage, a DNA vector, a RNA vector, a viral vector, a bacterial vector, a plasmid vector, a cosmid vector, and an artificial chromosome vector.
  • An “expression vector” is any type of vector that is capable of directing the expression of a protein encoded by one or more genes carried by the vector when it is present in the appropriate environment.
  • Viral vectors are usually non-replicating or replication-impaired vectors, which means that the viral vector cannot replicate to any significant extent in normal cells (e.g., normal human cells), as measured by conventional means (e.g. via measuring DNA synthesis and/or viral titer).
  • Non-replicating or replication-impaired vectors may have become so naturally (i.e., they have been isolated as such from nature) or artificially (e.g., by breeding in vitro or by genetic manipulation).
  • MVA modified vaccinia Ankara
  • viral vectors are incapable of causing a significant infection in a subject, typically in a mammalian subject.
  • Retroviruses are viruses having an RNA genome.
  • a retroviral vector contains all of the cis-acting sequences necessary for the packaging and integration of the viral genome, i.e., (a) a long terminal repeat (LTR), or portions thereof, at each end of the vector; (b) primer binding sites for negative and positive strand DNA synthesis; and (c) a packaging signal, necessary for the incorporation of genomic RNA into virions. More detail regarding retroviral vectors can be found in Boesen, et al., 1994, Biotherapy 6:291-302; Clowes, et al., 1994, J. Clin. Invest.
  • LTR long terminal repeat
  • “Gammaretroviruses” refers to a genus of the retroviridae family. Exemplary gammaretroviruses include mouse stem cell virus, murine leukemia virus, feline leukemia virus, feline sarcoma virus, and avian reticuloendotheliosis viruses.
  • Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), simian immunodeficiency virus (SIV), human immunodeficiency virus (HIV), and combinations thereof (see, e.g., Buchscher et al., J. Virol. 66:2731-2739, 1992; Johann et al., J. Virol. 66:1635-1640, 1992; Sommerfelt et al., Virol. 176:58-59, 1990; Wilson et al., J. Virol. 63:2374-2378, 1989; Miller et al., J. Virol. 65:2220-2224, 1991; and PCT/US94/05700).
  • MiLV murine leukemia virus
  • GaLV gibbon ape leukemia virus
  • SIV simian immunodeficiency virus
  • HAV human immunodeficiency virus
  • lentiviral vectors refers to a genus of retroviruses that are capable of infecting dividing and non-dividing cells and typically produce high viral titers. Lentiviral vectors have been employed in gene therapy for a number of diseases. For example, hematopoietic gene therapies using lentiviral vectors or gamma retroviral vectors have been used for x-linked adrenoleukodystrophy and beta thalassaemia. See, e.g., Kohn et al., Clin. Immunol. 135:247-54, 2010; Cartier et al., Methods Enzymol.
  • HIV human immunodeficiency virus: including HIV type 1, and HIV type 2
  • equine infectious anemia virus feline immunodeficiency virus (FIV); bovine immune deficiency virus (BIV); and simian immunodeficiency virus (SIV).
  • HIV human immunodeficiency virus: including HIV type 1, and HIV type 2
  • equine infectious anemia virus feline immunodeficiency virus (FIV)
  • bovine immune deficiency virus BIV
  • SIV simian immunodeficiency virus
  • retroviral vectors can be used in the practice of the methods disclosed herein. These include, e.g., vectors based on human foamy virus (HFV) or other viruses in the Spumavirus genera.
  • HBV human foamy virus
  • FVes Foamy viruses
  • FVes are the largest retroviruses known today and are widespread among different mammals, including all non-human primate species, however are absent in humans. This complete apathogenicity qualifies FV vectors as ideal gene transfer vehicles for genetic therapies in humans and clearly distinguishes FV vectors as gene delivery system from HIV-derived and also gammaretrovirus-derived vectors.
  • FV vectors are suitable for gene therapy applications because they can (1) accommodate large transgenes (>9 kb), (2) transduce slowly dividing cells efficiently, and (3) integrate as a provirus into the genome of target cells, thus enabling stable long term expression of the transgene(s).
  • FV vectors do need cell division for the pre-integration complex to enter the nucleus, however the complex is stable for at least 30 days and still infective.
  • the intracellular half-life of the FV pre-integration complex is comparable to the one of lentiviruses and significantly higher than for gammaretroviruses, therefore FV are also—similar to LV vectors—able to transduce rarely dividing cells.
  • FV vectors are natural self-inactivating vectors and characterized by the fact that they seem to have hardly any potential to activate neighboring genes. In addition, FV vectors can enter any cells known (although the receptor is not identified yet) and infectious vector particles can be concentrated 100-fold without loss of infectivity due to a stable envelope protein. FV vectors achieve high transduction efficiency in HSC and have been used in animal models to correct monogenetic diseases such as leukocyte adhesion deficiency (LAD) in dogs and Fanconi anemia in mice. FV vectors are also used in preclinical studies of ⁇ -thalassemia.
  • LAD leukocyte adhesion deficiency
  • viral vectors include those derived from adenoviruses (e.g., adenovirus 5 (Ad5), adenovirus 35 (Ad35), adenovirus 11 (Ad11), adenovirus 26 (Ad26), adenovirus 48 (Ad48) or adenovirus 50 (Ad50)), adeno-associated virus (AAV; see, e.g., U.S. Pat. No. 5,604,090; Kay et al., Nat. Genet.
  • adenoviruses e.g., adenovirus 5 (Ad5), adenovirus 35 (Ad35), adenovirus 11 (Ad11), adenovirus 26 (Ad26), adenovirus 48 (Ad48) or adenovirus 50 (Ad50)
  • AAV adeno-associated virus
  • alphaviruses cytomegaloviruses (CMV), flaviviruses, herpes viruses (e.g., herpes simplex), influenza viruses, papilloma viruses (e.g., human and bovine papilloma virus; see, e.g., U.S. Pat. No. 5,719,054), poxviruses, vaccinia viruses, etc.
  • CMV cytomegaloviruses
  • flaviviruses e.g., herpes simplex
  • influenza viruses e.g., papilloma viruses (e.g., human and bovine papilloma virus; see, e.g., U.S. Pat. No. 5,719,054)
  • poxviruses vaccinia viruses, etc.
  • chromosome vectors such as mammalian artificial chromosomes (Vos, 1998, Curr. Op. Genet. Dev. 8:351-359) and yeast artificial chromosomes (YAC).
  • YAC yeast artificial chromosomes
  • YAC are typically used when the inserted nucleic acids are too large for more conventional vectors (e.g., greater than 12 kb).
  • Vectors and other methods to deliver nucleic acids can include regulatory sequences to control the expression of the nucleic acid molecules.
  • These regulatory sequences can be eukaryotic or prokaryotic in nature.
  • the regulatory sequence can be a tissue specific promoter such that the expression of the one or more therapeutic proteins will be substantially greater in the target tissue type compared to other types of tissue.
  • the regulatory sequence can result in the constitutive expression of the one or more therapeutic proteins or CAR upon entry of the vector into the cell.
  • the regulatory sequences can include inducible sequences. Inducible regulatory sequences are well known to those skilled in the art and are those sequences that require the presence of an additional inducing factor to result in expression of the one or more therapeutic proteins or CAR.
  • Suitable regulatory sequences include binding sites corresponding to tissue-specific transcription factors based on endogenous nuclear proteins, sequences that direct expression in a specific cell type, the lac operator, the tetracycline operator and the steroid hormone operator. Any inducible regulatory sequence known to those of skill in the art may be used.
  • the nucleic acid is stably integrated into the genome of a cell.
  • the nucleic acid is stably maintained in a cell as a separate, episomal segment.
  • the efficiency of integration, the size of the DNA sequence that can be integrated, and the number of copies of a DNA sequence that can be integrated into a genome can be improved by using transposons.
  • Transposons or transposable elements include a short nucleic acid sequence with terminal repeat sequences upstream and downstream.
  • Active transposons can encode enzymes that facilitate the excision and insertion of nucleic acid into a target DNA sequence.
  • transposable elements have been described in the art that facilitate insertion of nucleic acids into the genome of vertebrates, including humans. Examples include sleeping beauty (e.g., derived from the genome of salmonid fish); piggyback (e.g., derived from lepidopteran cells and/or the Myotis lucifugus); mariner (e.g., derived from Drosophila); frog prince (e.g., derived from Rana pipiens); Tol2 (e.g., derived from medaka fish); TcBuster (e.g., derived from the red flour beetle Tribolium castaneum) and spinON.
  • CRISPR-Cas systems may also be used.
  • Gene editing technologies such as CRISPR-Cas; CRISPR-Cpf1; megaTALs, TALENs, or zinc finger nucleases may also be used.
  • approaches that facilitate homology-directed repair (HDR) should be adopted (e.g., homology arms).
  • nucleic acid including a therapeutic gene or CAR can be introduced into cells disclosed herein.
  • the term “gene” refers to a nucleic acid sequence (used interchangeably with polynucleotide or nucleotide sequence) that encodes one or more therapeutic proteins or CAR as described herein. This definition includes various sequence polymorphisms, mutations, and/or sequence variants wherein such alterations do not substantially affect the function of the encoded one or more therapeutic proteins or CAR.
  • the term “gene” may include not only coding sequences but also regulatory regions such as promoters, enhancers, and termination regions. The term further can include all introns and other DNA sequences spliced from the mRNA transcript, along with variants resulting from alternative splice sites.
  • Gene sequences encoding the molecule can be DNA or RNA that directs the expression of the one or more therapeutic proteins or CAR. These nucleic acid sequences may be a DNA strand sequence that is transcribed into RNA or an RNA sequence that is translated into protein. The nucleic acid sequences include both the full-length nucleic acid sequences as well as non-full-length sequences derived from the full-length protein. The sequences can also include degenerate codons of the native sequence or sequences that may be introduced to provide codon preference in a specific cell type.
  • a gene sequence encoding one or more therapeutic proteins or CAR can be readily prepared by synthetic or recombinant methods from the relevant amino acid sequence.
  • the gene sequence encoding any of these sequences can also have one or more restriction enzyme sites at the 5′ and/or 3′ ends of the coding sequence in order to provide for easy excision and replacement of the gene sequence encoding the sequence with another gene sequence encoding a different sequence.
  • the gene sequence encoding the sequences can be codon optimized for expression in mammalian cells.
  • a gene can be selected to provide a therapeutically effective response against a condition that, in particular embodiments, is inherited.
  • the condition can be Grave's Disease, rheumatoid arthritis, pernicious anemia, Multiple Sclerosis (MS), inflammatory bowel disease, systemic lupus erythematosus (SLE), adenosine deaminase deficiency (ADA-SCID) or severe combined immunodeficiency disease (SCID), Wiskott-Aldrich syndrome (WAS), chronic granulomatous disease (CGD), Fanconi anemia (FA), Battens disease, adrenoleukodystrophy (ALD) or metachromatic leukodystrophy (MLD), muscular dystrophy, pulmonary aveolar proteinosis (PAP), pyruvate kinase deficiency, Shwachmann-Diamond-Blackfan anemia, dyskeratosis congenita, cystic steasis,
  • the therapeutic gene may be a gene that encodes a protein and/or a gene whose function has been interrupted.
  • exemplary therapeutic gene and gene products include: soluble CD40; CTLA; Fas L; antibodies to CD4, CD5, CD7, CD52, etc.; antibodies to IL1, 1L2, 1L6; an antibody to TCR specifically present on autoreactive T cells; IL4; IL10; 1L12; 1L13; IL1Ra, sIL1RI, sIL1R11; sTNFRI; sTNFRII; antibodies to TNF; P53, PTPN22, and DRB1*1501/DQB1*0602; globin family genes; WAS; phox; FANC family genes; dystrophin; pyruvate kinase; CLN3; ABCD1; arylsulfatase A; SFTPB; SFTPC; NLX2.1; ABCA3; GATA1; ribosomal protein genes
  • Therapeutically effective amounts may provide function to immune and other blood cells and/or microglial cells or may alternatively—depending on the treated condition—inhibit lymphocyte activation, induce apoptosis in lymphocytes, eliminate various subsets of lymphocytes, inhibit T cell activation, eliminate or inhibit autoreactive T cells, inhibit Th-2 or Th-1 lymphocyte activity, antagonize 11_1 or TNF, reduce inflammation, induce selective tolerance to an inciting agent, reduce or eliminate an immune-mediated condition; and/or reduce or eliminate a symptom of the immune-mediated condition.
  • Therapeutic effective amounts may also provide functional DNA repair mechanisms; surfactant protein expression; telomere maintenance; lysosomal function; breakdown of lipids or other proteins such as amyloids; permit ribosomal function; and/or permit development of mature blood cell lineages which would otherwise not develop such as macrophages other white blood cell types.
  • a gene can be selected to provide a therapeutically effective response against diseases related to red blood cells and clotting.
  • the disease is a hemoglobinopathy like thalassemia, or a sickle cell disease/trait.
  • the therapeutic gene may be, for example, a gene that induces or increases production of hemoglobin; induces or increases production of beta-globin, or alpha-globin; or increases the availability of oxygen to cells in the body.
  • the therapeutic gene may be, for example, HBB or CYB5R3.
  • Exemplary effective treatments may, for example, increase blood cell counts, improve blood cell function, or increase oxygenation of cells in patients.
  • the disease is hemophilia.
  • the therapeutic gene may be, for example, a gene that increases the production of coagulation/clotting factor VIII or coagulation/clotting factor IX, causes the production of normal versions of coagulation factor VIII or coagulation factor IX, a gene that reduces the production of antibodies to coagulation/clotting factor VIII or coagulation/clotting factor IX, or a gene that causes the proper formation of blood clots.
  • Exemplary therapeutic genes include F8 and F9.
  • Exemplary effective treatments may, for example, increase or induce the production of coagulation/clotting factors VIII and IX; improve the functioning of coagulation/clotting factors VIII and IX, or reduce clotting time in subjects.
  • a gene can be selected to provide a therapeutically effective response against a lysosomal storage disorder.
  • the lysosomal storage disorder is mucopolysaccharidosis (MPS), type I; MPS II or Hunter Syndrome; MPS III or Sanfilippo syndrome; MPS IV or Morquio syndrome; MPS V; MPS VI or Maroteaux-Lamy syndrome; MPS VII or sly syndrome; alpha-mannsidosis; beta-mannosidosis; glycogen storage disease type I, also known as GSDI, von Gierke disease, or Tay Sachs; Pompe disease; Gaucher disease; or Fabry disease.
  • MPS mucopolysaccharidosis
  • the therapeutic gene may be, for example a gene encoding or inducing production of an enzyme, or that otherwise causes the degradation of mucopolysaccharides in lysosomes.
  • exemplary therapeutic genes include IDUA or iduronidase, IDS, GNS, HGSNAT, SGSH, NAGLU, GUSB, GALNS, GLB1, ARSB, and HYAL1.
  • Exemplary effective genetic therapies for lysosomal storage disorders may, for example, encode or induce the production of enzymes responsible for the degradation of various substances in lysosomes; reduce, eliminate, prevent, or delay the swelling in various organs, including the head (exp.
  • Macrosephaly the liver, spleen, tongue, or vocal cords; reduce fluid in the brain; reduce heart valve abnormalities; prevent or dilate narrowing airways and prevent related upper respiratory conditions like infections and sleep apnea; reduce, eliminate, prevent, or delay the destruction of neurons, and/or the associated symptoms.
  • a gene can be selected to provide a therapeutically effective response against a hyperproliferative disease.
  • the hyperproliferative disease is cancer.
  • the therapeutic gene may be, for example, a tumor suppressor gene, a gene that induces apoptosis, a gene encoding an enzyme, a gene encoding an antibody, or a gene encoding a hormone.
  • Exemplary therapeutic genes and gene products include 101F6, 123F2 (RASSF1), 53BP2, abl, ABLI, ADP, aFGF, APC, ApoAl, ApoAlV, ApoE, ATM, BAI-1, BDNF, Beta*(BLU), bFGF, BLC1, BLC6, BRCA1, BRCA2, CBFA1, CBL, C-CAM, CFTR, CNTF, COX-1, CSFIR, CTS-1, cytosine deaminase, DBCCR-1, DCC, Dp, DPC-4, E1A, E2F, EBRB2, erb, ERBA, ERBB, ETS1, ETS2, ETV6, Fab, FCC, FGF, FGR, FHIT, fms, FOX, FUS 1, FUS1, FYN, G-CSF, GDAIF, Gene 21 (NPRL2), Gene 26 (CACNA2D2), GM-CSF, GMF, gsp, H
  • a gene can be selected to provide a therapeutically effective response against an infectious disease.
  • the infectious disease is human immunodeficiency virus (HIV).
  • the therapeutic gene may be, for example, a gene rendering immune cells resistant to HIV infection, or which enables immune cells to effectively neutralize the virus via immune reconstruction, polymorphisms of genes encoding proteins expressed by immune cells, genes advantageous for fighting infection that are not expressed in the patient, genes encoding an infectious agent, receptor or coreceptor; a gene encoding ligands for receptors or coreceptors; viral and cellular genes essential for viral replication including; a gene encoding ribozymes, antisense RNA, small interfering RNA (siRNA) or decoy RNA to block the actions of certain transcription factors; a gene encoding dominant negative viral proteins, intracellular antibodies, intrakines and suicide genes.
  • siRNA small interfering RNA
  • Exemplary therapeutic genes and gene products include ⁇ 2 ⁇ 1; ⁇ v ⁇ 3; ⁇ v ⁇ 5; ⁇ v ⁇ 63; BOB/GPR15; Bonzo/STRL-33/TYMSTR; CCR2; CCR3; CCR5; CCR8; CD4; CD46; CD55; CXCR4; aminopeptidase-N; HHV-7; ICAM; ICAM-1; PRR2/HveB; HveA; ⁇ -dystroglycan; LDLR/ ⁇ 2MR/LRP; PVR; PRR1/HveC; and laminin receptor.
  • a therapeutically effective amount for the treatment of HIV may increase the immunity of a subject against HIV, ameliorate a symptom associated with AIDS or HIV, or induce an innate or adaptive immune response in a subject against HIV.
  • An immune response against HIV may include antibody production and result in the prevention of AIDS and/or ameliorate a symptom of AIDS or HIV infection of the subject, or decrease or eliminate HIV infectivity and/or virulence.
  • methods disclosed herein include enriching for/isolating, expanding, ablating and/or modifying cells for treating subjects (humans, veterinary animals (dogs, cats, reptiles, birds, etc.), livestock (horses, cattle, goats, pigs, chickens, etc.).
  • human subjects are pediatric.
  • Treating subjects includes delivering therapeutically effective amounts.
  • Therapeutically effective amounts include those that provide effective amounts, prophylactic treatments, and/or therapeutic treatments.
  • an “effective amount” is the number of cells necessary to result in a desired physiological change in a subject. Effective amounts are often administered for research purposes.
  • a “prophylactic treatment” includes a treatment administered to a subject who does not display signs or symptoms of a condition to be treated or displays only early signs or symptoms of the condition to be treated such that treatment is administered for the purpose of diminishing, preventing, or decreasing the risk of developing the condition.
  • a prophylactic treatment functions as a preventative treatment against a condition.
  • a “therapeutic treatment” includes a treatment administered to a subject who displays symptoms or signs of a condition and is administered to the subject for the purpose of reducing the severity or progression of the condition.
  • the actual dose amount administered to a particular subject can be determined by a physician, veterinarian, or researcher taking into account parameters such as physical and physiological factors including target; body weight; type of condition; severity of condition; upcoming relevant events, when known; previous or concurrent therapeutic interventions; idiopathy of the subject; and route of administration, for example.
  • parameters such as physical and physiological factors including target; body weight; type of condition; severity of condition; upcoming relevant events, when known; previous or concurrent therapeutic interventions; idiopathy of the subject; and route of administration, for example.
  • in vitro and in vivo assays can optionally be employed to help identify optimal dosage ranges.
  • Therapeutically effective amounts to administer can include greater than 10 2 cells, greater than 10 3 cells, greater than 10 4 cells, greater than 10 5 cells, greater than 10 6 cells, greater than 10 7 cells, greater than 10 8 cells, greater than 10 9 cells, greater than 10 10 cells, or greater than 10 11 .
  • a minimum dose is 2 ⁇ 10 6 cells/kg subject body weight.
  • the methods and compositions disclosed herein ablate pHSC within a subject.
  • the methods and compositions disclosed herein ablate pHSC within a subject as part of a non-genotoxic conditioning regimen.
  • the non-genotoxic conditioning regimen precedes an HSC transplant in the subject and/or the infusion of genetically-modified cells into the subject.
  • the subject is a human pediatric subject receiving the HSC transplant and/or the infusion of genetically-modified cells.
  • a composition including HSC is administered to a patient following selective ablation as described elsewhere herein.
  • administration of HSC cause an increase in granulocyte colony stimulating factor (GCSF).
  • GCSF granulocyte colony stimulating factor
  • MCSF macrophage colony stimulating factor
  • administration of HSC cause an increase in endogenous myeloid cells.
  • hematopoietic recovery includes recovery of white blood cells. In particular embodiments, hematopoietic recovery includes recovery of lymphocytes. In particular embodiments, hematopoietic recovery includes recovery of myeloid cells.
  • hematopoietic recovery includes improvement in one or more complete blood count measures.
  • improvement in blood count measure includes an increase in hemoglobin level, an increase in hematocrit level, an increase in red blood cell number, and combinations thereof.
  • hematopoietic recovery includes an increase in bone marrow cellularity.
  • CBC Complete blood count
  • FBC full blood count
  • blood panel is a test panel typically ordered by medical professionals that provides information about the cell types and numbers in a patient's blood.
  • a “complete blood count measure” includes measurement of total white cells, total red cells, hemoglobin, hematocrit, mean corpuscular volume, mean corpuscular hemoglobin, mean corpuscular hemoglobin concentration, red blood cell distribution width, neutrophil granulocytes, lymphocytes, monocytes, eisonophil granulocytes, basophil granulocytes, platelet numbers, and/or mean platelet volume.
  • a method for inducing tolerance in a patient including administering to a patient a therapeutically effective amount of an agent, for example an antibody coupled to a toxin (or CAR-modified immune cell), that selectively ablates endogenous HSC; and administering to the patient a therapeutically effective amount of HSC from a donor, which administering may be performed in conjunction with introducing an allograft into said patient, treating autoimmune disease, etc.
  • an agent for example an antibody coupled to a toxin (or CAR-modified immune cell
  • methods and compositions disclosed herein are used to ablate pHSC within a subject to treat a malignancy associated with hyperproliferative HSC, such as a hematopoietic cancer.
  • hematopoietic cancers include acute lymphocytic leukemia, B-cell prolymphocytic leukemia, Burkitt lymphoma/leukemia, chronic lymphocytic leukemia (CLL), diffuse large B-cell lymphoma, follicular lymphoma (grades I, II, Ill, or IV), Hodgkin's lymphoma, intravascular large B-cell lymphoma, lymphoma, lymphoplasmocytic lymphoma, mantle cell lymphoma, marginal zone lymphoma (extra-nodal and nodal), mediastinal (thymic) large B-cell lymphoma, multiple myeloma, non-Hodgkin's lymphoma, POEMS syndrome/osteosclerotic myeloma, primary effusion lymphoma, splenic marginal zone lymphoma, small lymphocytic lymphoma, smoldering multiple myelom
  • An anti-cancer effect can include one or more of a decrease in the number of cancer cells, an increase in life expectancy, induction of apoptosis of cancer cells, induction of cancer cell death, inhibition of cancer cell proliferation, prolongation of a subject's life, and/or reduction of relapse or re-occurrence of the cancer following treatment.
  • compositions and formulations disclosed herein can be administered by, for example, injection, infusion, perfusion, or lavage and can more particularly include administration through one or more bone marrow, intravenous, intradermal, intraarterial, intranodal, intralymphatic, intraperitoneal, intralesional, intraprostatic, intravaginal, intrarectal, topical, intrathecal, intratumoral, intramuscular, intravesicular, and/or subcutaneous infusions and/or bolus injections.
  • purification and final formulation of cells includes pelleting the cell product and removing the resulting supernatant.
  • Exemplary cellular carriers include saline, buffered saline, physiological saline, water, Hanks' solution, Ringer's solution, Nonnosol-R (Abbott Labs), Plasma-Lyte A® (Baxter Laboratories, Inc., Morton Grove, IL), glycerol, ethanol, and combinations thereof.
  • carriers can be supplemented with human serum albumin (HSA) or other human serum components or fetal bovine serum.
  • HAS human serum albumin
  • a carrier for infusion includes buffered saline with 5% HAS or dextrose.
  • Additional isotonic agents include polyhydric sugar alcohols including trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol, or mannitol.
  • Carriers can include buffering agents, such as citrate buffers, succinate buffers, tartrate buffers, fumarate buffers, gluconate buffers, oxalate buffers, lactate buffers, acetate buffers, phosphate buffers, histidine buffers, and/or trimethylamine salts.
  • buffering agents such as citrate buffers, succinate buffers, tartrate buffers, fumarate buffers, gluconate buffers, oxalate buffers, lactate buffers, acetate buffers, phosphate buffers, histidine buffers, and/or trimethylamine salts.
  • Stabilizers refer to a broad category of excipients which can range in function from a bulking agent to an additive which helps to prevent cell adherence to container walls.
  • Typical stabilizers can include polyhydric sugar alcohols; amino acids, such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2-phenylalanine, glutamic acid, and threonine; organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myoinisitol, galactitol, glycerol, and cyclitols, such as inositol; PEG; amino acid polymers; sulfur-containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate,
  • formulations can include a local anesthetic such as lidocaine to ease pain at a site of injection.
  • a local anesthetic such as lidocaine to ease pain at a site of injection.
  • Therapeutically effective amounts of cells within formulations can be greater than 10 2 cells, greater than 10 3 cells, greater than 10 4 cells, greater than 10 5 cells, greater than 10 6 cells, greater than 10 7 cells, greater than 10 8 cells, greater than 10 9 cells, greater than 10 10 cells, or greater than 10 11 .
  • cells are generally in a volume of a liter or less, 500 mls or less, 250 mls or less or 100 mls or less.
  • the density of administered cells is typically greater than 10 4 cells/ml, 10 7 cells/ml or 10 8 cells/ml.
  • formulations disclosed herein can be prepared for administration by, for example, injection, infusion, perfusion, or lavage.
  • a method of preparing an enriched primitive hematopoietic stem cell (pHSC) population including:
  • stem cell source includes umbilical cord blood, placental blood, bone marrow, or peripheral blood.
  • a method of any of embodiments 1-3, wherein the enriching includes magnetic-assisted cell sorting (MACS), fluorescence-activated cell sorting (FACS) or antibody-panning.
  • MCS magnetic-assisted cell sorting
  • FACS fluorescence-activated cell sorting
  • antibody-panning antibody-panning
  • LHR binding agent includes a luteinizing hormone (LH) alpha subunit and a LH beta subunit.
  • LH alpha subunit and LH beta subunit include SEQ ID NO: 23 and SEQ ID NO: 22 or SEQ ID NO: 11 and SEQ ID NO: 9.
  • Exemplary embodiment 10 also includes a method of expanding pHSC populations in culture media supplemented with an LH agonist that is practiced independently of embodiments 1-9.
  • LH alpha subunit and LH beta subunit include SEQ ID NO: 23 and SEQ ID NO: 22 or SEQ ID NO: 11 and SEQ ID NO: 9.
  • SCF stem cell factor
  • TPO human thrombopoietin
  • FLT-3L human Fms-related tyrosine kinase 3 ligand
  • IL-3 human interleukin-3
  • SCF, TPO and FLT-3L or the SCF and IL-3 are recombinant SCF, TPO and FLT-3L or recombinant SCF and IL-3.
  • the therapeutic gene is selected from ABCD1, ABCA3, ABLI, ADA, AKT1, APC, APP, ARSA, ARSB, BCL11A, BLC1, BLC6, BRCA1, BRCA2, BRIP1, C9ORF72, C46 or other C peptide, CAR, CAS9, C-CAM, CBFAI, CBL, CCR5, CD4, CD19, CD40, CDA, CFTR, CLN3, C-MYC, CRE, CSCR4, CSFIR, CTLA, CTS-I, CYB5R3, DCC, DHFR, DKC1, DLL1, DMD, EGFR, ERBA, ERBB, EBRB2, ETSI, ETS2, ETV6, F8, F9, FANCA, FANCB, FANCC, FANCD2, FANCE, FANCF, FANCG, FANCI, FANCL, FANCM, FasL, FCC, FGR, FOX, FUS, FUSI, FY
  • a method of ablating primitive hematopoietic stem cells (pHSC) in a subject in need thereof including administering to the subject a therapeutically effective amount of a pHSC-ablating agent including a luteinizing hormone receptor (LHR) binding agent.
  • pHSC primitive hematopoietic stem cells
  • LHR binding agent includes a luteinizing hormone (LH) alpha subunit and a LH beta subunit.
  • LH alpha subunit and LH beta subunit include SEQ ID NO: 23 and SEQ ID NO: 22 or SEQ ID NO: 11 and SEQ ID NO: 9.
  • pHSC-ablating agent includes a lymphocyte genetically-modified to express the LHR binding agent as part of a chimeric antigen receptor (CAR).
  • CAR chimeric antigen receptor
  • lymphocyte is a T cell or a natural killer (NK) cell.
  • toxin is selected from abrin A chain, ⁇ -amanitin, ⁇ -amanitin, ⁇ -amanitin, £-amanitin, amanin, amaninamide, amanullin, amanullinic acid, auristatin-E, crotin, curcin, diphtheria A chain, diphtheria toxin, enomycin, exotoxin A chain, gelonin toxin, luffin toxin, modeccin toxin, momordin toxin, phenomycin, pseudomonas exotoxin A, Ricin A chain, saporin, or trichosanthin toxin.
  • a method of ablating malignant cells in a subject in need thereof including administering to the subject a therapeutically effective amount of genetically-modified lymphocytes expressing a chimeric antigen receptor (CAR) including an extracellular domain including a luteinizing hormone (LH) alpha subunit and a LH beta subunit.
  • CAR chimeric antigen receptor
  • a method of embodiment 37 or 38, wherein the malignant cells are leukemia cells and/or lymphoma cells.
  • LH alpha subunit and LH beta subunit include SEQ ID NO: 23 and SEQ ID NO: 22 or SEQ ID NO: 11 and SEQ ID NO: 9.
  • lymphocyte is a T cell or a natural killer (NK) cell.
  • CAR chimeric antigen receptor
  • a CAR of embodiment 47, wherein the LH alpha subunit and LH beta subunit include SEQ ID NO: 23 and SEQ ID NO: 22 or SEQ ID NO: 11 and SEQ ID NO: 9.
  • a CAR including SEQ ID NO: 20 or SEQ ID NO: 7.
  • cDNA including SEQ ID NO: 19 or SEQ ID NO: 6.
  • a lymphocyte including SEQ ID NO: 19 or SEQ ID NO: 6.
  • a formulation for administration to a subject including an enriched pHSC population formed according to a method of embodiments 1-22, a CAR of embodiments 47-59, cDNA of embodiment 60, and/or a lymphocyte of embodiment 63.
  • variants of protein and/or nucleic acid sequences disclosed herein include those having one or more conservative amino acid substitutions.
  • a “conservative substitution” involves a substitution found in one of the following conservative substitutions groups: Group 1: Alanine (Ala), Glycine (Gly), Serine (Ser), Threonine (Thr); Group 2: Aspartic acid (Asp), Glutamic acid (Glu); Group 3: Asparagine (Asn), Glutamine (Gln); Group 4: Arginine (Arg), Lysine (Lys), Histidine (His); Group 5: Isoleucine (Ile), Leucine (Leu), Methionine (Met), Valine (Val); and Group 6: Phenylalanine (Phe), Tyrosine (Tyr), Tryptophan (Trp).
  • amino acids can be grouped into conservative substitution groups by similar function or chemical structure or composition (e.g., acidic, basic, aliphatic, aromatic, sulfur-containing).
  • an aliphatic grouping may include, for purposes of substitution, Gly, Ala, Val, Leu, and Ile.
  • Other groups containing amino acids that are considered conservative substitutions for one another include: sulfur-containing: Met and Cysteine (Cys); acidic: Asp, Glu, Asn, and Gln; small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro, and Gly; polar, negatively charged residues and their amides: Asp, Asn, Glu, and Gln; polar, positively charged residues: His, Arg, and Lys; large aliphatic, nonpolar residues: Met, Leu, Ile, Val, and Cys; and large aromatic residues: Phe, Tyr, and Trp. Additional information is found in Creighton (1984) Proteins, W.H. Freeman and Company.
  • variants of gene sequences can include codon optimized variants, sequence polymorphisms, splice variants, and/or mutations that do not affect the function of an encoded product to a statistically-significant degree.
  • Variants of the protein, nucleic acid, and gene sequences disclosed herein also include sequences with at least 70% sequence identity, 80% sequence identity, 85% sequence, 90% sequence identity, 95% sequence identity, 96% sequence identity, 97% sequence identity, 98% sequence identity, or 99% sequence identity to the protein, nucleic acid, or gene sequences disclosed herein.
  • % sequence identity refers to a relationship between two or more sequences, as determined by comparing the sequences.
  • identity also means the degree of sequence relatedness between protein, nucleic acid, or gene sequences as determined by the match between strings of such sequences.
  • Identity (often referred to as “similarity”) can be readily calculated by known methods, including (but not limited to) those described in: Computational Molecular Biology (Lesk, A. M., ed.) Oxford University Press, NY (1988); Biocomputing: Informatics and Genome Projects (Smith, D. W., ed.) Academic Press, NY (1994); Computer Analysis of Sequence Data, Part I (Griffin, A. M., and Griffin, H.
  • Example 1 Suppression of luteinizing hormone enhances HSC recovery after hematopoietic injuries.
  • HSC hematopoietic stem cell
  • SSA sex steroid ablation
  • BM bone marrow
  • LHRH-Ant novel luteinizing hormone-releasing hormone-antagonist
  • L-TBI total body irradiation
  • LHSCs Long-term self-renewing HSCs derived from both human and mouse expressed high levels of the luteinizing hormone/choriogonadotropin receptor (LHR) and while LH stimulation promoted HSC expansion, its suppression after L-TBI inhibited entry of HSCs into cell cycle, thus promoting HSC quiescence and protection against exhaustion.
  • LHR luteinizing hormone/choriogonadotropin receptor
  • LHRH-Ant could represent a rational non-cellular medical countermeasure for mitigating radiation injury and promoting hematopoietic regeneration when administered after hematopoietic insult.
  • a lethal TBI (L-TBI) dose of 840cGy that mediated lethality in more than 90% of mice was used. It was found that mice receiving LHRH-Ant 24 h after L-TBI exposure showed a significant increase in survival compared to control animals treated with vehicle alone ( FIG. 2 A ).
  • BM were analyzed at several time points after L-TBI.
  • PB peripheral blood
  • BM cellularity of mice treated with the LHRH-Ant started to separate significantly from the vehicle group by day 14 after radiation ( FIG. 2 D ).
  • colony-forming unit activity was next quantified to determine the effects of LHRH-Ant on the recovery of committed hematopoietic progenitor cells.
  • mice were treated with the androgen receptor (AR) inhibitor enzalutamide (MDV3100) 24 h after L-TBI. Consistent with the data in surgically castrated mice, MDV3100 alone did not mediate any survival benefit but in groups treated with both MDV3100 and LHRH-Ant there was significant increase in mouse survival ( FIG. 4 B ). These data strongly show that the inhibition of sex steroid activity, through surgical castration or pharmacological inhibition of AR signaling, did not represent the primary mechanism driving the regenerative effects mediated by LHRH-Ant treatment after radiation exposure.
  • AR androgen receptor
  • LH luteinizing hormone
  • FSH follicle stimulating hormone
  • LHCGR expression was a peculiarity of LT-HSCs with little or no expression found on purified BM stromal cells ( FIG. 5 C ). These findings were consistent with publically accessible gene expression databases 21,22 . Using recently identified surface markers enabling granular characterization of the human HSC compartment ( FIG. 5 D ) 23,24 , LHCGR expression was significantly enriched in the most primitive HSC1 (Lin-CD34+CD38 ⁇ CD45RA ⁇ CD90+CD49f+) and HSC2 (CD34+CD38-CD45RA-CD90- CD49f+); with expression nearly absent in downstream multi-potent progenitors (MPPs) and multi-lymphoid progenitors (MLPs) ( FIGS. 4 E, 4 F ). Although LHCGR expression has previously been shown in a crude fraction of Lin-CD45 + Sca1 + cells 3 , this is the first evidence of its enriched expression on the most primitive HSCs.
  • LHCGR human chorionic gonadotropin
  • mice deficient for LHCGR could be radio protected when exposed irradiation.
  • the results showed that LHCGR-KO mice had a modest but statistically significant increase in survival when exposed to L-TBI compared to littermate control mice ( FIG. 4 H ).
  • HSC self-renewal, differentiation, and proliferation
  • This is particularly relevant during hematopoietic injuries (such as high dose or repeated rounds of chemotherapy or irradiation) when dormant HSCs transiently start to proliferate to replenish blood cells as unbalanced HSC proliferation can lead to stem cell exhaustion and long-term myelosuppression 35-37 .
  • LH significantly enhanced colony formation in cobblestone area-forming cell (CAFC) and colony-forming cell (CFC) assays ( FIGS. 6 A, 6 B ).
  • mice were challenged with successive doses of 5-fluorouracil (5-FU); a well-established method to functionally test HSC proliferation and self-renewal that leads to ablation of proliferating HSCs and ultimately death 29,34,47 .
  • 5-FU 5-fluorouracil
  • Abrogation of LH production significantly improved survival after serial 5-FU challenge ( FIG. 8 B ), supporting a role in promoting HSC quiescence.
  • mice that had been reconstituted for 6 months with WT or kiLHR were exposed to SL-TBI and cell apoptosis was evaluated two days later. Consistent with previous findings, constitutive LHCGR signaling in kiLHR HSCs significantly promoted reduction in LT-HSC survival after radiation exposure, as measured by higher proportion of apoptotic cells ( FIG. 8 D ).
  • mice C57BL/6 (CD45.2) male mice (The Jackson Laboratory, MA) were used at 7 to 8 weeks of age. B6.SJL-Ptprca Pepcb/BoyJ (CD45.1) male mice (The Jackson Laboratory) were used between 7 and 12 weeks of age for transplant. Mice were irradiated with a Gammacell 40 Irradiator (Cs-137), with an average dose rate of 95 cGy/min, in a plexiglass mouse pie cage. To assess mouse survival after radiation, mice were monitored for up to 60 days after TBI. To adjust for differences in weight, identical mice were purchased from Jackson and cages randomly distributed over different groups. All animal protocols were approved by the Memorial Sloan Kettering Cancer Center Institutional Animal Care and Use Committee.
  • Cs-137 Gammacell 40 Irradiator
  • Degarelix (as acetate), a LHRH-Ant (Firmagon), was resuspended in sterile water for injection and administered S.C. to mice at a dose of 40 mg/kg.
  • S.C. subcutaneously
  • PBS saline control solution
  • Degarelix was purchased from the Memorial Sloan-Kettering Cancer Center Pharmacy.
  • Poly I:C InvivoGen was administered I.P to mice at a dose of 5 mg/kg.
  • hCG (cellsciences) was resuspended in sterile PBS and administered S.C. to mice at a dose of 201U.
  • MDV3100 (selleckchem) was resuspended in a mixture of 45% PBS, 45% PEG and 10% DMSO and administered daily to mice by oral gavage at a dose of 10 mg/kg.
  • 5-FU InvivoGen
  • CFC Colony-Forming Cell
  • CAFC Cobblestone Areas Forming Cell
  • CAFC assay 1.5-3 ⁇ 10 3 purified LSK cells were co-cultured with the confluent MS-5 cells in 3 ml of ⁇ -MEM containing 12.5% FBS (Atlanta Biologicals, GA), 12.5% horse serum (GE Health Life Science, Utah), 1 ⁇ M Hydrocortisone (Sigma Inc, MO) and 5 ⁇ 10-5 M 2-mercaptoethanol (Fisher Scientific) in triplicates at 37° C. and 5% CO2. Half of the culture medium was replenished weekly. After 3 weeks of co-culture, CAFCs were scored as phase-dark hematopoietic clones of at least 5 cells beneath the stromal layer using an inverted microscope.
  • Mouse cells Two thousand purified LSK cells and MS-5 cells were co-cultured in T-12.5 flasks with or without 0.5 or 5 ⁇ g/ml of LH in 4 replicates. LH was added daily for 3 day and media replenished with an half of fresh CAFC medium weekly. After three weeks, CAFC were scored. The co-cultures were further harvested by washing with 3 ml of cold PBS 3 times and detached with 0.05% trypsin solution. The harvested co-culture medium, the washes and the detached cells were pooled, pelleted and subjected to CFC bioassay.
  • Human cells Human umbilical cord blood (UCB) CD34+ cells were harvested, enriched and cultured as previously described 52 . Briefly before enrichment of NHP CD34+ cells, red cells were lysed in ammonium chloride lysis buffer. For enrichment of human CD34+ cells, microbead conjugated anti-CD34 antibody (Miltenyi Biotech) was used. Enriched and sort-purified CD34+ cells were cultured in StemSpan (Stemcell Technologies) supplemented with 100 U/ml penicillin streptomycin (Gibco by Life Technologies) and SCF, TPO and FLT3-L (all Peprotech) (100 ng/ml each) with 50% exchange of culture medium on day 4.
  • StemSpan StemSpan
  • SCF penicillin streptomycin
  • TPO and FLT3-L All Peprotech
  • CFU-MIX colony forming unit—(CFU-) granulocyte (CFU-G), macrophage (CFU-M), granulocyte-macrophage (CFU-GM) and burst forming unit-erythrocyte (BFU-E). Colonies consisting of erythroid and myeloid cells were scored as CFU-MIX.
  • Flow cytometry and cell cycle analysis Monoclonal antibodies recognizing the following markers were used for flow cytometric analyses and cell sorting of murine cells (LSR II or FACSAria III, BD Biosciences): (from BD Pharmingen) c-kit (2B8), Sca-1 (D7), CD11b (M1/70), CD11c (HL3), CD19 (ID3), CD3 ⁇ (145-2C11), CD34 (RAM34), CD45 (30-F11), CD45.1 (A20), CD45.2 (104), CD48 (HM48-1), CD62L (MEL-14), CD135 (A2F10.1), Gr-1 (RB6-8C5), NK1.1 (PK136), TER-119 (TER-119); (from eBioscience) CD127 (A7R34), CD150 (mShad150); (from Invitrogen) B220 (RA3-6B2) and streptavidin (N/A).
  • the mouse lineage antibody cocktail included anti-CD3, anti-CD4, anti-CD8 ⁇ , anti-CD19, anti-CD11 b, anti-CD11c, anti-Gr-1, anti-NK1.1, and anti-TER119.
  • the following antibodies were used for flow cytometry analyses of human samples, CD49f (eBioGoH3), CD45RA (L48), CD34 (581), CD38 (HIT2).
  • the human lineage antibody cocktail included anti-CD3, anti-CD14, anti-CD16, anti-CD19, anti-CD20, anti-CD56.
  • a polyclonal anti-LHCGR (Alomone, cat #:ALR-010) was used.
  • BM cells were stained with surface markers, fixed, and permeabilized using the Fixation/Permeabilization kit (cat. 00552100 ebioscience) and permeabilization buffer (cat. 008333 ebioscience). Cells were then incubated with Ki67-Alexa 700 (B56) (from BD Biosciences) for 45 minutes at 4C. After centrifugation DAPI (5 ⁇ g/ml) was added to cells and allowed to incubate for at least 30 min at RT before analysis.
  • Fixation/Permeabilization kit catalog. 00552100 ebioscience
  • permeabilization buffer catalog. 008333 ebioscience
  • BM cells were flushed from intact femurs and tibia, and spleens were mashed with glass slides to generate single-cell suspension. Collection of the cells was performed in RPMI media with 10% FBS or PBS with 0.5% BSA, and filtered through a 70- ⁇ m strainer. Unless otherwise stated, all cell numbers in this study were standardized as total counts per two legs or per spleen. Human cord bloods were obtained from New York Blood Center. Cord bloods were processed separately in each experiment. An equal volume of phosphate buffered saline was added prior to layering on Ficoll/Paque gradient and samples were processed according to manufacturer's protocol. CD34+ cells were enriched by magnetic separation using human CD34 MicroBead kit (Miltenyi Biotec).
  • Bone marrow transplant In the competitive BM transplant, whole BM from CD45.2+ (vehicle or LHRH-Ant) donors and were collected and transplanted into lethally irradiated CD45.1+ mice (1100 cGy TBI, split dose) along with 2.5 ⁇ 10 5 CD45.1+ competitors, through tail vein injection. Donor chimerism was monitored monthly after transplant. In the LSK transplant, lineage-Sca-1+c-Kit+ cells from BM were selected using a FACS Aria II cell sorter (BD).
  • BD FACS Aria II cell sorter
  • Real time PCR Reverse transcription-PCR was performed with QuantiTect reverse transcription kit (QIAGEN).
  • QIAGEN QuantiTect reverse transcription kit
  • specific primer and probe sets were obtained from Applied Biosystems as follows: ⁇ -actin (Mm01205647_g1); HPRT (Mm00446968_m1); AR (Mm00442688_m1); FSHR (Mm00442819_m1); LHCGR (Mm00442931_m1).
  • PCR was done on ABI 7500 (Applied Biosystems) or Step-One Plus (Applied Biosystems) with TaqMan Universal PCR Master Mix (Applied Biosystems). Relative amounts of mRNA were calculated by the Ct method.
  • each embodiment disclosed herein can comprise, consist essentially of or consist of its particular stated element, step, ingredient or component.
  • the terms “include” or “including” should be interpreted to recite: “comprise, consist of, or consist essentially of.”
  • the transition term “comprise” or “comprises” means includes, but is not limited to, and allows for the inclusion of unspecified elements, steps, ingredients, or components, even in major amounts.
  • the transitional phrase “consisting of” excludes any element, step, ingredient or component not specified.
  • the transition phrase “consisting essentially of” limits the scope of the embodiment to the specified elements, steps, ingredients or components and to those that do not materially affect the embodiment. A material effect would cause a statistically-significant reduction in the ability to enrich for and isolate, expand and/or ablate pHSC.
  • the term “about” has the meaning reasonably ascribed to it by a person skilled in the art when used in conjunction with a stated numerical value or range, i.e. denoting somewhat more or somewhat less than the stated value or range, to within a range of ⁇ 20% of the stated value; ⁇ 19% of the stated value; ⁇ 18% of the stated value; ⁇ 17% of the stated value; ⁇ 16% of the stated value; ⁇ 15% of the stated value; ⁇ 14% of the stated value; ⁇ 13% of the stated value; ⁇ 12% of the stated value; ⁇ 11% of the stated value; ⁇ 10% of the stated value; ⁇ 9% of the stated value; ⁇ 8% of the stated value; ⁇ 7% of the stated value; ⁇ 6% of the stated value; ⁇ 5% of the stated value; ⁇ 4% of the stated value; ⁇ 3% of the stated value; ⁇ 2% of the stated value; or ⁇ 1% of the stated value.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Chemical & Material Sciences (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Genetics & Genomics (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Cell Biology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Hematology (AREA)
  • General Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Medicinal Chemistry (AREA)
  • Virology (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Physics & Mathematics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Molecular Biology (AREA)
  • Plant Pathology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Endocrinology (AREA)
  • Reproductive Health (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)

Abstract

The use of luteinizing hormone receptor (LHR) binding agents and luteinizing hormone (LH) agonists to enrich for primitive hematopoietic stem cell (pHSC) populations, to target pHSC for ablation, and/or to expand pHSC populations are described. The methods can be used to prepare therapeutic hematopoietic stem cell (HSC) populations, to prepare patients for therapeutic HSC transplants, and/or to treat malignancies, such as those associated with hyperproliferative HSC.

Description

CROSS-REFERENCE TO RELATED APPLICATION
This application is a continuation of U.S. patent application Ser. No. 16/753,277, filed Apr. 2, 2020 which is a U.S. National Phase Patent Application based on International Patent Application No. PCT/US2018/054004, filed Oct. 2, 2018, which claims priority to U.S. Provisional Patent Application No. 62/566,897 filed Oct. 2, 2017, the entire contents of each of which are incorporated by reference herein.
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT
This invention was made with government support under HL069929 and CA008748 awarded by the National Institutes of Health. The government has certain rights in the invention.
FIELD OF THE DISCLOSURE
The use of luteinizing hormone receptor (LHR) binding agents and luteinizing hormone (LH) agonists to enrich for primitive hematopoietic stem cell (pHSC) populations, to target pHSC for ablation, and/or to expand pHSC populations are described. The methods can be used to prepare therapeutic hematopoietic stem cell (HSC) populations, to prepare patients for therapeutic HSC transplants or genetic cell therapies, and/or to treat malignancies, such as those associated with hyperproliferative HSC.
REFERENCE TO SEQUENCE LISTING
The Sequence Listing associated with this application is provided in text format in lieu of a paper copy, and is hereby incorporated by reference into the specification. The name of the text file containing the Sequence Listing is 2WR4787_ST25.txt. The text file is 93 KB, was created on Jun. 8, 2023, and is being submitted electronically via Patent Center.
BACKGROUND OF THE DISCLOSURE
Hematopoietic stem cells (HSC) are stem cells that can give rise to all blood cell types such as white blood cells and red blood cells. The therapeutic administration of HSC can be used to treat a variety of side-effects of radiation exposure (e.g., cancer treatment or accidental), cancers (e.g., malignant blood cancers), and genetic blood disorders. For example, HSC can be administered to reconstitute the immune systems of individuals following radiation exposure. In individuals with malignant blood cancers, HSC can be used as transplants. In this use, the existing malignant hematopoietic system of an individual is ablated and HSC are provided as a therapeutic treatment to generate a properly functioning hematopoietic system. This transplant/therapeutic approach can also be used to treat a variety of genetic blood disorders and infections as described in more detail elsewhere herein. In various therapeutic uses of HSC, it can be beneficial to isolate primitive hematopoietic stem cell (pHSC) specifically and to genetically-modify these HSC to provide corrected cellular function.
In the clinical and therapeutic setting, the current gold standard for isolation of HSC is through the use of molecules that bind to the CD34 protein on the cellular surface of HSC. Singular use of the CD34 HSC cell surface marker, however, leads to a mixed or heterogeneous population of cells that have distinct phenotypes and characteristics because cells in addition to the most primitive HSC express CD34, including downstream progenitor cells. Due to the heterogeneity of these cell populations, there are several major limitations with using CD34 to identify HSCs. For example, the numbers of CD34-expressing cells isolated from blood and bone marrow products require large volumes of reagents for manipulation, which can be cost prohibitive if genetic manipulation of the HSCs is required. Thus, the field has widely recognized that there continues to be an unmet need to identify a more enriched, true (i.e., most primitive) HSC population, as well as methods to expand these cell populations for therapeutic uses.
As indicated, while HSCs are administered for therapeutic purposes, in many treatment regimens it is important to remove existing HSCs within a patient before the therapeutic administration. For example, hematopoietic stem cell transplant (HSCT) is primarily indicated to treat malignancies and blood disorders and requires intensive conditioning of a patient's tissues (e.g., bone marrow tissue) to remove existing HSCs prior to engraftment of the therapeutic HSC. Current non-targeted conditioning methods include, for example, irradiation (e.g., total body irradiation (TBI)) and DNA alkylating/modifying agents. These conditioning methods are highly toxic to multiple organ systems, and completely wipe out the hematopoietic and immune systems, frequently leading to life-threatening complications precluding the use of HSCT for less dire, but still severe, conditions such as autoimmune diseases.
Thus, there is significant room for improvement in the ability to prepare pHSC populations, ablate pHSC populations in vivo, and modify pHSC populations for therapeutic uses.
SUMMARY OF THE DISCLOSURE
The current disclosure addresses many drawbacks of the prior art. First, the current disclosure describes use of luteinizing hormone/choriogonadotropin receptor (LHR) binding agents and luteinizing hormone agonists to isolate, enrich and/or expand stem cell populations including the most primitive populations of human hematopoietic stem cells (pHSC). Using highly purified pHSC populations reduces the heterogeneity of cell populations providing more pure and homogenous therapeutic cell populations with stem cell capability for expansion and use. In particular embodiments, LHR binding agents can be used to enrich for and isolate pHSC. In particular embodiments, LH agonists can be used to expand pHSC.
Additionally, the current disclosure provides targeting LHR-expressing HSC for selective ablation during conditioning before a HSC transplant and/or genetic cell therapy. The described targeted and selective ablation reduces undesirable toxicity and minimizes the incidence of serious adverse reactions observed with currently utilized non-targeted conditioning methods. Moreover, selective ablation of HSC from HSC microenvironments (i.e., the HSC niche) opens the niche for the engraftment of donor stem cells. The efficiency of engraftment can be significantly enhanced by selective ablation, as compared to engraftment without selective ablation.
In particular embodiments, the current disclosure provides targeting LHR-expressing hyperproliferative HSC. Such embodiments can be used to treat malignancies associated with hyperproliferative HSC, such as hematopoietic cancers. These treatments can be performed independently of or in conjunction with selective ablation during conditioning before a HSC transplant or infusion of genetically modified cells.
Particular embodiments directed to the ablation of HSC can utilize LHR binding agents that result in selective ablation of LHR-expressing HSC. Examples of LHR binding agents include, for example, an LHR-binding antibody conjugated to a toxin, a bi-specific antibody, an LHR-binding bispecific T cell engaging (BiTE) antibody, or a chimeric antigen receptor (CAR)-modified immune cell.
BRIEF DESCRIPTION OF THE FIGURES
FIGS. 1A-1D. (1A) A lethal total body irradiation (L-TBI) dose of 840cGy mediated lethality in more than 90% of mice. (1B) Mouse lethality was a result of bone marrow failure, as transplant of BM Lin−Sca1+ ckit+ (LSK) cells 3 days after L-TBI completely rescued all mice. (1C) Treatment of the mice 24 h and 15 days after L-TBI did not significantly enhance the survival benefit. (1D) A statistically significant benefit in survival in female mice given LHRH-Ant was also found.
FIGS. 2A-2I. (2A) Mice receiving LHRH-Ant 24 h after L-TBI exposure showed a significant increase in survival compared to control animals treated with vehicle alone. (2B) Complete blood counts analysis revealed that only mice treated with LHRH-Ant recovered after L-TBI. (2C) Treatment with LHRH-Ant significantly enhanced mouse survival even when administered 48 h after L-TBI. (2D) In keeping with the peripheral blood (PB) recovery shown in FIG. 2B), BM cellularity of mice treated with the LHRH-Ant started to separate significantly from the vehicle group by day 14 after radiation. (2E) While there was no difference in total BM cellularity at day 7, there was a significant increase in CFU-GM and BFU-E colonies in L-TBI mice also treated with LHRH-Ant. (2F, 2G) On day 14 after L-TBI, expansion of LSKs as well as their downstream progenitors in mice given LHRH-Ant were found. Moreover, crucially for sustained hematopoiesis, significantly more LT-HSCs were also found. (2H, 2I) Host mice receiving cells from LHRH-Ant-treated L-TBI mice had significantly better hematopoietic reconstitution than recipients of cells from vehicle-treated control L-TBI mice.
FIG. 3 . Host mice receiving cells from LHRH-Ant-treated L-TBI mice had significantly better hematopoietic reconstitution than recipients of cells from vehicle-treated control L-TBI mice.
FIGS. 4A-4H. (4A) Surgical castration did not protect mice from radiation injury, but only the simultaneous treatment of the castrated mice with the LHRH-Ant restored the benefits in mouse survival. (4B) Consistent with the data in surgically castrated mice, MDV3100 alone did not mediate any survival benefit but in groups treated with both MDV3100 and LHRH-Ant there was a significant increase in mouse survival. (4C) Radiation by itself drastically reduced the levels of testosterone in both groups, and treatment with LHRH-Ant did not significantly lower the level of testosterone after radiation showing that the beneficial effects of LHRH-Ant on hematopoiesis and survival post irradiation were sex steroid independent. While levels of FSH did not change after L-TBI, levels of LH did decrease gradually over time and, as expected, LH and FSH were dramatically decreased in irradiated mice after LHRH-Ant treatment. (4D) Almost no detectable expression of the androgen receptor (AR) or follicle-stimulating hormone receptor (FSHR) was found on any of the HSPC subsets examined. In contrast, expression of luteinizing hormone/choriogonadotropin receptor (LHCGR) was highly enriched on long-term HSCs (LT-HSCs), and at comparable levels to those observed in the testes. (4E, 4F) Using recently identified surface markers enabling granular characterization of the human HSC compartment, LHCGR expression was significantly enriched in the most primitive HSC1 (Lin-CD34+ CD38-CD45RA-CD9O+CD49f+) and HSC2 (CD34+ CD38−CD45RA−CD90− CD49f+); with expression nearly absent in downstream multi-potent progenitors (MPPs) and multi-lymphoid progenitors (MLPs). (4G) Administration of hCG abrogated the beneficial effects of LHRH-Ant on survival after radiation injury. (4H) LHCGR-KO mice had a modest but statistically significant increase in survival when exposed to L-TBI compared to littermate control mice.
FIGS. 5A-5D. (5A) Cell populations and phenotypes. (5B) LHCGR expression pattern in HSCPs derived from female mice. (5C) LHCGR expression was a peculiarity of LT-HSCs with little or no expression found on purified BM stromal cells. (5D) These findings were consistent with publicly accessible gene expression databases.
FIGS. 6A-6G. (6A, 6B) LH significantly enhanced colony formation in cobblestone area-forming cell (6A; CAFC) and colony-forming cell (6B; CFC) assays. (6C) LH was also able to significantly expand human HSC1 in vitro (CD34+ CD38−CD45RA−CD90+) in a stroma-free culture system. (6D) When cell cycle status of HSCs in LHRH-Ant treated mice after L-TBI was analyzed, a significantly higher proportion of Ki-67− quiescent LT-HSCs in the LHRH-Ant-treated group with fewer proliferative HSCs compared to the vehicle group was found. (6E, 6F) Aablation of LH production in mice using a luteinizing hormone-releasing hormone-antagonist (LHRH-Ant) retained significantly more LT-HSCs in G0 in both models. (6G) Using the same administration scheme as described in FIG. 3F it was revealed that LHRH-Ant treatment significantly increased the proportion of live LT-HSCs compared to vehicle treated mice
FIG. 7 . When cell cycle status of HSCs in LHRH-Ant treated mice after L-TBI was analyzed, a significantly higher proportion of Ki-67− quiescent LT-HSCs in the LHRH-Ant-treated group with fewer proliferative HSCs compared to the vehicle group was found.
FIGS. 8A-8E. (8A) LT-HSC derived from LHRH-Ant-treated mice showed significant overexpression of genes related to quiescence and apoptosis (p=0.02 and p=0.004, respectively). (8B) Abrogation of LH production significantly improved survival after serial 5-FU challenge. (8C) Ablation of LH can limit HSC entry into cell cycle thus promoting their quiescence and survival during hematopoietic insult. (8D) Constitutive LHCGR signaling in kiLHR HSCs significantly promoted reduction in LT-HSC survival after radiation exposure, as measured by higher proportion of apoptotic cells. (8E) Pharmacological inhibition of LH signaling using a single dose of an LHRH-Ant represents a rational and feasible approach to preserve the HSC pool after high dose radiation, thereby mitigating acute hematopoietic radiation syndrome.
FIGS. 9A, 9B. Schematics of mouse and human LH-CAR designs.
FIGS. 10A-10D. LH-CAR redirects T cells to kill primary mouse Leydig testis cell tumors cell lines and LHCGR-transduced C1498 leukemia. (10A) Chimeric antigen receptor (CAR) designed based on natural ligand for the LHCGR receptor (luteinizing hormone) comprised by glycoprotein hormones alpha chain, linker, and luteinizing hormone beta subunit (10A, left panel was used to generate described experimental results). (10B) Mouse T cells were transduced with a retrovirus encoding myc tagged mouse LH-CAR containing CD28 costimulatory domain and CD3 zeta followed by a Thyl.1 reporter. Flow cytometry demonstrated co-expression of myc tag (CAR) and Thyl.1 reporter gene. (10C) Mouse T cells were transduced with the LH-CAR or mock transduced and incubated overnight with firefly luciferase-transduced MLTC1 and MA10 Leydig cell lines expressing LHCGR. Viable targets were assessed via luciferase assay. (10D) Mouse T cells were transduced with the LH-CAR or mock transduced and incubated overnight with firefly luciferase-transduced C1498 leukemia cell line also transduced to express LHCGR. Viable targets were assessed via luciferase assay after three days of co-culture.
FIG. 11 . Luetenizing hormone receptor sequences (SEQ ID NOs: 1-3).
FIG. 12 . Signaling domain including a variant of CD3 zeta and a portion of the 4-1BB intracellular signaling domain (DNA (SEQ ID NO: 4) and protein (SEQ ID NO: 5).
FIGS. 13A, 13B. LH-CAR. (13A) Mouse LH-CAR cDNA (SEQ ID NO: 6), Mouse LH-CAR translation (SEQ ID NO: 7) and subcomponents thereof including signal peptide (SEQ ID NO: 8), LH beta subunit (SEQ ID NO: 9), linker (SEQ ID NO: 10), LH alpha subunit (SEQ ID NO: 11), Myc (SEQ ID NO: 12), CD8 hinge (SEQ ID NO: 13), CD8 transmembrane domain (SEQ ID NO: 14), CD28 cytoplasmic (SEQ ID NO: 15), CD3 zeta (SEQ ID NO: 16), 2A (SEQ ID NO: 17), and Thyl.1 (SEQ ID NO: 18); (13B) human LH-CAR cDNA (SEQ ID NO: 19), human LH-CAR translation (SEQ ID NO: 20) and subcomponents thereof including signal peptide (SEQ ID NO: 21), LH beta subunit (SEQ ID NO: 22), linker (SEQ ID NO: 10), LH alpha subunit (SEQ ID NO: 23), Myc (SEQ ID NO: 12), CD28 hinge (SEQ ID NO: 24), CD28 transmembrane domain: (SEQ ID NO: 25), 4-1BB (SEQ ID NO: 26), and CD3 zeta (SEQ ID NO: 27).
 DETAILED DISCLOSURE
There is significant room for improvement in the ability to prepare homogenous primitive hematopoietic stem cell (pHSC) populations, ablate pHSC populations in vivo, and modify pHSC populations for therapeutic uses.
The current disclosure provides improvements through the use of luteinizing hormone/choriogonadotropin receptor (LHR) binding agents to generate populations of the most primitive populations of human stem cells; use of LH agonists to promote HSC expansion; targeting LHR-expressing HSC for selective ablation during conditioning before a HSC transplant and/or infusion of genetically modified cells; and/or as an independent or complementary treatment to ablate hyperproliferative HSC associated with hematopoietic cancers. Particular embodiments may also use LH agonists to enhance HSC transfection/transduction in treatments utilizing genetic modification. Each of these aspects of the current disclosure are now described in more detail.
I. Use of the Luteinizing Hormone/Choriogonadotropin Receptor (LHR) Binding Agents to Isolate/Enrich for Primitive Populations of Human or Mouse Stem Cells. Stem cells are defined by their ability to form multiple cell types (multipotency) and their ability to self-renew. Hematopoietic stem cells (HSC) refer to stem cells that can differentiate into the hematopoietic lineage and give rise to all blood cell types such as white blood cells and red blood cells, including myeloid (e.g., monocytes and macrophages, neutrophils, basophils, eosinophils, erythrocytes, megakaryocytes/platelets, dendritic cells), and lymphoid lineages (e.g., T-cells, B-cells, NK-cells).
The current disclosure provides use of the luteinizing hormone/choriogonadotropin receptor (LHR) binding agents to generate and expand populations of human and mouse pHSC including: human HSC1 and/or HSC2 and mouse long-term HSCs (LT-HSCs). In addition to expression of LHR (which is nearly absent on multipotent progenitors (MPPs) and multi-lymphoid progenitors (MLPs)), in particular embodiments, human HSC1 can be identified by the following profile: CD34+/CD38−/CD45RA−/CD90+ or CD34+/CD45RA−/CD90+ and mouse LT-HSC can be identified by Lin-Scal+ckit+CD150+CD48-F1t3-CD34− (where Lin represents the absence of expression of any marker of mature cells including CD3, Cd4, CD8, CD11 b, CD11 c, NK1.1, and TER119). Thus, HSC1 can include the marker profile: LHR+/CD34+/CD38−/CD45RA/CD90+. In addition to expression of LHR, in particular embodiments, HSC1 can be identified by the following profile: Lin−/CD34+/CD38−/CD45RA−/CD90+/CD49f+. Thus, HSC1 can include the marker profile: LHR+/Lin−/CD34+/CD38−/CD45RA−/CD90+/CD49f+. In addition to expression of LHR, in particular embodiments, HSC2 can be identified by the following profile: CD34+/CD38/CD45RA−/CD90−/CD49f+. Thus, HSC2 can include the marker profile: LHR+/CD34+/CD38−/CD45RA−/CD90−/CD49f+. Based on the foregoing profiles, expression of LHR can be combined with presence or absence of the following one or more markers to prepare HSC1 and/or HSC2 cell populations: Lin/CD34/CD38/CD45RA/CD90/CD49f as well as CD133. Various other combinations may also be used so long as the marker combination reliably isolates HSC1 or HSC2.
Sources of HSC to generate pHSC populations include cord blood, mobilized peripheral blood and bone marrow. Methods regarding collection, anti-coagulation and processing, etc. of blood samples are well known in the art. See, for example, Alsever et al., 1941, N.Y. St. J. Med. 41:126; De Gowin, et al., 1940, J. Am. Med. Ass. 114:850; Smith, et al., 1959, J. Thorac. Cardiovasc. Surg. 38:573; Rous and Turner, 1916, J. Exp. Med. 23:219; and Hum, 1968, Storage of Blood, Academic Press, New York, pp. 26-160.
HSC in peripheral blood are preferably mobilized prior to collection. Peripheral blood HSC can be mobilized by any method. Peripheral blood HSC can be mobilized by treating the subject with any agent(s), described herein or known in the art, that increase the number of HSC circulating in the peripheral blood of the subject. For example, in particular embodiments, peripheral blood is mobilized by treating the subject with one or more cytokines or growth factors (e.g., G-CSF, kit ligand (KL), IL-I, IL-7, IL-8, IL-11, Flt3 ligand, SCF, thrombopoietin, or GM-CSF (such as sargramostim)). Different types of G-CSF that can be used in the methods for mobilization of peripheral blood include filgrastim and longer acting G-CSF-pegfilgrastim. In particular embodiments, peripheral blood is mobilized by treating the subject with one or more chemokines (e.g., macrophage inflammatory protein-1α (MIP1α/CCL3)), chemokine receptor ligands (e.g., chemokine receptor 2 ligands GROβ and GROβΔ4, chemokine receptor analogs (e.g., stromal cell derived factor-1α (SDF-1α) protein analogs such as CTCE-0021, CTCE-0214, or SDF-1α such as Met-SDF-1β), or chemokine receptor antagonists (e.g., chemokine (C-X-C motif) receptor 4 (CXCR4) antagonists such as AMD3100).
In particular embodiments, peripheral blood is mobilized by treating the subject with one or more anti-integrin signaling agents (e.g., function blocking anti-very late antigen 4 (VLA-4) antibody, or anti-vascular cell adhesion molecule 1 (VCAM-1)).
In particular embodiments, peripheral blood is mobilized by treating the subject with one or more cytotoxic drugs such as cyclophosphamide, etoposide or paclitaxel.
In particular embodiments, peripheral blood can be mobilized by administering to a subject one or more of the agents listed above for a certain period of time. For example, the subject can be treated with one or more agents (e.g., G-CSF) via injection (e.g., subcutaneous, intravenous or intraperitoneal), once daily or twice daily, for 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days prior to collection of HSC. In specific embodiments, HSC are collected within 1, 2, 3, 4, 5, 6, 7, 8, 12, 14, 16, 18, 20 or 24 hours after the last dose of an agent used for mobilization of HSC into peripheral blood. In particular embodiments, HSC are mobilized by treating the subject with two or more different types of agents described above or known in the art, such as a growth factor (e.g., G-CSF) and a chemokine receptor antagonist (e.g., CXCR4 receptor antagonist such as AMD3100), or a growth factor (e.g., G-CSF or KL) and an anti-integrin agent (e.g., function blocking VLA-4 antibody). In particular embodiments, different types of mobilizing agents are administered concurrently or sequentially. For additional information regarding methods of mobilization of peripheral blood see, e.g., Craddock et al., 1997, Blood 90(12):4779-4788; Jin et al., 2008, Journal of Translational Medicine 6:39; Pelus, 2008, Curr. Opin. Hematol. 15(4):285-292; Papayannopoulou et al., 1998, Blood 91(7):2231-2239; Tricot et al., 2008, Haematologica 93(11):1739-1742; and Weaver et al., 2001, Bone Marrow Transplantation 27(2):S23-S29).
HSC from peripheral blood can be collected from the blood through a syringe or catheter inserted into a subject's vein. For example, in particular embodiments, the peripheral blood can be collected using an apheresis machine. Blood flows from the vein through the catheter into an apheresis machine, which separates the white blood cells, including HSC from the rest of the blood and then returns the remainder of the blood to the subject's body. Apheresis can be performed for several days (e.g., 1 to 5 days) until enough HSC have been collected.
HSC from bone marrow can be obtained, e.g., directly from bone marrow from the posterior iliac crest by needle aspiration (see, e.g., Kodo et al., 1984, J. Clin Invest. 73:1377-1384), or from the blood following pre-treatment with cytokines (such as G-CSF and/or AM D3100) that induce cells to be released from the bone marrow compartment.
Enrichment/isolation of pHSC can be performed using any appropriate technique that is not unduly detrimental to the viability of the enriched for/isolated cells. Examples include magnetic separation using, for example, antibody-coated magnetic beads; fluorescence activated cell sorting (FACS; Williams et al., 1985, J. Immunol. 135:1004; Lu et al., 1986, Blood 68(1):126-133); affinity chromatography; cytotoxic agents joined to a monoclonal antibody or used in conjunction with a monoclonal antibody, e.g., complement and cytotoxins; “panning” with antibody attached to a solid matrix, e.g., plate, or other convenient technique (Broxmeyer et al., 1984, J. Clin. Invest. 73:939-953), agglutination using a lectin such as soybean (Reisner et al., 1980, Proc. Natl. Acad. Sci. U.S.A. 77:1164); etc.
Enrichment/isolation thus refers to a process wherein the percentage of target cells (i.e., HSC1 and/or HSC2 for human samples; LT-HSGs and ST-HSGs for mouse samples) in the sample is increased (relative to the percentage in the sample before the enrichment/isolation procedure). In particular embodiments, the increase in the number of target cells is an increase in the percentage of target cells in the enriched sample, relative to the sample prior to the enrichment/isolation procedure, for example at least a 25-, 50-, 75-, 100-, 150, 200-, 250-, 300-, 350-fold increase. In particular embodiments, LHR+HSC1 and/or LHR+HSC2 human cells, or LHR+ LT-HSGs and/or LHR+ ST-HSGs mouse cells, are enriched for/isolated using a binding agent specific for LHR, which binding agent is conjugated to a magnetic bead, and a magnetic cell separation device to separate out the LHR+ HSC1 and/or LHR+ HSC2 cells. As indicated, binding agents for other pHSC markers can also be used in combination with LHR (e.g., LH R+/CD34+; LH R+/CD34+/CD38−/CD45RA−/CD90+; LH R+/Li n−/CD34+/CD38−/CD45RA−/CD90+/CD49f; LHR+/CD34+/CD38−/CD45RA−/CD90−/CD49f+). In particular embodiments, using anti-LHR binding agents in combination with other HSC1 and/or HSC2 markers (or LHR+LT-HSGs and/or LHR+ST-HSGs mouse cells), results in target cells enriched to >80% of the population; >85% of the population; >90% of the population; >95% of the population; >99% of the population; or 100% of the population.
In particular embodiments, binding agents to assist in the preparation of pHSC populations include the LH alpha subunit and the LH beta subunit. The alpha subunit includes DCPECTLQEN PFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRV TVMGGFKVENHTACHCSTCYYHKS (SEQ ID NO: 23 (human)) or GCPECKLKEN KYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKAT VMGNARVENHTECHCSTCYYHKS (SEQ ID NO: 11 (mouse)). In particular embodiments, the LH beta subunit includes SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQA VLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTC DHPQLSGLLFL (SEQ ID NO: 22 (human)) or SRGPLRPLCRPVNATLAAENEFCPVC ITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPIVSFPVALSCRC GPCRLSSSDCGGPRTQPMACDLPHLPGLLLL (SEQ ID NO: 9 (mouse)).
In particular embodiments, binding agents to assist in the preparation of pHSC populations include antibodies or binding fragments thereof. Numerous antibodies that bind LHR or other HSC1/HSC2 markers are commercially available. For example, anti-LHR antibodies are commercially available from Abcam, Invitrogen, Alomone Labs, Novus Biologicals, Origene Technologies, Bio-Rad, Abbexa, St. John's Laboratory, Millipore Sigma, LifeSpan Biosciences, etc.
Anti-LHR antibodies utilized or produced according to the methods disclosed herein have high affinity for LHR. The same is true for antibodies that bind to other HSC1 and/or HSC2 markers. In particular embodiments “affinity” refers to the strength of the sum total of noncovalent interactions between a single binding site of an antibody and its target marker. Unless indicated otherwise, “binding affinity” refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (i.e., antibody and target marker). The affinity of an antibody for its target marker can generally be represented by the dissociation constant (Kd) or the association constant (KA). Affinity can be measured by common methods known in the art.
In particular embodiments, binding affinities can be assessed in relevant in vitro conditions, such as a buffered salt solution approximating physiological pH (7.4) at room temperature or 37° C.
In particular embodiments, “bind” means that the antibody associates with its target marker with a dissociation constant (1(D) of 10−8 M or less, in particular embodiments of from 10−5 M to 10−13 M, in particular embodiments of from 10−5 M to 10−10 M, in particular embodiments of from 10−5 M to 10−7 M, in particular embodiments of from 10−8 M to 10−13 M, or in particular embodiments of from 10−9 M to 10−13 M. The term can be further used to indicate that the antibody does not bind to other biomolecules present, (e.g., it binds to other biomolecules with a dissociation constant (KD) of 10−4 M or more, in particular embodiments of from 10−4 M to 1 M).
In particular embodiments, “bind” means that the antibody associates with its target marker with an affinity constant (i.e., association constant, KA) of 107 M−1 or more, in particular embodiments of from 105 M−1 to 1013 M−1, in particular embodiments of from 105 M−1 to 1010 M−1, in particular embodiments of from 105 M−1 to 108 M−1, in particular embodiments of from 107 M−1 to 1013 M−1, or in particular embodiments of from 107 M−1 to 108 M−1. The term can be further used to indicate that the antibody does not bind to other biomolecules present, (e.g., it binds to other biomolecules with an association constant (KA) of 104 M−1 or less, in particular embodiments of from 104 M−1 to 1 M−1).
Naturally occurring antibody structural units include a tetramer. Each tetramer includes two pairs of polypeptide chains, each pair having one light chain and one heavy chain.
The amino-terminal portion of each chain includes a variable region that is responsible for target marker recognition and epitope binding. The variable regions exhibit the same general structure of relatively conserved framework regions (FR) joined by three hyper variable regions, also called complementarity determining regions (CDRs). The CDRs from the two chains of each pair are aligned by the framework regions, which enables binding to a specific target marker epitope. From N-terminal to C-terminal, both light and heavy chain variable regions include the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is typically in accordance with the definitions of Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)), or Chothia & Lesk, J. Mol. Biol., 196:901-917 (1987); Chothia et al., Nature, 342:878-883 (1989).
Within full-length light and heavy chains, the variable and constant regions are joined by a “J” region of amino acids, with the heavy chain also including a “D” region of amino acids. See, e.g., Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)).
Human light chains are classified as kappa and lambda light chains. Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. IgG has several subclasses, including, IgG1, IgG2, IgG3, and IgG4. IgA is similarly subdivided into subclasses including IgA1 and IgA2.
CDRs from antibodies that bind target markers can be utilized to aid in the preparation of pHSC populations in a variety of binding domain formats. For example, particular embodiments can include binding fragments of an antibody, e.g., Fv, Fab, Fab′, F(ab′)2, Fc, and single chain Fv fragments (scFvs) or any effective binding fragments of an antibody that bind specifically to the targeted marker.
A single chain variable fragment (scFv) is a fusion protein of the variable regions of the heavy and light chains of immunoglobulins connected with a short linker peptide. Fv fragments include the V L and V H domains of a single arm of an antibody, but lack the constant regions. Although the two domains of the Fv fragment, VL and VH, are coded by separate genes, they can be joined, using, for example, recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (single chain Fv (scFv)). For additional information regarding Fv and scFv, see e.g., Bird, et al., Science 242 (1988) 423-426; Huston, et al., Proc. Natl. Acad. Sci. USA 85 (1988) 5879-5883; Plueckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore (eds.), Springer-Verlag, New York), (1994) 269-315; WO1993/16185; U.S. Pat. Nos. 5,571,894; and 5,587,458.
A Fab fragment is a monovalent antibody fragment including VL, VH, CL and CH1 domains. A F(ab′)2 fragment is a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region. Diabodies include two epitope-binding sites that may be bivalent. See, for example, EP 0404097; WO1993/01161; and Holliger, et al., Proc. Natl. Acad. Sci. USA 90 (1993) 6444-6448. Dual affinity retargeting antibodies (DART™; based on the diabody format but featuring a C-terminal disulfide bridge for additional stabilization (Moore et al., Blood 117, 4542-51 (2011))) can also be formed. Antibody fragments can also include isolated CDRs. For a review of antibody fragments, see Hudson, et al., Nat. Med. 9 (2003) 129-134.
Unless otherwise indicated, the term “antibody” includes antibodies including two full-length heavy chains and two full-length light chains, the fragments as described above, and variants described more fully below. Furthermore, unless explicitly excluded, antibodies can include monoclonal antibodies, human or humanized antibodies, bispecific antibodies, polyclonal antibodies, linear antibodies, minibodies, domain antibodies, synthetic antibodies, chimeric antibodies, antibody fusions, and fragments thereof, respectively.
A monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies including the population are identical and/or bind the same target marker epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which include different antibodies directed against different epitopes of an antigen, each monoclonal antibody of a monoclonal antibody preparation is directed against a single epitope on an antigen. Thus, the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, monoclonal antibodies can be made by a variety of techniques, including the hybridoma method, recombinant DNA methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci.
In particular embodiments, an anti-LHR binding agent includes a CDRH1 including GYSITSGYG (SEQ ID NO: 28); a CDRH2 including IHYSGST (SEQ ID NO: 29); a CDRH3 including ARSLRY (SEQ ID NO: 30); and a CDRL1 including SSVNY (SEQ ID NO: 31); a CDRL2 including DTS; and a CDRL3 including HQWSSYPYT (SEQ ID NO: 32).
In particular embodiments, an anti-LHR binding agent includes a CDRH1 including GFSLTTYG (SEQ ID NO: 33); a CDRH2 including IWGDGST (SEQ ID NO: 34); and a CDRH3 including AEGSSLFAY (SEQ ID NO: 35); and a CDRL1 including QSLLNSGNQKNY (SEQ ID NO: 36); a CDRL2 including WAS; and a CDRL3 including QNDYSYPLT (SEQ ID NO: 37).
In particular embodiments, an anti-LHR binding agent includes a CDRH1 including GYSFTGYY (SEQ ID NO: 38); a CDRH2 including IYPYNGVS (SEQ ID NO: 39); and a CDRH3 including ARERGLYQLRAMDY (SEQ ID NO: 40); and a CDRL1 including QSISNN (SEQ ID NO: 41); a CDRL2 including NAS; and a CDRL3 including QQSNSWPYT (SEQ ID NO: 42).
In particular embodiments, an anti-LHR binding agent includes a heavy chain including EVQLQESGPDLVKPSQSLSLTCTVTGYSITSGYGWHRQFPGNKLEWMGYIHYSGSTTYNPSLK SRISISRDTSKNQFFLQLNSVTTEDTATYYCARSLRYWGQGTTLTVSS (SEQ ID NO: 43) and a light chain including DIVMTQTPAIMSASPGQKVTITCSASSSVNYMHVVYQQKLGSSP KLWIYDTSKLAPG VPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSYPYTFGSGTKLEIK (SEQ ID NO: 44).
In particular embodiments, an anti-LHR binding agent includes a heavy chain including QVQLKESGPGLVAPSQSLSrrCTVSGFSLTTYGVSVVVRQPPGKGLEWLGVIWGDGSTYYHSAL ISRLSISKDNSKSQVFLKLNSLQTDDTATYYCAEGSSLFAYWGQGTLVTVS A (SEQ ID NO: 45) and a light chain including DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQ QKPGQPPKLLIYWASTRQSGVPDRFTGSGSGTDFTLTISSVQAEDXAVYYCQNDYSYPLTFGS GTKLEIK (SEQ ID NO: 46).
In particular embodiments, an anti-LHR binding agent includes a heavy chain including EVQLEQSGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTLHYA DTVKGRFTISRDNPKNTLFLQMKLPSLCYGLLGSRNLSHRLL (SEQ ID NO: 47) and a light chain including DIVLTQTPSSLSASLG DTITITCHASQN I NVWLFVVYQQKPGN I PKLLIYKASN LLTGVPSRFSGSG SGTGFTLTISSLQPEDIATYYCQQGQSFPVVTFGGGTKLEIK (SEQ ID NO: 48).
In particular embodiments, an anti-LHR binding agent includes a heavy chain including QVKLQQSG PELVKPGASVKI SCKASGYSFTGYYM HVVVKQSHG N I LDWIGYIYPYNGVSSYNQK FKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARERGLYQLRAMDYW GQGTSVTVSS (SEQ ID NO: 49) and a light chain including DIVLTQTPATLSVTPGDSVSLSCRASQ SISNNLHVVYQQKSHESPRLLI KNASQSISGI PSKFSGSGSGTDFTLRI NSVETEDFGMYFCQQS NSWPYTFGSGTKLEIK (SEQ ID NO: 50).
II. Use of LH Agonists to Promote pHSC Expansion. Particular embodiments include expanding LHR+ HSC1 and/or LHR+ HSC2 cells (or LHR+ LT-HSCs and/or LHR+ ST-HSCs mouse cells) by contacting the cells with an LH agonist to aid in the preparation of pHSC populations with sufficient numbers for a therapeutic use.
LH agonists include natural LH agonists and functional LH agonists. Natural LH agonists can include the native mammalian LH. The native mammalian LH is a gonadotropin secreted by the anterior lobe of the pituitary. LH is a heterodimer including non-covalently bound alpha and beta subunits. The alpha subunit is common among LH, FSH and hCG, and the beta subunit is specific for each hormone.
In particular embodiments, the LH agonist is LH (see, for example, U.S. Pat. No. 5,444,167). In particular embodiments, an LH agonist is recombinantly produced human LH. In particular embodiments, an LH agonist includes the sequence: EHWSYGLRPG (SEQ ID NO: 51).
In particular embodiments, a natural LH agonist is a protein which (1) includes a polypeptide that shares at least 90% sequence identity to the native human LH; and (2) possesses the biological activity of the native mammalian LH.
A functional LH agonist is a compound that binds to and activates LHR, although it does not necessarily share at least 90% sequence identity with LH. In particular embodiments, a functional LH agonist useful in the present disclosure may have the native alpha subunit, with the beta subunit having mutations. Alternatively, the LH may have the native beta subunit, with the alpha subunit having mutations. The functional LH agonist may also have both the alpha and beta subunit sharing a substantial sequence similarity with a native, corresponding subunit, but the entire sequence including less than 90% sequence identity with LH. Thus, in particular embodiments, LH analogs include a deletional, insertional, or substitutional mutants of a native LH subunit.
LH orthologues encompass LH from other species and the naturally occurring variants thereof.
LH and human chorionic gonadotropin (hCG) bind to the same LH receptor. In particular embodiments, hCG is used clinically as a surrogate for LH.
In particular embodiments, fresh LH can be added to culture conditions on a daily basis, every other day, every third day, or every fourth day at a dose of, for example, 0.05, 0.5, 5, 50 and/or 500 nM.
Particular embodiments include expansion in culture conditions including StemSpan supplemented with penicillin/streptomycin and 50-150 ng/ml (e.g., 100 ng/ml) stem cell factor (SCF; also known as the c-kit ligand or mast cell growth factor), thrombopoietin (TPO) and Flt-3 ligand (Flt-3L).
Additional culture conditions can include expansion in the presence of one more growth factors, such as: angiopoietin-like proteins (Angptls, e.g., Angptl2, Angptl3, Angptl7, Angpt15, and Mfap4); erythropoietin; fibroblast growth factor-1 (FGF-1); granulocyte colony stimulating factor (G-CSF); granulocyte-macrophage colony stimulating factor (GM-CSF); insulin growth factor-2 (IFG-2); interleukin-3 (IL-3); interleukin-6 (IL-6); interleukin-7 (IL-7); interleukin-11 (IL-11); and analogs thereof (wherein the analogs include any structural variants of the growth factors having the biological activity of the naturally occurring growth factor; see, e.g., WO 2007/1145227 and U.S. Patent Publication No. 2010/0183564).
In particular embodiments, the amount or concentration of growth factors suitable for expanding HSC is the amount or concentration effective to promote expansion of HSC, but substantially no differentiation of the HSC.
The amount or concentration of growth factors suitable for expanding HSC depends on the activity of the growth factor preparation, and the species correspondence between the growth factors and HSC, etc. Generally, when the growth factor(s) and HSC are of the same species, the total amount of growth factor in the culture medium ranges from 1 ng/ml to 5 μg/ml, from 5 ng/ml to 1 μg/ml, or from 5 ng/ml to 250 ng/ml. In additional embodiments, the amount of growth factors can be in the range of 5-1000 or 50-100 ng/ml.
In particular embodiments, the foregoing growth factors are present in the culture condition for expanding HSC at the following concentrations: 25-300 ng/ml SCF, 25-300 ng/ml Flt-3L, 25-100 ng/ml TPO, 25-100 ng/ml IL-6 and 10 ng/ml IL-3. In more specific embodiments, 50, 100, or 200 ng/ml SCF; 50, 100, or 200 ng/ml of Flt-3L; 50 or 100 ng/ml TPO; 50 or 100 ng/ml IL-6; and 10 ng/ml IL-3 can be used.
In particular embodiments, HSC expansion disclosed herein does not utilize an extracellular matrix protein such as fibronectin (FN), or a fragment thereof (e.g., CH-296 (Dao et. al., 1998, Blood 92(12):4612-21)) or RetroNectin® (a recombinant human fibronectin fragment; (Clontech Laboratories, Inc., Madison, WI). In particular embodiments, the culture system is a stroma-free culture system.
In particular embodiments, expansion results in (or more than) a 50-, 75-, 100- 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 1000-, 2000-, 3000-, 4000-, 5000-fold increase in the number of HSC in the expanded sample, relative to the unexpanded sample. In particular embodiments, cell populations are also preferably expanded until a sufficient number of cells are obtained to provide for at least one infusion into a human subject, typically around 104 cells/kg to 109 cells/kg or 2×106 cells/kg subject body weight.
For additional general information regarding appropriate culturing and/or expansion conditions, see U.S. Pat. No. 7,399,633; U.S. Patent Publication No. 2010/0183564; Freshney Culture of Animal Cells, Wiley-Liss, Inc., New York, NY (1994)); Vamum-Finney et al., 1993, Blood 101:1784-1789; Ohishi et al., 2002, J. Clin. Invest. 110:1165-1174; Delaney et al., 2010, Nature Med. 16(2): 232-236; WO 2006/047569A2; WO 2007/095594A2; U.S. Pat. No. 5,004,681; WO 2011/127470 A1; WO 2011/127472A1; and See Chapter 2 of Regenerative Medicine, Department of Health and Human Services, August 2006, and the references cited therein.
III. Targeting LHR-expressing pHSC for Selective Ablation During Conditioning Before a HSC Transplant and/or Infusion of Genetically Modified Cells and/or as a Treatment for Malignancies Associated with Hyperproliferative HSC. As indicated, for many therapeutic uses of HSCs it is beneficial to ablate a patient's existing HSC. Selective ablation of endogenous HSC can open a niche for the engraftment of therapeutic HSC without general ablation of cells in the tissue, such as that caused by radiation or chemotherapy. The more targeted ablation approach reduces the effects of such therapies on non-targeted cells and tissues, such as platelets, white blood cells and red blood cells as well as undesirable side effects upon other tissues (e.g. on cells of the gastrointestinal system, hair growth, and the increased risk of secondary malignancies). In particular embodiments, relative to traditional conditioning regimens, the methods disclosed herein do not induce neutropenia, thrombocytopenia and/or anemia and/or induces less neutropenia, thrombocytopenia and/or anemia than conditioning regimens currently used in the clinical setting. The reduced side effects associated with HSC ablation methods disclosed herein can be especially beneficial for pediatric patients.
In particular embodiments, selective ablation of endogenous HSC can provide a treatment for malignancies associated with hyperproliferative HSC, such as leukemias, lymphomas, and myelomas.
Particular embodiments utilize LHR binding agents that result in ablation of LHR-expressing pHSC. Particular embodiments include ablating pHSC within a niche. In mammals, endogenous HSC reside in the bone marrow, and thus ablative agents will reduce the numbers of pHSC resident in bone marrow.
“Ablate” and “ablation” generally refer to the partial or complete removal of a population of cells (e.g., HSC) from target tissues (e.g., bone marrow tissues of a subject). In particular embodiments, such ablation includes a complete removal or depletion of such cells from the target tissue. Alternatively, in other aspects, such ablation is a partial removal or depletion of such cells (e.g., HSCs) from the target tissue. For example, in particular embodiments, the methods disclosed herein result in at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97.5%, 98% or 99% depletion of pHSC. In particular embodiments, ablation results in a pHSC reduction of at least 75%, at least 80% at least 90%, at least 95%, at least 99% or more.
In particular embodiments, LHR binding agents include anti-LHR antibodies conjugated to a toxin such as Saporin. As indicated previously, numerous anti-LHR antibodies are commercially available.
The carboxy-terminal portion of each antibody chain defines a constant region that can be responsible for effector function in vivo. Examples of effector functions include: C1q binding and complement dependent cytotoxicity (CDC); antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptors); and B cell activation.
Antibodies of interest for ablation may be tested for their ability to induce ADCC. Assays for apoptosis may be performed by the terminal deoxynucleotidyl transferase-mediated digoxigenin-11-dUTP nick end labeling (TUNEL) assay (Lazebnik et al., Nature: 371, 346 (1994)). Cytotoxicity may also be detected directly by detection kits known in the art, such as Cytotoxicity Detection Kit from Roche Applied Science (Indianapolis, Ind.). Preferably, the antibodies utilized within the present disclosure induce at least 10%, 20%, 30%, 40%, 50%, 60%, 80%, 90%, 95%, or 100% cytotoxicity of targeted pHSC.
Antibodies lacking fucose have been correlated with enhanced ADCC activity, especially at low doses of antibody. Methods of preparing fucose-less antibodies include growth in rat myeloma YB2/0 cells (ATCC CRL 1662). YB2/0 cells express low levels of FUT8 mRNA, which encodes an enzyme (a1,6-fucosyltransferase) necessary for fucosylation of polypeptides. Alternative embodiments for promoting cytotoxicity of cells with antibody treatment include antibody-mediated stimulation of signaling cascades resulting in cell death to the antibody bound cell. In addition, antibody-mediated stimulation of the innate immune system (e.g. through NK cells) may also result in the death of targeted LHR-expressing cells.
In particular embodiments of the disclosure, the antibody is of an isotype that can bind Fc receptors on macrophages and drive opsonization (Rashid et al., J. Immunol. 1992, 148:1382-1388). In particular embodiments, the antibody is of an IgG isotype, e.g. IgG1, IgG2, IgG3, IgG4, etc. In particular embodiments, the antibody is a rodent antibody of the IgG2b type. In other embodiments, the isotype is a human or humanized antibody of the IgG3 isotype (for review, see Davies and Metzger, Ann Rev Immunol 1983 1:87-117). Where a candidate antibody is of an isotype that does not bind Fc receptors and/or drive opsonization, the antibody may be modified through various methods known in the art to change the isotype to one that does bind Fc receptors and/or drive opsonization.
In particular embodiments for administration to humans, human antibodies can be used. A human antibody is one which includes an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences.
Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001) and Lonberg, Curr. Opin. Immunol. 20:450-459 (2008). Human antibodies may be prepared by administering LHR (or a fragment thereof) to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic mice, the endogenous immunoglobulin loci have generally been inactivated. For review of methods for obtaining human antibodies from transgenic animals, see Lonberg, Nat. Biotech. 23:1117-1125 (2005). See also, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 describing XENOMOUSE™ technology; U.S. Pat. No. 5,770,429 describing HUMAB technology; U.S. Pat. No. 7,041,870 describing K-M MOUSE® technology, and U.S. Patent Application Publication No. US 2007/0061900, describing VELOCIMOUSE® technology). Human variable regions from intact antibodies generated by such animals may be further modified, e.g., by combining with a different human constant region.
Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described. (See, e.g., Kozbor J. Immunol., 133: 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al., J. Immunol., 147: 86 (1991).) Human antibodies generated via human B-cell hybridoma technology are also described in Li et al., Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006). Additional methods include those described, for example, in U.S. Pat. No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26(4):265-268 (2006) (describing human-human hybridomas). Human hybridoma technology (Trioma technology) is also described in Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) and Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3):185-91 (2005).
Traditional strategies for hybridoma development using mice, llamas, chicken, rats, hamsters, rabbits, etc. can also be used.
If produced or utilized antibodies are not human, such antibodies can be humanized. A “humanized” antibody refers to a chimeric antibody including amino acid residues from non-human CDRs and amino acid residues from human FRs. In particular embodiments, a humanized antibody will include substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDRs correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody. A humanized antibody optionally may include at least a portion of an antibody constant region derived from a human antibody. A “humanized form” of an antibody, e.g., a non-human antibody, refers to an antibody that has undergone humanization.
Humanized antibodies and methods of making them are reviewed, e.g., in Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008), and are further described, e.g., in Riechmann et al., Nature 332:323-329 (1988); Queen et al., Proc. Nat'l Acad. Sci. USA 86:10029-10033 (1989); U.S. Pat. Nos. 5,821,337, 7,527,791, 6,982,321, and 7,087,409; Kashmiri et al., Methods 36:25-34 (2005) (describing SDR (a-CDR) grafting); Padlan, Mol. Immunol. 28:489-498 (1991) (describing “resurfacing”); Dall'Acqua et al., Methods 36:43-60 (2005) (describing “FR shuffling”); and Osbourn et al., Methods 36:61-68 (2005) and Klimka et al., Br. J. Cancer, 83:252-260 (2000) (describing the “guided selection” approach to FR shuffling).
Human framework regions that may be used for humanization include: framework regions selected using the “best-fit” method (see, e.g., Sims et al., J. Immunol. 151:2296 (1993)); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al., Proc. Nati. Acad. Sci. USA, 89:4285 (1992); and Presta et al., J. Immunol., 151:2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008)); and framework regions derived from screening FR libraries (see, e.g., Baca et al., J. Biol. Chem. 272:10678-10684 (1997) and Rosok et al., J. Biol. Chem. 271:22611-22618 (1996)).
A human consensus framework is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin variable light (VL) or variable heavy (VH) framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences. The subgroup of sequences can be a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda Md. (1991), vols. 1-3. In particular embodiments, for the VL, the subgroup is subgroup kappa I as in Kabat et al., supra. In particular embodiments, for the VH, the subgroup is subgroup III as in Kabat et al., supra.
In particular embodiments, antibody variants have been modified from a reference sequence to produce an administration benefit. Exemplary administration benefits can include (1) reduced susceptibility to proteolysis, (2) reduced susceptibility to oxidation, (3) altered binding affinity for forming protein complexes, (4) altered binding affinities, (5) reduced immunogenicity; and/or (6) extended half-live. For discussion of Fab and F(ab′)2 fragments having increased in vivo half-life, see U.S. Pat. No. 5,869,046.
As indicated particular embodiments can utilize variants of anti-LHR antibodies. Variants of anti-LHR antibodies can include those having one or more conservative amino acid substitutions or one or more non-conservative substitutions that do not adversely affect the binding of the antibody to LHR.
In particular embodiments, a VL region can include one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions), or a combination of the above-noted changes, when compared to an antibody produced and characterized according to methods disclosed herein. An insertion, deletion or substitution may be anywhere in the VL region, including at the amino- or carboxy-terminus or both ends of this region, provided that each CDR includes zero changes or at most one, two, or three changes and provided an antibody including the modified VL region can still specifically bind LHR with an affinity similar to the reference antibody.
In particular embodiments, a VH region can be derived from or based on a disclosed VH and can include one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions or non-conservative amino acid substitutions), or a combination of the above-noted changes, when compared with when compared to an antibody produced and characterized according to methods disclosed herein. An insertion, deletion or substitution may be anywhere in the VH region, including at the amino- or carboxy-terminus or both ends of this region, provided that each CDR includes zero changes or at most one, two, or three changes and provided an antibody including the modified VH region can still specifically bind its target epitope with an affinity similar to the reference antibody.
In particular embodiments, one or more amino acid modifications may be introduced into the Fc region of an antibody, thereby generating an Fc region variant. The Fc region variant may include a human Fc region sequence (e.g., a human IgG1 (EPKSCDKTHTCPPCP (SEQ ID NO: 52)), IgG2 (ERKCCVECPPCP (SEQ ID NO: 53)), IgG3 (ELKTPLGDTHTCPRCP (SEQ ID NO: 54); or IgG4 (ESKYGPPCPSCP (SEQ ID NO: 55)) Fc region) including an amino acid modification (e.g. a substitution) at one or more amino acid positions. Exemplary human IgG4 modifications include ESKYGPPCPPCP (SEQ ID NO: 56); YGPPCPPCP (SEQ ID NO: 57); KYGPPCPPCP (SEQ ID NO: 58); and EVVKYGPPCPPCP (SEQ ID NO: 59).
In particular embodiments for ablation, antibodies can be coupled to a toxin. Toxins can include molecules that inactivate ribosomes, inhibit RNA polymerase II and/or III, and/or inhibits protein synthesis. Toxins include anti-tubulin agents (e.g. maytansines) or tubulin inhibitors, DNA crosslinking agents, DNA alkylating agents and cell cycle or mitotic disrupters. Examples of toxins include abrin A chain, abrin toxin, amatoxin (e.g., α-amanitin, β-amanitin, γ-amanitin, £-amanitin, amanin, amaninamide, amanullin, amanullinic acid), auristatin-E, crotin, curcin, diphtheria A chain, diphtheria toxin, enomycin, exotoxin A chain, gelonin toxin, luffin toxin, modeccin toxin, momordin toxin, phenomycin, pseudomonas exotoxin A, radiochemicals (e.g., radioisotopes), Ricin A chain, saporin, and trichosanthin toxin. Particular embodiments utilize saporin.
In particular embodiments, the toxic agent is a selective inhibitor of growth factor signaling required for stem cell maintenance or growth. Exemplary of such agents are those that inhibit c-kit mediated signaling, which is required for maintenance of HSC. Such agents include antibodies that bind to and interfere with c-kit signaling; and drugs that selectively inhibit c-kit signaling, e.g. imatinib, nilotinib, certain 5-substituted 1,4-dihydroindeno[1,2-c]pyrazoles, etc., as known in the art and discussed in, for example, WO03028711; WO/2005/115304; Bioorganic & Medicinal Chemistry Letters (2007) 17:3136-3140; and Chow et al., (2007) Leuk Lymphoma. 2007 48(7):1379-88.
In particular embodiments, CAR-modified immune cells can also be used as LHR binding agents to target LHR-expressing pHSC for ablation. In these embodiments, immune cells (e.g., T cells, natural killer cells) can be genetically modified with polynucleotides that express chimeric antigen receptors (CAR) to ablate LHR-expressing pHSC. CAR refer to synthetically designed receptors including at least a binding domain that binds LHR and an effector domain and optionally a spacer domain and/or a transmembrane domain. CAR-modified immune cells can mediate the ablation of cells bound by the CAR-binding domain.
CAR binding domains for LHR can be generated from the CDRs of existing or prepared anti-LHR antibodies and variants thereof as described above. In particular embodiments, CAR binding domains can include the LH alpha subunit and the LH beta subunit.
Effector domains are capable of transmitting functional signals to an immune cell. In particular embodiments, an effector domain will directly or indirectly promote a cellular response by associating with one or more other proteins that directly promote a cellular response. Effector domains can provide for activation of at least one function of a transduced lymphocyte expressing the CAR upon binding to LHR expressed on a targeted HSC. Activation of the lymphocyte can include one or more of proliferation, differentiation, activation or other effector functions.
An effector domain may include one, two, three or more receptor signaling domains, intracellular signaling domains, costimulatory domains, or combinations thereof. Any intracellular effector domain, costimulatory domain or both from any of a variety of signaling molecules (e.g., signal transduction receptors) may be used in the CARs for purposes described herein.
Exemplary effector domains include those from 4-1BB, CD3ϵ, CD3δ, CD3ζ, CD27, CD28, CD79A, CD79B, CARD11, DAP10, FcRα, FcRβ, FcRγ, Fyn, HVEM, ICOS, Lck, LAG3, LAT, LRP, NOTCH1, Wnt, NKG2D, OX40, ROR2, Ryk, SLAMF1, Slp76, pTα, TCRα, TCRβ, TRIM, Zap70, PTCH2, or any combination thereof.
In particular embodiments, 4-1BB includes KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCR FPEEEEGGCEL (SEQ ID NO: 26). Uniprot Q07011 provides 4-1BB including residues 1-23 (signal peptide); 24-186 (extracellular domain); 187-213 (transmembrane domain); and 214-255 (intracellular domain).
In particular embodiments, a CD28 signaling region includes MLRLLLALNLFPSIQ VTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQV YSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCP SPLFPGPSKPFVVVLVVVGGVLACYSLLVTVAFIIFVVVRSKRSRLLHSDYMNMTPRRPGPTRKH YQPYAPPRD FAAYRS (SEQ ID NO: 60). For reference, Uniprot P10747 includes CD28 including residues 1-18 (signal peptide); 19-152 (extracellular domain); 153-179 (transmembrane domain); and 180-220 (intracellular domain) wherein residues 186 and 187 can be LL or GG.
In particular embodiments, a CD3 zeta signaling region includes RVKFSRSADA PAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEA YSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 27).
In particular embodiments, a CD3 zeta signaling region includes AKFSRSAETAANLQ DPNQLYNELN LGRREEYDVLEKKRARDPEMGGKQQRRRN PQEGVYNALQKDKMAEAYSEIG TKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLAPR (SEQ ID NO: 16).
Uniprot P20963 provides human CD3 zeta isoform 3 including residues 1-21 (signal peptide); 22-30 (extracellular domain); 31-51 (transmembrane domain); 52-164 (intracellular domain); 61-89 (ITAM1); 100-128 (ITAM2); and 131-159 (ITAM3).
T cell activation particularly can be said to be mediated by two distinct classes of cytoplasmic signaling sequence: those that initiate antigen-dependent primary activation and provide a T cell receptor like signal (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signaling sequences). Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as receptor tyrosine-based activation motifs or iTAMs. Examples of iTAM containing primary cytoplasmic signaling sequences include those derived from CD3 zeta, FeR gamma, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d. In particular embodiments, ITAM1 refers to APAYQQGQNQLYNELNLGRREEYDVLDKR (SEQ ID NO: 61); ITAM2 refers to PQRRKNPQEGLYNELQKDKMAEAYSEIGM (SEQ ID NO: 62); and ITAM3 refers to ERRRGKGHDGLYQGLSTATKDTYDALHMQ (SEQ ID NO: 63).
In particular embodiments, an effector domain includes a cytoplasmic portion that associates with a cytoplasmic signaling protein, wherein the cytoplasmic signaling protein is a lymphocyte receptor or signaling domain thereof, a protein including a plurality of ITAMs, a costimulatory factor, or any combination thereof.
Examples of intracellular signaling domains include the cytoplasmic sequences of the CD3 zeta chain, and/or co-receptors that act in concert to initiate signal transduction following CAR engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability. In particular embodiments, an intracellular signaling domain of a CAR can be designed to include an intracellular signaling domain combined with any other desired cytoplasmic domain(s). For example, the intracellular signaling domain of a CAR can include an intracellular signaling domain and a costimulatory signaling region. The costimulatory signaling region refers to a portion of the CAR including the intracellular domain of a costimulatory molecule. A costimulatory molecule is a cell surface molecule other than the expressed marker ligand that is required for a response of lymphocytes to a marker. Examples of such molecules include CD27, CD28, 4-1BB (CD 137), OX40, CD30, CD40, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83.
In particular embodiments, CAR polynucleotides can include a sequence encoding for a spacer region. The length of the spacer region can be customized to optimize LHR recognition. In particular embodiments, a spacer length can be selected based upon the location of a marker epitope, affinity of an antibody for the epitope, and/or the ability of the lymphocytes expressing the CAR to proliferate in vivo in response to LHR recognition.
Typically, a spacer region is found between the binding domain and a transmembrane domain of the CAR. Spacer regions can provide for flexibility of the binding domain and allows for high expression levels in the modified cells. In particular embodiments, a spacer region can have at least 10 to 250 amino acids, at least 10 to 200 amino acids, at least 10 to 150 amino acids, at least 10 to 100 amino acids, at least 10 to 50 amino acids or at least 10 to 25 amino acids and including any integer between the endpoints of any of the listed ranges. In further embodiments, a spacer region has 250 amino acids or less; 200 amino acids or less, 150 amino acids or less; 100 amino acids or less; 50 amino acids or less; 40 amino acids or less; 30 amino acids or less; 20 amino acids or less; or 10 amino acids or less.
In particular embodiments, spacer regions can be derived from a hinge region of an immunoglobulin like molecule, for example all or a portion of the hinge region from a human IgG1, human IgG2, a human IgG3, or a human IgG4. In particular embodiments, a hinge region includes a CD8 hinge and/or a CD28 hinge.
An exemplary hinge sequence derived from the IgG1 heavy chain is encoded by CTCGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCG (SEQ ID NO: 64).
Exemplary CD8 hinge domains include AAASTTTKPVLRTPSPVHPTGTSQPQRPEDC RPRGSVKGTGLDFACDIY (SEQ ID NO: 13); PAKPTTTPAPRPPTPAPTIASQP LSLRPEACRPAAGGAVHTRGLDFACDIY (SEQ ID NO: 65); KVNSTTTKPVLRTPSPV HPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY (SEQ ID NO: 66); and PVKPTTTPAPR PPTQAPITTSQRVSLRPGTCQPSAGST VEASGLDLSCDIY (SEQ ID NO: 67).
An exemplary CD28 hinge includes AAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFP GPSKP (SEQ ID NO: 24).
Hinge regions can be modified to avoid undesirable structural interactions such as dimerization. In particular embodiments, all or a portion of a hinge region can be combined with one or more domains of a constant region of an immunoglobulin. For example, a portion of a hinge region can be combined with all or a portion of a CH2 or CH3 domain or variant thereof. An example of an intermediate length spacer including an IgG4 hinge and a CH3 region includes ESKYGPPCPPCPGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSD IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY TQKSLSLSLGK (SEQ ID NO: 68). An example of a longer spacer including an IgG4 hinge and a CH3 region includes ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTP EVTCVVVDVSQEDPEVQFNVVYVDGVEVH NAKTKPREEQFNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQK SLSLSLGK (SEQ ID NO: 69). For reference, Uniprot P0861 includes a IgG4-Fc with residues 1-98 (CH1), 99-110 (hinge), 111-220 (CH2), 221-327 (CH3) wherein residue 108 can be S or P.
CARs disclosed herein can also include transmembrane domains. In particular embodiments, the CAR polynucleotide encodes the transmembrane domain. The transmembrane domain provides for anchoring of the CAR in a lymphocyte membrane. The transmembrane domain may be derived either from a natural or a synthetic source. When the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. Transmembrane regions include at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD8, CD28, CD3, CD45, CD4, CD6, CD9, CD16, CD22; CD33, CD37, CD64, CD80, CD86, CD134, CD137 and CD154. In particular embodiments, the CD8 transmembrane domain includes IWAPLAGICVALLLSLIITLI (SEQ ID NO: 14); IYIWAPLAGTCGVLLLSLVIT (SEQ ID NO: 70); or IWAPLAGICAVLLLSLVITLI (SEQ ID NO: 71). In particular embodiments, the CD28 transmembrane domain includes FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 25).
In further particular embodiments, synthetic or variant transmembrane domains include predominantly hydrophobic residues such as leucine and valine.
CAR can also include linkers, tags, reporters, and/or expression modulators. A linker can be an amino acid sequence having from one up to 500 amino acids, which can provide flexibility and room for conformational movement between two regions, domains, motifs, cassettes or modules connected by the linker. Exemplary linker sequences include those having from one to ten repeats of GlyxSery, wherein x and y are independently an integer from 0 to 10 provided that x and y are not both 0 (e.g., (Gly4Ser)3 (SEQ ID NO: 10), (Gly3Ser)2 (SEQ ID NO: 72), Gly2Ser, or a combination thereof such as (Gly3Ser)2Gly2Ser)(SEQ ID NO: 73). In certain other embodiments, a linker sequence can include one or more immunoglobulin heavy chain constant regions, such as a CH3 alone or a CH2CH3 sequence. In particular embodiments, a CH2 sequence includes APEFLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNVVYVDGVEVHNAKTKPREEQFNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAK (SEQ ID NO: 74) and a CH3 sequence includes
GQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 75).
Exemplary tags include Myc tag (EQKLISEEDL (SEQ ID NO:12)), Strep tag (which refers the original STREP® tag (WRHPQFGG (SEQ ID NO: 76)), STREP TAG® II (WSHPQFEK (SEQ ID NO: 77)), or any variant thereof; see, e.g., U.S. Pat. No. 7,981,632), His tag, Flag tag (DYKDDDDK (SEQ ID NO:78)), Xpress tag (DLYDDDDK (SEQ ID NO:79)), Avi tag (GLNDIFEAQKIEWHE (SEQ ID NO:80)), Calmodulin tag (KRRWKKNFIAVSAANRFKKISSSGAL (SEQ ID NO:81)), Polyglutamate tag, HA tag (YPYDVPDYA (SEQ ID NO:82)), Nus tag, S tag, SBP tag, Softag 1 (SLAELLNAGLGGS (SEQ ID NO:83)), Softag 3 (TQDPSRVG (SEQ ID NO:84)), V5 tag (GKPIPNPLLGLDST (SEQ ID NO:85)).
Particular embodiments can include 2A (GTGQCTNYALLKLAGDVESNPGPGS (SEQ ID NO: 17)); T2A (LEGGGEGRGSLLTCGDVEENPGPR (SEQ ID NO: 86)); T2A (GSG)EGRGSLLTCGD VEENPGP (SEQ ID NO: 87); P2A (GSG)ATNFSLLKQAGDVEENPGP (SEQ ID NO: 88); E2A (GSG) QCTNYALLKLAGDVESNPGPP (SEQ ID NO: 89); and F2A (GSG)VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 90).
Particular examples of CAR protein sequences are provided in FIG. 13A (SEQ ID NO: 7) and FIG. 13B (SEQ ID NO: 20).
Methods to genetically modify immune cells to incorporate polynucleotides encoding functional CAR are described further below in relation to genetic modifications for therapeutic purposes. Particular examples of cDNA encoding CAR are provided in FIG. 13A (SEQ ID NO: 6) and FIG. 13B (SEQ ID NO: 19).
Particular embodiments modify pHSC populations enriched or expanded according to a method disclosed herein to express a CAR. In particular embodiments, the pHSC populations differentiate into a more committed cell line before or after the modification. In particular embodiments, the pHSC populations differentiate into a more committed cell line before or after administration to a subject.
In particular embodiments, T cells are genetically modified to express CAR. T cells can refer to all types of immune cells expressing CD3 including T-helper cells (CD4+ cells), cytotoxic T-cells (CD8+ cells), natural killer T-cells, T-regulatory cells (Treg) and gamma-delta T cells. Particular embodiments genetically modify beneficial combinations of T cell types, such as CD4+ T cells and CD8+ T cells.
In particular embodiments, T cells are derived from a pHSC population enriched or expanded according to a method disclosed herein. In particular embodiments, T cells modified to express a CAR are obtained from a subject who will receive the modified T cells as a treatment. In particular embodiments, T cells are autologous T cells. In particular embodiments, T cells include autologous and allogeneic primary patient cells.
Examples of commercially available T-cell lines include lines BCL2 (AAA) Jurkat (ATCC® CRL-2902™), BCL2 (S70A) Jurkat (ATCC® CRL-2900™), BCL2 (S87A) Jurkat (ATCC® CRL-2901™), BCL2 Jurkat (ATCC® CRL-2899™), Neo Jurkat (ATCC® CRL-2898™), TALL-104 cytotoxic human T cell line (ATCC #CRL-11386). Further examples include mature T-cell lines, e.g., such as Deglis, EBT-8, HPB-MLp-W, HUT 78, HUT 102, Karpas 384, Ki 225, My-La, Se-Ax, SKW-3, SMZ-1 and T34; and immature T-cell lines, e.g., ALL-SIL, Be13, CCRF-CEM, CML-T1, DND-41, DU.528, EU-9, HD-Mar, HPB-ALL, H-SB2, HT-1, JK-T1, Jurkat, Karpas 45, KE-37, KOPT-K1, K-T1, L-KAW, Loucy, MAT, MOLT-1, MOLT 3, MOLT-4, MOLT 13, MOLT-16, MT-1, MT-ALL, P12/Ichikawa, Peer, PER0117, PER-255, PF-382, PFI-285, RPMI-8402, ST-4, SUP-T1 to T14, TALL-1, TALL-101, TALL-103/2, TALL-104, TALL-105, TALL-106, TALL-107, TALL-197, TK-6, TLBR-1, -2, -3, and -4, CCRF-HSB-2 (CCL-120.1), J.RT3-T3.5 (ATCC TIB-153), J45.01 (ATCC CRL-1990), J.CaM1.6 (ATCC CRL-2063), RS4;11 (ATCC CRL-1873), CCRF-CEM (ATCC CRM-CCL-119); and cutaneous T-cell lymphoma lines, e.g., HuT78 (ATCC CRM-TIB-161), MJ[G11] (ATCC CRL-8294), HuT102 (ATCC TIB-162).
Particular embodiments modify natural killer cells (also known as NK cells and killer cells) cells to express CAR. NK cells are activated in response to interferons or macrophage-derived cytokines. They serve to contain viral infections while the adaptive immune response is generating antigen-specific cytotoxic T cells that can clear the infection. NK cells express CD8, CD16 and CD56 but do not express CD3. In particular embodiments, NK cells are genetically modified to express CAR. In particular embodiments, NK cells are derived from a pHSC population enriched or expanded according to a method disclosed herein. In particular embodiments, NK cells modified to express a CAR are obtained from a subject who will receive the modified NK cells as a treatment. In particular embodiments, NK cells are autologous NK cells. In particular embodiments, NK cells include autologous and allogeneic primary patient cells.
Examples of commercial NK cell lines include lines NK-92 (ATCC® CRL-2407™), NK-92MI (ATCC® CRL-2408™), HANK1, KHYG-1, NKL, NK-YS, NOI-90, and YT.
Particular embodiments may also utilize mixtures of pHSC, HSC, HSPC, T cells, and/or NK cells. In particular embodiments, some cells within a mixture are genetically modified and some are not. In particular embodiments, some classes of cells within a mixture are genetically modified and other classes are not.
As indicated, particular embodiments include use of an antibody directed against LHR wherein the antibody is conjugated to a toxin to clear HSCs from a niche. Particular embodiments include use of a CAR immune cell directed against LHR. HSC clearance from a niche improves subsequent engraftment of therapeutically-administered HSC. Thus, in particular embodiments, the present disclosure combines the use of selective ablation of endogenous HSC, in combination with the administration to the recipient of exogenous therapeutic HSC, resulting in efficient, long-term engraftment and tolerance.
Following ablation, and after a period of time sufficient to substantially eliminate the HSC ablative agent from the patient circulation, exogenous HSC are introduced to the patient, where the exogenous HSC occupy the same niche as the ablated endogenous HSC. Exogenous HSC may be autologous, allogeneic, or xenogeneic relative to the patient.
The period of time required for clearance of the ablative agent may be empirically determined, or may be based on prior experience of the pharmacokinetics of the agent. Where the agent is an antibody, determination can be conveniently monitored by containing HSC with recipient serum, and determining the presence of antibodies that bind to the HSC. Alternatively, patient serum may be monitored for the presence of HSC selective growth inhibition. The time for clearance is usually the time sufficient for the level of ablative agent to decrease at least 10-fold from peak levels, usually at least 100-fold, 1000-fold, 10,000-fold, or more. It is preferable to introduce the therapeutic HSC within the empty niche “window” following ablation, usually within 3 days, 2 days, 1 day, or at the time of clearance.
In particular embodiments, HSC are administered to the subject after the ablative agent has cleared or dissipated from the subject's target tissues such that the level of ablative agent remaining in the target tissue of the subject does not induce significant cell death in the transplanted HSC population. For example, in particular embodiments, the HSC population is administered to the subject two to eighteen days after the administration of the ablative agent.
As indicated previously, administered HSC can be genetically-modified or non-genetically modified. The following discussion of methods to genetically-modify HSC for a therapeutic purpose can also apply to genetically-modifying immune cells to express CAR.
In particular embodiments, administered HSC may be genetically altered in order to introduce genes useful in the differentiated cell, e.g. repair of a genetic defect in an individual, selectable marker, etc., or genes useful in selection against undifferentiated cells. Cells may also be genetically modified to enhance survival, control proliferation, and the like. Cells may be genetically altered by transfection or transduction with a suitable vector, homologous recombination, or other appropriate technique, so that they express a gene of interest. In particular embodiments, cells are transfected with genes encoding a telomerase catalytic component (TERT), typically under a heterologous promoter that increases telomerase expression beyond what occurs under the endogenous promoter, (see International Patent Application WO 98/14592). In particular embodiments, a selectable marker is introduced, to provide for greater purity of the desired differentiating cell. Cells may be genetically altered using vector containing supernatants over an 8-16 h period, and then exchanged into growth medium for 1-2 days. Genetically altered cells are selected using a drug selection agent such as puromycin, G418, or blasticidin, and then recultured.
Numerous techniques for the introduction of one or more genetic modifications into cells can be used, provided that the necessary developmental and physiological functions of the recipient cells are not disrupted. See e.g., Loeffler and Behr, 1993, Meth. Enzymol. 217:599-618; Cohen, et al., 1993, Meth. Enzymol. 217:618-644; Cline, 1985, Pharmac. Ther. 29:69-92). In particular embodiments, the technique should provide for the stable transfer of nucleic acid to the cell, so that the nucleic acid is expressible by the cell and preferably heritable and expressible by its cell progeny.
Exemplary methods include transfection, electroporation, microinjection, liposomes/lipofection (Tarahovsky and lvanitsky, 1998, Biochemistry (Mosc) 63:607-618), ribozymes (Branch and Klotman, 1998, Exp. Nephrol. 6:78-83), calcium phosphate mediated transfection, infection with a viral or bacteriophage vector containing the gene sequences, cell fusion, chromosome-mediated gene transfer, microcell-mediated gene transfer, sheroplast fusion, administration of naked DNA, DNA complexes and/or triplex DNA (Chan and Glazer, 1997, J. Mol. Med. 75:267-282), transposons/transposases, etc.
A “vector” is a nucleic acid molecule that is capable of transporting another nucleic acid. Vectors may be, e.g., viruses, phage, a DNA vector, a RNA vector, a viral vector, a bacterial vector, a plasmid vector, a cosmid vector, and an artificial chromosome vector. An “expression vector” is any type of vector that is capable of directing the expression of a protein encoded by one or more genes carried by the vector when it is present in the appropriate environment.
Viral vectors are usually non-replicating or replication-impaired vectors, which means that the viral vector cannot replicate to any significant extent in normal cells (e.g., normal human cells), as measured by conventional means (e.g. via measuring DNA synthesis and/or viral titer). Non-replicating or replication-impaired vectors may have become so naturally (i.e., they have been isolated as such from nature) or artificially (e.g., by breeding in vitro or by genetic manipulation). There will generally be at least one cell-type in which the replication-impaired viral vector can be grown—for example, modified vaccinia Ankara (MVA) can be grown in CEF cells. Typically, viral vectors are incapable of causing a significant infection in a subject, typically in a mammalian subject.
“Retroviruses” are viruses having an RNA genome. In particular embodiments, a retroviral vector contains all of the cis-acting sequences necessary for the packaging and integration of the viral genome, i.e., (a) a long terminal repeat (LTR), or portions thereof, at each end of the vector; (b) primer binding sites for negative and positive strand DNA synthesis; and (c) a packaging signal, necessary for the incorporation of genomic RNA into virions. More detail regarding retroviral vectors can be found in Boesen, et al., 1994, Biotherapy 6:291-302; Clowes, et al., 1994, J. Clin. Invest. 93:644-651; Kiem, et al., 1994, Blood 83:1467-1473; Salmons and Gunzberg, 1993, Human Gene Therapy 4:129-141; Miller, et al., 1993, Meth. Enzymol. 217:581-599; and Grossman and Wilson, 1993, Curr. Opin. in Genetics and Devel. 3:110-114.
“Gammaretroviruses” refers to a genus of the retroviridae family. Exemplary gammaretroviruses include mouse stem cell virus, murine leukemia virus, feline leukemia virus, feline sarcoma virus, and avian reticuloendotheliosis viruses.
Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), simian immunodeficiency virus (SIV), human immunodeficiency virus (HIV), and combinations thereof (see, e.g., Buchscher et al., J. Virol. 66:2731-2739, 1992; Johann et al., J. Virol. 66:1635-1640, 1992; Sommerfelt et al., Virol. 176:58-59, 1990; Wilson et al., J. Virol. 63:2374-2378, 1989; Miller et al., J. Virol. 65:2220-2224, 1991; and PCT/US94/05700).
Particularly suitable are lentiviral vectors. “Lentivirus” refers to a genus of retroviruses that are capable of infecting dividing and non-dividing cells and typically produce high viral titers. Lentiviral vectors have been employed in gene therapy for a number of diseases. For example, hematopoietic gene therapies using lentiviral vectors or gamma retroviral vectors have been used for x-linked adrenoleukodystrophy and beta thalassaemia. See, e.g., Kohn et al., Clin. Immunol. 135:247-54, 2010; Cartier et al., Methods Enzymol. 507:187-198, 2012; and Cavazzana-Calvo et al., Nature 467:318-322, 2010. Several examples of lentiviruses include HIV (human immunodeficiency virus: including HIV type 1, and HIV type 2); equine infectious anemia virus; feline immunodeficiency virus (FIV); bovine immune deficiency virus (BIV); and simian immunodeficiency virus (SIV).
In particular embodiments, other retroviral vectors can be used in the practice of the methods disclosed herein. These include, e.g., vectors based on human foamy virus (HFV) or other viruses in the Spumavirus genera.
Foamy viruses (FVes) are the largest retroviruses known today and are widespread among different mammals, including all non-human primate species, however are absent in humans. This complete apathogenicity qualifies FV vectors as ideal gene transfer vehicles for genetic therapies in humans and clearly distinguishes FV vectors as gene delivery system from HIV-derived and also gammaretrovirus-derived vectors.
FV vectors are suitable for gene therapy applications because they can (1) accommodate large transgenes (>9 kb), (2) transduce slowly dividing cells efficiently, and (3) integrate as a provirus into the genome of target cells, thus enabling stable long term expression of the transgene(s). FV vectors do need cell division for the pre-integration complex to enter the nucleus, however the complex is stable for at least 30 days and still infective. The intracellular half-life of the FV pre-integration complex is comparable to the one of lentiviruses and significantly higher than for gammaretroviruses, therefore FV are also—similar to LV vectors—able to transduce rarely dividing cells. FV vectors are natural self-inactivating vectors and characterized by the fact that they seem to have hardly any potential to activate neighboring genes. In addition, FV vectors can enter any cells known (although the receptor is not identified yet) and infectious vector particles can be concentrated 100-fold without loss of infectivity due to a stable envelope protein. FV vectors achieve high transduction efficiency in HSC and have been used in animal models to correct monogenetic diseases such as leukocyte adhesion deficiency (LAD) in dogs and Fanconi anemia in mice. FV vectors are also used in preclinical studies of β-thalassemia.
Additional examples of viral vectors include those derived from adenoviruses (e.g., adenovirus 5 (Ad5), adenovirus 35 (Ad35), adenovirus 11 (Ad11), adenovirus 26 (Ad26), adenovirus 48 (Ad48) or adenovirus 50 (Ad50)), adeno-associated virus (AAV; see, e.g., U.S. Pat. No. 5,604,090; Kay et al., Nat. Genet. 24:257 (2000); Nakai et al., Blood 91:4600 (1998)), alphaviruses, cytomegaloviruses (CMV), flaviviruses, herpes viruses (e.g., herpes simplex), influenza viruses, papilloma viruses (e.g., human and bovine papilloma virus; see, e.g., U.S. Pat. No. 5,719,054), poxviruses, vaccinia viruses, etc. See Kozarsky and Wilson, 1993, Current Opinion in Genetics and Development 3:499-503, Rosenfeld, et al., 1991, Science 252:431-434; Rosenfeld, et al., 1992, Cell 68:143-155; Mastrangeli, et al., 1993, J. Clin. Invest. 91:225-234; Walsh, et al., 1993, Proc. Soc. Exp. Bioi. Med. 204:289-300; and Lundstrom, 1999, J. Recept. Signal Transduct. Res. 19: 673-686. Examples include modified vaccinia Ankara (MVA) and NYVAC, or strains derived therefrom. Other examples include avipox vectors, such as a fowlpox vectors (e.g., FP9) or canarypox vectors (e.g., ALVAC and strains derived therefrom).
Other methods of gene delivery include use of artificial chromosome vectors such as mammalian artificial chromosomes (Vos, 1998, Curr. Op. Genet. Dev. 8:351-359) and yeast artificial chromosomes (YAC). YAC are typically used when the inserted nucleic acids are too large for more conventional vectors (e.g., greater than 12 kb).
Vectors and other methods to deliver nucleic acids can include regulatory sequences to control the expression of the nucleic acid molecules. These regulatory sequences can be eukaryotic or prokaryotic in nature. In particular embodiments, the regulatory sequence can be a tissue specific promoter such that the expression of the one or more therapeutic proteins will be substantially greater in the target tissue type compared to other types of tissue. In particular embodiments, the regulatory sequence can result in the constitutive expression of the one or more therapeutic proteins or CAR upon entry of the vector into the cell. Alternatively, the regulatory sequences can include inducible sequences. Inducible regulatory sequences are well known to those skilled in the art and are those sequences that require the presence of an additional inducing factor to result in expression of the one or more therapeutic proteins or CAR. Examples of suitable regulatory sequences include binding sites corresponding to tissue-specific transcription factors based on endogenous nuclear proteins, sequences that direct expression in a specific cell type, the lac operator, the tetracycline operator and the steroid hormone operator. Any inducible regulatory sequence known to those of skill in the art may be used.
In particular embodiments, the nucleic acid is stably integrated into the genome of a cell. In particular embodiments, the nucleic acid is stably maintained in a cell as a separate, episomal segment.
In particular embodiments, the efficiency of integration, the size of the DNA sequence that can be integrated, and the number of copies of a DNA sequence that can be integrated into a genome can be improved by using transposons. Transposons or transposable elements include a short nucleic acid sequence with terminal repeat sequences upstream and downstream. Active transposons can encode enzymes that facilitate the excision and insertion of nucleic acid into a target DNA sequence.
A number of transposable elements have been described in the art that facilitate insertion of nucleic acids into the genome of vertebrates, including humans. Examples include sleeping beauty (e.g., derived from the genome of salmonid fish); piggyback (e.g., derived from lepidopteran cells and/or the Myotis lucifugus); mariner (e.g., derived from Drosophila); frog prince (e.g., derived from Rana pipiens); Tol2 (e.g., derived from medaka fish); TcBuster (e.g., derived from the red flour beetle Tribolium castaneum) and spinON. CRISPR-Cas systems may also be used.
Gene editing technologies such as CRISPR-Cas; CRISPR-Cpf1; megaTALs, TALENs, or zinc finger nucleases may also be used. For addition of gene sequences, approaches that facilitate homology-directed repair (HDR) should be adopted (e.g., homology arms).
Any nucleic acid including a therapeutic gene or CAR can be introduced into cells disclosed herein. The term “gene” refers to a nucleic acid sequence (used interchangeably with polynucleotide or nucleotide sequence) that encodes one or more therapeutic proteins or CAR as described herein. This definition includes various sequence polymorphisms, mutations, and/or sequence variants wherein such alterations do not substantially affect the function of the encoded one or more therapeutic proteins or CAR. The term “gene” may include not only coding sequences but also regulatory regions such as promoters, enhancers, and termination regions. The term further can include all introns and other DNA sequences spliced from the mRNA transcript, along with variants resulting from alternative splice sites. Gene sequences encoding the molecule can be DNA or RNA that directs the expression of the one or more therapeutic proteins or CAR. These nucleic acid sequences may be a DNA strand sequence that is transcribed into RNA or an RNA sequence that is translated into protein. The nucleic acid sequences include both the full-length nucleic acid sequences as well as non-full-length sequences derived from the full-length protein. The sequences can also include degenerate codons of the native sequence or sequences that may be introduced to provide codon preference in a specific cell type.
A gene sequence encoding one or more therapeutic proteins or CAR can be readily prepared by synthetic or recombinant methods from the relevant amino acid sequence. In particular embodiments, the gene sequence encoding any of these sequences can also have one or more restriction enzyme sites at the 5′ and/or 3′ ends of the coding sequence in order to provide for easy excision and replacement of the gene sequence encoding the sequence with another gene sequence encoding a different sequence. In particular embodiments, the gene sequence encoding the sequences can be codon optimized for expression in mammalian cells.
As one example, a gene can be selected to provide a therapeutically effective response against a condition that, in particular embodiments, is inherited. In particular embodiments, the condition can be Grave's Disease, rheumatoid arthritis, pernicious anemia, Multiple Sclerosis (MS), inflammatory bowel disease, systemic lupus erythematosus (SLE), adenosine deaminase deficiency (ADA-SCID) or severe combined immunodeficiency disease (SCID), Wiskott-Aldrich syndrome (WAS), chronic granulomatous disease (CGD), Fanconi anemia (FA), Battens disease, adrenoleukodystrophy (ALD) or metachromatic leukodystrophy (MLD), muscular dystrophy, pulmonary aveolar proteinosis (PAP), pyruvate kinase deficiency, Shwachmann-Diamond-Blackfan anemia, dyskeratosis congenita, cystic fibrosis, Parkinson's disease, Alzheimer's disease, or amyotrophic lateral sclerosis (Lou Gehrig's disease). In particular embodiments, depending on the condition, the therapeutic gene may be a gene that encodes a protein and/or a gene whose function has been interrupted. Exemplary therapeutic gene and gene products include: soluble CD40; CTLA; Fas L; antibodies to CD4, CD5, CD7, CD52, etc.; antibodies to IL1, 1L2, 1L6; an antibody to TCR specifically present on autoreactive T cells; IL4; IL10; 1L12; 1L13; IL1Ra, sIL1RI, sIL1R11; sTNFRI; sTNFRII; antibodies to TNF; P53, PTPN22, and DRB1*1501/DQB1*0602; globin family genes; WAS; phox; FANC family genes; dystrophin; pyruvate kinase; CLN3; ABCD1; arylsulfatase A; SFTPB; SFTPC; NLX2.1; ABCA3; GATA1; ribosomal protein genes; TERT; TERC; DKC1; TINF2; CFTR; LRRK2; PARK2; PARK7; PINK1; SNCA; PSEN1; PSEN2; APP; SOD1; TDP43; FUS; ubiquitin 2; and/or C9ORF72. Therapeutically effective amounts may provide function to immune and other blood cells and/or microglial cells or may alternatively—depending on the treated condition—inhibit lymphocyte activation, induce apoptosis in lymphocytes, eliminate various subsets of lymphocytes, inhibit T cell activation, eliminate or inhibit autoreactive T cells, inhibit Th-2 or Th-1 lymphocyte activity, antagonize 11_1 or TNF, reduce inflammation, induce selective tolerance to an inciting agent, reduce or eliminate an immune-mediated condition; and/or reduce or eliminate a symptom of the immune-mediated condition. Therapeutic effective amounts may also provide functional DNA repair mechanisms; surfactant protein expression; telomere maintenance; lysosomal function; breakdown of lipids or other proteins such as amyloids; permit ribosomal function; and/or permit development of mature blood cell lineages which would otherwise not develop such as macrophages other white blood cell types.
As another example, a gene can be selected to provide a therapeutically effective response against diseases related to red blood cells and clotting. In particular embodiments, the disease is a hemoglobinopathy like thalassemia, or a sickle cell disease/trait. The therapeutic gene may be, for example, a gene that induces or increases production of hemoglobin; induces or increases production of beta-globin, or alpha-globin; or increases the availability of oxygen to cells in the body. The therapeutic gene may be, for example, HBB or CYB5R3. Exemplary effective treatments may, for example, increase blood cell counts, improve blood cell function, or increase oxygenation of cells in patients. In another particular embodiment, the disease is hemophilia. The therapeutic gene may be, for example, a gene that increases the production of coagulation/clotting factor VIII or coagulation/clotting factor IX, causes the production of normal versions of coagulation factor VIII or coagulation factor IX, a gene that reduces the production of antibodies to coagulation/clotting factor VIII or coagulation/clotting factor IX, or a gene that causes the proper formation of blood clots. Exemplary therapeutic genes include F8 and F9. Exemplary effective treatments may, for example, increase or induce the production of coagulation/clotting factors VIII and IX; improve the functioning of coagulation/clotting factors VIII and IX, or reduce clotting time in subjects.
As another example, a gene can be selected to provide a therapeutically effective response against a lysosomal storage disorder. In particular embodiments, the lysosomal storage disorder is mucopolysaccharidosis (MPS), type I; MPS II or Hunter Syndrome; MPS III or Sanfilippo syndrome; MPS IV or Morquio syndrome; MPS V; MPS VI or Maroteaux-Lamy syndrome; MPS VII or sly syndrome; alpha-mannsidosis; beta-mannosidosis; glycogen storage disease type I, also known as GSDI, von Gierke disease, or Tay Sachs; Pompe disease; Gaucher disease; or Fabry disease. The therapeutic gene may be, for example a gene encoding or inducing production of an enzyme, or that otherwise causes the degradation of mucopolysaccharides in lysosomes. Exemplary therapeutic genes include IDUA or iduronidase, IDS, GNS, HGSNAT, SGSH, NAGLU, GUSB, GALNS, GLB1, ARSB, and HYAL1. Exemplary effective genetic therapies for lysosomal storage disorders may, for example, encode or induce the production of enzymes responsible for the degradation of various substances in lysosomes; reduce, eliminate, prevent, or delay the swelling in various organs, including the head (exp. Macrosephaly), the liver, spleen, tongue, or vocal cords; reduce fluid in the brain; reduce heart valve abnormalities; prevent or dilate narrowing airways and prevent related upper respiratory conditions like infections and sleep apnea; reduce, eliminate, prevent, or delay the destruction of neurons, and/or the associated symptoms.
As another example, a gene can be selected to provide a therapeutically effective response against a hyperproliferative disease. In particular embodiments, the hyperproliferative disease is cancer. The therapeutic gene may be, for example, a tumor suppressor gene, a gene that induces apoptosis, a gene encoding an enzyme, a gene encoding an antibody, or a gene encoding a hormone. Exemplary therapeutic genes and gene products include 101F6, 123F2 (RASSF1), 53BP2, abl, ABLI, ADP, aFGF, APC, ApoAl, ApoAlV, ApoE, ATM, BAI-1, BDNF, Beta*(BLU), bFGF, BLC1, BLC6, BRCA1, BRCA2, CBFA1, CBL, C-CAM, CFTR, CNTF, COX-1, CSFIR, CTS-1, cytosine deaminase, DBCCR-1, DCC, Dp, DPC-4, E1A, E2F, EBRB2, erb, ERBA, ERBB, ETS1, ETS2, ETV6, Fab, FCC, FGF, FGR, FHIT, fms, FOX, FUS 1, FUS1, FYN, G-CSF, GDAIF, Gene 21 (NPRL2), Gene 26 (CACNA2D2), GM-CSF, GMF, gsp, HCR, HIC-1, HRAS, hst, IGF, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11 IL-12, ING1, interferon α, interferon β, interferon γ, IRF-1, JUN, KRAS, LCK, LUCA-1 (HYAL1), LUCA-2 (HYAL2), LYN, MADH4, MADR2, MCC, mda7, MDM2, MEN-I, MEN-II, MLL, MMAC1, MYB, MYC, MYCL1, MYCN, neu, NF-1, NF-2, NGF, NOEY1, NOEY2, NRAS, NT3, NTS, OVCA1, p16, p21, p27, p53, p57, p73, p300, PGS, PIM1, PL6, PML, PTEN, raf, Rap1A, ras, Rb, RB1, RET, rks-3, ScFv, scFV ras, SEM A3, SRC, TALI, TCL3, TFPI, thrombospondin, thymidine kinase, TNF, TP53, trk, T-VEC, VEGF, VHL, WT1, WT-1, YES, and zac1. Exemplary effective genetic therapies may suppress or eliminate tumors, result in a decreased number of cancer cells, reduced tumor size, slow or eliminate tumor growth, or alleviate symptoms caused by tumors.
As another example, a gene can be selected to provide a therapeutically effective response against an infectious disease. In particular embodiments, the infectious disease is human immunodeficiency virus (HIV). The therapeutic gene may be, for example, a gene rendering immune cells resistant to HIV infection, or which enables immune cells to effectively neutralize the virus via immune reconstruction, polymorphisms of genes encoding proteins expressed by immune cells, genes advantageous for fighting infection that are not expressed in the patient, genes encoding an infectious agent, receptor or coreceptor; a gene encoding ligands for receptors or coreceptors; viral and cellular genes essential for viral replication including; a gene encoding ribozymes, antisense RNA, small interfering RNA (siRNA) or decoy RNA to block the actions of certain transcription factors; a gene encoding dominant negative viral proteins, intracellular antibodies, intrakines and suicide genes. Exemplary therapeutic genes and gene products include α2β1; αvβ3; αvβ5; αvβ63; BOB/GPR15; Bonzo/STRL-33/TYMSTR; CCR2; CCR3; CCR5; CCR8; CD4; CD46; CD55; CXCR4; aminopeptidase-N; HHV-7; ICAM; ICAM-1; PRR2/HveB; HveA; α-dystroglycan; LDLR/α2MR/LRP; PVR; PRR1/HveC; and laminin receptor. A therapeutically effective amount for the treatment of HIV, for example, may increase the immunity of a subject against HIV, ameliorate a symptom associated with AIDS or HIV, or induce an innate or adaptive immune response in a subject against HIV. An immune response against HIV may include antibody production and result in the prevention of AIDS and/or ameliorate a symptom of AIDS or HIV infection of the subject, or decrease or eliminate HIV infectivity and/or virulence.
As indicated, methods disclosed herein include enriching for/isolating, expanding, ablating and/or modifying cells for treating subjects (humans, veterinary animals (dogs, cats, reptiles, birds, etc.), livestock (horses, cattle, goats, pigs, chickens, etc.). In particular embodiments, human subjects are pediatric. Treating subjects includes delivering therapeutically effective amounts. Therapeutically effective amounts include those that provide effective amounts, prophylactic treatments, and/or therapeutic treatments.
An “effective amount” is the number of cells necessary to result in a desired physiological change in a subject. Effective amounts are often administered for research purposes.
A “prophylactic treatment” includes a treatment administered to a subject who does not display signs or symptoms of a condition to be treated or displays only early signs or symptoms of the condition to be treated such that treatment is administered for the purpose of diminishing, preventing, or decreasing the risk of developing the condition. Thus, a prophylactic treatment functions as a preventative treatment against a condition.
A “therapeutic treatment” includes a treatment administered to a subject who displays symptoms or signs of a condition and is administered to the subject for the purpose of reducing the severity or progression of the condition.
The actual dose amount administered to a particular subject can be determined by a physician, veterinarian, or researcher taking into account parameters such as physical and physiological factors including target; body weight; type of condition; severity of condition; upcoming relevant events, when known; previous or concurrent therapeutic interventions; idiopathy of the subject; and route of administration, for example. In addition, in vitro and in vivo assays can optionally be employed to help identify optimal dosage ranges.
Therapeutically effective amounts to administer can include greater than 102 cells, greater than 103 cells, greater than 104 cells, greater than 105 cells, greater than 106 cells, greater than 107 cells, greater than 108 cells, greater than 109 cells, greater than 1010 cells, or greater than 1011. In particular embodiments, a minimum dose is 2×106 cells/kg subject body weight.
In particular embodiments, the methods and compositions disclosed herein ablate pHSC within a subject. In particular embodiments, the methods and compositions disclosed herein ablate pHSC within a subject as part of a non-genotoxic conditioning regimen. In particular embodiments, the non-genotoxic conditioning regimen precedes an HSC transplant in the subject and/or the infusion of genetically-modified cells into the subject. In particular embodiments, the subject is a human pediatric subject receiving the HSC transplant and/or the infusion of genetically-modified cells. In particular embodiments, for engraftment purposes, a composition including HSC is administered to a patient following selective ablation as described elsewhere herein.
In particular embodiments, administration of HSC cause an increase in granulocyte colony stimulating factor (GCSF). In certain aspects, the methods and compositions disclosed herein cause an increase in macrophage colony stimulating factor (MCSF). In particular embodiments, the methods and compositions disclosed herein cause an increase in endogenous myeloid cells.
In particular embodiments, hematopoietic recovery includes recovery of white blood cells. In particular embodiments, hematopoietic recovery includes recovery of lymphocytes. In particular embodiments, hematopoietic recovery includes recovery of myeloid cells.
In particular embodiments, hematopoietic recovery includes improvement in one or more complete blood count measures. In particular embodiments, improvement in blood count measure includes an increase in hemoglobin level, an increase in hematocrit level, an increase in red blood cell number, and combinations thereof. In particular embodiments, hematopoietic recovery includes an increase in bone marrow cellularity.
“Complete blood count (CBC),” also known as full blood count (FBC), full blood exam, or blood panel, is a test panel typically ordered by medical professionals that provides information about the cell types and numbers in a patient's blood. In particular embodiments, a “complete blood count measure” includes measurement of total white cells, total red cells, hemoglobin, hematocrit, mean corpuscular volume, mean corpuscular hemoglobin, mean corpuscular hemoglobin concentration, red blood cell distribution width, neutrophil granulocytes, lymphocytes, monocytes, eisonophil granulocytes, basophil granulocytes, platelet numbers, and/or mean platelet volume.
The methods of the disclosure are also useful in the induction of tolerance in a patient, for example tolerance to donor tissue, e.g. in organ transplants; tolerance to autoantigens, e.g. in the context of treatment of autoimmune disease; and the like. In particular embodiments, a method is provided for inducing tolerance in a patient, including administering to a patient a therapeutically effective amount of an agent, for example an antibody coupled to a toxin (or CAR-modified immune cell), that selectively ablates endogenous HSC; and administering to the patient a therapeutically effective amount of HSC from a donor, which administering may be performed in conjunction with introducing an allograft into said patient, treating autoimmune disease, etc.
In particular embodiments, methods and compositions disclosed herein are used to ablate pHSC within a subject to treat a malignancy associated with hyperproliferative HSC, such as a hematopoietic cancer.
Examples of hematopoietic cancers include acute lymphocytic leukemia, B-cell prolymphocytic leukemia, Burkitt lymphoma/leukemia, chronic lymphocytic leukemia (CLL), diffuse large B-cell lymphoma, follicular lymphoma (grades I, II, Ill, or IV), Hodgkin's lymphoma, intravascular large B-cell lymphoma, lymphoma, lymphoplasmocytic lymphoma, mantle cell lymphoma, marginal zone lymphoma (extra-nodal and nodal), mediastinal (thymic) large B-cell lymphoma, multiple myeloma, non-Hodgkin's lymphoma, POEMS syndrome/osteosclerotic myeloma, primary effusion lymphoma, splenic marginal zone lymphoma, small lymphocytic lymphoma, smoldering multiple myeloma (SMM), and Waldenstrom's macroglobulinemia.
Effective treatments against a malignancy associated with hyperproliferative HSC can be evidenced by an anti-cancer effect. An anti-cancer effect can include one or more of a decrease in the number of cancer cells, an increase in life expectancy, induction of apoptosis of cancer cells, induction of cancer cell death, inhibition of cancer cell proliferation, prolongation of a subject's life, and/or reduction of relapse or re-occurrence of the cancer following treatment.
As indicated, the compositions and formulations disclosed herein can be administered by, for example, injection, infusion, perfusion, or lavage and can more particularly include administration through one or more bone marrow, intravenous, intradermal, intraarterial, intranodal, intralymphatic, intraperitoneal, intralesional, intraprostatic, intravaginal, intrarectal, topical, intrathecal, intratumoral, intramuscular, intravesicular, and/or subcutaneous infusions and/or bolus injections.
In particular embodiments, purification and final formulation of cells includes pelleting the cell product and removing the resulting supernatant. Exemplary cellular carriers include saline, buffered saline, physiological saline, water, Hanks' solution, Ringer's solution, Nonnosol-R (Abbott Labs), Plasma-Lyte A® (Baxter Laboratories, Inc., Morton Grove, IL), glycerol, ethanol, and combinations thereof.
In particular embodiments, carriers can be supplemented with human serum albumin (HSA) or other human serum components or fetal bovine serum. In particular embodiments, a carrier for infusion includes buffered saline with 5% HAS or dextrose. Additional isotonic agents include polyhydric sugar alcohols including trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol, or mannitol.
Carriers can include buffering agents, such as citrate buffers, succinate buffers, tartrate buffers, fumarate buffers, gluconate buffers, oxalate buffers, lactate buffers, acetate buffers, phosphate buffers, histidine buffers, and/or trimethylamine salts.
Stabilizers refer to a broad category of excipients which can range in function from a bulking agent to an additive which helps to prevent cell adherence to container walls. Typical stabilizers can include polyhydric sugar alcohols; amino acids, such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2-phenylalanine, glutamic acid, and threonine; organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myoinisitol, galactitol, glycerol, and cyclitols, such as inositol; PEG; amino acid polymers; sulfur-containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, alpha-monothioglycerol, and sodium thiosulfate; low molecular weight polypeptides (i.e., <10 residues); proteins such as HSA, bovine serum albumin, gelatin or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; monosaccharides such as xylose, mannose, fructose and glucose; disaccharides such as lactose, maltose and sucrose; trisaccharides such as raffinose, and polysaccharides such as dextran.
Where necessary or beneficial, formulations can include a local anesthetic such as lidocaine to ease pain at a site of injection.
Therapeutically effective amounts of cells within formulations can be greater than 10 2 cells, greater than 103 cells, greater than 104 cells, greater than 105 cells, greater than 106 cells, greater than 107 cells, greater than 108 cells, greater than 109 cells, greater than 1010 cells, or greater than 1011.
In formulations disclosed herein, cells are generally in a volume of a liter or less, 500 mls or less, 250 mls or less or 100 mls or less. Hence the density of administered cells is typically greater than 104 cells/ml, 107 cells/ml or 108 cells/ml.
The formulations disclosed herein can be prepared for administration by, for example, injection, infusion, perfusion, or lavage.
EXEMPLARY EMBODIMENTS
1. A method of preparing an enriched primitive hematopoietic stem cell (pHSC) population including:
    • obtaining a stem cell source;
    • enriching the stem cell source for LHR+/CD34+ cells; LHR+/CD34+/CD38− cells; LHR+/CD34+/CD45RA− cells; LHR+/CD34+/CD90+ cells; LHR+/CD34+/CD90− cells; LHR+/CD34+/CD38−/CD45RA−/CD90+ cells or LHR+/CD34+/CD38−/CD45RA−/CD90− cells thereby preparing the enriched pHSC population.
2. A method of embodiment 2, wherein the enriching does not utilize CD49f.
3. A method of embodiment 1 or 2, wherein the stem cell source includes umbilical cord blood, placental blood, bone marrow, or peripheral blood.
4. A method of any of embodiments 1-3, wherein the enriching includes magnetic-assisted cell sorting (MACS), fluorescence-activated cell sorting (FACS) or antibody-panning.
5. A method of any of embodiments 1-4, wherein the enriching utilizes a luteinizing hormone receptor (LHR) binding agent.
6. A method of embodiment 5, wherein the LHR binding agent includes a luteinizing hormone (LH) alpha subunit and a LH beta subunit.
7. A method of embodiment 6, wherein the LH alpha subunit and LH beta subunit include SEQ ID NO: 23 and SEQ ID NO: 22 or SEQ ID NO: 11 and SEQ ID NO: 9.
8. A method of any of embodiments 5-7, wherein the LHR binding agent includes SEQ ID NO: 51.
9. A method of any of embodiments 5-8, wherein the LHR binding agent includes:
    • a CDRH1 of SEQ ID NO: 28, a CDRH2 of SEQ ID NO: 29, a CDRH3 of SEQ ID NO: 30, a CDRL1 of SEQ ID NO: 31, a CDRL2 of DTS, and a CDRL3 of SEQ ID NO: 32;
    • a CDRH1 of SEQ ID NO: 33, a CDRH2 of SEQ ID NO: 34, a CDRH3 of SEQ ID NO: 35, a CDRL1 of SEQ ID NO: 36, a CDRL2 of WAS, and a CDRL3 of SEQ ID NO: 37;
    • a CDRH1 of SEQ ID NO: 38, a CDRH2 of SEQ ID NO: 39, a CDRH3 of SEQ ID NO: 40, a CDRL1 of SEQ ID NO: 41, a CDRL2 of NAS, and a CDRL3 of SEQ ID NO: 42;
    • a heavy chain of SEQ ID NO: 43 and a light chain of SEQ ID NO: 44;
    • a heavy chain of SEQ ID NO: 45 and a light chain of SEQ ID NO: 46;
    • a heavy chain of SEQ ID NO: 47 and a light chain of SEQ ID NO: 48; or
    • a heavy chain of SEQ ID NO: 49 and a light chain of SEQ ID NO: 50.
10. A method of any of embodiments 1-9, further including culturing the enriched pHSC population in culture media supplemented with an LH agonist. Exemplary embodiment 10 also includes a method of expanding pHSC populations in culture media supplemented with an LH agonist that is practiced independently of embodiments 1-9.
11. A method of embodiment 10, wherein the LH agonist includes an LH alpha subunit and an LH beta subunit.
12. A method of embodiment 11, wherein the LH alpha subunit and LH beta subunit include SEQ ID NO: 23 and SEQ ID NO: 22 or SEQ ID NO: 11 and SEQ ID NO: 9.
13. A method of any of embodiments 10-12, wherein the LH agonist includes SEQ ID NO: 51.
14. A method of any of embodiments 10-13, wherein the culture media is further supplemented with either human stem cell factor (SCF), human thrombopoietin (TPO), and human Fms-related tyrosine kinase 3 ligand (FLT-3L) or SCF and human interleukin-3 (IL-3).
15. A method of embodiment 15, wherein the SCF, TPO and FLT-3L or the SCF and IL-3 are recombinant SCF, TPO and FLT-3L or recombinant SCF and IL-3.
16. A method of any of embodiments 1-15, further including genetically modifying the enriched pHSC population.
17. A method of embodiment 16, wherein the genetic modification results in expression of a therapeutic gene.
18. A method of embodiment 17, wherein the therapeutic gene is selected from ABCD1, ABCA3, ABLI, ADA, AKT1, APC, APP, ARSA, ARSB, BCL11A, BLC1, BLC6, BRCA1, BRCA2, BRIP1, C9ORF72, C46 or other C peptide, CAR, CAS9, C-CAM, CBFAI, CBL, CCR5, CD4, CD19, CD40, CDA, CFTR, CLN3, C-MYC, CRE, CSCR4, CSFIR, CTLA, CTS-I, CYB5R3, DCC, DHFR, DKC1, DLL1, DMD, EGFR, ERBA, ERBB, EBRB2, ETSI, ETS2, ETV6, F8, F9, FANCA, FANCB, FANCC, FANCD2, FANCE, FANCF, FANCG, FANCI, FANCL, FANCM, FasL, FCC, FGR, FOX, FUS, FUSI, FYN, GALNS, GATA1, GLB1, GNS, GUSB, HBB, HBD, HBE1, HBG1, HBG2, HCR, HGSNAT, HOXB4, HRAS, HYAL1, ICAM-1, iCaspase, IDUA, IDS, JUN, KLF4, KRAS, LCK, LRRK2, LYN, MCC, MDM2, MGMT, MLL, MMACI, MYB, MEN-I, MEN-II, MYC, NAGLU, NANOG, NF-1, NF-2, NKX2.1, NOTCH, OCT4, p16, p21, p27, p53, p57, p73, PALB2, PARK2, PARK7, phox, PINK1, PK, PSEN1, PSEN2, PTPN22, RAD51C, ras, RPL3 through RPL40, RPLP0, RPLP1, RPLP2, RPS2 through RPS30, RPSA, SFTPB, SFTPC, SGSH, SLX4, SNCA, SOD1, SOX2, TERC, TERT, TDP43, TINF2, TK, ubiquilin 2, VHL, WAS or WT-1.
19. A method of any of embodiments 16-18, wherein the genetic modification includes a non-integrating vector.
20. A method of any of embodiments 16-19, wherein the genetic modification includes a viral vector.
21. A method of embodiment 20, wherein the viral vector is a lentiviral vector or a foamy viral vector.
22. A method of any of embodiments 1-21, further including formulating the enriched pHSC population for administration to a subject.
23. A method of ablating primitive hematopoietic stem cells (pHSC) in a subject in need thereof including administering to the subject a therapeutically effective amount of a pHSC-ablating agent including a luteinizing hormone receptor (LHR) binding agent.
24. A method of embodiment 23, wherein the LHR binding agent includes a luteinizing hormone (LH) alpha subunit and a LH beta subunit.
25. A method of embodiment 24, wherein the LH alpha subunit and LH beta subunit include SEQ ID NO: 23 and SEQ ID NO: 22 or SEQ ID NO: 11 and SEQ ID NO: 9.
26. A method of any of embodiments 23-25, wherein the LHR binding agent includes SEQ ID NO: 51.
27. A method of any of embodiments 23-26, wherein the LHR binding agent includes:
    • a CDRH1 of SEQ ID NO: 28, a CDRH2 of SEQ ID NO: 29, a CDRH3 of SEQ ID NO: 30, a CDRL1 of SEQ ID NO: 31, a CDRL2 of DTS, and a CDRL3 of SEQ ID NO: 32;
    • a CDRH1 of SEQ ID NO: 33, a CDRH2 of SEQ ID NO: 34, a CDRH3 of SEQ ID NO: 35, a CDRL1 of SEQ ID NO: 36, a CDRL2 of WAS, and a CDRL3 of SEQ ID NO: 37;
    • a CDRH1 of SEQ ID NO: 38, a CDRH2 of SEQ ID NO: 39, a CDRH3 of SEQ ID NO: 40, a CDRL1 of SEQ ID NO: 41, a CDRL2 of NAS, and a CDRL3 of SEQ ID NO: 42;
    • a heavy chain of SEQ ID NO: 43 and a light chain of SEQ ID NO: 44;
    • a heavy chain of SEQ ID NO: 45 and a light chain of SEQ ID NO: 46;
    • a heavy chain of SEQ ID NO: 47 and a light chain of SEQ ID NO: 48; or
    • a heavy chain of SEQ ID NO: 49 and a light chain of SEQ ID NO: 50.
28. A method of any of embodiments 23-27, wherein the pHSC-ablating agent includes a lymphocyte genetically-modified to express the LHR binding agent as part of a chimeric antigen receptor (CAR).
29. A method of embodiment 28, wherein the CAR includes 4-1BB and CD3 zeta.
30. A method of embodiment 28 or 29, wherein the CAR includes a CD28 hinge and a CD28 transmembrane domain.
31. A method of any of embodiments 28-30, wherein the CAR includes CD3 zeta and Thyl.1.
32. A method of any of embodiments 28-31, wherein the CAR includes a CD8 hinge and a CD8 transmembrane domain.
33. A method of embodiment 28, wherein the CAR includes SEQ ID NO: 20 or SEQ ID NO: 7.
34. A method of any of embodiments 28-33, wherein the lymphocyte is a T cell or a natural killer (NK) cell.
35. A method of any of embodiments 23-34, wherein the pHSC-ablating agent includes a toxin.
36. A method of embodiment 35, wherein the toxin is selected from abrin A chain, α-amanitin, β-amanitin, γ-amanitin, £-amanitin, amanin, amaninamide, amanullin, amanullinic acid, auristatin-E, crotin, curcin, diphtheria A chain, diphtheria toxin, enomycin, exotoxin A chain, gelonin toxin, luffin toxin, modeccin toxin, momordin toxin, phenomycin, pseudomonas exotoxin A, Ricin A chain, saporin, or trichosanthin toxin.
37. A method of ablating malignant cells in a subject in need thereof including administering to the subject a therapeutically effective amount of genetically-modified lymphocytes expressing a chimeric antigen receptor (CAR) including an extracellular domain including a luteinizing hormone (LH) alpha subunit and a LH beta subunit.
38. A method of embodiment 37, wherein the malignant cells are hematopoietic stem cells.
39. A method of embodiment 37 or 38, wherein the malignant cells are leukemia cells and/or lymphoma cells.
40. A method of any of embodiments 37-39, wherein the LH alpha subunit and LH beta subunit include SEQ ID NO: 23 and SEQ ID NO: 22 or SEQ ID NO: 11 and SEQ ID NO: 9.
41. A method of any of embodiments 37-40, wherein the CAR includes 4-1BB and CD3 zeta.
42. A method of any of embodiments 37-41, wherein the CAR includes a CD28 hinge and a CD28 transmembrane domain.
43. A method of any of embodiments 37-42, wherein the CAR includes CD3 zeta and Thyl.1.
44. A method of any of embodiments 37-43, wherein the CAR includes a CD8 hinge and a CD8 transmembrane domain.
45. A method of embodiment 37, wherein the CAR includes SEQ ID NO: 20 or SEQ ID NO: 7.
46. A method of any of embodiments 37-45, wherein the lymphocyte is a T cell or a natural killer (NK) cell.
47. A chimeric antigen receptor (CAR) including an extracellular domain including a luteinizing hormone (LH) alpha subunit and a LH beta subunit.
48. A CAR of embodiment 47, wherein the LH alpha subunit and LH beta subunit include SEQ ID NO: 23 and SEQ ID NO: 22 or SEQ ID NO: 11 and SEQ ID NO: 9.
49. A CAR of embodiment 48, wherein SEQ ID NO: 23 and SEQ ID NO: 22 are linked by SEQ ID NO: 10 or SEQ ID NO: 11 and SEQ ID NO: 9 are linked by SEQ ID NO: 10.
50. A CAR of any of embodiments 47-49, further including SEQ ID NO: 24 and SEQ ID NO: 25.
51. A CAR of any of embodiments 47-50, further including SEQ ID NO: 26 and SEQ ID NO: 27.
52. A CAR of any of embodiments 47-51, further including SEQ ID NO: 15 and SEQ ID NO: 16.
53. A CAR of any of embodiments 47-52, further including SEQ ID NO: 15, SEQ ID NO: 16 and SEQ ID NO: 17.
54. A CAR of any of embodiments 47, 48, or 50-53, further including a linker that is 16 amino acids or less.
55. A CAR of any of embodiments 47-54, wherein the linker is a Gly-Ser linker.
56. A CAR of embodiment 55, wherein the Gly-Ser linker includes SEQ ID NO: 10.
57. A CAR of any of embodiments 47-56, further including a tag sequence.
58. A CAR of embodiment 57, wherein the tag sequence is selected from Myc tag, Strep tag, His tag, Flag tag, Xpress tag, Avi tag, Calmodulin tag, Polyglutamate tag, HA tag, or V5 tag.
59. A CAR including SEQ ID NO: 20 or SEQ ID NO: 7.
60. cDNA including SEQ ID NO: 19 or SEQ ID NO: 6.
61. A lymphocyte expressing SEQ ID NO: 20 or SEQ ID NO: 7.
62. A lymphocyte including SEQ ID NO: 19 or SEQ ID NO: 6.
63. A lymphocyte of embodiment 61 or 62 wherein the lymphocyte is a T cell or NK cell. 64. A formulation for administration to a subject including an enriched pHSC population formed according to a method of embodiments 1-22, a CAR of embodiments 47-59, cDNA of embodiment 60, and/or a lymphocyte of embodiment 63.
As indicated previously, particular embodiments disclosed herein include variants of protein and/or nucleic acid sequences disclosed herein. Variants of proteins can include those having one or more conservative amino acid substitutions. As used herein, a “conservative substitution” involves a substitution found in one of the following conservative substitutions groups: Group 1: Alanine (Ala), Glycine (Gly), Serine (Ser), Threonine (Thr); Group 2: Aspartic acid (Asp), Glutamic acid (Glu); Group 3: Asparagine (Asn), Glutamine (Gln); Group 4: Arginine (Arg), Lysine (Lys), Histidine (His); Group 5: Isoleucine (Ile), Leucine (Leu), Methionine (Met), Valine (Val); and Group 6: Phenylalanine (Phe), Tyrosine (Tyr), Tryptophan (Trp).
Additionally, amino acids can be grouped into conservative substitution groups by similar function or chemical structure or composition (e.g., acidic, basic, aliphatic, aromatic, sulfur-containing). For example, an aliphatic grouping may include, for purposes of substitution, Gly, Ala, Val, Leu, and Ile. Other groups containing amino acids that are considered conservative substitutions for one another include: sulfur-containing: Met and Cysteine (Cys); acidic: Asp, Glu, Asn, and Gln; small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro, and Gly; polar, negatively charged residues and their amides: Asp, Asn, Glu, and Gln; polar, positively charged residues: His, Arg, and Lys; large aliphatic, nonpolar residues: Met, Leu, Ile, Val, and Cys; and large aromatic residues: Phe, Tyr, and Trp. Additional information is found in Creighton (1984) Proteins, W.H. Freeman and Company.
As indicated elsewhere, variants of gene sequences can include codon optimized variants, sequence polymorphisms, splice variants, and/or mutations that do not affect the function of an encoded product to a statistically-significant degree.
Variants of the protein, nucleic acid, and gene sequences disclosed herein also include sequences with at least 70% sequence identity, 80% sequence identity, 85% sequence, 90% sequence identity, 95% sequence identity, 96% sequence identity, 97% sequence identity, 98% sequence identity, or 99% sequence identity to the protein, nucleic acid, or gene sequences disclosed herein.
“% sequence identity” refers to a relationship between two or more sequences, as determined by comparing the sequences. In the art, “identity” also means the degree of sequence relatedness between protein, nucleic acid, or gene sequences as determined by the match between strings of such sequences. “Identity” (often referred to as “similarity”) can be readily calculated by known methods, including (but not limited to) those described in: Computational Molecular Biology (Lesk, A. M., ed.) Oxford University Press, NY (1988); Biocomputing: Informatics and Genome Projects (Smith, D. W., ed.) Academic Press, NY (1994); Computer Analysis of Sequence Data, Part I (Griffin, A. M., and Griffin, H. G., eds.) Humana Press, NJ (1994); Sequence Analysis in Molecular Biology (Von Heijne, G., ed.) Academic Press (1987); and Sequence Analysis Primer (Gribskov, M. and Devereux, J., eds.) Oxford University Press, NY (1992). Preferred methods to determine identity are designed to give the best match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. Sequence alignments and percent identity calculations may be performed using the Megalign program of the LASERGENE bioinformatics computing suite (DNASTAR, Inc., Madison, Wisconsin). Multiple alignment of the sequences can also be performed using the Clustal method of alignment (Higgins and Sharp CABIOS, 5, 151-153 (1989) with default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=10). Relevant programs also include the GCG suite of programs (Wisconsin Package Version 9.0, Genetics Computer Group (GCG), Madison, Wisconsin); BLASTP, BLASTN, BLASTX (Altschul, et al., J. Mol. Biol. 215:403-410 (1990); DNASTAR (DNASTAR, Inc., Madison, Wisconsin); and the FASTA program incorporating the Smith-Waterman algorithm (Pearson, Comput. Methods Genome Res., [Proc. Int. Symp.] (1994), Meeting Date 1992, 111-20. Editor(s): Suhai, Sandor. Publisher: Plenum, New York, N.Y. Within the context of this disclosure it will be understood that where sequence analysis software is used for analysis, the results of the analysis are based on the “default values” of the program referenced. As used herein “default values” will mean any set of values or parameters, which originally load with the software when first initialized.
Example 1. Suppression of luteinizing hormone enhances HSC recovery after hematopoietic injuries. Introduction. There is a significant unmet clinical need for novel strategies to protect the hematopoietic stem cell (HSC) pool and regenerate hematopoiesis after radiation injury caused by common cancer therapies or by accidental exposure1,2. In addition to their role in promoting sexual dimorphisms, there is increasing evidence that sex hormones regulate HSC self-renewal, differentiation, and proliferation3-5. It has been previously reported that sex steroid ablation (SSA) promoted bone marrow (BM) lymphopoiesis and HSC recovery in aged and immunodepleted mice5-8. Here it is shown that the use of a novel luteinizing hormone-releasing hormone-antagonist (LHRH-Ant), currently used widely in the clinic for androgen ablative therapies, promoted hematopoietic recovery and mouse survival when administered 24 h after an otherwise lethal dose of total body irradiation (L-TBI). Unexpectedly, this protective effect was independent of sex steroid inhibition, but relied on the suppression of luteinizing hormone (LH). Long-term self-renewing HSCs (LT-HSCs) derived from both human and mouse expressed high levels of the luteinizing hormone/choriogonadotropin receptor (LHR) and while LH stimulation promoted HSC expansion, its suppression after L-TBI inhibited entry of HSCs into cell cycle, thus promoting HSC quiescence and protection against exhaustion. Taken together these data not only reveal a novel mechanism that regulates HSC function, but also offer a therapeutic approach to promote hematopoietic regeneration after injury.
Background. Radiation-induced BM toxicity is a common dose-limiting side-effect for most cancer therapy and is the primary cause of death for victims of accidental exposure. Despite intensive research to identify effective treatments for hematopoietic recovery and mitigation of radiation injury, available non-cellular approaches are still limited9. Although several cytokines and growth factors have shown radio-protective properties when administered before radiation exposure, few are effective in mitigating radiation toxicity in a post-injury setting, restricting their application in the worst-case scenario of a nuclear accident or terrorist attack10-13.
Description. Inhibition of sex steroids, which can be achieved in a reversible fashion pharmacologically, is a well-described strategy to promote lymphopoiesis in the BM and thymus8,7,14,15. Although the most common method of sex steroid ablation clinically has been to use LHRH-agonists, it was described that an LHRH-Antagonist represents a more rational approach to promote immediate ablation of sex steroids for immune regeneration as it is far more rapid and abrogates the initial surge in sex steroids that LHRH-Agonist cause16. Taken together with the impact of sex steroid inhibition on HSC function and the rapid regenerative effects of LHRH-Ant, it was hypothesized that LHRH-Ant could represent a rational non-cellular medical countermeasure for mitigating radiation injury and promoting hematopoietic regeneration when administered after hematopoietic insult. To test this hypothesis, a lethal TBI (L-TBI) dose of 840cGy that mediated lethality in more than 90% of mice (FIG. 1A) was used. It was found that mice receiving LHRH-Ant 24 h after L-TBI exposure showed a significant increase in survival compared to control animals treated with vehicle alone (FIG. 2A). Mouse lethality was a result of bone marrow failure, since transplant of BM Lin-Sca1+tkit+ (LSK) cells 3 days after L-TBI completely rescued all mice (FIG. 1B). Despite similar drops in cellularity across both groups for the first 10 days, consistent with the survival data, complete blood counts analysis revealed that only mice treated with LHRH-Ant recovered after L-TBI (FIG. 2B). It was then tested if LHRH-Ant could mediate even greater mouse survival when administered multiple times. However, treatment of the mice 24 h and 15 days after LTBI did not significantly enhance the survival benefit (FIG. 10 ). Although reduced in its effectiveness, intriguingly, treatment with LHRH-Ant significantly enhanced mouse survival even when administered 48 h after L-TBI, further validating this treatment as a potential countermeasure for radiation exposure (FIG. 2B). Importantly, although modest in comparison to the survival benefit observed in male mice, a statistically significant benefit in survival in female mice given LHRH-Ant was also found (FIG. 1D). This data are in agreement with a previous report, showing that LHRH-Ant has reduced regenerative properties in female mice16.
To investigate the specific regenerative effects mediated by LHRH-Ant treatment on the hematopoietic stem and progenitor cell (HSPC) compartment, BM were analyzed at several time points after L-TBI. In keeping with the peripheral blood (PB) recovery shown in FIG. 2B, BM cellularity of mice treated with the LHRH-Ant started to separate significantly from the vehicle group by day 14 after radiation (FIG. 2D). To determine hematopoietic functional potential, colony-forming unit activity was next quantified to determine the effects of LHRH-Ant on the recovery of committed hematopoietic progenitor cells. While there was no difference in total BM cellularity at day 7, there was a significant increase in CFU-GM and BFU-E colonies in L-TBI mice also treated with LHRH-Ant (FIG. 2E). Consistent with these functional findings, on day 14 after L-TBI, expansion of LSKs as well as their downstream progenitors in mice given LHRH-Ant were found (FIGS. 2F, 2G). Moreover, crucially for sustained hematopoiesis, significantly more LT-HSCs were also found (FIGS. 2F, 2G). However, given the changes in HSC phenotype after radiation, the standard competitive repopulation functional assay was adapted to evaluate the presence and relative quantity of functional HSCs after L-TBI. Specifically, all cells from the BM and spleen (to account for potential changes to circulating HSCs) were collected and transplanted from vehicle or LHRH-Ant treated mice at day 14 after L-TBI into irradiated hosts (along with a rescue dose of congenic WBM cells to ensure survival). This approach allowed detection of differences in the total number of residual HSCs which would be reflected by a functional difference in hematopoietic reconstitution. Host mice receiving cells from LHRH-Ant-treated L-TBI mice had significantly better hematopoietic reconstitution than recipients of cells from vehicle-treated control L-TBI mice (FIGS. 2H, 2I, and 3 ), showing that there greater number of functional HSCs persist in mice treated with LHRH-Ant. Taken together, these data show that pharmacological inhibition of the LHRH-receptor mitigated TBI-induced mortality and myelosuppression through protection and recovery of the HSC compartment.
Given the previous report linking sex steroids to HSC function5,7, the initial hypothesis was that LHRH-Ant facilitates hematopoietic recovery after radiation exposure through androgen ablation. To test this hypothesis and gain insight into the mechanisms driving the regenerative effects of LHRH-Ant, surgical castration was performed in male mice and their survival after L-TBI was followed. Surprisingly, surgical castration did not protect mice from radiation injury, but only the simultaneous treatment of the castrated mice with the LHRH-Ant restored the benefits in mouse survival (FIG. 4A). However, as surgery needed to be performed 5 days prior to TBI to ensure recovery by the time of irradiation, it could not be discounted that cessation of sex steroids before radiation mediates a separate effect. To account for this, mice were treated with the androgen receptor (AR) inhibitor enzalutamide (MDV3100) 24 h after L-TBI. Consistent with the data in surgically castrated mice, MDV3100 alone did not mediate any survival benefit but in groups treated with both MDV3100 and LHRH-Ant there was significant increase in mouse survival (FIG. 4B). These data strongly show that the inhibition of sex steroid activity, through surgical castration or pharmacological inhibition of AR signaling, did not represent the primary mechanism driving the regenerative effects mediated by LHRH-Ant treatment after radiation exposure. In line with the well-characterized toxic effects of radio-/chemo-therapy on gonads and fertility 17-20, radiation by itself drastically reduced the levels of testosterone in both groups (FIG. 4C), and treatment with LHRH-Ant did not significantly lower the level of testosterone after radiation (FIG. 4C); showing that the beneficial effects of LHRH-Ant on hematopoiesis and survival post irradiation were sex steroid independent.
As LHRH exerts its effects in the pituitary, luteinizing hormone (LH) and follicle stimulating hormone (FSH), which are downstream of LHRH and upstream of sex steroids were then examined. While levels of FSH did not change after L-TBI, levels of LH did decrease gradually over time (FIG. 4C) and, as expected, LH and FSH were dramatically decreased in irradiated mice after LHRH-Ant treatment (FIG. 4C).
To gain some insights into the potential contribution of hormone signaling in hematopoiesis, the expression of AR as well as the LH and FSH receptors were analyzed on purified populations of HSPCs. Almost no detectable expression of the androgen receptor (AR) or follicle-stimulating hormone receptor (FSHR) was found on any of the HSPC subsets examined (FIG. 4D). In contrast, expression of luteinizing hormone/choriogonadotropin receptor (LHCGR) was highly enriched on long-term HSCs (LT-HSCs), and at comparable levels to those observed in the testes (FIG. 4D). Similar LHCGR expression pattern was also observed in HSCPs derived from female mice (FIG. 5B). Further analysis revealed that LHCGR expression was a peculiarity of LT-HSCs with little or no expression found on purified BM stromal cells (FIG. 5C). These findings were consistent with publically accessible gene expression databases21,22. Using recently identified surface markers enabling granular characterization of the human HSC compartment (FIG. 5D)23,24, LHCGR expression was significantly enriched in the most primitive HSC1 (Lin-CD34+CD38−CD45RA−CD90+CD49f+) and HSC2 (CD34+CD38-CD45RA-CD90- CD49f+); with expression nearly absent in downstream multi-potent progenitors (MPPs) and multi-lymphoid progenitors (MLPs) (FIGS. 4E, 4F). Although LHCGR expression has previously been shown in a crude fraction of Lin-CD45+Sca1+ cells3, this is the first evidence of its enriched expression on the most primitive HSCs.
Given restricted expression of LHCGR to the primitive HSC compartment, it was sought to definitively determine whether the regenerative effects of LHRH-Ant treatment depended specifically on LH suppression. For this LHCGR was re-stimulated in LHRH-Ant treated mice that had been given L-TBI 1 day prior. For these studies the alternative LHCGR ligand human chorionic gonadotropin (hCG) was employed due to its longer half-life compared to LH (60-120 minutes for LH, several hours for hCG) and its wide use in routine laboratory procedure to stimulate the LHCGR25,26. Consistent with the hypothesis, administration of hCG abrogated the beneficial effects of LHRH-Ant on survival after radiation injury (FIG. 4G).
Given the negative impact of LH signaling on HSC during hematopoietic recovery after radiation, it was hypothesized that mice deficient for LHCGR could be radio protected when exposed irradiation. The results showed that LHCGR-KO mice had a modest but statistically significant increase in survival when exposed to L-TBI compared to littermate control mice (FIG. 4H).
The control of HSC self-renewal, differentiation, and proliferation is a tightly regulated process crucial for maintaining the HSC pool29-34. This is particularly relevant during hematopoietic injuries (such as high dose or repeated rounds of chemotherapy or irradiation) when dormant HSCs transiently start to proliferate to replenish blood cells as unbalanced HSC proliferation can lead to stem cell exhaustion and long-term myelosuppression35-37. Consistent with its previously described role in promoting proliferation of primary cells, including gonadal and neuronal cells38-40, LH significantly enhanced colony formation in cobblestone area-forming cell (CAFC) and colony-forming cell (CFC) assays (FIGS. 6A, 6B). Importantly, LH was also able to significantly expand human HSC1 in vitro (CD34+CD38−CD45RA−CD90+) in a stroma-free culture system (FIG. 6C). Although there is a clear need for HSC proliferation to ensure regenerative hematopoiesis, previous reports have also shown that induction of HSC quiescence after high-dose irradiation correlates with increased hematopoietic recovery and enhanced mouse survival35,37,41. Taken together these findings show that abrogation of LHCGR signaling after TBI promotes HSC quiescence and thus survival. Consistent with this hypothesis, when cell cycle status of HSCs in LHRH-Ant treated mice after L-TBI was analyzed, a significantly higher proportion of Ki-67− quiescent LT-HSCs in the LHRH-Ant-treated group with fewer proliferative HSCs compared to the vehicle group was found (FIG. 6D and FIG. 7 ). This showed that the inhibition of LH signaling retains HSCs in a quiescent phase and protected them from LH-induced entry into the cell cycle after high-dose irradiation.
To further validate this hypothesis, two additional models were used to force HSCs out of their quiescence phase, Poly I:C and sub-lethal dose of total body irradiation (SL-TBI)35,42,43. To eliminate any potential effects of downstream sex steroids on HSCs, all cohorts of mice in these studies had been surgically castrated. Consistent with the hypothesis, ablation of LH production in mice using a luteinizing hormone-releasing hormone-antagonist (LHRH-Ant) retained significantly more LT-HSCs in G0 in both models (FIGS. 6E, 6F). To evaluate if promoting HSC quiescence resulted in increased cell viability after radiation exposure cell apoptosis was analyzed using AnnexinV/DAPI staining. Using the same administration scheme as described in FIG. 3F it was revealed that LHRH-Ant treatment significantly increased the proportion of live LT-HSCs compared to vehicle treated mice (FIG. 6G).
To gain some insights in to the molecular changes mediated by LHRH-Ant treatment on HSCs LT-HSCs were purified after 300cGy irradiation and expression of key genes associated with quiescence, proliferation, DNA damage response and apoptosis of HSCs was assessed. Broadly, it was observed that LT-HSC derived from LHRH-Ant-treated mice showed significant overexpression of genes related to quiescence and apoptosis (p=0.02 and p=0.004, respectively) (FIG. 8A). Specifically, within these categories, significantly higher levels of Hest and Cdknla (p21), two genes previously identified to be critical in promoting HSC quiescence34,44; as well as the anti-apoptotic genes Bcl2 and Mcl1, which were both significantly increased in the LHRH-Ant treated samples were found. Importantly, both Bcl-2 and Mcl-1 have been implicated in regulating HSC quiescence and survival respectively45,46.
To test whether this LHRH-Ant-mediated preservation of HSC quiescence and enhancement of HSC survival after hematopoietic stress could confer protection against chemotherapy-induced myeloablation, mice were challenged with successive doses of 5-fluorouracil (5-FU); a well-established method to functionally test HSC proliferation and self-renewal that leads to ablation of proliferating HSCs and ultimately death29,34,47. Abrogation of LH production significantly improved survival after serial 5-FU challenge (FIG. 8B), supporting a role in promoting HSC quiescence. Together, these results show that ablation of LH can limit HSC entry into cell cycle thus promoting their quiescence and survival during hematopoietic insult.
To evaluate the cell intrinsic effects of LHCGR stimulation in HSCs, repopulating experiments were performed with LT-HSCs purified from WT or kiLHR mice, which have a gain of function mutation (D582G) that makes the LHCGR constitutively active40,48. Peripheral blood analysis of donor reconstitution did not reveal any difference over the time course analyzed, showing that signaling of LHCGR is redundant for HSC repopulating potential and survival (FIG. 8C). Rather, it was hypothesized that stimulation of the LH receptor could be detrimental to cells that have undergone hematopoietic stress themselves and then need to proliferate in response to hematopoietic injury. Therefore, mice that had been reconstituted for 6 months with WT or kiLHR were exposed to SL-TBI and cell apoptosis was evaluated two days later. Consistent with previous findings, constitutive LHCGR signaling in kiLHR HSCs significantly promoted reduction in LT-HSC survival after radiation exposure, as measured by higher proportion of apoptotic cells (FIG. 8D).
Taken together the disclosure demonstrates that pharmacological inhibition of LH signaling using a single dose of an LHRH-Ant represents a rational and feasible approach to preserve the HSC pool after high dose radiation, thereby mitigating acute hematopoietic radiation syndrome (FIG. 8E). Contrary to the initial hypothesis, this was not mediated by sex steroids, but rather due to LH signaling through the most primitive HSCs, promoting their proliferation and leading to increased cell death. LH levels and HSC activity change considerably during several physiological conditions, including pregnancy, aging, stress, exercise and circadian rhythm, all of which have been implicated in hematopoiesis. These findings thus also lay the groundwork for revealing a potential role for LH in a range of aberrant hematopoietic conditions.
Methods. Mice: C57BL/6 (CD45.2) male mice (The Jackson Laboratory, MA) were used at 7 to 8 weeks of age. B6.SJL-Ptprca Pepcb/BoyJ (CD45.1) male mice (The Jackson Laboratory) were used between 7 and 12 weeks of age for transplant. Mice were irradiated with a Gammacell 40 Irradiator (Cs-137), with an average dose rate of 95 cGy/min, in a plexiglass mouse pie cage. To assess mouse survival after radiation, mice were monitored for up to 60 days after TBI. To adjust for differences in weight, identical mice were purchased from Jackson and cages randomly distributed over different groups. All animal protocols were approved by the Memorial Sloan Kettering Cancer Center Institutional Animal Care and Use Committee.
Reagents: Degarelix (as acetate), a LHRH-Ant (Firmagon), was resuspended in sterile water for injection and administered S.C. to mice at a dose of 40 mg/kg. To evaluate the radiomitigative effect of LHRH-Ant on survival, mice were treated subcutaneously (S.C.) with a single injection of the LHRH-Ant or a saline control solution (PBS). Degarelix was purchased from the Memorial Sloan-Kettering Cancer Center Pharmacy. Poly I:C (InvivoGen) was administered I.P to mice at a dose of 5 mg/kg. hCG (cellsciences) was resuspended in sterile PBS and administered S.C. to mice at a dose of 201U. LH from human pituitary (SIGMA) was resuspended in PBS for in vitro studies. MDV3100 (selleckchem) was resuspended in a mixture of 45% PBS, 45% PEG and 10% DMSO and administered daily to mice by oral gavage at a dose of 10 mg/kg. 5-FU (InvivoGen) was administered to mice intraperitoneally (I.P.) at a dose of 150 mg/kg once every 7 days consecutively for 3 times as previously described34,47,49.
Colony-Forming Cell (CFC) and Cobblestone Areas Forming Cell (CAFC): Assays were performed as previously described with a minor modifications50. For CFC assays, 5×104 BM nucleated cells (BMNC) per 1 mL of Iscove's modified Dulbecco's medium (GIBCO) supplemented with 1.2% methylcellulose (Dow Chemicals, MI), 30% FBS, 2 mM glutamine, 0.1 mM monothiolglycerol, 0.1 mg/ml hemin (Sigma Inc, MO), 0.05 mg gentamicin, 20 ng/mL murine c-kit ligand (Amgen Inc, CA), 6 units/ml human Epogen (Amgen Inc. CA), and 20 ng/mL murine IL-3 (Pepro Tech Inc., NJ) were plated in triplicates in 35-mm non-tissue culture dishes (Corning-Costar, NY). When there were fewer BMNC, all the BM cells were equally plated to Petri dishes in triplicates. Colonies were scored after 10 days of incubation at 37° C. and 5% CO2. For the CAFC assays, murine stromal cells MS-551 (kindly provided by Dr. KJ Mori, Niigata University, Niigata, Japan), was maintained in MEM alpha containing 10% FCS, 50 μg/ml gentamicin and tested with a MycoAlert Plus mycoplasma kit (Lonza) to ensure mycoplasma-free. When the MS-5 culture reached 90% confluence, the culture was passaged in 1:8 dilution. Two days prior to CAFC assay, confluent MS-5 cells were harvested, and 0.8-1×105 MS-5 cells/12.5 cm2 flasks were plated and cultured. For CAFC assay, 1.5-3×103 purified LSK cells were co-cultured with the confluent MS-5 cells in 3 ml of α-MEM containing 12.5% FBS (Atlanta Biologicals, GA), 12.5% horse serum (GE Health Life Science, Utah), 1 μM Hydrocortisone (Sigma Inc, MO) and 5×10-5 M 2-mercaptoethanol (Fisher Scientific) in triplicates at 37° C. and 5% CO2. Half of the culture medium was replenished weekly. After 3 weeks of co-culture, CAFCs were scored as phase-dark hematopoietic clones of at least 5 cells beneath the stromal layer using an inverted microscope.
In vitro effect of LH of HSCs, CAFC and CFC assays.
Mouse cells: Two thousand purified LSK cells and MS-5 cells were co-cultured in T-12.5 flasks with or without 0.5 or 5 μg/ml of LH in 4 replicates. LH was added daily for 3 day and media replenished with an half of fresh CAFC medium weekly. After three weeks, CAFC were scored. The co-cultures were further harvested by washing with 3 ml of cold PBS 3 times and detached with 0.05% trypsin solution. The harvested co-culture medium, the washes and the detached cells were pooled, pelleted and subjected to CFC bioassay.
Human cells: Human umbilical cord blood (UCB) CD34+ cells were harvested, enriched and cultured as previously described52. Briefly before enrichment of NHP CD34+ cells, red cells were lysed in ammonium chloride lysis buffer. For enrichment of human CD34+ cells, microbead conjugated anti-CD34 antibody (Miltenyi Biotech) was used. Enriched and sort-purified CD34+ cells were cultured in StemSpan (Stemcell Technologies) supplemented with 100 U/ml penicillin streptomycin (Gibco by Life Technologies) and SCF, TPO and FLT3-L (all Peprotech) (100 ng/ml each) with 50% exchange of culture medium on day 4. Fresh LH was added every day for the total duration of in vitro culture. For CFC assays 400 sorted cells were seeded into 1 ml MethoCult H4435 (StemCell Technologies). Hematopoietic colonies were scored after 12-14 days. Arising colonies were identified as colony forming unit—(CFU-) granulocyte (CFU-G), macrophage (CFU-M), granulocyte-macrophage (CFU-GM) and burst forming unit-erythrocyte (BFU-E). Colonies consisting of erythroid and myeloid cells were scored as CFU-MIX.
Flow cytometry and cell cycle analysis: Monoclonal antibodies recognizing the following markers were used for flow cytometric analyses and cell sorting of murine cells (LSR II or FACSAria III, BD Biosciences): (from BD Pharmingen) c-kit (2B8), Sca-1 (D7), CD11b (M1/70), CD11c (HL3), CD19 (ID3), CD3ϵ (145-2C11), CD34 (RAM34), CD45 (30-F11), CD45.1 (A20), CD45.2 (104), CD48 (HM48-1), CD62L (MEL-14), CD135 (A2F10.1), Gr-1 (RB6-8C5), NK1.1 (PK136), TER-119 (TER-119); (from eBioscience) CD127 (A7R34), CD150 (mShad150); (from Invitrogen) B220 (RA3-6B2) and streptavidin (N/A). The mouse lineage antibody cocktail included anti-CD3, anti-CD4, anti-CD8α, anti-CD19, anti-CD11 b, anti-CD11c, anti-Gr-1, anti-NK1.1, and anti-TER119. The following antibodies were used for flow cytometry analyses of human samples, CD49f (eBioGoH3), CD45RA (L48), CD34 (581), CD38 (HIT2). CD90 (5E10), CD10 (H110a). The human lineage antibody cocktail included anti-CD3, anti-CD14, anti-CD16, anti-CD19, anti-CD20, anti-CD56. To detect human LHCGR a polyclonal anti-LHCGR (Alomone, cat #:ALR-010) was used. For intracellular Ki67/DAPI staining, BM cells were stained with surface markers, fixed, and permeabilized using the Fixation/Permeabilization kit (cat. 00552100 ebioscience) and permeabilization buffer (cat. 008333 ebioscience). Cells were then incubated with Ki67-Alexa 700 (B56) (from BD Biosciences) for 45 minutes at 4C. After centrifugation DAPI (5 μg/ml) was added to cells and allowed to incubate for at least 30 min at RT before analysis.
Cell isolation and cord blood processing: BM cells were flushed from intact femurs and tibia, and spleens were mashed with glass slides to generate single-cell suspension. Collection of the cells was performed in RPMI media with 10% FBS or PBS with 0.5% BSA, and filtered through a 70-μm strainer. Unless otherwise stated, all cell numbers in this study were standardized as total counts per two legs or per spleen. Human cord bloods were obtained from New York Blood Center. Cord bloods were processed separately in each experiment. An equal volume of phosphate buffered saline was added prior to layering on Ficoll/Paque gradient and samples were processed according to manufacturer's protocol. CD34+ cells were enriched by magnetic separation using human CD34 MicroBead kit (Miltenyi Biotec).
Bone marrow transplant: In the competitive BM transplant, whole BM from CD45.2+ (vehicle or LHRH-Ant) donors and were collected and transplanted into lethally irradiated CD45.1+ mice (1100 cGy TBI, split dose) along with 2.5×105 CD45.1+ competitors, through tail vein injection. Donor chimerism was monitored monthly after transplant. In the LSK transplant, lineage-Sca-1+c-Kit+ cells from BM were selected using a FACS Aria II cell sorter (BD).
Real time PCR: Reverse transcription-PCR was performed with QuantiTect reverse transcription kit (QIAGEN). For real-time PCR, specific primer and probe sets were obtained from Applied Biosystems as follows: β-actin (Mm01205647_g1); HPRT (Mm00446968_m1); AR (Mm00442688_m1); FSHR (Mm00442819_m1); LHCGR (Mm00442931_m1). PCR was done on ABI 7500 (Applied Biosystems) or Step-One Plus (Applied Biosystems) with TaqMan Universal PCR Master Mix (Applied Biosystems). Relative amounts of mRNA were calculated by the Ct method.
Statistics: Bars and error bars represent the mean+SEM for the various groups. For most experiments, nonparametric testing was performed if normal distribution could not be assumed. All tests performed are two sided. Statistical analysis between two groups was performed with the nonparametric, unpaired Mann-Whitney U test. Tests performed are two sided, except for gene category analysis. Differential expression of gene categories was computed using Fisher's method and the input p-value for each individual gene from a category is computed from a one sided test. Survival data were analyzed with the Mantel-Cox log-rank test. Parametric t test was used for FIG. 6H right panel. The experiments were not randomized and the investigators were not blinded to the group allocation during the experiments or when assessing the outcomes. To ensure adequate power for statistical analysis at least five samples per group were tested. In general variation within groups and between experiments was low, however to take into account inter-experimental variation all experiments were performed at least twice. To account for intra-experimental variation, particularly for in vitro studies, several wells per conditions were assessed with primary sample material coming from at least two different mice. No samples or animals were excluded from the analysis except for mouse peripheral blood analysis where outliers were detected prior to the analysis with two-sided Grubbs' test for outliers (GraphPad). All statistics were calculated and display graphs generated using GraphPad 6.
As will be understood by one of ordinary skill in the art, each embodiment disclosed herein can comprise, consist essentially of or consist of its particular stated element, step, ingredient or component. Thus, the terms “include” or “including” should be interpreted to recite: “comprise, consist of, or consist essentially of.” The transition term “comprise” or “comprises” means includes, but is not limited to, and allows for the inclusion of unspecified elements, steps, ingredients, or components, even in major amounts. The transitional phrase “consisting of” excludes any element, step, ingredient or component not specified. The transition phrase “consisting essentially of” limits the scope of the embodiment to the specified elements, steps, ingredients or components and to those that do not materially affect the embodiment. A material effect would cause a statistically-significant reduction in the ability to enrich for and isolate, expand and/or ablate pHSC.
Unless otherwise indicated, all numbers expressing quantities of ingredients, properties such as molecular weight, reaction conditions, and so forth used in the specification and claims are to be understood as being modified in all instances by the term “about.” Accordingly, unless indicated to the contrary, the numerical parameters set forth in the specification and attached claims are approximations that may vary depending upon the desired properties sought to be obtained by the present invention. At the very least, and not as an attempt to limit the application of the doctrine of equivalents to the scope of the claims, each numerical parameter should at least be construed in light of the number of reported significant digits and by applying ordinary rounding techniques. When further clarity is required, the term “about” has the meaning reasonably ascribed to it by a person skilled in the art when used in conjunction with a stated numerical value or range, i.e. denoting somewhat more or somewhat less than the stated value or range, to within a range of ±20% of the stated value; ±19% of the stated value; ±18% of the stated value; ±17% of the stated value; ±16% of the stated value; ±15% of the stated value; ±14% of the stated value; ±13% of the stated value; ±12% of the stated value; ±11% of the stated value; ±10% of the stated value; ±9% of the stated value; ±8% of the stated value; ±7% of the stated value; ±6% of the stated value; ±5% of the stated value; ±4% of the stated value; ±3% of the stated value; ±2% of the stated value; or ±1% of the stated value.
Notwithstanding that the numerical ranges and parameters setting forth the broad scope of the invention are approximations, the numerical values set forth in the specific examples are reported as precisely as possible. Any numerical value, however, inherently contains certain errors necessarily resulting from the standard deviation found in their respective testing measurements.
The terms “a,” “an,” “the” and similar referents used in the context of describing the invention (especially in the context of the following claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. Recitation of ranges of values herein is merely intended to serve as a shorthand method of referring individually to each separate value falling within the range. Unless otherwise indicated herein, each individual value is incorporated into the specification as if it were individually recited herein. All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., “such as”) provided herein is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention otherwise claimed. No language in the specification should be construed as indicating any non-claimed element essential to the practice of the invention.
Groupings of alternative elements or embodiments of the invention disclosed herein are not to be construed as limitations. Each group member may be referred to and claimed individually or in any combination with other members of the group or other elements found herein. It is anticipated that one or more members of a group may be included in, or deleted from, a group for reasons of convenience and/or patentability. When any such inclusion or deletion occurs, the specification is deemed to contain the group as modified thus fulfilling the written description of all Markush groups used in the appended claims.
Certain embodiments of this invention are described herein, including the best mode known to the inventors for carrying out the invention. Of course, variations on these described embodiments will become apparent to those of ordinary skill in the art upon reading the foregoing description. The inventor expects skilled artisans to employ such variations as appropriate, and the inventors intend for the invention to be practiced otherwise than specifically described herein. Accordingly, this invention includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Moreover, any combination of the above-described elements in all possible variations thereof is encompassed by the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
Furthermore, numerous references have been made to patents, printed publications, journal articles and other written text throughout this specification (referenced materials herein). Each of the referenced materials are individually incorporated herein by reference in their entirety for their referenced teaching.
In closing, it is to be understood that the embodiments of the invention disclosed herein are illustrative of the principles of the present invention. Other modifications that may be employed are within the scope of the invention. Thus, by way of example, but not of limitation, alternative configurations of the present invention may be utilized in accordance with the teachings herein. Accordingly, the present invention is not limited to that precisely as shown and described.
The particulars shown herein are by way of example and for purposes of illustrative discussion of the preferred embodiments of the present invention only and are presented in the cause of providing what is believed to be the most useful and readily understood description of the principles and conceptual aspects of various embodiments of the invention. In this regard, no attempt is made to show structural details of the invention in more detail than is necessary for the fundamental understanding of the invention, the description taken with the drawings and/or examples making apparent to those skilled in the art how the several forms of the invention may be embodied in practice.
Definitions and explanations used in the present disclosure are meant and intended to be controlling in any future construction unless clearly and unambiguously modified in the following examples or when application of the meaning renders any construction meaningless or essentially meaningless. In cases where the construction of the term would render it meaningless or essentially meaningless, the definition should be taken from Webster's Dictionary, 3rd Edition or a dictionary known to those of ordinary skill in the art, such as the Oxford Dictionary of Biochemistry and Molecular Biology (Ed. Anthony Smith, Oxford University Press, Oxford, 2004).
EXAMPLE 1 REFERENCES
    • 1. Dainiak, Experimental hematology 30, 513-528 (2002).
    • 2. Anno, et al., Health Phys 84, 565-575 (2003).
    • 3. Mierzejewska, et al., Hematopoietic Stem/Progenitor Cells Express Several Functional Sex Hormone Receptors-Novel Evidence for a Potential Developmental Link Between Hematopoiesis and Primordial Germ Cells. Stem cells and development (2015).
    • 4. Sanchez-Aguilera, et al., Cell stem cell 15, 791-804 (2014).
    • 5. Nakada, et al., Nature 505, 555-558 (2014).
    • 6. Dudakov, et al., Journal of Immunology 183, 7084-7094 (2009).
    • 7. Khong, et al., Enhanced Hematopoietic Stem Cell Function Mediates Immune Regeneration following Sex Steroid Blockade. Stem cell reports (2015).
    • 8. Thurmond, et al., Endocrinology 141, 2309-2318 (2000).
    • 9. Williams, et al., Radiat Res 173, 557-578 (2010).
    • 10. Drouet, & Herodinlnt J Radiat Biol 86, 636-648 (2010).
    • 11. Herodin, & Drouet, Experimental hematology 33, 1071-1080 (2005).
    • 12. Koukourakis, Br J Radio! 85, 313-330 (2012).
    • 13. Singh & Yadav, Exp Mol Pathol 78, 156-169 (2005).
    • 14. Dudakov, et al., Journal of Immunology 182, 6247-6260 (2009).
    • 15. Goldberg, Journal of Immunology 184, 6014-6024 (2010).
    • 16. Velardi, et al., Sex steroid blockade enhances thymopoiesis by modulating Notch signaling. J Exp Med (2014).
    • 17. Delic, et al., The British journal of cancer. Supplement 7, 105-107 (1986).
    • 18. Delic, et al., Radiotherapy and oncology: journal of the European Society for Therapeutic Radiology and Oncology 5, 29-37 (1986).
    • 19. Shalet, et al., The Journal of endocrinology 120, 161-165 (1989).
    • 20. Meistrich, Pediatric blood & cancer 53, 261-266 (2009).
    • 21. Heng, Painter, & Immunological Genome Project, C. Nat Immunol 9, 1091-1094 (2008).
    • 22. Seita, et al., PLoS One 7, e40321 (2012).
    • 23. Huntsman, et al., Blood 126, 1631-1633 (2015).
    • 24. Notta, et al., Science 333, 218-221 (2011).
    • 25. Luo, et al., Journal of the American Association for Laboratory Animal Science: JAALAS 50, 471-478 (2011).
    • 26. Choi & Smitz, Molecular and cellular endocrinology 383, 203-213 (2014).
    • 27. Zhang, et al., Mol Endocrinol 15, 172-183 (2001).
    • 28. Lei, et al., Mol Endocrinol 15, 184-200 (2001).
    • 29. Tsai, et al., Nature cell biology 15, 309-316 (2013).
    • 30. Kharas, et al., Blood 115, 1406-1415 (2010).
    • 31. Kharas, & Gritsman, Cell cycle 9, 1223-1224 (2010).
    • 32. Wang, et al., Genes Dev 25, 1426-1438 (2011).
    • 33. Wang et al., Blood 107, 358-366 (2006).
    • 34. Cheng, et al., Science 287, 1804-1808 (2000).
    • 35. Johnson, et al., J Clin Invest 120, 2528-2536 (2010).
    • 36. Chen, et al., J Exp Med 205, 2397-2408 (2008).
    • 37. Himburg, et al., J Clin Invest 124, 4753-4758 (2014).
    • 38. Mak, et al., Nature neuroscience 10, 1003-1011 (2007).
    • 39. Shiraishi & Ascoli, Endocrinology 148, 3214-3225 (2007).
    • 40. McGee & Narayan, Endocrinology 154, 3900-3913 (2013).
    • 41. Zsebo, et al., Proc Natl Acad Sci USA 89, 9464-9468 (1992).
    • 42. Essers, et al., Nature 458, 904-908 (2009).
    • 43. Doan, et al., Epidermal growth factor regulates hematopoietic regeneration after radiation injury. Nat Med (2013).
    • 44. Yu, et al., Stem Cells 24, 876-888 (2006).
    • 45. Opferman, et al., Science 307, 1101-1104 (2005).
    • 46. Qing, et al., Blood 123, 1002-1011 (2014).
    • 47. Randall & Weissman, Blood 89, 3596-3606 (1997).
    • 48. Hai, et al., Biology of reproduction 93, 16 (2015).
    • 49. Tsai, et al., Nature cell biology 15, 309-316 (2013).
    • 50. Jo, et al., J Clin Invest 105, 101-111 (2000).
    • 51. Itoh, et al Experimental hematology 17, 145-153 (1989).
    • 52. Radtke, et al., Exp Hematol 44, 502-507 (2016).

Claims (18)

What is claimed is:
1. A cDNA comprising a sequence as set forth in SEQ ID NO: 19 or SEQ ID NO: 6 or a sequence having at least 90% sequence identity to SEQ ID NO: 19 or SEQ ID NO: 6.
2. The cDNA of claim 1, wherein the cDNA encodes a luteinizing hormone receptor (LHR) binding agent.
3. The cDNA of claim 2, wherein the LHR binding agent comprises a luteinizing hormone (LH) alpha subunit and a LH beta subunit.
4. The cDNA of claim 3, wherein
the LH alpha subunit has the sequence as set forth in SEQ ID NO: 23 or a sequence having at least 90% sequence identity to SEQ ID NO: 23 and the LH beta subunit has the sequence as set forth in SEQ ID NO: 22 or a sequence having at least 90% sequence identity to SEQ ID NO: 22; or
the LH alpha subunit has the sequence as set forth in SEQ ID NO: 11 or a sequence having at least 90% sequence identity to SEQ ID NO: 11 and the LH beta subunit has the sequence as set forth in SEQ ID NO: 9 or a sequence having at least 90% sequence identity to SEQ ID NO: 9.
5. The cDNA of claim 2, wherein the LHR binding agent has the sequence as set forth in SEQ ID NO: 51 or a sequence having at least 90% sequence identity to SEQ ID NO: 51.
6. The cDNA of claim 2, wherein the LHR binding agent comprises:
a CDRH1 having the sequence as set forth in SEQ ID NO: 28, a CDRH2 having the sequence as set forth in SEQ ID NO: 29, a CDRH3 having the sequence as set forth in SEQ ID NO: 30, a CDRL1 having the sequence as set forth in SEQ ID NO: 31, a CDRL2 having the sequence DTS, and a CDRL3 having the sequence as set forth in SEQ ID NO: 32;
a CDRH1 having the sequence as set forth in SEQ ID NO: 33, a CDRH2 having the sequence as set forth in SEQ ID NO: 34, a CDRH3 having the sequence as set forth in SEQ ID NO: 35, a CDRL1 having the sequence as set forth in SEQ ID NO: 36, a CDRL2 having the sequence WAS, and a CDRL3 having the sequence as set forth in SEQ ID NO: 37; or
a CDRH1 having the sequence as set forth in SEQ ID NO: 38, a CDRH2 having the sequence as set forth in SEQ ID NO: 39, a CDRH3 having the sequence as set forth in SEQ ID NO: 40, a CDRL1 having the sequence as set forth in SEQ ID NO: 41, a CDRL2 having the sequence NAS, and a CDRL3 having the sequence as set forth in SEQ ID NO: 42.
7. The cDNA of claim 2, wherein the LHR binding agent comprises
a heavy chain having the sequence as set forth in SEQ ID NO: 43 or a sequence having at least 90% sequence identity to SEQ ID NO: 43 and a light chain having the sequence as set forth in SEQ ID NO: 44 or a sequence having at least 90% sequence identity to SEQ ID NO: 44;
a heavy chain having the sequence as set forth in SEQ ID NO: 45 or a sequence having at least 90% sequence identity to SEQ ID NO: 45 and a light chain having the sequence as set forth in SEQ ID NO: 46 or a sequence having at least 90% sequence identity to SEQ ID NO: 46;
a heavy chain having the sequence as set forth in SEQ ID NO: 47 or a sequence having at least 90% sequence identity to SEQ ID NO: 47 and a light chain having the sequence as set forth in SEQ ID NO: 48 or a sequence having at least 90% sequence identity to SEQ ID NO: 48; or
a heavy chain having the sequence as set forth in SEQ ID NO: 49 or a sequence having at least 90% sequence identity to SEQ ID NO: 49 and a light chain having the sequence as set forth in SEQ ID NO: 50 or a sequence having at least 90% sequence identity to SEQ ID NO: 50.
8. The cDNA of claim 1, wherein the cDNA encodes the sequence as set forth in SEQ ID NO: 10 or a sequence having at least 90% sequence identity to SEQ ID NO: 10.
9. The cDNA of claim 1, wherein the cDNA encodes 4-1BB and CD3 zeta.
10. The cDNA of claim 1, wherein the cDNA encodes a CD28 hinge and a CD28 transmembrane domain.
11. The cDNA of claim 1, wherein the cDNA encodes
the sequence as set forth in SEQ ID NO: 20 or a sequence having at least 90% sequence identity to SEQ ID NO: 20, or
the sequence as set forth in SEQ ID NO: 7 or a sequence having at least 90% sequence identity to SEQ ID NO: 7.
12. The cDNA of claim 1, wherein the cDNA encodes the sequence as set forth in SEQ ID NO: 24 or a sequence having at least 90% sequence identity to SEQ ID NO: 24 and SEQ ID NO: 25 or a sequence having at least 90% sequence identity to SEQ ID NO: 25.
13. The cDNA of claim 1, wherein the cDNA encodes the sequence as set forth in SEQ ID NO: 26 or a sequence having at least 90% sequence identity to SEQ ID NO: 26 and SEQ ID NO: 27 or a sequence having at least 90% sequence identity to SEQ ID NO: 27.
14. The cDNA of claim 1, wherein the cDNA encodes the sequence as set forth in SEQ ID NO: 15 or a sequence having at least 90% sequence identity to SEQ ID NO: 15 and SEQ ID NO: 16 or a sequence having at least 90% sequence identity to SEQ ID NO: 16.
15. The cDNA of claim 1, wherein the cDNA encodes
the sequence as set forth in SEQ ID NO: 15 or a sequence having at least 90% sequence identity to SEQ ID NO: 15,
the sequence as set forth in SEQ ID NO: 16 or a sequence having at least 90% sequence identity to SEQ ID NO: 16 and
the sequence as set forth in SEQ ID NO: 17 or a sequence having at least 90% sequence identity to SEQ ID NO: 17.
16. The cDNA of claim 1, wherein the cDNA is within an immune cell.
17. The cDNA of claim 16, wherein the immune cell is a hematopoietic stem cell (HSC), a T cell, or a natural killer (NK) cell.
18. The cDNA of claim 17, wherein the HSC is a primitive HSC (pHSC).
US18/208,490 2017-10-02 2023-06-12 Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells Active US12295973B2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US18/208,490 US12295973B2 (en) 2017-10-02 2023-06-12 Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201762566897P 2017-10-02 2017-10-02
PCT/US2018/054004 WO2019070740A2 (en) 2017-10-02 2018-10-02 Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify primitive stem cell populations
US202016753277A 2020-04-02 2020-04-02
US18/208,490 US12295973B2 (en) 2017-10-02 2023-06-12 Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
US16/753,277 Continuation US11786557B2 (en) 2017-10-02 2018-10-02 Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells
PCT/US2018/054004 Continuation WO2019070740A2 (en) 2017-10-02 2018-10-02 Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify primitive stem cell populations

Publications (2)

Publication Number Publication Date
US20240091265A1 US20240091265A1 (en) 2024-03-21
US12295973B2 true US12295973B2 (en) 2025-05-13

Family

ID=65994753

Family Applications (2)

Application Number Title Priority Date Filing Date
US16/753,277 Active 2040-06-13 US11786557B2 (en) 2017-10-02 2018-10-02 Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells
US18/208,490 Active US12295973B2 (en) 2017-10-02 2023-06-12 Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US16/753,277 Active 2040-06-13 US11786557B2 (en) 2017-10-02 2018-10-02 Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells

Country Status (3)

Country Link
US (2) US11786557B2 (en)
EP (1) EP3675878A4 (en)
WO (1) WO2019070740A2 (en)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20230026461A (en) * 2020-06-23 2023-02-24 제넨테크, 인크. Macrocyclic compounds and methods of use thereof

Citations (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5444167A (en) 1993-07-07 1995-08-22 Wallac Oy Variant luteinizing hormone encoding DNA
WO1998014592A2 (en) 1996-10-01 1998-04-09 Geron Corporation Telomerase reverse transcriptase
US20020127652A1 (en) 2000-02-11 2002-09-12 Schambye Hans Thalsgard Follicle stimulating hormones
WO2003028711A2 (en) 2001-09-27 2003-04-10 Novartis Ag Use of c-kit inhibitors for the treatment of myeloma
US20030219786A1 (en) 2000-08-11 2003-11-27 Applied Research Systems Ars Holding N.V. Novel glycoproteins and methods of use thereof
US20050020524A1 (en) 1999-04-15 2005-01-27 Monash University Hematopoietic stem cell gene therapy
US6919209B1 (en) 1998-12-04 2005-07-19 City Of Hope Method of genetically modifying very primitive quiescent human hematopoietic stem cells
WO2005115304A2 (en) 2004-05-24 2005-12-08 Ab Science Use of c-kit inhibitors for treating fibrodysplasia
US20140348744A1 (en) 2013-05-24 2014-11-27 Jacek K. Pinski Compositions and methods for regulating cancer-related signaling pathways
US20150037296A1 (en) 2011-06-10 2015-02-05 Bluebird Bio, Inc. Gene therapy vectors for adrenoleukodystrophy and adrenomyeloneuropathy
US20150266973A1 (en) * 2013-07-29 2015-09-24 Bluebird Bio, Inc. Multipartite signaling proteins and uses thereof
WO2016094880A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs)
WO2016118780A1 (en) 2015-01-21 2016-07-28 Fred Hutchinson Cancer Research Center Point-of-care and/or portable platform for gene therapy
WO2016160618A2 (en) 2015-03-27 2016-10-06 University Of Southern California Car t-cell therapy directed to lhr for the treatment of solid tumors
US20170226176A1 (en) * 2014-10-02 2017-08-10 The Wistar Institute Of Anatomy And Biology Methods and compositions for treating cancer

Patent Citations (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5444167A (en) 1993-07-07 1995-08-22 Wallac Oy Variant luteinizing hormone encoding DNA
WO1998014592A2 (en) 1996-10-01 1998-04-09 Geron Corporation Telomerase reverse transcriptase
US6919209B1 (en) 1998-12-04 2005-07-19 City Of Hope Method of genetically modifying very primitive quiescent human hematopoietic stem cells
US20050020524A1 (en) 1999-04-15 2005-01-27 Monash University Hematopoietic stem cell gene therapy
US20020127652A1 (en) 2000-02-11 2002-09-12 Schambye Hans Thalsgard Follicle stimulating hormones
US20030219786A1 (en) 2000-08-11 2003-11-27 Applied Research Systems Ars Holding N.V. Novel glycoproteins and methods of use thereof
WO2003028711A2 (en) 2001-09-27 2003-04-10 Novartis Ag Use of c-kit inhibitors for the treatment of myeloma
WO2005115304A2 (en) 2004-05-24 2005-12-08 Ab Science Use of c-kit inhibitors for treating fibrodysplasia
US20150037296A1 (en) 2011-06-10 2015-02-05 Bluebird Bio, Inc. Gene therapy vectors for adrenoleukodystrophy and adrenomyeloneuropathy
US20140348744A1 (en) 2013-05-24 2014-11-27 Jacek K. Pinski Compositions and methods for regulating cancer-related signaling pathways
US20150266973A1 (en) * 2013-07-29 2015-09-24 Bluebird Bio, Inc. Multipartite signaling proteins and uses thereof
US20170226176A1 (en) * 2014-10-02 2017-08-10 The Wistar Institute Of Anatomy And Biology Methods and compositions for treating cancer
WO2016094880A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs)
WO2016118780A1 (en) 2015-01-21 2016-07-28 Fred Hutchinson Cancer Research Center Point-of-care and/or portable platform for gene therapy
WO2016160618A2 (en) 2015-03-27 2016-10-06 University Of Southern California Car t-cell therapy directed to lhr for the treatment of solid tumors

Non-Patent Citations (77)

* Cited by examiner, † Cited by third party
Title
Abdelbaset-Ismail, et al., "Human Haematopoietic stem/progenitor cells express several functional sex hormone receptors," J. Cell Mol. Med., vol. 20, No. 1, 2016, pp. 134-146.
Akritopoulou-Zanze, et al., "Synthesis and biological evaluation of 5-substituted 1,4-dihydroindeno[1,2-c]pyrazoles as multitargeted receptor tyrosine kinase inhibitors," Bioorganic & Medicinal Chemistry Letters, vol. 17, No. 11, 2007, pp. 3136-3140.
Anno, et al., "Dose Response Relationships for Acute Ionizing-Radiation Lethality," Health Physics, vol. 84, No. 5, 2003, pp. 565-575.
Broxmeyer, et al., "HLA-DR human histocompatibility leukocyte antigens-restricted lymphocyte-monocyte interactions in the release from monocytes of acidic isoferritins that suppress hematopoietic progenitor cells.," Journal of Clinical Investigation, vol. 73, No. 4, 1984, pp. 939-953.
Chen, et al., "TSC-mTOR maintains quiescence and function of hematopoietic stem cells by repressing mitochondrial biogenesis and reactive oxygen species," J. Exp. Med., vol. 205, No. 10, 2008, pp. 2397-2408.
Cheng, et al., "Hematopoietic Stem Cell Quiescence Maintained by p21cip1/waf1," Science, vol. 287, No. 5459, 2000, pp. 1804-1808.
Choi & Smitz, "Luteinizing hormone and human chorionic gonadotropin: Origins of difference," Molecular and Cellular Endocrinology, vol. 383, No. 1-2, 2014, pp. 203-213.
Chow, et al., "The tyrosine kinase inhibitor AMN107 (Nilotinib) exhibits off-target effects in lymphoblastic cell lines," Leukemia & Lymphoma, vol. 48, No. 7, 2007, pp. 1379-1388.
Craddock, et al., "Antibodies to VLA4 integrin mobilize long-term repopulating cells and augment cytokine-induced mobilization in primates and mice," Blood, vol. 90, No. 12, 1997, pp. 4779-4788.
Dainiak, Nicholas, "Hematologic consequences of exposure to ionizing radiation," Experimental Hematology, vol. 30, No. 6, 2002, pp. 513-528.
Davies & Metzger, "Structural basis of antibody function," Annual Review of Immunology, vol. 1, 1983, pp. 87-117.
Delic, et al., "Leydig cell function in the pubertal rat following local testicular irradiation," Radiother. Oncol., vol. 5, No. 1, 1986, pp. 29-37.
Delic, et al., "Serum androgen binding protein and follicle stimulating hormone as indices of Sertoli cell function in the irradiated testis.," British Journal of Cancer, vol. 53, Suppl. 7, 1986, pp. 105-107.
Doan, et al., "Epidermal growth factor regulates hematopoietic regeneration after radiation injury," Nature Medicine, vol. 19, No. 3, 2013, pp. 295-304.
Drouet & Herodin, "Radiation victim management and the haematologist in the future: time to revisit therapeutic guidelines?," International Journal of Radiation Biology, vol. 86, No. 8, 2010, pp. 636-648.
Dudakov, et al., "Sex Steroid Ablation Enhances Hematopoietic Recovery following Cytotoxic Antineoplastic Therapy in Aged Mice," Journal of Immunology, vol. 183, No. 11, 2009, pp. 7084-7094.
Dudakov, et al., "Withdrawal of Sex Steroids Reverses Age- and Chemotherapy-Related Defects in Bone Marrow Lymphopoiesis," Journal of Immunology, vol. 182, No. 10, 2009, pp. 6247-6260.
Esser, et al., "IFNalpha activates dormant haematopoietic stem cells in vivo," Nature, vol. 458, 2009, pp. 904-908.
Extended European Search Report Dated May 19, 2021, for European Application No. 18864802.6, 8 pages.
Goldberg, et al., "Sex Steroid Ablation Enhances Immune Reconstitution Following Cytotoxic Antineoplastic Therapy in Young Mice," Journal of Immunology, vol. 184, No. 11, 2010, pp. 6014-6024.
Hai, et al., "Infertility in Female Mice with a Gain-of-Function Mutation in the Luteinizing Hormone Receptor Is Due to Irregular Estrous Cyclicity, Anovulation, Hormonal Alterations, and Polycystic Ovaries," Biology of Reproduction, vol. 93, No. 1, 2015, pp. 1-11.
Heng, et al., "The Immunological Genome Project: networks of gene expression in immune cells," Nature Immunology, vol. 9, No. 10, 2008, pp. 1091-1094.
Herodin & Drouet, "Cytokine-based treatment of accidentally irradiated victims and new approaches," Experimental Hematology, vol. 33, No. 10, 2005, pp. 1071-1080.
Himburg, et al., "Pleiotrophin mediates hematopoietic regeneration via activation of RAS," Journal of Clinical Investigation, vol. 124, No. 11, 2014, pp. 4753-4758.
Huntsman, et al., "Human hematopoietic stem cells from mobilized peripheral blood can be purified based on CD49f integrin expression," Blood, vol. 126, No. 13, 2015, pp. 1631-1633.
Invitation to Pay Additional Fees Dated Jan. 25, 2019 for International Application No. PCT/US2018/054004, 3 pages.
Itoh, et al., "Reproducible establishment of hemopoietic supportive stromal cell lines from murine bone marrow," Exp. Hematology, vol. 17, No. 2, 1989, pp. 145-153.
Jin, et al., "Differentiation of two types of mobilized peripheral blood stem cells by microRNA and cDNA expression analysis," Journal of Translational Medicine, vol. 6, No. 39, 2008, 12 pages.
Jo, et al., "Chemotaxis of primitive hematopoietic cells in response to stromal cell-derived factor-1," Journal of Clinical Investigation, vol. 105, No. 1, 2000, pp. 101-111.
Johnson, et al., "Mitigation of hematologic radiation toxicity in mice through pharmacological quiescence induced by CDK4/6 inhibition," Journal of Clinical Investigation, vol. 120, No. 7, 2010, pp. 2528-2536.
Kharas & Gritsman, "Akt: A double-edged sword for hematopoietic stem cells" Cell Cycle, vol. 9, No. 7, 2010, pp. 1223-1224.
Kharas, et al., "Constitutively active AKT depletes hematopoietic stem cells and induces leukemia in mice," Blood, vol. 115, No. 7, 2010, pp. 1406-1415.
Khong, et al., "Enhanced Hematopoietic Stem Cell Function Mediates Immune Regeneration following Sex Steroid Blockade," Stem Cell Reports, vol. 4, No. 3, 2015, pp. 445-458.
Kodo, et al., "Antibody synthesis by bone marrow cells in vitro following primary and booster tetanus toxoid immunization in humans," Journal of Clinical Investigation, vol. 73, No. 5, 1984, pp. 1377-1384.
Koukourakis, "Radiation damage and radioprotectants: new concepts in the era of molecular medicine," British Institute of Radiology, vol. 85, 2012, pp. 313-330.
Lazebnik, et al., "Cleavage of poly(ADP-ribose) polymerase by a proteinase with properties like ICE," Nature, vol. 371, 1994, pp. 346-347.
Lei, et al., "Targeted disruption of luteinizing hormone/human chorionic gonadotropin receptor gene," Mol. Endocrinol., vol. 15, No. 1, 2001, pp. 184-200.
Luo, et al., "Superovulation strategies for 6 commonly used mouse strains" J. Am. Assoc. Lab. Anim. Sci., vol. 50, No. 4, 2011, pp. 471-478.
Majeti, et al., "Identification of a Hierarchy of Multipotent Hematopoietic Progenitors in Human Cord Blood," Cell Stem Cell, vol. 1, No. 6, Cell Press, 2007, pp. 635-645.
Mak, et al., "Male pheromone-stimulated neurogenesis in the adult female brain: possible role in mating behavior.," Nature Neuroscience, vol. 10, No. 8, 2007, pp. 1003-1011.
McGee & Narayan, "Precocious Puberty and Leydig Cell Hyperplasia in Male Mice With a Gain of Function Mutation in the LH Receptor Gene," Endocrinology, vol. 154, No. 10, 2013, pp. 3900-3913.
Meduri, et al., "Luteinizing Hormone/Human Chorionic Gonadotropin Receptors in Breast Cancer," Cancer Research, 1997, pp. 857-864.
Meistrich, Marvin, "Male gonadal toxicity," Pediatric Blood & Cancer, vol. 53, No. 2, 2009, pp. 261-266.
Mierzejewska, et al., "Hematopoietic Stem/Progenitor Cells Express Several Functional Sex Hormone Receptors—Novel Evidence for a Potential Developmental Link Between Hematopoiesis and Primordial Germ Cells," Stem Cells and Development, vol. 24, No. 8, 2015, pp. 927-937.
Nakada, et al., "Oestrogen increases haematopoietic stem-cell self-renewal in females and during pregnancy," Nature, vol. 505, No. 7484, 2014, pp. 555-558.
Naldini, "A Comeback for Gene Therapy," Science, vol. 326, 2009, 3 pages.
Notta, et al., "Isolation of Single Human Hematopoietic Stem Cells Capable of Long-Term Multilineage Engraftment," Science, vol. 333, No. 6039, 2011, pp. 218-221.
Office Action for U.S. Appl. No. 16/753,277, mailed on Oct. 24, 2022, Dudakov, "Luteinizing Hormone Receptor Binding Agents and Luteinizing Hormone Agonists to Identify, Expand, Ablate and Modify Stem Cells", 8 Pages.
Opferman, et al., "Obligate Role of Anti-Apoptotic MCL-1 in the Survival of Hematopoietic Stem Cells," Science, vol. 307, No. 5712, 2005, pp. 1101-1104.
Papayannopoulou, et al., "Anti-VLA4/VCAM-1-induced mobilization requires cooperative signaling through the kit/mkit ligand pathway," Blood, vol. 91, No. 7, 1998, pp. 2231-2239.
Parrott et al., "Expression and actions of both the follicle stimulating hormone receptor and the luteinizing hormone receptor in normal ovarian surface epithelium and ovarian cancer," Mol. Cell. Endocrinol., vol. 172, No. 1-2, 2001, pp. 213-222.
Pelus, Louis, "Peripheral blood stem cell mobilization: new regimens, new cells, where do we stand," Curr. Opin. Hematol., vol. 15, No. 4, 2008, pp. 285-292.
Qing, et al., "Bcl2 overexpression rescues the hematopoietic stem cell defects in Ku70-deficient mice by restoration of quiescence," Blood, vol. 123, No. 7, 2014, pp. 1002-1011.
Radtke, et al., "The frequency of multipotent CD133+CD45RA—CD34+ hematopoietic stem cells is not increased in fetal liver compared with adult stem cell sources," Experimental Hematology, vol. 44, No. 6, 2016, pp. 502-507.
Randall & Weissman, "Phenotypic and functional changes induced at the clonal level in hematopoietic stem cells after 5-fluorouracil treatment," Blood, vol. 89, No. 10, 1997, pp. 3596-3606.
Rashid, et al., "Comparison of GK1.5 and chimeric rat/mouse GK1.5 anti-CD4 antibodies for prolongation of skin allograft survival and suppression of alloantibody production in mice," Journal of Immunology, vol. 148, No. 5, 1992, pp. 1382-1388.
Reisner, et al., "Allogeneic hemopoietic stem cell transplantation using mouse spleen cells fractionated by lectins: in vitro study of cell fractions," PNAS USA, vol. 77, No. 2, 1980, pp. 1164-1168.
Sanchez-Aguilera, et al., "Estrogen Signaling Selectively Induces Apoptosis of Hematopoietic Progenitors and Myeloid Neoplasms without Harming Steady-State Hematopoiesis," Cell Stem Cell, vol. 15, No. 6, 2014, pp. 791-804.
Search Report and Written Opinion Dated Mar. 22, 2019 for International Application No. PCT/US18/54004, 22 pages.
Seita, et al., "Gene Expression Commons: An Open Platform for Absolute Gene Expression Profiling." PLoS One, vol. 7, No. 7, 2012, 11 pages.
Shalet, et al., "Vulnerability of the human Leydig cell to radiation damage is dependent upon age," Journal of Endocrinology, vol. 120, No. 1, 1989, pp. 161-165.
Shiraishi & Ascoli, "Lutropin/Choriogonadotropin Stimulate the Proliferation of Primary Cultures of Rat Leydig Cells through a Pathway that Involves Activation of the Extracellularly Regulated Kinase 1/2 Cascade," Endocrinology, vol. 148, No. 7, 2007, pp. 3214-3225.
Singh & Yadav, "Role of cytokines and growth factors in radioprotection," Experimental and Molecular Pathology, vol. 78, No. 2, 2005, pp. 156-169.
Tatesu, et al., "A Novel Approach in Expanding CD34+CD90+ and CD34+CD38+CD90+ Cells Associated with Enhanced in Vivo Repopulating Potential," Blood, vol. 120, No. 21, 2012, pp. 1-3.
Thurmond, et al., "Role of Estrogen Receptor alpha in Hematopoietic Stem Cell Development and B Lymphocyte Maturation in the Male Mouse," Endocrinology, vol. 141, No. 7, 2000, pp. 2309-2318.
Tricot, et al., "Mobilization of peripheral blood stem cells in myeloma with either pegfilgrastim or filgrastim following chemotherapy," Haematologica, vol. 93, No. 11, 2008, pp. 1739-1742.
Tsai, et al., "Nrf2 regulates haematopoietic stem cell function," Nature Cell Biology, vol. 15, No. 3, 2013, pp. 309-316.
Urbanska, et al., "Follicle-stimulating hormone receptor as a target in the redirected T-cell therapy for Cancer," Cancer Immunol. Res., vol. 3, No. 10, 2015, pp. 1130-1137.
Velardi, et al., "Sex steroid blockade enhances thymopoiesis by modulating Notch signaling," Journal of Experimental Medicine, vol. 211, No. 12, 2014, pp. 2341-2349.
Wang, et al., "Fine-tuning p53 activity through C-terminal modification significantly contributes to HSC homeostasis and mouse radiosensitivity," Genes & Development, vol. 25, 2011, pp. 1426-1438.
Wang, et al., "Total body irradiation selectively induces murine hematopoietic stem cell senescence," Blood, vol. 107, No. 1, 2006, pp. 358-366.
Weaver, et al., "Mobilization of peripheral blood stem cells following myelosuppressive chemotherapy: a randomized comparison of filgrastim, sargramostim, or sequential sargramostim and filgrastim," Bone Marrow Transplantation, vol. 27, Suppl. 2, 2001, pp. S23-S29.
Williams, et al., "Animal Models for Medical Countermeasures to Radiation Exposure," Radiation Research, vol. 173, No. 4, 2010, pp. 557-578.
Williams, et al., "Pluripotential hematopoietic stem cells in post-5-fluorouracil murine bone marrow express the Thy-1 antigen," Journal of Immunology, vol. 135, No. 2, 1985, pp. 1004-1011.
Yu, et al., "HES1 Inhibits Cycling of Hematopoietic Progenitor Cells via DNA Binding," Stem Cells, vol. 24, No. 4, 2006, pp. 876-888.
Zhang, et al., "Normal prenatal but arrested postnatal sexual development of luteinizing hormone receptor knockout (LuRKO) mice," Mol. Endocrinol., vol. 15, No. 1, 2001, pp. 172-183.
Zsebo, et al., "Radioprotection of mice by recombinant rat stem cell factor," PNAS USA, vol. 89, No. 20, 1992, pp. 9464-9468.

Also Published As

Publication number Publication date
EP3675878A2 (en) 2020-07-08
US20240091265A1 (en) 2024-03-21
EP3675878A4 (en) 2021-06-16
WO2019070740A2 (en) 2019-04-11
US20200237827A1 (en) 2020-07-30
US11786557B2 (en) 2023-10-17
WO2019070740A3 (en) 2019-05-09

Similar Documents

Publication Publication Date Title
US20240041933A1 (en) Modified hematopoietic stem/progenitor and non-t effector cells, and uses thereof
ES2845898T5 (en) Engraftment of stem cells with a combination of an agent that targets stem cells and modulation of immunoregulatory signaling
JP2024105337A (en) Chimeric receptors for flt3 and methods of use thereof
JP6985934B2 (en) Manipulated hematopoietic stem / progenitor cells and non-T effector cells, as well as their use
KR102887853B1 (en) CD79A chimeric antigen receptor
KR20160068960A (en) Polyclonal gamma delta t cells for immunotherapy
RS63735B1 (en) CHIMERIC RECEPTORS AND PROCEDURES OF THEIR USE
US12398402B2 (en) Reducing CD33 expression to selectively protect therapeutic cells
CN110312527A (en) Non-genotoxic conditioning regimens for stem cell transplantation
US20220380776A1 (en) Base editor-mediated cd33 reduction to selectively protect therapeutic cells
US12295973B2 (en) Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells
HK40098659A (en) Genetically engineered cells and uses thereof

Legal Events

Date Code Title Description
FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

AS Assignment

Owner name: FRED HUTCHINSON CANCER CENTER, WASHINGTON

Free format text: MERGER AND CHANGE OF NAME;ASSIGNORS:FRED HUTCHINSON CANCER RESEARCH CENTER;SEATTLE CANCER CARE ALLIANCE;REEL/FRAME:064157/0801

Effective date: 20220401

Owner name: MEMORIAL SLOAN-KETTERING CANCER CENTER, NEW YORK

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:JAMES, SCOTT;REEL/FRAME:064157/0798

Effective date: 20180926

Owner name: FRED HUTCHINSON CANCER RESEARCH CENTER, WASHINGTON

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:DUDAKOV, JARROD;KIEM, HANS-PETER;RADTKE, STEFAN;SIGNING DATES FROM 20171005 TO 20171016;REEL/FRAME:064157/0781

Owner name: MEMORIAL SLOAN-KETTERING CANCER CENTER, NEW YORK

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:VAN DEN BRINK, MARCEL;VELARDI, ENRICO;SIGNING DATES FROM 20171116 TO 20171121;REEL/FRAME:064157/0772

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

STCF Information on status: patent grant

Free format text: PATENTED CASE