US11976123B2 - Anti-CD40 antibodies and uses thereof - Google Patents
Anti-CD40 antibodies and uses thereof Download PDFInfo
- Publication number
- US11976123B2 US11976123B2 US17/048,954 US201917048954A US11976123B2 US 11976123 B2 US11976123 B2 US 11976123B2 US 201917048954 A US201917048954 A US 201917048954A US 11976123 B2 US11976123 B2 US 11976123B2
- Authority
- US
- United States
- Prior art keywords
- antibody
- antibodies
- seq
- human
- cells
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active, expires
Links
- 238000000034 method Methods 0.000 claims abstract description 85
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 claims abstract description 78
- 101150013553 CD40 gene Proteins 0.000 claims abstract description 74
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 21
- 201000011510 cancer Diseases 0.000 claims abstract description 16
- 230000028993 immune response Effects 0.000 claims abstract description 13
- 208000026278 immune system disease Diseases 0.000 claims abstract description 12
- 241000282414 Homo sapiens Species 0.000 claims description 90
- 230000027455 binding Effects 0.000 claims description 69
- 238000009739 binding Methods 0.000 claims description 65
- 239000000427 antigen Substances 0.000 claims description 63
- 108091007433 antigens Proteins 0.000 claims description 62
- 102000036639 antigens Human genes 0.000 claims description 62
- 150000007523 nucleic acids Chemical class 0.000 claims description 30
- 101100099884 Homo sapiens CD40 gene Proteins 0.000 claims description 29
- 239000012634 fragment Substances 0.000 claims description 29
- 102000039446 nucleic acids Human genes 0.000 claims description 29
- 108020004707 nucleic acids Proteins 0.000 claims description 29
- 239000013598 vector Substances 0.000 claims description 25
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 22
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 18
- 239000013604 expression vector Substances 0.000 claims description 18
- 239000008194 pharmaceutical composition Substances 0.000 claims description 18
- 230000014509 gene expression Effects 0.000 claims description 16
- 238000004519 manufacturing process Methods 0.000 claims description 14
- 238000006467 substitution reaction Methods 0.000 claims description 9
- 102100029205 Low affinity immunoglobulin gamma Fc region receptor II-b Human genes 0.000 claims description 7
- 108010021472 Fc gamma receptor IIB Proteins 0.000 claims description 6
- 239000003937 drug carrier Substances 0.000 claims description 6
- 238000004113 cell culture Methods 0.000 claims description 4
- 238000012258 culturing Methods 0.000 claims description 3
- 238000003306 harvesting Methods 0.000 claims description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 67
- 201000010099 disease Diseases 0.000 abstract description 47
- 210000004443 dendritic cell Anatomy 0.000 abstract description 27
- 230000002708 enhancing effect Effects 0.000 abstract description 5
- 230000011664 signaling Effects 0.000 abstract description 4
- 230000003915 cell function Effects 0.000 abstract 1
- 210000004027 cell Anatomy 0.000 description 82
- 108090000623 proteins and genes Proteins 0.000 description 49
- 239000000203 mixture Substances 0.000 description 30
- 108090000765 processed proteins & peptides Proteins 0.000 description 25
- 102000004169 proteins and genes Human genes 0.000 description 24
- 108060003951 Immunoglobulin Proteins 0.000 description 23
- 102000018358 immunoglobulin Human genes 0.000 description 23
- 235000018102 proteins Nutrition 0.000 description 22
- 102000004196 processed proteins & peptides Human genes 0.000 description 21
- 208000035475 disorder Diseases 0.000 description 20
- 229910052757 nitrogen Inorganic materials 0.000 description 20
- 238000011282 treatment Methods 0.000 description 20
- 229920001184 polypeptide Polymers 0.000 description 19
- 210000004408 hybridoma Anatomy 0.000 description 18
- 230000000694 effects Effects 0.000 description 17
- 235000001014 amino acid Nutrition 0.000 description 15
- 238000003556 assay Methods 0.000 description 14
- 239000000243 solution Substances 0.000 description 13
- 150000001413 amino acids Chemical class 0.000 description 12
- -1 for example Proteins 0.000 description 12
- 230000001225 therapeutic effect Effects 0.000 description 12
- 238000002965 ELISA Methods 0.000 description 11
- 241000282567 Macaca fascicularis Species 0.000 description 11
- 229940024606 amino acid Drugs 0.000 description 11
- 239000003795 chemical substances by application Substances 0.000 description 11
- 230000000295 complement effect Effects 0.000 description 11
- 239000003814 drug Substances 0.000 description 11
- 108020004414 DNA Proteins 0.000 description 10
- 241001465754 Metazoa Species 0.000 description 10
- 230000001270 agonistic effect Effects 0.000 description 10
- 210000003719 b-lymphocyte Anatomy 0.000 description 10
- 102100032937 CD40 ligand Human genes 0.000 description 9
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 9
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 9
- 238000011161 development Methods 0.000 description 9
- 230000018109 developmental process Effects 0.000 description 9
- 238000005516 engineering process Methods 0.000 description 9
- 239000000463 material Substances 0.000 description 9
- 230000001404 mediated effect Effects 0.000 description 9
- 239000000546 pharmaceutical excipient Substances 0.000 description 9
- 208000023275 Autoimmune disease Diseases 0.000 description 8
- 108010029697 CD40 Ligand Proteins 0.000 description 8
- 241000700159 Rattus Species 0.000 description 8
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 8
- 230000004913 activation Effects 0.000 description 8
- 125000000539 amino acid group Chemical group 0.000 description 8
- 238000007796 conventional method Methods 0.000 description 8
- 238000001415 gene therapy Methods 0.000 description 8
- 229940072221 immunoglobulins Drugs 0.000 description 8
- 102000040430 polynucleotide Human genes 0.000 description 8
- 108091033319 polynucleotide Proteins 0.000 description 8
- 239000002157 polynucleotide Substances 0.000 description 8
- 208000024891 symptom Diseases 0.000 description 8
- 238000012360 testing method Methods 0.000 description 8
- 238000002560 therapeutic procedure Methods 0.000 description 8
- 206010035226 Plasma cell myeloma Diseases 0.000 description 7
- 239000004098 Tetracycline Substances 0.000 description 7
- 238000004458 analytical method Methods 0.000 description 7
- 230000015572 biosynthetic process Effects 0.000 description 7
- 239000000839 emulsion Substances 0.000 description 7
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 7
- 239000001963 growth medium Substances 0.000 description 7
- 239000002502 liposome Substances 0.000 description 7
- 241000894007 species Species 0.000 description 7
- 229960002180 tetracycline Drugs 0.000 description 7
- 229930101283 tetracycline Natural products 0.000 description 7
- 235000019364 tetracycline Nutrition 0.000 description 7
- 150000003522 tetracyclines Chemical class 0.000 description 7
- 238000013518 transcription Methods 0.000 description 7
- 230000035897 transcription Effects 0.000 description 7
- 239000003981 vehicle Substances 0.000 description 7
- 102000013462 Interleukin-12 Human genes 0.000 description 6
- 108010065805 Interleukin-12 Proteins 0.000 description 6
- 241000699666 Mus <mouse, genus> Species 0.000 description 6
- 241000699670 Mus sp. Species 0.000 description 6
- 239000004480 active ingredient Substances 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 238000001990 intravenous administration Methods 0.000 description 6
- 210000004962 mammalian cell Anatomy 0.000 description 6
- 201000000050 myeloid neoplasm Diseases 0.000 description 6
- 229940124597 therapeutic agent Drugs 0.000 description 6
- 102000004127 Cytokines Human genes 0.000 description 5
- 108090000695 Cytokines Proteins 0.000 description 5
- 108010092160 Dactinomycin Proteins 0.000 description 5
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 239000003112 inhibitor Substances 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 238000003259 recombinant expression Methods 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 239000003826 tablet Substances 0.000 description 5
- 230000003612 virological effect Effects 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- 108010063916 CD40 Antigens Proteins 0.000 description 4
- 241000282693 Cercopithecidae Species 0.000 description 4
- 108091026890 Coding region Proteins 0.000 description 4
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- 102000004890 Interleukin-8 Human genes 0.000 description 4
- 108090001007 Interleukin-8 Proteins 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- 241000124008 Mammalia Species 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 239000002202 Polyethylene glycol Substances 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 4
- 239000013543 active substance Substances 0.000 description 4
- 210000000612 antigen-presenting cell Anatomy 0.000 description 4
- 230000000890 antigenic effect Effects 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 239000000969 carrier Substances 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- 229960000640 dactinomycin Drugs 0.000 description 4
- 239000002552 dosage form Substances 0.000 description 4
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 238000001802 infusion Methods 0.000 description 4
- 238000013507 mapping Methods 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 239000003094 microcapsule Substances 0.000 description 4
- 238000000302 molecular modelling Methods 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- 239000006187 pill Substances 0.000 description 4
- 230000008488 polyadenylation Effects 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 239000000843 powder Substances 0.000 description 4
- 230000019491 signal transduction Effects 0.000 description 4
- 239000004094 surface-active agent Substances 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 3
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 3
- 102000014914 Carrier Proteins Human genes 0.000 description 3
- 241000701022 Cytomegalovirus Species 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 3
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 3
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 3
- 239000012190 activator Substances 0.000 description 3
- 239000000556 agonist Substances 0.000 description 3
- 125000000217 alkyl group Chemical group 0.000 description 3
- 230000001028 anti-proliverative effect Effects 0.000 description 3
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 3
- 238000011319 anticancer therapy Methods 0.000 description 3
- 230000005975 antitumor immune response Effects 0.000 description 3
- 229960001230 asparagine Drugs 0.000 description 3
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 description 3
- 239000001506 calcium phosphate Substances 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 230000005754 cellular signaling Effects 0.000 description 3
- 229920001577 copolymer Polymers 0.000 description 3
- 229960004397 cyclophosphamide Drugs 0.000 description 3
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 3
- 229960000975 daunorubicin Drugs 0.000 description 3
- 238000002825 functional assay Methods 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 238000001476 gene delivery Methods 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 210000004698 lymphocyte Anatomy 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 3
- 230000003278 mimic effect Effects 0.000 description 3
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 3
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 3
- 229960001156 mitoxantrone Drugs 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 238000002823 phage display Methods 0.000 description 3
- 150000003904 phospholipids Chemical class 0.000 description 3
- 229960003171 plicamycin Drugs 0.000 description 3
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 229960002930 sirolimus Drugs 0.000 description 3
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 238000013268 sustained release Methods 0.000 description 3
- 239000012730 sustained-release form Substances 0.000 description 3
- 101150061166 tetR gene Proteins 0.000 description 3
- MWWSFMDVAYGXBV-MYPASOLCSA-N (7r,9s)-7-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound Cl.O([C@@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 MWWSFMDVAYGXBV-MYPASOLCSA-N 0.000 description 2
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 2
- 108091093088 Amplicon Proteins 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 108010006654 Bleomycin Proteins 0.000 description 2
- 238000011740 C57BL/6 mouse Methods 0.000 description 2
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 2
- 208000006332 Choriocarcinoma Diseases 0.000 description 2
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 2
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 2
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 2
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 2
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- 108010054278 Lac Repressors Proteins 0.000 description 2
- 108010000817 Leuprolide Proteins 0.000 description 2
- 206010025323 Lymphomas Diseases 0.000 description 2
- 241000282560 Macaca mulatta Species 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- 229930192392 Mitomycin Natural products 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 2
- 108091061960 Naked DNA Proteins 0.000 description 2
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Natural products OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 201000010208 Seminoma Diseases 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical class C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 2
- 108091023040 Transcription factor Proteins 0.000 description 2
- 102000040945 Transcription factor Human genes 0.000 description 2
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 2
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 230000001464 adherent effect Effects 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 230000009824 affinity maturation Effects 0.000 description 2
- 229960001220 amsacrine Drugs 0.000 description 2
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 2
- 229940045799 anthracyclines and related substance Drugs 0.000 description 2
- 230000002927 anti-mitotic effect Effects 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 2
- 229960002092 busulfan Drugs 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 2
- 229940127093 camptothecin Drugs 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 229960004562 carboplatin Drugs 0.000 description 2
- YCIMNLLNPGFGHC-UHFFFAOYSA-N catechol Chemical compound OC1=CC=CC=C1O YCIMNLLNPGFGHC-UHFFFAOYSA-N 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- 229960004630 chlorambucil Drugs 0.000 description 2
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 229960004316 cisplatin Drugs 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 239000003246 corticosteroid Substances 0.000 description 2
- 229960001334 corticosteroids Drugs 0.000 description 2
- 230000000139 costimulatory effect Effects 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 229930182912 cyclosporin Natural products 0.000 description 2
- 230000001934 delay Effects 0.000 description 2
- 238000000502 dialysis Methods 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 2
- 231100000673 dose–response relationship Toxicity 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 239000012055 enteric layer Substances 0.000 description 2
- 229940088598 enzyme Drugs 0.000 description 2
- 229960001904 epirubicin Drugs 0.000 description 2
- 210000002919 epithelial cell Anatomy 0.000 description 2
- LZCLXQDLBQLTDK-UHFFFAOYSA-N ethyl 2-hydroxypropanoate Chemical compound CCOC(=O)C(C)O LZCLXQDLBQLTDK-UHFFFAOYSA-N 0.000 description 2
- 229960005420 etoposide Drugs 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 210000002950 fibroblast Anatomy 0.000 description 2
- 229940126864 fibroblast growth factor Drugs 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 2
- 238000009396 hybridization Methods 0.000 description 2
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 2
- 229960000908 idarubicin Drugs 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 230000016784 immunoglobulin production Effects 0.000 description 2
- 229940125721 immunosuppressive agent Drugs 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 239000000411 inducer Substances 0.000 description 2
- 230000028709 inflammatory response Effects 0.000 description 2
- 238000007919 intrasynovial administration Methods 0.000 description 2
- 238000007913 intrathecal administration Methods 0.000 description 2
- 238000010253 intravenous injection Methods 0.000 description 2
- RGLRXNKKBLIBQS-XNHQSDQCSA-N leuprolide acetate Chemical compound CC(O)=O.CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 RGLRXNKKBLIBQS-XNHQSDQCSA-N 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 239000012669 liquid formulation Substances 0.000 description 2
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 229960001924 melphalan Drugs 0.000 description 2
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 229960004857 mitomycin Drugs 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 210000001616 monocyte Anatomy 0.000 description 2
- 206010028417 myasthenia gravis Diseases 0.000 description 2
- 229960004866 mycophenolate mofetil Drugs 0.000 description 2
- RTGDFNSFWBGLEC-SYZQJQIISA-N mycophenolate mofetil Chemical compound COC1=C(C)C=2COC(=O)C=2C(O)=C1C\C=C(/C)CCC(=O)OCCN1CCOCC1 RTGDFNSFWBGLEC-SYZQJQIISA-N 0.000 description 2
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 238000004806 packaging method and process Methods 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- AQIXEPGDORPWBJ-UHFFFAOYSA-N pentan-3-ol Chemical compound CCC(O)CC AQIXEPGDORPWBJ-UHFFFAOYSA-N 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 2
- 229960000624 procarbazine Drugs 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 238000000159 protein binding assay Methods 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- GHMLBKRAJCXXBS-UHFFFAOYSA-N resorcinol Chemical compound OC1=CC=CC(O)=C1 GHMLBKRAJCXXBS-UHFFFAOYSA-N 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 210000003705 ribosome Anatomy 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 210000000329 smooth muscle myocyte Anatomy 0.000 description 2
- 239000008247 solid mixture Substances 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 235000010356 sorbitol Nutrition 0.000 description 2
- 239000003549 soybean oil Substances 0.000 description 2
- 235000012424 soybean oil Nutrition 0.000 description 2
- 206010041823 squamous cell carcinoma Diseases 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 2
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 2
- 229960001278 teniposide Drugs 0.000 description 2
- 201000002510 thyroid cancer Diseases 0.000 description 2
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 229960003048 vinblastine Drugs 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- XMQUEQJCYRFIQS-YFKPBYRVSA-N (2s)-2-amino-5-ethoxy-5-oxopentanoic acid Chemical compound CCOC(=O)CC[C@H](N)C(O)=O XMQUEQJCYRFIQS-YFKPBYRVSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- LKJPYSCBVHEWIU-KRWDZBQOSA-N (R)-bicalutamide Chemical compound C([C@@](O)(C)C(=O)NC=1C=C(C(C#N)=CC=1)C(F)(F)F)S(=O)(=O)C1=CC=C(F)C=C1 LKJPYSCBVHEWIU-KRWDZBQOSA-N 0.000 description 1
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 description 1
- JLPULHDHAOZNQI-ZTIMHPMXSA-N 1-hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCC\C=C/C\C=C/CCCCC JLPULHDHAOZNQI-ZTIMHPMXSA-N 0.000 description 1
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- FUFLCEKSBBHCMO-UHFFFAOYSA-N 11-dehydrocorticosterone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 FUFLCEKSBBHCMO-UHFFFAOYSA-N 0.000 description 1
- XKZQKPRCPNGNFR-UHFFFAOYSA-N 2-(3-hydroxyphenyl)phenol Chemical compound OC1=CC=CC(C=2C(=CC=CC=2)O)=C1 XKZQKPRCPNGNFR-UHFFFAOYSA-N 0.000 description 1
- FALRKNHUBBKYCC-UHFFFAOYSA-N 2-(chloromethyl)pyridine-3-carbonitrile Chemical compound ClCC1=NC=CC=C1C#N FALRKNHUBBKYCC-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- CTRPRMNBTVRDFH-UHFFFAOYSA-N 2-n-methyl-1,3,5-triazine-2,4,6-triamine Chemical class CNC1=NC(N)=NC(N)=N1 CTRPRMNBTVRDFH-UHFFFAOYSA-N 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- HIQIXEFWDLTDED-UHFFFAOYSA-N 4-hydroxy-1-piperidin-4-ylpyrrolidin-2-one Chemical compound O=C1CC(O)CN1C1CCNCC1 HIQIXEFWDLTDED-UHFFFAOYSA-N 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 1
- 208000016683 Adult T-cell leukemia/lymphoma Diseases 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 235000019489 Almond oil Nutrition 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241000710929 Alphavirus Species 0.000 description 1
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 1
- 208000032116 Autoimmune Experimental Encephalomyelitis Diseases 0.000 description 1
- 206010064539 Autoimmune myocarditis Diseases 0.000 description 1
- NOWKCMXCCJGMRR-UHFFFAOYSA-N Aziridine Chemical class C1CN1 NOWKCMXCCJGMRR-UHFFFAOYSA-N 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 239000005552 B01AC04 - Clopidogrel Substances 0.000 description 1
- 239000005528 B01AC05 - Ticlopidine Substances 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 208000023328 Basedow disease Diseases 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 229920002799 BoPET Polymers 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 208000013165 Bowen disease Diseases 0.000 description 1
- 208000019337 Bowen disease of the skin Diseases 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 108010074051 C-Reactive Protein Proteins 0.000 description 1
- 102100032752 C-reactive protein Human genes 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- 208000009458 Carcinoma in Situ Diseases 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 102000011727 Caspases Human genes 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- 229940123587 Cell cycle inhibitor Drugs 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 1
- 108010077544 Chromatin Proteins 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 208000015943 Coeliac disease Diseases 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000012422 Collagen Type I Human genes 0.000 description 1
- 108010022452 Collagen Type I Proteins 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- MFYSYFVPBJMHGN-UHFFFAOYSA-N Cortisone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)(O)C(=O)CO)C4C3CCC2=C1 MFYSYFVPBJMHGN-UHFFFAOYSA-N 0.000 description 1
- MFYSYFVPBJMHGN-ZPOLXVRWSA-N Cortisone Chemical compound O=C1CC[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 MFYSYFVPBJMHGN-ZPOLXVRWSA-N 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 206010011686 Cutaneous vasculitis Diseases 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- 108010036941 Cyclosporins Proteins 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 239000012623 DNA damaging agent Substances 0.000 description 1
- 208000006313 Delayed Hypersensitivity Diseases 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 206010066919 Epidemic polyarthritis Diseases 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 229940123414 Folate antagonist Drugs 0.000 description 1
- 229940032072 GVAX vaccine Drugs 0.000 description 1
- 208000007882 Gastritis Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 208000024869 Goodpasture syndrome Diseases 0.000 description 1
- 108010069236 Goserelin Proteins 0.000 description 1
- BLCLNMBMMGCOAS-URPVMXJPSA-N Goserelin Chemical compound C([C@@H](C(=O)N[C@H](COC(C)(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(=O)NNC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 BLCLNMBMMGCOAS-URPVMXJPSA-N 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 1
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 108010068250 Herpes Simplex Virus Protein Vmw65 Proteins 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 1
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 1
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 1
- 101000611185 Homo sapiens Tumor necrosis factor receptor superfamily member 5 Proteins 0.000 description 1
- 238000012450 HuMAb Mouse Methods 0.000 description 1
- 241000714260 Human T-lymphotropic virus 1 Species 0.000 description 1
- 208000003352 Hyper-IgM Immunodeficiency Syndrome Diseases 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical class C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 108700002232 Immediate-Early Genes Proteins 0.000 description 1
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 1
- 208000028622 Immune thrombocytopenia Diseases 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 208000029462 Immunodeficiency disease Diseases 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 1
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- 238000012695 Interfacial polymerization Methods 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 208000011200 Kawasaki disease Diseases 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 239000004907 Macro-emulsion Substances 0.000 description 1
- 208000000172 Medulloblastoma Diseases 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 208000002030 Merkel cell carcinoma Diseases 0.000 description 1
- 102000029749 Microtubule Human genes 0.000 description 1
- 108091022875 Microtubule Proteins 0.000 description 1
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 1
- HZQDCMWJEBCWBR-UUOKFMHZSA-N Mizoribine Chemical compound OC1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 HZQDCMWJEBCWBR-UUOKFMHZSA-N 0.000 description 1
- 208000003445 Mouth Neoplasms Diseases 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 239000005041 Mylar™ Substances 0.000 description 1
- FXHOOIRPVKKKFG-UHFFFAOYSA-N N,N-Dimethylacetamide Chemical compound CN(C)C(C)=O FXHOOIRPVKKKFG-UHFFFAOYSA-N 0.000 description 1
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 108700019961 Neoplasm Genes Proteins 0.000 description 1
- 102000048850 Neoplasm Genes Human genes 0.000 description 1
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 206010029266 Neuroendocrine carcinoma of the skin Diseases 0.000 description 1
- MWUXSHHQAYIFBG-UHFFFAOYSA-N Nitric oxide Chemical class O=[N] MWUXSHHQAYIFBG-UHFFFAOYSA-N 0.000 description 1
- KYRVNWMVYQXFEU-UHFFFAOYSA-N Nocodazole Chemical compound C1=C2NC(NC(=O)OC)=NC2=CC=C1C(=O)C1=CC=CS1 KYRVNWMVYQXFEU-UHFFFAOYSA-N 0.000 description 1
- MSHZHSPISPJWHW-UHFFFAOYSA-N O-(chloroacetylcarbamoyl)fumagillol Chemical compound O1C(CC=C(C)C)C1(C)C1C(OC)C(OC(=O)NC(=O)CCl)CCC21CO2 MSHZHSPISPJWHW-UHFFFAOYSA-N 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 208000010191 Osteitis Deformans Diseases 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 208000027868 Paget disease Diseases 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 241000721454 Pemphigus Species 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 229920001214 Polysorbate 60 Polymers 0.000 description 1
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 241000710942 Ross River virus Species 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 235000019485 Safflower oil Nutrition 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 241000710961 Semliki Forest virus Species 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 229920001800 Shellac Polymers 0.000 description 1
- 241000710960 Sindbis virus Species 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 244000258044 Solanum gilo Species 0.000 description 1
- NWGKJDSIEKMTRX-AAZCQSIUSA-N Sorbitan monooleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O NWGKJDSIEKMTRX-AAZCQSIUSA-N 0.000 description 1
- IYFATESGLOUGBX-YVNJGZBMSA-N Sorbitan monopalmitate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O IYFATESGLOUGBX-YVNJGZBMSA-N 0.000 description 1
- HVUMOYIDDBPOLL-XWVZOOPGSA-N Sorbitan monostearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O HVUMOYIDDBPOLL-XWVZOOPGSA-N 0.000 description 1
- PRXRUNOAOLTIEF-ADSICKODSA-N Sorbitan trioleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCC\C=C/CCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCC\C=C/CCCCCCCC PRXRUNOAOLTIEF-ADSICKODSA-N 0.000 description 1
- 208000006045 Spondylarthropathies Diseases 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 108010023197 Streptokinase Proteins 0.000 description 1
- 108091027544 Subgenomic mRNA Proteins 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 1
- 201000009594 Systemic Scleroderma Diseases 0.000 description 1
- 206010042953 Systemic sclerosis Diseases 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 230000037453 T cell priming Effects 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 208000029052 T-cell acute lymphoblastic leukemia Diseases 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- 206010043276 Teratoma Diseases 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 description 1
- 108010034949 Thyroglobulin Proteins 0.000 description 1
- 102000009843 Thyroglobulin Human genes 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 1
- 102000003978 Tissue Plasminogen Activator Human genes 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 101710162629 Trypsin inhibitor Proteins 0.000 description 1
- 229940122618 Trypsin inhibitor Drugs 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 108090000435 Urokinase-type plasminogen activator Proteins 0.000 description 1
- 102000003990 Urokinase-type plasminogen activator Human genes 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 241000710959 Venezuelan equine encephalitis virus Species 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 206010047642 Vitiligo Diseases 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- LWZFANDGMFTDAV-BURFUSLBSA-N [(2r)-2-[(2r,3r,4s)-3,4-dihydroxyoxolan-2-yl]-2-hydroxyethyl] dodecanoate Chemical compound CCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O LWZFANDGMFTDAV-BURFUSLBSA-N 0.000 description 1
- 229960000446 abciximab Drugs 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 229940081735 acetylcellulose Drugs 0.000 description 1
- 229960001138 acetylsalicylic acid Drugs 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 239000003463 adsorbent Substances 0.000 description 1
- 201000006966 adult T-cell leukemia Diseases 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 239000008168 almond oil Substances 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 229960000473 altretamine Drugs 0.000 description 1
- 229960003437 aminoglutethimide Drugs 0.000 description 1
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 229960002932 anastrozole Drugs 0.000 description 1
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 1
- 229940125364 angiotensin receptor blocker Drugs 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001772 anti-angiogenic effect Effects 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000002095 anti-migrative effect Effects 0.000 description 1
- 230000002529 anti-mitochondrial effect Effects 0.000 description 1
- 230000003460 anti-nuclear Effects 0.000 description 1
- 230000003356 anti-rheumatic effect Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 239000003146 anticoagulant agent Substances 0.000 description 1
- 229940127219 anticoagulant drug Drugs 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 229940045687 antimetabolites folic acid analogs Drugs 0.000 description 1
- 239000003080 antimitotic agent Substances 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 229940045719 antineoplastic alkylating agent nitrosoureas Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 229940127218 antiplatelet drug Drugs 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 239000003886 aromatase inhibitor Substances 0.000 description 1
- 229940046844 aromatase inhibitors Drugs 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 238000002820 assay format Methods 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 229960000997 bicalutamide Drugs 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 201000009036 biliary tract cancer Diseases 0.000 description 1
- 208000020790 biliary tract neoplasm Diseases 0.000 description 1
- 238000013357 binding ELISA Methods 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- HUTDDBSSHVOYJR-UHFFFAOYSA-H bis[(2-oxo-1,3,2$l^{5},4$l^{2}-dioxaphosphaplumbetan-2-yl)oxy]lead Chemical compound [Pb+2].[Pb+2].[Pb+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O HUTDDBSSHVOYJR-UHFFFAOYSA-H 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- 230000023555 blood coagulation Effects 0.000 description 1
- 238000010241 blood sampling Methods 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- PHEZJEYUWHETKO-UHFFFAOYSA-N brequinar Chemical compound N1=C2C=CC(F)=CC2=C(C(O)=O)C(C)=C1C(C=C1)=CC=C1C1=CC=CC=C1F PHEZJEYUWHETKO-UHFFFAOYSA-N 0.000 description 1
- 229950010231 brequinar Drugs 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- LRHPLDYGYMQRHN-UHFFFAOYSA-N butyl alcohol Substances CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 125000001314 canonical amino-acid group Chemical group 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 235000011089 carbon dioxide Nutrition 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 238000010370 cell cloning Methods 0.000 description 1
- 230000011712 cell development Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 210000003679 cervix uteri Anatomy 0.000 description 1
- 229960000541 cetyl alcohol Drugs 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 230000005591 charge neutralization Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 210000003483 chromatin Anatomy 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 229960003009 clopidogrel Drugs 0.000 description 1
- GKTWGGQPFAXNFI-HNNXBMFYSA-N clopidogrel Chemical compound C1([C@H](N2CC=3C=CSC=3CC2)C(=O)OC)=CC=CC=C1Cl GKTWGGQPFAXNFI-HNNXBMFYSA-N 0.000 description 1
- 238000003501 co-culture Methods 0.000 description 1
- 238000005354 coacervation Methods 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000003271 compound fluorescence assay Methods 0.000 description 1
- 238000002591 computed tomography Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000013256 coordination polymer Substances 0.000 description 1
- 235000005687 corn oil Nutrition 0.000 description 1
- 239000002285 corn oil Substances 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 229960004544 cortisone Drugs 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 239000002385 cottonseed oil Substances 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 208000017763 cutaneous neuroendocrine carcinoma Diseases 0.000 description 1
- HPXRVTGHNJAIIH-UHFFFAOYSA-N cyclohexanol Chemical compound OC1CCCCC1 HPXRVTGHNJAIIH-UHFFFAOYSA-N 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 1
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 1
- 229940038472 dicalcium phosphate Drugs 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 229960002768 dipyridamole Drugs 0.000 description 1
- IZEKFCXSFNUWAM-UHFFFAOYSA-N dipyridamole Chemical compound C=12N=C(N(CCO)CCO)N=C(N3CCCCC3)C2=NC(N(CCO)CCO)=NC=1N1CCCCC1 IZEKFCXSFNUWAM-UHFFFAOYSA-N 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 208000037765 diseases and disorders Diseases 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 210000001198 duodenum Anatomy 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 239000002702 enteric coating Substances 0.000 description 1
- 230000010502 episomal replication Effects 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 229930013356 epothilone Natural products 0.000 description 1
- HESCAJZNRMSMJG-KKQRBIROSA-N epothilone A Chemical class C/C([C@@H]1C[C@@H]2O[C@@H]2CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(C)=N1 HESCAJZNRMSMJG-KKQRBIROSA-N 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 229940011871 estrogen Drugs 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- 229940116333 ethyl lactate Drugs 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 208000012997 experimental autoimmune encephalomyelitis Diseases 0.000 description 1
- 239000003527 fibrinolytic agent Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 229960000556 fingolimod Drugs 0.000 description 1
- KKGQTZUTZRNORY-UHFFFAOYSA-N fingolimod Chemical compound CCCCCCCCC1=CC=C(CCC(N)(CO)CO)C=C1 KKGQTZUTZRNORY-UHFFFAOYSA-N 0.000 description 1
- 238000009459 flexible packaging Methods 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- NBVXSUQYWXRMNV-UHFFFAOYSA-N fluoromethane Chemical compound FC NBVXSUQYWXRMNV-UHFFFAOYSA-N 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 150000002224 folic acids Chemical class 0.000 description 1
- 238000011990 functional testing Methods 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 229940045109 genistein Drugs 0.000 description 1
- TZBJGXHYKVUXJN-UHFFFAOYSA-N genistein Natural products C1=CC(O)=CC=C1C1=COC2=CC(O)=CC(O)=C2C1=O TZBJGXHYKVUXJN-UHFFFAOYSA-N 0.000 description 1
- 235000006539 genistein Nutrition 0.000 description 1
- ZCOLJUOHXJRHDI-CMWLGVBASA-N genistein 7-O-beta-D-glucoside Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=CC(O)=C2C(=O)C(C=3C=CC(O)=CC=3)=COC2=C1 ZCOLJUOHXJRHDI-CMWLGVBASA-N 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 230000012178 germinal center formation Effects 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 229960002989 glutamic acid Drugs 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 125000003147 glycosyl group Chemical group 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 229960002913 goserelin Drugs 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 239000008240 homogeneous mixture Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 239000003668 hormone analog Substances 0.000 description 1
- 238000002657 hormone replacement therapy Methods 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 206010066130 hyper-IgM syndrome Diseases 0.000 description 1
- 229960001101 ifosfamide Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 1
- 229940127121 immunoconjugate Drugs 0.000 description 1
- 230000007813 immunodeficiency Effects 0.000 description 1
- 229940099472 immunoglobulin a Drugs 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000005462 in vivo assay Methods 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 229940028435 intralipid Drugs 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 229940043355 kinase inhibitor Drugs 0.000 description 1
- 238000009533 lab test Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229960000681 leflunomide Drugs 0.000 description 1
- VHOGYURTWQBHIL-UHFFFAOYSA-N leflunomide Chemical compound O1N=CC(C(=O)NC=2C=CC(=CC=2)C(F)(F)F)=C1C VHOGYURTWQBHIL-UHFFFAOYSA-N 0.000 description 1
- 229960003881 letrozole Drugs 0.000 description 1
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 1
- 239000002960 lipid emulsion Substances 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 229940087857 lupron Drugs 0.000 description 1
- 201000011649 lymphoblastic lymphoma Diseases 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 229940124302 mTOR inhibitor Drugs 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 239000003628 mammalian target of rapamycin inhibitor Substances 0.000 description 1
- 208000027202 mammary Paget disease Diseases 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 210000001806 memory b lymphocyte Anatomy 0.000 description 1
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Chemical class 0.000 description 1
- 229940071648 metered dose inhaler Drugs 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 210000004688 microtubule Anatomy 0.000 description 1
- 230000004065 mitochondrial dysfunction Effects 0.000 description 1
- 229960000350 mitotane Drugs 0.000 description 1
- 229950000844 mizoribine Drugs 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- CQDGTJPVBWZJAZ-UHFFFAOYSA-N monoethyl carbonate Chemical compound CCOC(O)=O CQDGTJPVBWZJAZ-UHFFFAOYSA-N 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 208000001725 mucocutaneous lymph node syndrome Diseases 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 229960000951 mycophenolic acid Drugs 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 210000001989 nasopharynx Anatomy 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 229940086322 navelbine Drugs 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 201000008026 nephroblastoma Diseases 0.000 description 1
- 208000004235 neutropenia Diseases 0.000 description 1
- 229960002653 nilutamide Drugs 0.000 description 1
- XWXYUMMDTVBTOU-UHFFFAOYSA-N nilutamide Chemical compound O=C1C(C)(C)NC(=O)N1C1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 XWXYUMMDTVBTOU-UHFFFAOYSA-N 0.000 description 1
- 239000002840 nitric oxide donor Substances 0.000 description 1
- OSTGTTZJOCZWJG-UHFFFAOYSA-N nitrosourea Chemical compound NC(=O)N=NO OSTGTTZJOCZWJG-UHFFFAOYSA-N 0.000 description 1
- 229950006344 nocodazole Drugs 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N p-hydroxybenzoic acid methyl ester Natural products COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 229940124583 pain medication Drugs 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 102000013415 peroxidase activity proteins Human genes 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 239000008024 pharmaceutical diluent Substances 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 239000000106 platelet aggregation inhibitor Substances 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 208000005987 polymyositis Diseases 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 238000002818 protein evolution Methods 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 230000029058 respiratory gaseous exchange Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 235000005713 safflower oil Nutrition 0.000 description 1
- 239000003813 safflower oil Substances 0.000 description 1
- 239000000523 sample Substances 0.000 description 1
- 201000000306 sarcoidosis Diseases 0.000 description 1
- 238000004062 sedimentation Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- ZLGIYFNHBLSMPS-ATJNOEHPSA-N shellac Chemical compound OCCCCCC(O)C(O)CCCCCCCC(O)=O.C1C23[C@H](C(O)=O)CCC2[C@](C)(CO)[C@@H]1C(C(O)=O)=C[C@@H]3O ZLGIYFNHBLSMPS-ATJNOEHPSA-N 0.000 description 1
- 229940113147 shellac Drugs 0.000 description 1
- 239000004208 shellac Substances 0.000 description 1
- 235000013874 shellac Nutrition 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 235000011067 sorbitan monolaureate Nutrition 0.000 description 1
- 229940083466 soybean lecithin Drugs 0.000 description 1
- 239000008347 soybean phospholipid Substances 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 201000005671 spondyloarthropathy Diseases 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 208000017572 squamous cell neoplasm Diseases 0.000 description 1
- SFVFIFLLYFPGHH-UHFFFAOYSA-M stearalkonium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CC1=CC=CC=C1 SFVFIFLLYFPGHH-UHFFFAOYSA-M 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 238000011146 sterile filtration Methods 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 239000002731 stomach secretion inhibitor Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229960005202 streptokinase Drugs 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 210000002536 stromal cell Anatomy 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 229940014800 succinic anhydride Drugs 0.000 description 1
- 239000001797 sucrose acetate isobutyrate Substances 0.000 description 1
- 235000010983 sucrose acetate isobutyrate Nutrition 0.000 description 1
- UVGUPMLLGBCFEJ-SWTLDUCYSA-N sucrose acetate isobutyrate Chemical compound CC(C)C(=O)O[C@H]1[C@H](OC(=O)C(C)C)[C@@H](COC(=O)C(C)C)O[C@@]1(COC(C)=O)O[C@@H]1[C@H](OC(=O)C(C)C)[C@@H](OC(=O)C(C)C)[C@H](OC(=O)C(C)C)[C@@H](COC(C)=O)O1 UVGUPMLLGBCFEJ-SWTLDUCYSA-N 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 description 1
- 229940063683 taxotere Drugs 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 101150024821 tetO gene Proteins 0.000 description 1
- 229940021747 therapeutic vaccine Drugs 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 201000003067 thrombocytopenia due to platelet alloimmunization Diseases 0.000 description 1
- 230000002992 thymic effect Effects 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 229960002175 thyroglobulin Drugs 0.000 description 1
- 208000030829 thyroid gland adenocarcinoma Diseases 0.000 description 1
- 208000030901 thyroid gland follicular carcinoma Diseases 0.000 description 1
- 229960005001 ticlopidine Drugs 0.000 description 1
- PHWBOXQYWZNQIN-UHFFFAOYSA-N ticlopidine Chemical compound ClC1=CC=CC=C1CN1CC(C=CS2)=C2CC1 PHWBOXQYWZNQIN-UHFFFAOYSA-N 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- 229960000187 tissue plasminogen activator Drugs 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- 239000002753 trypsin inhibitor Substances 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 229960005356 urokinase Drugs 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- JXLYSJRDGCGARV-CFWMRBGOSA-N vinblastine Chemical compound C([C@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-CFWMRBGOSA-N 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- GBABOYUKABKIAF-IELIFDKJSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-IELIFDKJSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- CILBMBUYJCWATM-PYGJLNRPSA-N vinorelbine ditartrate Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O.OC(=O)[C@H](O)[C@@H](O)C(O)=O.C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC CILBMBUYJCWATM-PYGJLNRPSA-N 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/283—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- CD40 a member of the TNF-receptor superfamily, is a costimulatory protein found on antigen presenting cells, where it mediates a wide variety of immune and inflammatory responses, such as T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. While the protein is constitutively expressed by antigen presenting cells, including dendritic cells, B cells, and macrophages, it may also be expressed on endothelial cells, smooth muscle cells, fibroblasts, and epithelial cells.
- CD40 is also expressed on a variety of tumor cells, including non-Hodgkin's and Hodgkin's lymphomas, myeloma, and certain carcinomas, including nasopharynx, bladder, cervix, kidney, and ovary (Vonderheide et al., Clin Cancer Res. 2013; 19(5): 1035-1043).
- CD40 mediates immune responses via its binding to CD40 ligand (CD40L, also known as CD154).
- CD40L also known as CD154
- T help (T H ) cells activates antigen presenting cells, thus triggering a variety of downstream events.
- the present disclosure is based, at least in part, on the discovery of antibodies that are capable of binding to human CD40 and exhibited agonistic effects, which were enhanced in the presence of cells expressing ⁇ .
- Such antibodies are expected to be effective in modulating immune responses mediated by the CD40/CD40L signaling, thereby benefiting treatment of cancer and immune disorders such as those described herein.
- one aspect of the present disclosure features an isolated antibody that binds human CD40.
- Such anti-CD40 antibodies may bind the same epitope of human CD40 as anti-CD40 antibody clones 13F1A7, 17C5C2, 19G6D6, 36G7B8, or 9F12D9 described herein.
- the antibody may comprise the same heavy chain and light chain complementary determining regions (CDRs) as the reference antibody.
- the antibody may comprise the same heavy chain variable region and the same light chain variable region as the reference antibody.
- the anti-CD40 antibody described herein comprises:
- the anti-CD40 antibody described herein may comprise:
- the anti-CD40 antibody described herein may comprise:
- the anti-CD40 antibody described herein may cross-react the human CD40 with a non-human CD40 (e.g., a cynomolgus monkey CD40).
- a non-human CD40 e.g., a cynomolgus monkey CD40
- the anti-CD40 antibody described herein may be specific to human CD40.
- the anti-CD40 antibody may bind to CD40 expressed on cell surface.
- Such an antibody may be agonistic (e.g., capable of eliciting the CD40-mediated cell signaling in immune cells expressing the CD40).
- any of the anti-CD40 antibodies described herein may be a full-length antibody or an antigen-binding fragment thereof.
- the antibody is a full-length antibody, which may be an IgG molecule (e.g., an IgG4 molecule).
- the antibody may be an IgG4 molecule having the S228P amino acid substitution in its Fc domain.
- the antibody is a Fab or single-chain antibody.
- the anti-CD40 antibody described herein may be a human antibody, a humanized antibody, or a chimeric antibody.
- the anti-CD40 antibody described herein can be a bi-specific antibody that binds both CD40 and Fc ⁇ RIIB (not via Fc-FcR interaction).
- the present disclosure features an isolated nucleic acid or set of nucleic acids, which collectively encode any of the anti-CD40 antibodies described herein.
- the nucleic acid or set of nucleic acids is located on one vector or on two vectors, for example, one or two expression vectors.
- host cells comprising the isolated nucleic acid or set of nucleic acids (e.g., vectors such as expression vectors) coding for the anti-CD40 antibodies as described herein.
- the present disclosure provides a pharmaceutical composition
- a pharmaceutical composition comprising one or more of the anti-CD40 antibodies described herein or the nucleic acid or set of nucleic acids encoding such, and a pharmaceutically acceptable carrier.
- the present disclosure provides a method of modulating immune responses in a subject, the method comprising administering to a subject in need thereof an effective amount of any of the anti-CD40 antibodies described herein, which may be formulated into a pharmaceutical composition as also described herein.
- the subject in need of the treatment can be a human patient having, suspected of having, or at risk for a target disease described herein, for example, cancer or an immune disorder.
- the present disclosure provides a method for producing an anti-CD40 antibody, the method comprising: (i) culturing the host cell of described herein under conditions allowing for expression of the anti-CD40 antibody; and (ii) harvesting the anti-CD40 antibody thus produced from the cell culture.
- compositions for use in treating any of the target diseases and disorders as described herein comprising one or more of the anti-CD40 antibodies described herein and a pharmaceutically acceptable carrier, and uses of any of the anti-CD40 antibodies for manufacturing a medicament for use in treating the target disease and disorder.
- FIG. 1 is a graph showing dose responses of the exemplary anti-CD40 antibodies as indicated in binding to human CD40 expressed on CHO cells by FACS analysis.
- FIGS. 2 A- 2 B include bar graphs showing the activity of the exemplary anti-CD40 antibodies as indicated in activation of human dendritic cells (DC) ( FIG. 2 A ) or B cells ( FIG. 2 B ) from healthy donors as evidenced by cytokine production.
- the upper panels of FIG. 2 A and FIG. 2 B are bar graphs showing production of IL-12 and the lower panels of FIG. 2 A .
- FIG. 3 is a graph showing the binding of recombinant chimeric antibodies as indicated to human CD40 protein as determined by ELISA.
- FIG. 4 is a graph showing the binding of chimeric antibodies as indicated to cellular human CD40 as determined by FACS.
- FIG. 5 is a graph showing binding of chimeric antibodies as indicated to cynomolgus monkey CD40 protein as determined by ELISA.
- FIGS. 6 A- 6 B include a set of bar graphs showing the activity of the exemplary anti-CD40 antibodies as indicated in activation of human dendritic cells (DC) from healthy donors by the anti-CD40 antibodies either in solution ( FIG. 6 A ) or in co-culture of CHO cells expressing human Fc ⁇ RIIB ( FIG. 6 B ).
- the upper panels in FIG. 6 A and FIG. 6 B are bar graphs showing production of CD86.
- the middle panels in FIG. 6 A and FIG. 6 B are bar graphs showing production of IL-12.
- the bottom panels in FIG. 6 A and FIG. 6 B are bar graphs showing production of IL-8.
- FIG. 7 A shows the data for LYV376 (upper panel) and LYV377 (lower lower).
- FIG. 7 B shows the data for LYV378 (upper panel) and LYV379 (lower panel).
- FIG. 7 C shows the data for LYV391.
- CD40 is a member of the tumor necrosis factor (TNF) receptor family. It is a 48 kDa cell surface glycoprotein expressed on a number of normal cells, including dendritic cells, B lymphocytes, monocytes, macrophages, thymic epithelium, endothelial cells, fibroblasts, and smooth muscle cells (Elgueta et al., Immunol Rev. 2009). CD40 was also found to express on B-lymphoma cells and on cells of a number of solid tumors (Remer et al., Curr Top Microbiol Immunol. 2014; 405:165-207).
- TNF tumor necrosis factor
- CD40 is expressed constitutively; however, it also can be upregulated in antigen presenting cells by maturation signals, such as LPS, IL1 ⁇ p, INF- ⁇ , and GM-CSF (Ma et al., Semin Immunol. 2009; 21(5): 265-272).
- maturation signals such as LPS, IL1 ⁇ p, INF- ⁇ , and GM-CSF (Ma et al., Semin Immunol. 2009; 21(5): 265-272).
- CD40 has been shown to have a number of varied effects, depending on the type of cell involved. For example, activation of CD40 signaling on B cells stimulates B cell proliferation and differentiation, immunoglobulin production, isotype switching, and B cell memory generation. In comparison, CD40 signaling on dendritic cells and monocytes leads to expression of costimulatory molecules and secretion of inflammatory cytokines (e.g., IL-8, IL-12, and TNF- ⁇ ), providing for efficient activation of T lymphocytes. Increasing CD40 activity has been shown to increase T-cell priming and, for CD40-expressing dendritic cells, to favor the generation of Th1 cellular immune responses.
- inflammatory cytokines e.g., IL-8, IL-12, and TNF- ⁇
- the CD40/CD40L signaling pathway plays a crucial role in triggering immune responses (e.g., activating dendritic cells), leading to anti-tumor immune responses in cancer patients.
- immune responses e.g., activating dendritic cells
- Anti-CD40 antibodies capable of binding to CD40.
- Such anti-CD40 antibodies surprisingly exhibited agonistic effects to enhance the activity of dendritic cells and B cells, particularly in the presence of cells expressing Fc ⁇ RIIB.
- Agonistic anti-CD40 antibodies may mimic the activity of a natural ligand of CD40 (e.g., CD40L) and trigger the cell signaling mediated by CD40 to induce DC activation. Therefore, the agonistic anti-CD40 antibodies described herein are expected to be effective in modulating immune responses via the CD40/CD40L signaling pathway and thus be effective in modulating immune responses, for example, enhancing the activity of dendritic cells and other immune cells, thereby benefiting treatment of diseases such as any cancer and immune disorders.
- CD40L natural ligand of CD40
- the present disclosure provides antibodies that bind CD40, which may be of any source, for example, human and/or monkey CD40.
- Such anti-CD40 antibodies i.e., antibodies that bind the CD40 antigen
- the anti-CD40 antibodies described herein may cross-react with CD40 antigens of different species (e.g., binding to both human and monkey CD40).
- the anti-CD40 antibodies described herein can bind cell surface CD40, for example, CD40 expressed on cells (e.g., dendritic cells or other types of cells as described herein) that naturally express CD40 on the surface.
- the anti-CD40 antibodies described herein may be agonistic antibodies, which, upon binding to CD40, elicit cell signaling mediated by CD40.
- the agonistic activity of an anti-CD40 antibody described herein can be determined by routine methods known in the art or by assays described in Examples below.
- CD40 is a protein well known in the art.
- NCBI GenBank Accession Nos. NP_001241.1 and XP_005569275.1 provide information for the human and cynomolgus monkey CD40 antigens, respectively.
- CD40 Human CD40 (SEQ ID NO: 38): MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSD CTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETD TICTCEEGWHCTSEACESCVLHRSCSPGFGVKQTATGVSDTICEPCPVGF FSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPI IFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAP VQETLHGCQPVTQEDGKESRISVQERQ Cynomolgus Monkey ( Macaca fascicularis ) CD40 (SEQ ID NO: 39): MVRLPLQCVLWGCLLTAVYPEPPTACREKQYLINSQCCSLCQPGQKLVSD CTEFTETECLPCGESEFLDTWNRETRCHQHKYCDPNLGLRV
- CD40 polypeptides from other species are known in the art and can be obtained from publicly available gene database, for example, GenBank, using either the human sequence or the cynomolgus monkey sequence as a query.
- An antibody (interchangeably used in plural form) as described herein is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
- a target such as a carbohydrate, polynucleotide, lipid, polypeptide, etc.
- antibody encompasses not only intact (i.e., full-length) polyclonal or monoclonal antibodies, but also antigen-binding fragments thereof (such as Fab, Fab′, F(ab′)2, Fv), single chain (scFv), mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, chimeric antibodies, diabodies, nanobodies, linear antibodies, single chain antibodies, multispecific antibodies (e.g., bispecific antibodies) and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies.
- antigen-binding fragments thereof such as Fab, Fab′, F(ab′)2, Fv), single chain (scFv), mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, chimeric antibodies, diabodies, nanobodies, linear antibodies, single chain antibodies, multispecific antibodies (e.g., bispecific antibodies)
- An antibody includes an antibody of any class, such as IgD, IgE, IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class.
- immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2.
- the heavy-chain constant domains that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively.
- the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
- a typical antibody molecule comprises a heavy chain variable region (V H ) and a light chain variable region (V L ), which are usually involved in antigen binding.
- V H and V L regions can be further subdivided into regions of hypervariability, also known as “complementarity determining regions” (“CDR”), interspersed with regions that are more conserved, which are known as “framework regions” (“FR”).
- CDR complementarity determining regions
- FR framework regions
- Each V H and V L is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the extent of the framework region and CDRs can be precisely identified using methodology known in the art, for example, by the Kabat definition, the Chothia definition, the AbM definition, and/or the contact definition, all of which are well known in the art. See, e.g., Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition , U.S. Department of Health and Human Services, NIH Publication No. 91-3242, Chothia et al., (1989) Nature 342:877; Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917, Al-lazikani et al (1997) J. Molec. Biol. 273:927-948; and Almagro, J. Mol. Recognit. 17:132-143 (2004). See also hgmp.mrc.ac.uk and bioinf.org.uk/abs.
- the anti-CD40 antibody described herein may be a full-length antibody, which contains two heavy chains and two light chains, each including a variable domain and a constant domain.
- the anti-CD40 antibody can be an antigen-binding fragment of a full-length antibody.
- binding fragments encompassed within the term “antigen-binding fragment” of a full length antibody include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , C L and C H 1 domains; (ii) a F(ab) 2 fragment, a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and C H 1 domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a V H domain; and (vi) an isolated complementarity determining region (CDR) that retains functionality.
- a Fab fragment a monovalent fragment consisting of the V L , V H , C L and C H 1 domains
- F(ab) 2 fragment a bi
- V L and V H are coded for by separate genes, they can be joined using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules known as single chain Fv (scFv).
- scFv single chain Fv
- the antibodies described herein can be murine, rat, human, or any other origin (including chimeric or humanized antibodies). Such antibodies are non-naturally occurring, i.e., would not be produced in an animal without human act (e.g., immunizing such an animal with a desired antigen or fragment thereof or isolated from antibody libraries).
- any of the antibodies described herein can be either monoclonal or polyclonal.
- a “monoclonal antibody” refers to a homogenous antibody population and a “polyclonal antibody” refers to a heterogeneous antibody population. These two terms do not limit the source of an antibody or the manner in which it is made.
- humanized antibodies refer to forms of non-human (e.g., murine) antibodies that are specific chimeric immunoglobulins, immunoglobulin chains, or antigen-binding fragments thereof that contain minimal sequence derived from non-human immunoglobulin.
- humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a CDR of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity.
- donor antibody such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity.
- Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
- the humanized antibody may comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences, but are included to further refine and optimize antibody performance.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
- the humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin.
- Antibodies may have Fc regions modified as described in WO 99/58572.
- humanized antibodies have one or more CDRs (one, two, three, four, five, or six) which are altered with respect to the original antibody, which are also termed one or more CDRs “derived from” one or more CDRs from the original antibody. Humanized antibodies may also involve affinity maturation.
- variable regions of V H and V L of a parent non-human antibody are subjected to three-dimensional molecular modeling analysis following methods known in the art.
- framework amino acid residues predicted to be important for the formation of the correct CDR structures are identified using the same molecular modeling analysis.
- human V H and V L chains having amino acid sequences that are homologous to those of the parent non-human antibody are identified from any antibody gene database using the parent V H and V L sequences as search queries. Human V H and V L acceptor genes are then selected.
- the CDR regions within the selected human acceptor genes can be replaced with the CDR regions from the parent non-human antibody or functional variants thereof.
- residues within the framework regions of the parent chain that are predicted to be important in interacting with the CDR regions can be used to substitute for the corresponding residues in the human acceptor genes.
- the antibody described herein is a chimeric antibody, which can include a heavy constant region or a part thereof and/or a light constant region or a part thereof from a human antibody.
- Chimeric antibodies refer to antibodies having a variable region or part of variable region from a first species and a constant region from a second species.
- the variable region of both light and heavy chains mimics the variable regions of antibodies derived from one species of mammals (e.g., a non-human mammal such as mouse, rabbit, and rat), while the constant portions are homologous to the sequences in antibodies derived from another mammal such as human.
- amino acid modifications can be made in the variable region and/or the constant region.
- the anti-CD40 antibodies described herein specifically bind to the corresponding target antigen (e.g., the human CD40 antigen) or an epitope thereof.
- An antibody that “specifically binds” to an antigen or an epitope is a term well understood in the art. A molecule is said to exhibit “specific binding” if it reacts more frequently, more rapidly, with greater duration and/or with greater affinity with a particular target antigen than it does with alternative targets. An antibody “specifically binds” to a target antigen or epitope if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances.
- an antibody that specifically (or preferentially) binds to an antigen (CD40) or an antigenic epitope therein is an antibody that binds this target antigen with greater affinity, avidity, more readily, and/or with greater duration than it binds to other antigens or other epitopes in the same antigen. It is also understood with this definition that, for example, an antibody that specifically binds to a first target antigen may or may not specifically or preferentially bind to a second target antigen. As such, “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding.
- an antibody that “specifically binds” to a target antigen or an epitope thereof may not bind to other antigens or other epitopes in the same antigen (i.e., only baseline binding activity can be detected in a conventional method).
- the anti-CD40 antibody described herein may specifically binds human CD40 or a fragment thereof as relative to the monkey counterpart, or vice versa (e.g., having a binding affinity at least 10-fold higher to one antigen than the other as determined in the same assay under the same assay conditions).
- the anti-CD40 antibody described herein may cross-react to human and a non-human CD40 (e.g., monkey), e.g., the difference in binding affinity to the human and the non-human CD40 is less than 5-fold, e.g., less than 2-fold, or substantially similar.
- a non-human CD40 e.g., monkey
- an anti-CD40 antibody as described herein has a suitable binding affinity for the target antigen (e.g., CD40) or antigenic epitopes thereof.
- binding affinity refers to the apparent association constant or KA.
- the KA is the reciprocal of the dissociation constant (K D ).
- the anti-CD40 antibody described herein may have a binding affinity (K D ) of at least 10 ⁇ 5 , 10 ⁇ 6 , 10 ⁇ 7 , 10 ⁇ 8 , 10 ⁇ 9 , 10 ⁇ 10 M, or lower for the target antigen or antigenic epitope.
- An increased binding affinity corresponds to a decreased K D .
- the antibody has specificity for the first antigen (e.g., a first protein in a first conformation or mimic thereof) relative to the second antigen (e.g., the same first protein in a second conformation or mimic thereof or a second protein). Differences in binding affinity (e.g., for specificity or other comparisons) can be at least 1.5, 2, 3, 4, 5, 10, 15, 20, 37.5, 50, 70, 80, 91, 100, 500, 1000, 10,000 or 10 5 fold. In some embodiments, any of the anti-CD40 antibodies may be further affinity matured to increase the binding affinity of the antibody to the target antigen or antigenic epitope thereof.
- Binding affinity can be determined by a variety of methods including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance, or spectroscopy (e.g., using a fluorescence assay).
- Exemplary conditions for evaluating binding affinity are in HBS-P buffer (10 mM HEPES pH7.4, 150 mM NaCl, 0.005% (v/v) Surfactant P20). These techniques can be used to measure the concentration of bound binding protein as a function of target protein concentration.
- the anti-CD40 agonistic antibody as described herein comprises a heavy chain variable region that comprises a heavy chain CDR1 region (HC CDR1), a heavy chain CDR2 region (HC CDR2), and a heavy chain CDR3 region (HC CDR3) connected by heavy chain framework regions.
- the HC CDRs of the anti-CD40 antibody may comprise one or more of the following core motifs.
- the anti-CD40 antibody described herein may further comprises a light chain variable region that comprises a light chain CDR1 region (LC CDR1), a light chain CDR2 region (LC CDR2), and a light chain CDR3 region (LC CDR3) connected by light chain framework regions.
- the LC CDRs of the anti-CD40 antibody may comprise one or more of the following core motifs:
- V H and V L chains of the exemplary antibody clones are provided above.
- the anti-CD49 antibodies described herein bind to the same epitope of a CD40 polypeptide as any of the exemplary antibodies described herein (for example, 1966D6 (LYV376), 13F1A7 (LTV377), 9F12D9 (LYV378), 17C5C2 (LYV379), and 366788 (LYV391) or complete against the exemplary antibody from binding to the CD40 antigen.
- exemplary antibodies described herein for example, 1966D6 (LYV376), 13F1A7 (LTV377), 9F12D9 (LYV378), 17C5C2 (LYV379), and 366788 (LYV391) or complete against the exemplary antibody from binding to the CD40 antigen.
- An “epitope” refers to the site on a target antigen that is recognized and bound by an antibody.
- the site can be entirely composed of amino acid components, entirely composed of chemical modifications of amino acids of the protein (e.g., glycosyl moieties), or composed of combinations thereof.
- Overlapping epitopes include at least one common amino acid residue.
- An epitope can be linear, which is typically 6-15 amino acids in length. Alternatively, the epitope can be conformational.
- the epitope to which an antibody binds can be determined by routine technology, for example, the epitope mapping method (see, e.g., descriptions below).
- An antibody that binds the same epitope as an exemplary antibody described herein may bind to exactly the same epitope or a substantially overlapping epitope (e.g., containing less than 3 non-overlapping amino acid residue, less than 2 non-overlapping amino acid residues, or only 1 non-overlapping amino acid residue) as the exemplary antibody. Whether two antibodies compete against each other from binding to the cognate antigen can be determined by a competition assay, which is well known in the art.
- sequences correspond to SEQ ID Nos: 22, 26, 18, 20 and 24.
- sequences correspond to SEQ ID Nos: 19, 23, 27, 25 and 21.
- the anti-CD40 antibody comprises the same V H and/or V L CDRs as an exemplary antibody described herein.
- Two antibodies having the same V H and/or V L CDRs means that their CDRs are identical when determined by the same approach (e.g., the Kabat approach or the Chothia approach as known in the art).
- Such anti-CD40 antibodies may have the same V H , the same V L , or both as compared to an exemplary antibody described herein.
- a functional variant comprises substantially the same V H and V L CDRs as the exemplary antibody.
- it may comprise only up to 5 (e.g., 4, 3, 2, or 1) amino acid residue variations in the total CDR regions of the antibody and binds the same epitope of CD40 with substantially similar affinity (e.g., having a K D value in the same order).
- the amino acid residue variations are conservative amino acid residue substitutions.
- a “conservative amino acid substitution” refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made.
- Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g. Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989, or Current Protocols in Molecular Biology, F. M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York.
- amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.
- the anti-CD40 antibody may comprise heavy chain CDRs that are at least 80% (e.g., 85%, 90%, 95%, or 98%) sequence identity, individually or collectively, as compared with the V H CDRs of an exemplary antibody described herein.
- the anti-CD40 antibody may comprise light chain CDRs that are at least 80% (e.g., 85%, 90%, 95%, or 98%) sequence identity, individually or collectively, as compared with the V L CDRs as an exemplary antibody described herein.
- Gapped BLAST can be utilized as described in Altschul et al., Nucleic Acids Res. 25(17):3389-3402, 1997.
- the default parameters of the respective programs e.g., XBLAST and NBLAST.
- the heavy chain of any of the anti-CD40 antibodies as described herein may further comprise a heavy chain constant region (CH) or a portion thereof (e.g., CH1, CH2, CH3, or a combination thereof).
- the heavy chain constant region can of any suitable origin, e.g., human, mouse, rat, or rabbit.
- the heavy chain constant region is from a human IgG (a gamma heavy chain) of any IgG subfamily as described herein.
- the constant region is from human Ig molecule such as IgG4, an exemplary amino acid sequence of which is provided below (SEQ ID NO: 40; S228 is in boldface):
- the anti-CD40 antibody described herein may contain a mutated Fc region as compared with a wild-type counterpart such that the antibody has a higher binding affinity to an Fc receptor, for example, Fc ⁇ RIIB (CD32B).
- Fc ⁇ RIIB Fc ⁇ RIIB
- Such antibodies may engage Fc ⁇ RIM-expressing cells efficiently, thereby enhancing therapeutic effects.
- the anti-CD40 antibody may comprise the Fc region from an IgG4 molecule (e.g., SEQ ID NO: 40), which may contain an S/P substitution at the position as indicated (boldfaced and underlined; S228P).
- the heavy chain constant region of the antibodies described herein may comprise a single domain (e.g., CH1, CH2, or CH3) or a combination of any of the single domains.
- the anti-CD40 antibody as described herein may comprise a modified constant region.
- it may comprise a modified constant region that is immunologically inert, e.g., does not trigger complement mediated lysis, or does not stimulate antibody-dependent cell mediated cytotoxicity (ADCC).
- ADCC activity can be assessed using methods disclosed in U.S. Pat. No. 5,500,362.
- the constant region is modified as described in Eur. J. Immunol . (1999) 29:2613-2624; PCT Application No. PCT/GB99/01441; and/or UK Patent Application No. 9809951.8.
- any of the anti-CD40 antibodies described herein may comprise a light chain that further comprises a light chain constant region, which can be any CL known in the art.
- the CL is a kappa light chain.
- the CL is a lambda light chain.
- Antibody heavy and light chain constant regions are well known in the art, e.g., those provided in the IMGT database (www.imgt.org) or at www.vbase2.org/vbstat.php., both of which are incorporated by reference herein.
- the anti-CD40 antibody is a bi-specific antibody capable of binding to both CD40 and Fc ⁇ RIM (not via Fc-FcR interaction).
- a bi-specific antibody may comprise a first antigen-binding region and a second antigen-binding region, each of which may comprise a V H /V L pair.
- the first antigen-binding region binds CD40 while the second antigen-binding region binds Fc ⁇ RIM
- the anti-CD40 antibodies described herein are chimeric antibodies, which may comprise the V H and V L regions derived from any of the exemplary antibodies described herein and heavy and light chain constant regions from human immunoglobulins. A number of examples is provided below.
- Antibodies capable of binding CD40 as described herein can be made by any method known in the art. See, for example, Harlow and Lane, (1998) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York.
- antibodies specific to a target antigen can be made by the conventional hybridoma technology.
- the full-length target antigen or a fragment thereof, optionally coupled to a carrier protein such as KLH, can be used to immunize a host animal for generating antibodies binding to that antigen.
- the route and schedule of immunization of the host animal are generally in keeping with established and conventional techniques for antibody stimulation and production, as further described herein.
- General techniques for production of mouse, humanized, and human antibodies are known in the art and are described herein. It is contemplated that any mammalian subject including humans or antibody producing cells therefrom can be manipulated to serve as the basis for production of mammalian, including human hybridoma cell lines.
- the host animal is inoculated intraperitoneally, intramuscularly, orally, subcutaneously, intraplantar, and/or intradermally with an amount of immunogen, including as described herein.
- Hybridomas can be prepared from the lymphocytes and immortalized myeloma cells using the general somatic cell hybridization technique of Kohler, B. and Milstein, C. (1975) Nature 256:495-497 or as modified by Buck, D. W., et al., In Vitro, 18:377-381 (1982).
- Available myeloma lines including but not limited to X 63 -Ag8.653 and those from the Salk Institute, Cell Distribution Center, San Diego, Calif., USA, may be used in the hybridization.
- the technique involves fusing myeloma cells and lymphoid cells using a fusogen such as polyethylene glycol, or by electrical means well known to those skilled in the art.
- the cells are separated from the fusion medium and grown in a selective growth medium, such as hypoxanthine-aminopterin-thymidine (HAT) medium, to eliminate unhybridized parent cells.
- a selective growth medium such as hypoxanthine-aminopterin-thymidine (HAT) medium
- HAT hypoxanthine-aminopterin-thymidine
- Any of the media described herein, supplemented with or without serum, can be used for culturing hybridomas that secrete monoclonal antibodies.
- EBV immortalized B cells may be used to produce the anti-CD40 monoclonal antibodies described herein.
- hybridomas are expanded and subcloned, if desired, and supernatants are assayed for anti-immunogen activity by conventional immunoassay procedures (e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay).
- immunoassay procedures e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay.
- Hybridomas that may be used as source of antibodies encompass all derivatives, progeny cells of the parent hybridomas that produce monoclonal antibodies capable of enhancing CD40 activity.
- Hybridomas that produce such antibodies may be grown in vitro or in vivo using known procedures.
- the monoclonal antibodies may be isolated from the culture media or body fluids, by conventional immunoglobulin purification procedures such as ammonium sulfate precipitation, gel electrophoresis, dialysis, chromatography, and ultrafiltration, if desired.
- Undesired activity if present, can be removed, for example, by running the preparation over adsorbents made of the immunogen attached to a solid phase and eluting or releasing the desired antibodies off the immunogen.
- Immunization of a host animal with a target antigen or a fragment containing the target amino acid sequence conjugated to a protein that is immunogenic in the species to be immunized e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean trypsin inhibitor using a bifunctional or derivatizing agent, for example maleimidobenzoyl sulfosuccinimide ester (conjugation through cysteine residues), N-hydroxysuccinimide (through lysine residues), glutaraldehyde, succinic anhydride, SOC1, or R1N ⁇ C ⁇ NR, where R and R1 are different alkyl groups, can yield a population of antibodies (e.g., monoclonal antibodies).
- a target antigen or a fragment containing the target amino acid sequence conjugated to a protein that is immunogenic in the species to be immunized e.g., keyhole limpet hemocyanin, serum album
- an antibody (monoclonal or polyclonal) of interest may be sequenced and the polynucleotide sequence may then be cloned into a vector for expression or propagation.
- the sequence encoding the antibody of interest may be maintained in vector in a host cell and the host cell can then be expanded and frozen for future use.
- the polynucleotide sequence may be used for genetic manipulation to “humanize” the antibody or to improve the affinity (affinity maturation), or other characteristics of the antibody.
- the constant region may be engineered to more resemble human constant regions to avoid immune response if the antibody is used in clinical trials and treatments in humans.
- Fully human antibodies can be obtained by using commercially available mice that have been engineered to express specific human immunoglobulin proteins.
- Transgenic animals that are designed to produce a more desirable (e.g., fully human antibodies) or more robust immune response may also be used for generation of humanized or human antibodies. Examples of such technology are XenomouseTM from Amgen, Inc. (Fremont, Calif.) and HuMAb-MouseTM and TC MouseTM from Medarex, Inc. (Princeton, N.J.).
- antibodies may be made recombinantly by phage display or yeast technology. See, for example, U.S. Pat. Nos.
- antibodies capable of binding to the target antigens as described herein may be isolated from a suitable antibody library via routine practice.
- Antibody libraries can be used to identify proteins that bind to a target antigen (e.g., CD40) via routine screening processes.
- the polypeptide component is probed with the target antigen or a fragment thereof and, if the polypeptide component binds to the target, the antibody library member is identified, typically by retention on a support. Retained display library members are recovered from the support and analyzed.
- the analysis can include amplification and a subsequent selection under similar or dissimilar conditions. For example, positive and negative selections can be alternated.
- the analysis can also include determining the amino acid sequence of the polypeptide component and purification of the polypeptide component for detailed characterization.
- Antigen-binding fragments of an intact antibody can be prepared via routine methods.
- F(ab′)2 fragments can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab′)2 fragments.
- DNA encoding a monoclonal antibodies specific to a target antigen can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies).
- the hybridoma cells serve as a preferred source of such DNA. Once isolated, the DNA may be placed into one or more expression vectors, which are then transfected into host cells such as E.
- DNA can then be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences, Morrison et al., (1984) Proc. Nat. Acad. Sci. 81:6851, or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide.
- genetically engineered antibodies such as “chimeric” or “hybrid” antibodies; can be prepared that have the binding specificity of a target antigen.
- variable regions of V H and V L of a parent non-human antibody are subjected to three-dimensional molecular modeling analysis following methods known in the art.
- framework amino acid residues predicted to be important for the formation of the correct CDR structures are identified using the same molecular modeling analysis.
- human V H and V L chains having amino acid sequences that are homologous to those of the parent non-human antibody are identified from any antibody gene database using the parent V H and V L sequences as search queries. Human V H and V L acceptor genes are then selected.
- the CDR regions within the selected human acceptor genes can be replaced with the CDR regions from the parent non-human antibody or functional variants thereof.
- residues within the framework regions of the parent chain that are predicted to be important in interacting with the CDR regions can be used to substitute for the corresponding residues in the human acceptor genes.
- a single-chain antibody can be prepared via recombinant technology by linking a nucleotide sequence coding for a heavy chain variable region and a nucleotide sequence coding for a light chain variable region.
- a flexible linker is incorporated between the two variable regions.
- techniques described for the production of single chain antibodies can be adapted to produce a phage or yeast scFv library and scFv clones specific to CD40 can be identified from the library following routine procedures. Positive clones can be subjected to further screening to identify those that enhance CD40 activity.
- Antibodies obtained following a method known in the art and described herein can be characterized using methods well known in the art. For example, one method is to identify the epitope to which the antigen binds, or “epitope mapping.” There are many methods known in the art for mapping and characterizing the location of epitopes on proteins, including solving the crystal structure of an antibody-antigen complex, competition assays, gene fragment expression assays, and synthetic peptide-based assays, as described, for example, in Chapter 11 of Harlow and Lane, Using Antibodies, a Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1999. In an additional example, epitope mapping can be used to determine the sequence, to which an antibody binds.
- the epitope can be a linear epitope, i.e., contained in a single stretch of amino acids, or a conformational epitope formed by a three-dimensional interaction of amino acids that may not necessarily be contained in a single stretch (primary structure linear sequence).
- Peptides of varying lengths e.g., at least 4-6 amino acids long
- the epitope to which the antibody binds can be determined in a systematic screening by using overlapping peptides derived from the target antigen sequence and determining binding by the antibody.
- the open reading frame encoding the target antigen is fragmented either randomly or by specific genetic constructions and the reactivity of the expressed fragments of the antigen with the antibody to be tested is determined.
- the gene fragments may, for example, be produced by PCR and then transcribed and translated into protein in vitro, in the presence of radioactive amino acids. The binding of the antibody to the radioactively labeled antigen fragments is then determined by immunoprecipitation and gel electrophoresis. Certain epitopes can also be identified by using large libraries of random peptide sequences displayed on the surface of phage particles (phage libraries). Alternatively, a defined library of overlapping peptide fragments can be tested for binding to the test antibody in simple binding assays.
- mutagenesis of an antigen binding domain can be performed to identify residues required, sufficient, and/or necessary for epitope binding.
- domain swapping experiments can be performed using a mutant of a target antigen in which various fragments of CD40 have been replaced (swapped) with sequences from a closely related, but antigenically distinct protein (such as another member of the tumor necrosis factor receptor family). By assessing binding of the antibody to the mutant CD40, the importance of the particular antigen fragment to antibody binding can be assessed.
- competition assays can be performed using other antibodies known to bind to the same antigen to determine whether an antibody binds to the same epitope as the other antibodies. Competition assays are well known to those of skill in the art.
- an anti-CD40 antibody is prepared by recombinant technology as exemplified below.
- Nucleic acids encoding the heavy and light chain of an anti-CD40 antibody as described herein can be cloned into one expression vector, each nucleotide sequence being in operable linkage to a suitable promoter.
- each of the nucleotide sequences encoding the heavy chain and light chain is in operable linkage to a distinct prompter.
- the nucleotide sequences encoding the heavy chain and the light chain can be in operable linkage with a single promoter, such that both heavy and light chains are expressed from the same promoter.
- an internal ribosomal entry site IRS
- the nucleotide sequences encoding the two chains of the antibody are cloned into two vectors, which can be introduced into the same or different cells.
- the two chains are expressed in different cells, each of them can be isolated from the host cells expressing such and the isolated heavy chains and light chains can be mixed and incubated under suitable conditions allowing for the formation of the antibody.
- a nucleic acid sequence encoding one or all chains of an antibody can be cloned into a suitable expression vector in operable linkage with a suitable promoter using methods known in the art.
- the nucleotide sequence and vector can be contacted, under suitable conditions, with a restriction enzyme to create complementary ends on each molecule that can pair with each other and be joined together with a ligase.
- synthetic nucleic acid linkers can be ligated to the termini of a gene. These synthetic linkers contain nucleic acid sequences that correspond to a particular restriction site in the vector. The selection of expression vectors/promoter would depend on the type of host cells for use in producing the antibodies.
- promoters can be used for expression of the antibodies described herein, including, but not limited to, cytomegalovirus (CMV) intermediate early promoter, a viral LTR such as the Rous sarcoma virus LTR, HIV-LTR, HTLV-1 LTR, the simian virus 40 (SV40) early promoter, E. coli lac UV5 promoter, and the herpes simplex tk virus promoter.
- CMV cytomegalovirus
- a viral LTR such as the Rous sarcoma virus LTR, HIV-LTR, HTLV-1 LTR
- SV40 simian virus 40
- E. coli lac UV5 promoter E. coli lac UV5 promoter
- herpes simplex tk virus promoter the herpes simplex tk virus promoter.
- Regulatable promoters can also be used.
- Such regulatable promoters include those using the lac repressor from E. coli as a transcription modulator to regulate transcription from lac operator-bearing mammalian cell promoters (Brown, M. et al., Cell, 49:603-612 (1987)), those using the tetracycline repressor (tetR) (Gossen, M., and Bujard, H., Proc. Natl. Acad. Sci. USA 89:5547-5551 (1992); Yao, F. et al., Human Gene Therapy, 9:1939-1950 (1998); Shockelt, P., et al., Proc. Natl. Acad. Sci.
- Regulatable promoters that include a repressor with the operon can be used.
- the lac repressor from E. coli can function as a transcriptional modulator to regulate transcription from lac operator-bearing mammalian cell promoters (M. Brown et al., Cell, 49:603-612 (1987); Gossen and Bujard (1992); M. Gossen et al., Natl. Acad. Sci.
- tetracycline repressor tetR
- VP 16 transcription activator
- tetR-VP 16 tetR-mammalian cell transcription activator fusion protein
- tetO-bearing minimal promoter derived from the human cytomegalovirus (hCMV) major immediate-early promoter to create a tetR-tet operator system to control gene expression in mammalian cells.
- hCMV human cytomegalovirus
- a tetracycline inducible switch is used.
- tetracycline repressor alone, rather than the tetR-mammalian cell transcription factor fusion derivatives can function as potent trans-modulator to regulate gene expression in mammalian cells when the tetracycline operator is properly positioned downstream for the TATA element of the CMVIE promoter (Yao et al., Human Gene Therapy, 10(16):1392-1399 (2003)).
- tetracycline inducible switch is that it does not require the use of a tetracycline repressor-mammalian cells transactivator or repressor fusion protein, which in some instances can be toxic to cells (Gossen et al., Natl. Acad. Sci. USA, 89:5547-5551 (1992); Shockett et al., Proc. Natl. Acad. Sci. USA, 92:6522-6526 (1995)), to achieve its regulatable effects.
- the vector can contain, for example, some or all of the following: a selectable marker gene, such as the neomycin gene for selection of stable or transient transfectants in mammalian cells; enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription; transcription termination and RNA processing signals from SV40 for mRNA stability; SV40 polyoma origins of replication and ColE1 for proper episomal replication; internal ribosome binding sites (IRESes), versatile multiple cloning sites; and T7 and SP6 RNA promoters for in vitro transcription of sense and antisense RNA.
- a selectable marker gene such as the neomycin gene for selection of stable or transient transfectants in mammalian cells
- enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription
- transcription termination and RNA processing signals from SV40 for mRNA stability
- SV40 polyoma origins of replication and ColE1 for proper episomal replication
- polyadenylation signals useful to practice the methods described herein include, but are not limited to, human collagen I polyadenylation signal, human collagen II polyadenylation signal, and SV40 polyadenylation signal.
- One or more vectors comprising nucleic acids encoding any of the antibodies may be introduced into suitable host cells for producing the antibodies.
- the host cells can be cultured under suitable conditions for expression of the antibody or any polypeptide chain thereof.
- Such antibodies or polypeptide chains thereof can be recovered by the cultured cells (e.g., from the cells or the culture supernatant) via a conventional method, e.g., affinity purification.
- polypeptide chains of the antibody can be incubated under suitable conditions for a suitable period of time allowing for production of the antibody.
- methods for preparing an antibody described herein involve a recombinant expression vector that encodes both the heavy chain and the light chain of an anti-CD40 antibody, as also described herein.
- the recombinant expression vector can be introduced into a suitable host cell (e.g., a dhfr ⁇ CHO cell) by a conventional method, e.g., calcium phosphate-mediated transfection.
- a suitable host cell e.g., a dhfr ⁇ CHO cell
- Positive transformant host cells can be selected and cultured under suitable conditions allowing for the expression of the two polypeptide chains that form the antibody, which can be recovered from the cells or from the culture medium.
- the two chains recovered from the host cells can be incubated under suitable conditions allowing for the formation of the antibody.
- two recombinant expression vectors are provided, one encoding the heavy chain of the anti-CD40 antibody and the other encoding the light chain of the anti-CD40 antibody.
- Both of the two recombinant expression vectors can be introduced into a suitable host cell (e.g., dhfr ⁇ CHO cell) by a conventional method, e.g., calcium phosphate-mediated transfection.
- each of the expression vectors can be introduced into a suitable host cells. Positive transformants can be selected and cultured under suitable conditions allowing for the expression of the polypeptide chains of the antibody.
- the antibody produced therein can be recovered from the host cells or from the culture medium.
- the polypeptide chains can be recovered from the host cells or from the culture medium and then incubated under suitable conditions allowing for formation of the antibody.
- the two expression vectors are introduced into different host cells, each of them can be recovered from the corresponding host cells or from the corresponding culture media. The two polypeptide chains can then be incubated under suitable conditions for formation of the antibody.
- Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recovery of the antibodies from the culture medium.
- some antibodies can be isolated by affinity chromatography with a Protein A or Protein G coupled matrix.
- nucleic acids encoding the heavy chain, the light chain, or both of an anti-CD40 antibody as described herein, vectors (e.g., expression vectors) containing such; and host cells comprising the vectors are within the scope of the present disclosure.
- Anti-CD40 antibodies thus prepared can be can be characterized using methods known in the art, whereby an increase in CD40 biological activity is detected and/or measured.
- an ELISA-type assay may be suitable for qualitative or quantitative measurement of CD40 promotion of T cell proliferation.
- the present disclosure provides methods of treating a disease, for example a cancer or an immune disorder, by administering a therapeutically effective amount of an anti-CD40 antibody.
- the antibodies, as well as the encoding nucleic acids or nucleic acid sets, vectors comprising such, or host cells comprising the vectors, as described herein can be mixed with a pharmaceutically acceptable carrier (excipient) to form a pharmaceutical composition for use in treating a target disease.
- a pharmaceutically acceptable carrier excipient
- “Acceptable” means that the carrier must be compatible with the active ingredient of the composition (and preferably, capable of stabilizing the active ingredient) and not deleterious to the subject to be treated.
- compositions to be used in the present methods can comprise pharmaceutically acceptable carriers, excipients, or stabilizers in the form of lyophilized formulations or aqueous solutions.
- pharmaceutically acceptable carriers excipients, or stabilizers in the form of lyophilized formulations or aqueous solutions.
- Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations used, and may comprise buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine,
- the pharmaceutical composition described herein comprises liposomes containing the antibodies (or the encoding nucleic acids) which can be prepared by methods known in the art, such as described in Epstein, et al., Proc. Natl. Acad. Sci. USA 82:3688 (1985); Hwang, et al., Proc. Natl. Acad. Sci. USA 77:4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Pat. No. 5,013,556.
- Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
- PEG-PE PEG-derivatized phosphatidylethanolamine
- the antibodies, or the encoding nucleic acid(s), may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
- colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
- macroemulsions for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
- sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
- sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinyl alcohol)), polylactides (U.S. Pat. No.
- copolymers of L-glutamic acid and 7 ethyl-L-glutamate copolymers of L-glutamic acid and 7 ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-( ⁇ )-3-hydroxybutyric acid.
- LUPRON DEPOTTM injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate
- sucrose acetate isobutyrate sucrose acetate isobutyrate
- poly-D-( ⁇ )-3-hydroxybutyric acid poly-D-( ⁇ )-3-hydroxybutyric acid.
- compositions to be used for in vivo administration must be sterile. This is readily accomplished by, for example, filtration through sterile filtration membranes.
- Therapeutic antibody compositions are generally placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- compositions described herein can be in unit dosage forms such as tablets, pills, capsules, powders, granules, solutions or suspensions, or suppositories, for oral, parenteral or rectal administration, or administration by inhalation or insufflation.
- the principal active ingredient can be mixed with a pharmaceutical carrier, e.g., conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g., water, to form a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof.
- a pharmaceutical carrier e.g., conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g., water, to form a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof.
- preformulation compositions as homogeneous, it is meant that the active ingredient is dispersed evenly throughout the composition so that the composition may be readily subdivided into equally effective unit dosage forms such as tablets, pills and capsules.
- This solid preformulation composition is then subdivided into unit dosage forms of the type described above containing from 0.1 to about 500 mg of the active ingredient of the present invention.
- the tablets or pills of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action.
- the tablet or pill can comprise an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former.
- the two components can be separated by an enteric layer that serves to resist disintegration in the stomach and permits the inner component to pass intact into the duodenum or to be delayed in release.
- enteric layers or coatings such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.
- Suitable surface-active agents include, in particular, non-ionic agents, such as polyoxyethylenesorbitans (e.g., TweenTM 20, 40, 60, 80 or 85) and other sorbitans (e.g., Span 20, 40, 60, 80 or 85).
- Compositions with a surface-active agent will conveniently comprise between 0.05 and 5% surface-active agent, and can be between 0.1 and 2.5%. It will be appreciated that other ingredients may be added, for example mannitol or other pharmaceutically acceptable vehicles, if necessary.
- Suitable emulsions may be prepared using commercially available fat emulsions, such as Intralipid LiposynTM, InfonutrolTM, LipofundinTM and LipiphysanTM.
- the active ingredient may be either dissolved in a pre-mixed emulsion composition or alternatively it may be dissolved in an oil (e.g., soybean oil, safflower oil, cottonseed oil, sesame oil, corn oil or almond oil) and an emulsion formed upon mixing with a phospholipid (e.g. egg phospholipids, soybean phospholipids or soybean lecithin) and water.
- an oil e.g., soybean oil, safflower oil, cottonseed oil, sesame oil, corn oil or almond oil
- a phospholipid e.g. egg phospholipids, soybean phospholipids or soybean lecithin
- other ingredients may be added, for example glycerol or glucose, to adjust the tonicity of the emulsion.
- Suitable emulsions will typically contain up to 20% oil, for example, between 5 and 20%.
- the fat emulsion can comprise fat droplets between 0.1 and 1.0 ⁇ m, particularly 0.1 and 0.5 ⁇ m, and have a pH in the range of 5.5 to 8.0.
- the emulsion compositions can be those prepared by mixing an antibody with IntralipidTM or the components thereof (soybean oil, egg phospholipids, glycerol and water).
- compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous or organic solvents, or mixtures thereof, and powders.
- the liquid or solid compositions may contain suitable pharmaceutically acceptable excipients as set out above.
- the compositions are administered by the oral or nasal respiratory route for local or systemic effect.
- compositions in preferably sterile pharmaceutically acceptable solvents may be nebulized by use of gases. Nebulized solutions may be breathed directly from the nebulizing device or the nebulizing device may be attached to a face mask, tent or intermittent positive pressure breathing machine. Solution, suspension or powder compositions may be administered, preferably orally or nasally, from devices which deliver the formulation in an appropriate manner.
- an effective amount of the pharmaceutical composition described herein can be administered to a subject (e.g., a human) in need of the treatment via a suitable route, such as intravenous administration, e.g., as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, inhalation or topical routes.
- nebulizers for liquid formulations including jet nebulizers and ultrasonic nebulizers are useful for administration.
- Liquid formulations can be directly nebulized and lyophilized powder can be nebulized after reconstitution.
- the antibodies as described herein can be aerosolized using a fluorocarbon formulation and a metered dose inhaler, or inhaled as a lyophilized and milled powder.
- the subject to be treated by the methods described herein can be a mammal, more preferably a human.
- Mammals include, but are not limited to, farm animals, sport animals, pets, primates, horses, dogs, cats, mice and rats.
- a human subject who needs the treatment may be a human patient having, at risk for, or suspected of having a target disease/disorder, such as a cancer or an immune disorder such as an autoimmune disease.
- cancers include, but are not limited to, breast cancer; biliary tract cancer; bladder cancer; brain cancer including glioblastomas and medulloblastomas; cervical cancer; choriocarcinoma; colon cancer; endometrial cancer; esophageal cancer; gastric cancer; hematological neoplasms including acute lymphocytic and myelogenous leukemia, e.g., B Cell CLL; T-cell acute lymphoblastic leukemia/lymphoma; hairy cell leukemia; chronic myelogenous leukemia, multiple myeloma; AIDS-associated leukemias and adult T-cell leukemia/lymphoma; intraepithelial neoplasms including Bowen's disease and Paget's disease; liver cancer; lung cancer; lymphomas including Hodgkin's disease and lymphocytic lymphomas; neuroblastomas; oral cancer including squamous cell carcinoma; ovarian cancer including those arising from epi
- a subject having a target cancer can be identified by routine medical examination, e.g., laboratory tests, organ functional tests, CT scans, ultrasounds, and/or genetic testing.
- the subject to be treated by the method described herein may be a human cancer patient who has undergone or is subjecting to an anti-cancer therapy, for example, chemotherapy, radiotherapy, immunotherapy, or surgery.
- Immune disorders refer to a dysfunction of the immune system. Examples include autoimmune diseases, immunodeficiencies, or allergies.
- the target disease for treatment is an autoimmune disease. Examples include, but are not limited to, rheumatoid arthritis (RA), systemic lupus erythematosus (SLE), Myasthenia Gravis (MG), Graves' Disease, Idiopathic Thrombocytopenia Purpura (ITP), Guillain-Barre Syndrome, autoimmune myocarditis, Membrane Glomerulonephritis, Hyper IgM syndrome, diabetes mellitus, Type I or Type II diabetes, multiple sclerosis, Reynaud's syndrome, autoimmune thyroiditis, gastritis, Celiac Disease, Vitiligo, Hepatitis, primary biliary cirrhosis, inflammatory bowel disease, spondyloarthropathies, experimental autoimmune encephalomyelitis, immune neutropenia, juvenile onset diabetes, and
- a subject having a target autoimmune disease can be identified by routine medical examination, e.g., presence of antinuclear antibodies, anti-mitochondrial autoantibodies, anti-neutrophil cytoplasmic antibody, anti-phospholipid antibodies, anti-citrullinated peptide (anti-CCP), anti-rheumatoid factor, immunoglobulin A, C-reactive protein test, complement test, erythrocyte sedimentation rate (ESR) test, blood clotting profile, and protein electrophoresis/immunofixation electrophoresis, and/or genetic testings.
- routine medical examination e.g., presence of antinuclear antibodies, anti-mitochondrial autoantibodies, anti-neutrophil cytoplasmic antibody, anti-phospholipid antibodies, anti-citrullinated peptide (anti-CCP), anti-rheumatoid factor, immunoglobulin A, C-reactive protein test, complement test, erythrocyte sedimentation rate (ESR
- the subject to be treated by the method described herein may be a human subject with an autoimmune disease who has undergone or is subjecting to an autoimmune disease treatment, for example, immunosuppressive mediation, hormone replacement therapy, blood transfusions, anti-inflammatory medication, and/or pain medication.
- an autoimmune disease treatment for example, immunosuppressive mediation, hormone replacement therapy, blood transfusions, anti-inflammatory medication, and/or pain medication.
- a subject suspected of having any of such target disease/disorder might show one or more symptoms of the disease/disorder.
- a subject at risk for the disease/disorder can be a subject having one or more of the risk factors for that disease/disorder.
- an effective amount refers to the amount of each active agent required to confer therapeutic effect on the subject, either alone or in combination with one or more other active agents.
- the therapeutic effect is increased CD40 activity, activation of dendritic cells, increased T cell responses, and/or increased anti-tumor immune responses. Determination of whether an amount of the antibody achieved the therapeutic effect would be evident to one of skill in the art. Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the individual patient parameters including age, physical condition, size, gender and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. These factors are well known to those of ordinary skill in the art and can be addressed with no more than routine experimentation. It is generally preferred that a maximum dose of the individual components or combinations thereof be used, that is, the highest safe dose according to sound medical judgment.
- Empirical considerations such as the half-life, generally will contribute to the determination of the dosage.
- antibodies that are compatible with the human immune system such as humanized antibodies or fully human antibodies, may be used to prolong half-life of the antibody and to prevent the antibody being attacked by the host's immune system.
- Frequency of administration may be determined and adjusted over the course of therapy, and is generally, but not necessarily, based on treatment and/or suppression and/or amelioration and/or delay of a target disease/disorder.
- sustained continuous release formulations of an antibody may be appropriate.
- formulations and devices for achieving sustained release are known in the art.
- dosages for an antibody as described herein may be determined empirically in individuals who have been given one or more administration(s) of the antibody. Individuals are given incremental dosages of the agonist. To assess efficacy of the agonist, an indicator of the disease/disorder can be followed.
- an initial candidate dosage can be about 2 mg/kg.
- a typical daily dosage might range from about any of 0.1 ⁇ g/kg to 3 ⁇ g/kg to 30 ⁇ g/kg to 300 ⁇ g/kg to 3 mg/kg, to 30 mg/kg to 100 mg/kg or more, depending on the factors mentioned above.
- the treatment is sustained until a desired suppression of symptoms occurs or until sufficient therapeutic levels are achieved to alleviate a target disease or disorder, or a symptom thereof.
- An exemplary dosing regimen comprises administering an initial dose of about 2 mg/kg, followed by a weekly maintenance dose of about 1 mg/kg of the antibody, or followed by a maintenance dose of about 1 mg/kg every other week.
- other dosage regimens may be useful, depending on the pattern of pharmacokinetic decay that the practitioner wishes to achieve. For example, dosing from one-four times a week is contemplated. In some embodiments, dosing ranging from about 3 ⁇ g/mg to about 2 mg/kg (such as about 3 ⁇ g/mg, about 10 ⁇ g/mg, about 30 ⁇ g/mg, about 100 ⁇ g/mg, about 300 ⁇ g/mg, about 1 mg/kg, and about 2 mg/kg) may be used.
- dosing frequency is once every week, every 2 weeks, every 4 weeks, every 5 weeks, every 6 weeks, every 7 weeks, every 8 weeks, every 9 weeks, or every 10 weeks; or once every month, every 2 months, or every 3 months, or longer.
- the progress of this therapy is easily monitored by conventional techniques and assays.
- the dosing regimen (including the antibody used) can vary over time.
- doses ranging from about 0.3 to 5.00 mg/kg may be administered.
- the dosage of the anti-CD40 antibody described herein can be 10 mg/kg.
- the particular dosage regimen i.e., dose, timing and repetition, will depend on the particular individual and that individual's medical history, as well as the properties of the individual agents (such as the half-life of the agent, and other considerations well known in the art).
- the appropriate dosage of an antibody as described herein will depend on the specific antibody, antibodies, and/or non-antibody peptide (or compositions thereof) employed, the type and severity of the disease/disorder, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the agonist, and the discretion of the attending physician.
- the clinician will administer an antibody, until a dosage is reached that achieves the desired result.
- the desired result is an increase in anti-tumor immune response in the tumor microenvironment.
- Administration of one or more antibodies can be continuous or intermittent, depending, for example, upon the recipient's physiological condition, whether the purpose of the administration is therapeutic or prophylactic, and other factors known to skilled practitioners.
- the administration of an antibody may be essentially continuous over a preselected period of time or may be in a series of spaced dose, e.g., either before, during, or after developing a target disease or disorder.
- treating refers to the application or administration of a composition including one or more active agents to a subject, who has a target disease or disorder, a symptom of the disease/disorder, or a predisposition toward the disease/disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder, the symptom of the disease, or the predisposition toward the disease or disorder.
- Alleviating a target disease/disorder includes delaying the development or progression of the disease, or reducing disease severity or prolonging survival. Alleviating the disease or prolonging survival does not necessarily require curative results.
- “delaying” the development of a target disease or disorder means to defer, hinder, slow, retard, stabilize, and/or postpone progression of the disease. This delay can be of varying lengths of time, depending on the history of the disease and/or individuals being treated.
- a method that “delays” or alleviates the development of a disease, or delays the onset of the disease is a method that reduces probability of developing one or more symptoms of the disease in a given time frame and/or reduces extent of the symptoms in a given time frame, when compared to not using the method. Such comparisons are typically based on clinical studies, using a number of subjects sufficient to give a statistically significant result.
- “Development” or “progression” of a disease means initial manifestations and/or ensuing progression of the disease. Development of the disease can be detectable and assessed using standard clinical techniques as well known in the art. However, development also refers to progression that may be undetectable. For purpose of this disclosure, development or progression refers to the biological course of the symptoms. “Development” includes occurrence, recurrence, and onset. As used herein “onset” or “occurrence” of a target disease or disorder includes initial onset and/or recurrence.
- the antibodies described herein are administered to a subject in need of the treatment at an amount sufficient to enhance the activity of CD40 (and/or DC activation) by at least 10% (e.g., 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater) in vivo.
- compositions can be administered via other conventional routes, e.g., administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir.
- parenteral as used herein includes subcutaneous, intracutaneous, intravenous, intramuscular, intraarticular, intraarterial, intrasynovial, intrasternal, intrathecal, intralesional, and intracranial injection or infusion techniques.
- injectable depot routes of administration such as using 1-, 3-, or 6-month depot injectable or biodegradable materials and methods.
- the pharmaceutical composition is administered intraocularly or intravitreally.
- Injectable compositions may contain various carriers such as vegetable oils, dimethylactamide, dimethyformamide, ethyl lactate, ethyl carbonate, isopropyl myristate, ethanol, and polyols (glycerol, propylene glycol, liquid polyethylene glycol, and the like).
- water soluble antibodies can be administered by the drip method, whereby a pharmaceutical formulation containing the antibody and a physiologically acceptable excipient is infused.
- Physiologically acceptable excipients may include, for example, 5% dextrose, 0.9% saline, Ringer's solution or other suitable excipients.
- Intramuscular preparations e.g., a sterile formulation of a suitable soluble salt form of the antibody
- a pharmaceutical excipient such as Water-for-Injection, 0.9% saline, or 5% glucose solution.
- an antibody is administered via site-specific or targeted local delivery techniques.
- site-specific or targeted local delivery techniques include various implantable depot sources of the antibody or local delivery catheters, such as infusion catheters, an indwelling catheter, or a needle catheter, synthetic grafts, adventitial wraps, shunts and stents or other implantable devices, site specific carriers, direct injection, or direct application. See, e.g., PCT Publication No. WO 00/53211 and U.S. Pat. No. 5,981,568.
- Targeted delivery of therapeutic compositions containing an antisense polynucleotide, expression vector, or subgenomic polynucleotides can also be used.
- Receptor-mediated DNA delivery techniques are described in, for example, Findeis et al., Trends Biotechnol . (1993) 11:202; Chiou et al., Gene Therapeutics: Methods and Applications Of Direct Gene Transfer (J. A. Wolff, ed.) (1994); Wu et al., J. Biol. Chem . (1988) 263:621; Wu et al., J. Biol. Chem . (1994) 269:542; Zenke et al., Proc. Natl. Acad. Sci. USA (1990) 87:3655; Wu et al., J. Biol. Chem. (1991) 266:338.
- compositions containing a polynucleotide are administered in a range of about 100 ng to about 200 mg of DNA for local administration in a gene therapy protocol.
- concentration ranges of about 500 ng to about 50 mg, about 1 ⁇ g to about 2 mg, about 5 ⁇ g to about 500 ⁇ g, and about 20 ⁇ g to about 100 ⁇ g of DNA or more can also be used during a gene therapy protocol.
- the therapeutic polynucleotides and polypeptides described herein can be delivered using gene delivery vehicles.
- the gene delivery vehicle can be of viral or non-viral origin (see generally, Jolly, Cancer Gene Therapy (1994) 1:51; Kimura, Human Gene Therapy (1994) 5:845; Connelly, Human Gene Therapy (1995) 1:185; and Kaplitt, Nature Genetics (1994) 6:148).
- Expression of such coding sequences can be induced using endogenous mammalian or heterologous promoters and/or enhancers. Expression of the coding sequence can be either constitutive or regulated.
- Viral-based vectors for delivery of a desired polynucleotide and expression in a desired cell are well known in the art.
- Exemplary viral-based vehicles include, but are not limited to, recombinant retroviruses (see, e.g., PCT Publication Nos. WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; WO 93/11230; WO 93/10218; WO 91/02805; U.S. Pat. Nos. 5,219,740 and 4,777,127; GB Patent No. 2,200,651; and EP Patent No.
- alphavirus-based vectors e.g., Sindbis virus vectors, Semliki forest virus (ATCC VR-67; ATCC VR-1247), Ross River virus (ATCC VR-373; ATCC VR-1246) and Venezuelan equine encephalitis virus (ATCC VR-923; ATCC VR-1250; ATCC VR 1249; ATCC VR-532)
- AAV adeno-associated virus
- Non-viral delivery vehicles and methods can also be employed, including, but not limited to, polycationic condensed DNA linked or unlinked to killed adenovirus alone (see, e.g., Curiel, Hum. Gene Ther . (1992) 3:147); ligand-linked DNA (see, e.g., Wu, J. Biol. Chem. (1989) 264:16985); eukaryotic cell delivery vehicles cells (see, e.g., U.S. Pat. No. 5,814,482; PCT Publication Nos. WO 95/07994; WO 96/17072; WO 95/30763; and WO 97/42338) and nucleic charge neutralization or fusion with cell membranes. Naked DNA can also be employed.
- Exemplary naked DNA introduction methods are described in PCT Publication No. WO 90/11092 and U.S. Pat. No. 5,580,859.
- Liposomes that can act as gene delivery vehicles are described in U.S. Pat. No. 5,422,120; PCT Publication Nos. WO 95/13796; WO 94/23697; WO 91/14445; and EP Patent No. 0524968. Additional approaches are described in Philip, Mol. Cell. Biol . (1994) 14:2411, and in Woffendin, Proc. Natl. Acad. Sci . (1994) 91:1581.
- the particular dosage regimen i.e., dose, timing and repetition, used in the method described herein will depend on the particular subject and that subject's medical history.
- more than one antibody, or a combination of an antibody and another suitable therapeutic agent may be administered to a subject in need of the treatment.
- the antibody can also be used in conjunction with other agents that serve to enhance and/or complement the effectiveness of the agents.
- Treatment efficacy for a target disease/disorder can be assessed by methods well-known in the art.
- anti-CD40 antibodies described herein may be utilized in conjunction with other types of therapy for the target disease such as cancer or immune disorders.
- an anti-CD40 antibody as described herein when used for treating a cancer, it can be combined with an anti-cancer therapy, for example, those known in the art. Additional anti-cancer therapy includes chemotherapy, surgery, radiation, immunotherapy, gene therapy, and so forth.
- the treatment of the present disclosure can be combined with a chemotherapeutic agent, for example, pyrimidine analogs (5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine), purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiproliferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disruptors such as taxane (paclitaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (etoposide, teniposide), DNA damaging agents (actinomycin, amsacrine, anthracyclines, bleomycin, busulfan, camptothecin,
- the anti-CD40 antibody as described herein for treating an immune disorder can be co-used with other immunomodulatory treatments such as, e.g., therapeutic vaccines (including but not limited to GVAX, DC-based vaccines, etc.), or checkpoint inhibitors (including but not limited to agents that block CTLA4, PD1, LAGS, TIM3, etc.).
- therapeutic vaccines including but not limited to GVAX, DC-based vaccines, etc.
- checkpoint inhibitors including but not limited to agents that block CTLA4, PD1, LAGS, TIM3, etc.
- the antibody can be combined with another therapy for autoimmune diseases.
- Examples include, but are not limited to, intravenous Ig therapy; nonsteroidal anti-inflammatory drugs (NSAID); corticosteroids; cyclosporins, rapamycins, ascomycins; cyclophosphamide; azathioprene; methotrexate; brequinar; FTY 720; leflunomide; mizoribine; mycophenolic acid; mycophenolate mofetil; 15-deoxyspergualine; an immunosuppressive agent, or an adhesion molecule inhibitor.
- NSAID nonsteroidal anti-inflammatory drugs
- corticosteroids corticosteroids
- cyclosporins rapamycins, ascomycins
- cyclophosphamide azathioprene
- methotrexate brequinar
- FTY 720 leflunomide
- mizoribine mycophenolic acid
- mycophenolate mofetil 15-deoxyspergualine
- an immunosuppressive agent or an adh
- a second therapeutic agent when used, such an agent can be administered simultaneously or sequentially (in any order) with the therapeutic agent described herein.
- suitable therapeutically effective dosages for each agent may be lowered due to the additive action or synergy.
- kits for use in treating or alleviating a target diseases such as cancer and immune disorders as described herein.
- kits can include one or more containers comprising an anti-CD40 antibody, e.g., any of those described herein, and optionally a second therapeutic agent to be co-used with the anti-CD40 antibody, which is also described herein.
- the kit can comprise instructions for use in accordance with any of the methods described herein.
- the included instructions can comprise a description of administration of the anti-CD40 antibody, and optionally the second therapeutic agent, to treat, delay the onset, or alleviate a target disease as those described herein.
- the kit may further comprise a description of selecting an individual suitable for treatment based on identifying whether that individual has the target disease, e.g., applying the diagnostic method as described herein.
- the instructions comprise a description of administering an antibody to an individual at risk of the target disease.
- the instructions relating to the use of an anti-CD40 antibody generally include information as to dosage, dosing schedule, and route of administration for the intended treatment.
- the containers may be unit doses, bulk packages (e.g., multi-dose packages) or subunit doses.
- Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
- the label or package insert indicates that the composition is used for treating, delaying the onset and/or alleviating the disease, such as cancer or immune disorders (e.g., an autoimmune disease). Instructions may be provided for practicing any of the methods described herein.
- kits of this invention are in suitable packaging.
- suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like.
- packages for use in combination with a specific device such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump.
- a kit may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- the container may also have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- a sterile access port for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle.
- At least one active agent in the composition is an anti-CD40 antibody as those described herein.
- Kits may optionally provide additional components such as buffers and interpretive information.
- the kit comprises a container and a label or package insert(s) on or associated with the container.
- the invention provides articles of manufacture comprising contents of the kits described above.
- Recombinant human CD40/TNFRSF5 protein (cat #1493-CD, Fc chimera) and human CD40/TNFRSF5 MAb (Clone 82111, mouse IgG2B, cat #MAB6321) were purchased from R&D Systems (USA).
- Rhesus monkey CD40/TNFRSF5 Protein (His Tag) was purchased from Sino Biologics (cat #90097-C02H).
- a stable CHO cell line expressing human or cynomolgus monkey CD40 was developed by transfection with full length human CD40 cDNA (Gene ID: 958) or cynomolgus monkey CD40 cDNA (Gene ID: 102118696).
- a standard ELISA was used to detect anti-CD40 antibodies. Plates were coated with CD40 protein and incubated with anti-CD40 antibodies. The antibody molecules bound to CD40 were detected using secondary antibodies (goat anti-mouse or rat IgG) conjugated with peroxidase.
- FACS was performed to detect anti-CD40 antibodies using the CHO-CD40 cell line. After a period of incubation with antibody samples, CHO-CD40 cells were analyzed by commercially available PE- or FITC-labeled secondary antibodies using FACS.
- mice and Wistar rats were immunized with recombinant human CD40/TNFRSF5 protein Fc chimera and pcDNA3.1-human CD40 plasmid.
- the anti-CD40 serum titers of the immunized animals were monitored using an ELISA with human CD40 and human IgG as controls.
- the positive titers were further confirmed using FACS to screen CHO-human CD40 cells.
- Four mice and one rat with the highest titers were sacrificed; the harvested splenocytes were isolated and fused with SP2/0 myeloma cells using a standard hybridoma protocol.
- a total of one hundred 96-well plates of mouse or rat hybridomas were screened using an ELISA to measure the binding activity of antibodies secreted therefrom to the human CD40 protein. The positive samples were then tested by a human Fc counter screen. Next, these positive CD40-specific clones were tested for binding to human CD40 expressed on CHO-cells by FACS and subjected to two rounds of single cell cloning by limited dilutions. Twenty-six stable hybridoma clones were obtained.
- FIG. 1 shows the binding results of five exemplary antibodies secreted from hybridoma cells. These five antibodies were also tested in functional assays using human dendritic cells or B cells. As shown in FIGS. 2 A and 2 B , a number of the anti-CD40 antibodies exhibited apparent agonistic activity in activating human dendritic cells or B cells as evidenced by cytokine secretion.
- V H /V L sequences were determined following routine practice.
- the cDNA sequences encoding the anti-CD40 antibody variable domain sequences were synthesized as chimeras to human IgG4 heavy chain constant regions containing the hinge S228P (EU numbering; Kabat numbering 241) stabilizing mutation (Angal et., Mol. Immunol 30:105, 1993) or human kappa light chain constant region.
- CHO transient expression was carried out with plasmids containing the corresponding heavy and light chain sequences.
- These chimeric antibodies were purified by protein affinity chromatography. The purified antibody preparations contain ⁇ 5 EU/mg endotoxin and the level of the antibodies in monomer form is >95%.
- CD40 protein human CD40-His tag protein (Sino Biological Inc. Cat #10239-H08E) or rhesus monkey CD40-His (Sino Biological Inc. Cat #90097-C02H) was diluted in PBS to 1 ug/ml and used to coat an ELISA plate (Corning, Cat #9018, high binding) at a concentration of 50 ul/well. The plate was incubated overnight at 4° C. The plate was then decanted and washed with PBS-T, and 200 ⁇ l/well assay diluent (1 ⁇ PBS/1% BSA/0.05% Tween-20/0.05% proclin 300) was added.
- the plate was washed with PBS-T three times.
- the testing antibodies were diluted in assay diluent to 0, 0.000003, 0.00003, 0.0003, 0.003, 0.03, and 0.3 ug/ml or approximately 0, 0.00002, 0.0002, 0.002, 0.02, 0.2 and 2 nM and then added to the plate (50 ul/well).
- the plate was incubated for one hour at 37° C. and then washed three times with PBS-T.
- Anti-human IgG-HRP conjugate (Bethyl Cat #A80-319P) at a 1:10,000 dilution was added to the plate (100 ul/well).
- the plate was incubated for 0.5 hour at 37° C., followed by washing with PBS-T three times.
- the TMB substrate solution was added (100 ul/well). The color was allowed to develop for 8 minutes before it was stopped with 100 ul/well 2N H 2 SO 4 . Absorbance at 450 nm was determined with an ELISA reader. As shown in FIG. 3 , the tested exemplary antibodies bind human CD40 in a dose-dependent manner.
- CHO cells over-expressing human CD40 or cynomolgus monkey CD40 were harvested using trypsin-EDTA partial digestion followed by centrifugation at 1000 rpm for 5 minutes. The cells were resuspended in cold PBS-BSA (2%) at 5 ⁇ 10 6 /ml and aliquoted out to 100 ⁇ l/tube.
- the chimeric anti-CD40 antibodies were diluted in PBS-BSA in three times (final concentrations were 0.01, 0.1, 1, and 10 ug/ml) and 50 ⁇ l of each concentration was added to the CHO-CD40 cells. The cell solutions were mixed and incubated at 4° C. in the dark for 2 hours. The cells were then washed with PBS-BSA twice.
- PBMCs Fresh PBMCs were isolated from healthy volunteers by Ficoll separation as buffy coat and resuspended in PRMI-1640 containing 10% FBS at 3 ⁇ 10 6 /ml. To prepare dendritic cells, PBMCs were seeded into 6-well culture plate at 2 mL/well and allowed to adhere for 90 min at 37° C.
- the non-adherent fraction containing lymphocytes were removed and the adherent cells cultured in the RPMI1640 (10% FBS) supplemented with 100 ng/mL of rhGM-CSF and 50 ng/mL of rhIL-4 (Human Dendritic Cell Cytokine Package, Peprotech, Cat #AF-HDC) in a 37° C., 5% CO 2 humidified incubator for 7 days, and fresh the medium was replaced at day 3.
- the DC cells were harvested and plated at 1 ⁇ 10 5 /ml DC in 96-well plate. Soluable test antibodies were added.
- the cells were cultured for three days, and then supernatants were harvested and the levels of IL-8 and IL-12/P40 in the supernatants were measured by ELISAs.
- DC cells were adjusted a cell density of 1.25 ⁇ 10 6 /ml.
- the cells were added to a 24-well plate (0.4 mL/well) in the presence or absence of CHO-Fc ⁇ RIIB cells.
- antibody or medium (control) was added to the wells.
- the plates were incubated at 37° C. in 5% CO 2 for approximately 24 hours.
- the cell culture supernatant was then harvested and of the levels of IL-8, IL-12/P40, and IL12/P70 in the supernatant were measured.
- the anti-CD40 antibodies showed enhanced agonistic effects as evidenced by cytokine secretion when co-cultured with CHO cells expressing Fc ⁇ RIIB DC cells were harvested and subjected to FACS analysis for cell surface expression of CD86, a marker for DC activation.
- mice C57BL/6 mice (6-7 weeks old, 19-20 g, male were used for the study.
- Antibodies were formulated in PBS and administered via tail vein injection at 3 mg/kg in a group of 4 mice.
- FIGS. 7 A- 7 C show the blood antibody concentration of chimeric antibodies after a single intravenous injection of 3 mg/kg. Table 1, below, summarizes the pharmacokinetic parameters of the antibodies examined.
- inventive embodiments are presented by way of example only and that, within the scope of the appended claims and equivalents thereto, inventive embodiments may be practiced otherwise than as specifically described and claimed.
- inventive embodiments of the present disclosure are directed to each individual feature, system, article, material, kit, and/or method described herein.
- a reference to “A and/or B”, when used in conjunction with open-ended language such as “comprising” can refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
- the phrase “at least one,” in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements.
- This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase “at least one” refers, whether related or unrelated to those elements specifically identified.
- “at least one of A and B” can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Description
-
- (a) a heavy chain variable region (VH), which comprises (i) a heavy chain complementary determining region 1 (HC CDR1) set forth as GX1X2FX3X4X5X6X7X8 (SEQ ID NO: 1), in which X1 is F or Y, X2 is N, T, or I, X3 is N, T, or I, X4 is D, S, or N, X5 is S or Y, X6 is F, N, W, or G, X7 is M, I, or L, and X8 is N, D, or H; (ii) a heavy chain complementary determining region 2 (HC CDR2) set forth as QIRNX1NYX2YAX3YYX4ESLEG (SEQ ID NO: 2), in which X1 is K or G, X2 is N or D, X3 is T or A, and X4 is T or A; X1IX2PNNX3X4X5X6YNX7KFRX8 (SEQ ID NO: 3), in which X1 is D or R, X2 is N or D, X3 is D or G, X4 is I or G, X5 is S or T, X6 is I or K, X7 is Q or E, and X8 is G or Y; or SISPSGGVTYYRDSVKG (SEQ ID NO: 4); and/or (iii) a heavy chain complementary determining region 3 (HC CDR3) set forth as YYYDGX1X2DYFDX3 (SEQ ID NO: 5), in which X1 is F or H, X2 is A or F, and X3 is Y or N; RFAY (SEQ ID NO: 6); GVITTLVAGDY (SEQ ID NO: 7); or PFLGWGGANWIAH (SEQ ID NO: 8); and/or
- (b) a light chain variable region (VL), which comprises (i) a light chain complementary determining region 1 (LC CDR1) set forth as RSSQSLVYSYGNTYLH (SEQ ID NO: 9); SASSSISSNYLH (SEQ ID NO: 10); KASQNX1X2X3YLN (SEQ ID NO: 11), in which X1 is I or L, X2 is Y or N, and X3 is I or K; or LASEDISNDLA (SEQ ID NO: 12); (ii) a light chain complementary determining region 2 (LC CDR2) selected from the group consisting of X1X2SN X3X4S (SEQ ID NO: 13), in which X1 is N or R, X2 is V or T, X3 is R or L, and X4 is F or A; NTX1NLX2T (SEQ ID NO: 14), in which X1 is N or D, and X2 is Q or Y; or FVDRLLD (SEQ ID NO: 15); and/or (iii) a light chain complementary determining region 3 (LC CDR3) set forth as X1Q X2X3X4X5PX6T (SEQ ID NO: 16), in which X1 is S or Q, X2 is G or S, X3 is T, S, or Y, X4 is H, S, or K, X5 is V, I, or Y, and X6 is W, Y, or P; or X1QHX2X3RRT (SEQ ID NO: 17), in which X1 is L or M, X2 is S or N, and X3 is S or V.
-
- (i) the HC CDR1 of GX1X2FX3X4X5X6X7X8 (SEQ ID NO: 1), in which X1 is F, X2 is N, (ii) X3 is N, X4 is D, X5 is S or Y, X6 is F, X7 is M, and X8 is N;
- (ii) the HC CDR2 of QIRNX1NYX2YAX3YYX4ESLEG (SEQ ID NO: 2), in which X1 is K or G, X2 is N or D, X3 is T or A, and X4 is T or A;
- (iii) the HC CDR3 of YYYDGX1X2DYFDX3 (SEQ ID NO: 5), in which X1 is F or H, X2 is A or F, and X3 is Y or N;
- (iv) the LC CDR1 of RSSQSLVYSYGNTYLH (SEQ ID NO: 9) or SASSSISSNYLH (SEQ ID NO: 10);
- (v) the LC CDR2 of X1X2SN X3X4S (SEQ ID NO: 13), in which X1 is N or R, X2 is V or T, X3 is R or L, and X4 is F or A; and/or
- (vi) the LC CDR3 of X1Q X2X3X4X5PX6T (SEQ ID NO: 16), in which X1 is S or Q, X2 is G, X3 is T or 5, X4 is H or 5, X5 is V or I, and X6 is W or Y.
-
- (i) the HC CDR1 of GX1X2FX3X4X5X6X7X8 (SEQ ID NO: 1), in which X1 is Y, X2 is T or I, X3 is T or I, X4 is D or 5, X5 is Y, X6 is N or W, X7 is M or I, and X8 is D or H;
- (ii) the HC CDR2 of X1X2PNNX3X4X5X6YNX7KFRX8 (SEQ ID NO: 3), in which X1 is D or R, X2 is N or D, X3 is D or G, X4 is I or G, X5 is S or T, X6 is I or K, X7 is Q or E, and X8 is G or Y;
- (iii) the HC CDR3 of RFAY (SEQ ID NO: 6) or GVITTLVAGDY (SEQ ID NO: 7);
- (iv) the LC CDR1 of KASQNX1X2X3YLN (SEQ ID NO: 11), in which X1 is I or L, X2 is Y or N, and X3 is I or K;
- (v) the LC CDR2 of NTX1NLX2T (SEQ ID NO: 14), in which X1 is N or D, and X2 is Q or Y; and
- (vi) the LC CDR3 of X1QHX2X3RRT (SEQ ID NO: 17), in which X1 is L or M, X2 is S or N, and X3 is S or V.
| Human CD40 (SEQ ID NO: 38): |
| MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSD |
| CTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETD |
| TICTCEEGWHCTSEACESCVLHRSCSPGFGVKQTATGVSDTICEPCPVGF |
| FSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPI |
| IFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAP |
| VQETLHGCQPVTQEDGKESRISVQERQ |
| Cynomolgus Monkey (Macaca fascicularis) CD40 (SEQ |
| ID NO: 39): |
| MVRLPLQCVLWGCLLTAVYPEPPTACREKQYLINSQCCSLCQPGQKLVSD |
| CTEFTETECLPCGESEFLDTWNRETRCHQHKYCDPNLGLRVQQKGTSETD |
| TICTCEEGLHCTSESCESCVPHRSCLPGFGVKQTATGVSDTICEPCPVGF |
| FSNVSSAFEKCRPWTSCETKDLVVQQAGTNKTDVVCGPQDRQRALVVIPI |
| CLGILFVILLLVLVFIKKVAKKPNDKVPHPKQEPQEINFPDDLPGSNPAA |
| PVQETLHGCQPVTQEDGKESRISVQERQ |
[Bound]=[Free]/(Kd+[Free])
It is not always necessary to make an exact determination of KA, though, since sometimes it is sufficient to obtain a quantitative measurement of affinity, e.g., determined using a method such as ELISA or FACS analysis, is proportional to KA, and thus can be used for comparisons, such as determining whether a higher affinity is, e.g., 2-fold higher, to obtain a qualitative measurement of affinity, or to obtain an inference of affinity, e.g., by activity in a functional assay, e.g., an in vitro or in vivo assay.
-
- (i) GX1X2FX3X4X5X6X7X8 (SEQ ID NO: 1), in which X1 is F or Y, X2 is N, T, or I, X3 is N, T, or I, X4 is D, S, or N, X5 is S or Y, X6 is F, N, W, or G, X7 is M, I, or L, and X8 is N, D, or H. In some embodiments, X1 is F, X2 is N, X3 is N, X4 is D, X5 is S or Y, X6 is F, X7 is M, and X8 is N. In further embodiments, X1 is Y, X2 is T or I, X3 is T or I, X4 is D or 5, X5 is Y, X6 is N or W, X7 is M or I, and X8 is D or H.
HC CDR2: - (i) QIRNX1NYX2YAX3YYX4ESLEG (SEQ ID NO: 2), in which X1 is K or G, X2 is N or D, X3 is T or A, and X4 is T or A. In some embodiments, X1 is K or G, X2 is N or D, X3 is T or A, and X4 is T or A.
- (ii) X1IX2PX2′X3′X3X4X5X6YX6′X7X7′X7″X8′X8(SEQ ID NO: 41), in which X1 is D, R, or S, X2 is N, D, or S, X2′ is N or S, X3′ is N or G, X3 is D or G, X4 is I, G or V, X5 is S or T, X6 is I, K, or Y X7 is Q or E, and X8 is G or Y. In some embodiments, X1 is D or R, X2 is N or D, X3 is D or G, X4 is I or G, X5 is S or T, X6 is I or K, X6′ is N or R, X7 is Q, E, or D, X7′ is K or S, X7″ is F or V, X8′ is R or K, and X8 is G or Y. In some embodiments the HC CDR2 is X1IX2PNNX3X4X5X6YNX7KFRX8 (SEQ ID NO: 3), in which X1 is D or R, X2 is N or D, X3 is D or G, X4 is I or G, X5 is S or T, X6 is I or K, X7 is Q or E, and X8 is G or Y. In some embodiments, X1 is D or R, X2 is N or D, X3 is D or G, X4 is I or G, X5 is S or T, X6 is I or K, X7 is Q or E, and X8 is G or Y.
- (iii) SISPSGGVTYYRDSVKG (SEQ ID NO: 4)
HC CDR3: - (i) YYYDGX1X2DYFDX3 (SEQ ID NO: 5), in which X1 is F or H, X2 is A or F, and X3 is Y or N. In some embodiments, X1 is F or H, X2 is A or F, and X3 is Y or N;
- (ii) RFAY (SEQ ID NO: 6);
- (iii) GVITTLVAGDY (SEQ ID NO: 7); or
- (iv) PFLGWGGANWIAH (SEQ ID NO: 8)
- (i) GX1X2FX3X4X5X6X7X8 (SEQ ID NO: 1), in which X1 is F or Y, X2 is N, T, or I, X3 is N, T, or I, X4 is D, S, or N, X5 is S or Y, X6 is F, N, W, or G, X7 is M, I, or L, and X8 is N, D, or H. In some embodiments, X1 is F, X2 is N, X3 is N, X4 is D, X5 is S or Y, X6 is F, X7 is M, and X8 is N. In further embodiments, X1 is Y, X2 is T or I, X3 is T or I, X4 is D or 5, X5 is Y, X6 is N or W, X7 is M or I, and X8 is D or H.
-
- (i) RSSQSLVYSYGNTYLH (SEQ ID NO: 9)
- (ii) SASSSISSNYLH (SEQ ID NO: 10)
- (iii) X1ASX2X3X4X5LX6 (SEQ ID NO: 42), X1 is K or L, X2 is Q or E, X3 is I or L, X4 is Y, N, or S, X5 is I, K, or N, and X6 is N or A. In some embodiments, the LC CDR1 is KASQNX1X2X3YLN (SEQ ID NO: 11), in which X1 is I or L, X2 is Y or N, and X3 is I or K. In some embodiments, X1 is I or L, X2 is Y or N, and X3 is I or K. In some embodiments, the LC CDR1 is (iv) LASEDISNDLA (SEQ ID NO: 12).
LC CDR2: - X1X2X3X4X5X6X7 (SEQ ID NO: 43), in which X1 is N, R, or F, X2 is V or T, X3 is S, N, or D, X4 is N or R, X5 is R or L, X6 is F, A, Q, Y, or L, and X7 is S, T, or D. In some embodiments, the LC CDR2 is:
- (i) X1X2SN X3X4S (SEQ ID NO: 13), in which X1 is N or R, X2 is V or T, X3 is R or L, and X4 is F or A. In some embodiments, X1 is N or R, X2 is V or T, X3 is R or L, and X4 is F or A.
- (ii) NTX1NLX2T (SEQ ID NO: 14), in which X1 is N or D, and X2 is Q or Y. In some embodiments, X1 is N or D, and X2 is Q or Y.
- (iii) FVDRLLD (SEQ ID NO: 15).
LC CDR3: - (i) X1Q X2X3X4X5PX6T (SEQ ID NO: 16), in which X1 is S or Q, X2 is G or S, X3 is T, S, or Y, X4 is H, S, or K, X5 is V, I, or Y, and X6 is W, Y, or P. In some embodiments, X1 is S or Q, X2 is G, X3 is T or S, X4 is H or S, X5 is V or I, and X6 is W or Y.
- (ii) X1QHX2X3RRT (SEQ ID NO: 17), in which X1 is L or M, X2 is S or N, and X3 is S or V. In some embodiments, X1 is L or M, X2 is S or N, and X3 is S or V.
| 19G6196 |
| VH: |
| (SEQ ID NO: 18) |
| EVQLQQSGPELVKPGASVKIPCKASGYTFTDYNMDWVKQSHGKSLEWIGD |
| INPNNDISIYNQKFRGKATLTVDKSSSTAYMELRSLTSEDTAVYYCARRF |
| AYWGQGTLVTVSA |
| VL: |
| (SEQ ID NO: 19) |
| DVVMTQIPLSLPVSIGDQASISCRSSQSLVYSYGNTYLHWFLQKPGQSPK |
| LLIYNVSNRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYFCSQGTHVP |
| WTFGGGTKLEIK |
| 36G7B8 |
| VH: |
| (SEQ ID NO: 20) |
| QVQLQQPGAELVRPGASVKLSCKASGYIFISYWIHWLKQRPGRGLEWIGR |
| IDPNNGGTKYNEKFRYKASLTVDKSSSTAYMQLSSLTSEDSAVYYCTKGV |
| ITTLVAGDYWGQGTTLTVSS |
| VL: |
| (SEQ ID NO: 21) |
| DIQMTQSPASLSASLGETVSIECLASEDISNDLAWYQQKSGKSPQLLIYF |
| VDRLLDGVPSRFSGSGSGTRHSLKISGMQPEDEADYFCQQSYKYPPTFGG |
| GTKLELK |
| 13F1A7 |
| VH: |
| (SEQ ID NO: 22) |
| EVQILETGGGLVKPGGSLRLSCATSGFNFNDSFMNWVRQAPGKGLEWVAQ |
| IRNKNYNYATYYTESLEGRVTISRDDSKSRVYLQVSSLRAEDSAVYYCTS |
| YYYDGFADYFDYWGQGVMVTVSS |
| VL: |
| (SEQ ID NO: 23) |
| EIVLTQSPTTMAASPGEKITITCSASSSISSNYLHWYQQKPGSSPKVLIY |
| RTSNLASGVPVRFSGSGSGTSYSLTIGTMEAEDVATYYCQQGSSIPYTFG |
| GGTKLEIK |
| 9F12D9 |
| VH: |
| (SEQ ID NO: 24) |
| EVHLVESGGGLVQPGRSLKLSCAASGFTFTNYGLHWIRQAPTKGLEWVAS |
| ISPSGGVTYYRDSVKGRFTISRDNGKTTLHLQMDSLRSEDTATYYCALPF |
| LGWGGANWIAHWGQGTLVTVSS |
| VL: |
| (SEQ ID NO: 25) |
| DIKVTQSPSFLSASVGDRATINCKASQNLNKYLNWYQQKPGEPPKLLIYN |
| TDNLYTGIPSRFSGSGSVADFTLTISGLQPEDVATYFCMQHNVRRTFGGG |
| TKLELK |
| 17C5C2 |
| VH: |
| (SEQ ID NO: 26) |
| EVHILETGGGLVKPGGSLGLSCTTSGFNFNDYFMNWVRQAPGKGLEWVAQ |
| IRNGNYDYAAYYAESLEGRVTISRDDSKSSVNLQVSSLRAEDTAIYYCTS |
| YYYDGHFDYFDNWGHGVMVTVSS |
| VL: |
| (SEQ ID NO: 27) |
| DIKMTQSPSFLSASVGDSVTFTCKASQNIYIYLNWYQQKFGEAPKLLIYN |
| TNNLQTGIPSRFSGSESGTVFTLTISSLQPEDVATYFCLQHSSRRTFGGG |
| TKLELK |
| ASTKGPSVFP LAPCSRSTSE STAALGCLVK DYFPEPVTVS | |
| WNSGALTSGV HTFPAVLQSS GLYSLSSVVT VPSSSLGTKT | |
| YTCNVDHKPS NTKVDKRVES KYGPPCP S CP APEFLGGPSV | |
| FLFPPKPKDT LMISRTPEVT CVVVDVSQED PEVQFNWYVD | |
| GVEVHNAKTK PREEQFNSTY RVVSVLTVLH QDWLNGKEYK | |
| CKVSNKGLPS SIEKTISKAK GQPREPQVYT LPPSQEEMTK | |
| NQVSLTCLVK GFYPSDIAVE WESNGQPENN YKTTPPVLDS | |
| DGSFFLYSRL TVDKSRWQEG NVFSCSVMHE ALHNHYTQKS | |
| LSLSLGK |
| Chimeric antibody: HC of LYV376 = 19G6D6 in human IgG4SP | |
| (SEQ ID NO: 28) | |
| evqlqqsgpelvkpgasvkipckasgytftdynmdwvkqshgkslewigdinpnndisiynqkfrgkatlt | |
| vdkssstaymelrsltsedtavyycarrfaywgqgtivtvsaASTKGPSVFPLAPCSRSTSESTAALGCLV | |
| KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES | |
| KYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKP | |
| REEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ | |
| VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALH | |
| NHYTQKSLSLSLGK | |
| Chimeric antibody: LC of LYV376 = 19G6D6 in human kappa | |
| (SEQ ID NO: 29) | |
| eivltqspttmaaspgekititcsasssissnylhwyqqkpgsspkvliyrtsnlasgvpvrfsgsgsgts | |
| ysltigtmeaedvatyycqqgssipytfgggtkleikrTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYP | |
| REAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG | |
| EC | |
| Chimeric antibody: HC of LYV377 = 13F1A7 in human IgG4SP | |
| (SEQ ID NO: 30) | |
| evqiletggglvkpggslrlscatsgfnfndsfmnwvrqapgkglewvaqirnknynyatyyteslegrvt | |
| isrddsksrvylqvsslraedsavyyctsyyydgfadyfdywgqgvmvtvssASTKGPSVFPLAPCSRSTS | |
| ESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPS | |
| NTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDG | |
| VEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLP | |
| PSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVF | |
| SCSVMHEALHNHYTQKSLSLSLGK | |
| Chimeric antibody: LC of LYV377 = 13F1A7 in human Kappa | |
| (SEQ ID NO: 31) | |
| dikmtqspsflsasvgdsvtftckasqniyiylnwyqqkfgeapklliyntnnlqtgipsrfsgsesgtvf | |
| tltisslqpedvatyfclqhssrrtfgggtklelkrTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRE | |
| AKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC | |
| Chimeric antibody: HC of LYV378 = 9F12D8 in human IgG4S | |
| (SEQ ID NO: 32) | |
| evhlvesggglvqpgrslklscaasgftftnyglhwirqaptkglewvasispsggvtyyrdsvkgrftis | |
| rdngkttlhlqmdslrsedtatyycalpflgwgganwiahwgqgtlvtvssASTKGPSVFPLAPCSRSTSE | |
| STAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSN | |
| TKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGV | |
| EVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPP | |
| SQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFS | |
| CSVMHEALHNHYTQKSLSLSLGK | |
| Chimeric antibody: LC of LYV378 = 9F12D8 in human Kappa | |
| (SEQ ID NO: 33) | |
| diqmtqspaslsaslgetvsieclasedisndlawyqqksgkspqlliyfvdrlldgvpsrfsgsgsgtrh | |
| slkisgmqpedeadyfcqqsykypptfgggtklelkrTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPR | |
| EAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE | |
| C | |
| Chimeric antibody: HC of LYV379 = 17C5C2 in human IgG4SP | |
| (SEQ ID NO: 34) | |
| evhiletggglvkpggslglscttsgfnfndyfmnwvrqapgkglewvaqirngnydyaayyaeslegrvt | |
| isrddskssvnlqvsslraedtaiyyctsyyydghfdyfdnwghgvmvtvssASTKGPSVFPLAPCSRSTS | |
| ESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPS | |
| NTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDG | |
| VEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLP | |
| PSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVF | |
| SCSVMHEALHNHYTQKSLSLSLGK | |
| Chimeric antibody: LC of LYV379 = 17C5C2 in human Kappa | |
| (SEQ ID NO: 35) | |
| dikvtqspsflsasvgdratinckasqnlnkylnwyqqkpgeppklliyntdnlytgipsrfsgsgsvadf | |
| tltisglqpedvatyfcmqhnvrrtfgggtklelkrTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRE | |
| AKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC | |
| Chimeric antibody: HC of LYV391 = 36G7B8 in hG4SP | |
| (SEQ ID NO: 36) | |
| qvqlqqpgaelvrpgasvklsckasgyifisywihwlkqrpgrglewigridpnnggtkynekfrykaslt | |
| vdkssstaymqlssltsedsavyyctkgvittlvagdywgqgttltvssASTKGPSVFPLAPCSRSTSEST | |
| AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTK | |
| VDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEV | |
| HNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQ | |
| EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCS | |
| VMHEALHNHYTQKSLSLSLGK | |
| Chimeric antibody: LC of LYV391 = 36G7B8 in human kappa | |
| (SEQ ID NO: 37) | |
| dvvmtqiplslpvsigdqasiscrssqslvysygntylhwflqkpgqspklliynvsnrfsgvpdrfsgsg | |
| sgtdftlrisrveaedlgvyfcsqgthvpwtfgggtkleikrTVAAPSVFIFPPSDEQLKSGTASVVCLLN | |
| NFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKS | |
| FNRGEC |
Preparation of Anti-CD40 Antibodies
| TABLE 1 |
| Pharmacokinetic Parameters of Exemplary Antibodies |
| PK parameters | Unit | LYV376 | LYV377 | LYV378 | LYV379 | LYV391 |
| CL | mL/day/kg | 3.90 | 7.55 | 4.14 | 4.16 | 3.87 |
| Vss | mL/kg | 99.7 | 108 | 95.2 | 89.1 | 88.4 |
| V1 | mL/kg | 46.5 | 42.2 | 44.8 | 37.3 | 35.5 |
| Alpha t1/2 | day | 0.119 | 0.123 | 0.0873 | 0.0891 | 0.148 |
| Beta t1/2 | day | 18.5 | 10.3 | 16.1 | 15.4 | 16.2 |
| AUC | day*μg/mL | 782 | 400 | 729 | 750 | 782 |
| MRT | day | 26.5 | 14.5 | 23.1 | 22.1 | 23.0 |
Claims (17)
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CNPCT/CN2018/083864 | 2018-04-20 | ||
| CN2018083864 | 2018-04-20 | ||
| WOPCT/CN2018/083864 | 2018-04-20 | ||
| PCT/US2019/028364 WO2019204756A1 (en) | 2018-04-20 | 2019-04-19 | Anti-cd40 antibodies and uses thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20210179727A1 US20210179727A1 (en) | 2021-06-17 |
| US11976123B2 true US11976123B2 (en) | 2024-05-07 |
Family
ID=68239861
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/048,954 Active 2041-07-08 US11976123B2 (en) | 2018-04-20 | 2019-04-19 | Anti-CD40 antibodies and uses thereof |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US11976123B2 (en) |
| EP (1) | EP3781203A4 (en) |
| JP (1) | JP2021521804A (en) |
| KR (1) | KR20210005082A (en) |
| CN (1) | CN112512572B (en) |
| AU (1) | AU2019255781A1 (en) |
| CA (1) | CA3097007A1 (en) |
| WO (1) | WO2019204756A1 (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN115403670A (en) * | 2021-05-26 | 2022-11-29 | 安徽瀚海博兴生物技术有限公司 | anti-CD40 antibodies and uses thereof |
Citations (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003040170A2 (en) | 2001-11-09 | 2003-05-15 | Pfizer Products Inc. | Antibodies to cd40 |
| US7193064B2 (en) | 2001-04-27 | 2007-03-20 | Kirin Beer Kabushiki Kaisha | Anti-CD40 monoclonal antibody |
| WO2007066082A1 (en) | 2005-12-09 | 2007-06-14 | Ucb Pharma S.A. | Antibody molecules having specificity for human il-6 |
| US20070148163A1 (en) | 2003-12-25 | 2007-06-28 | Kirin Beer Kabushiki Kaisha | Mutants of anti-cd40 antibody |
| US20080085531A1 (en) | 2006-05-09 | 2008-04-10 | Pangenetics B.V. | Antagonistic anti-human CD40 monoclonal antibody |
| WO2008091954A2 (en) | 2007-01-23 | 2008-07-31 | Xencor, Inc. | Optimized cd40 antibodies and methods of using the same |
| US20120263732A1 (en) | 2003-12-22 | 2012-10-18 | Pfizer Inc. | Cd40 antibody formulation and methods |
| US20120294796A1 (en) | 2010-03-04 | 2012-11-22 | Macrogenics, Inc. | Antibodies Reactive with B7-H3 and Uses Thereof |
| WO2013034904A1 (en) | 2011-09-05 | 2013-03-14 | Alligator Bioscience Ab | Anti-cd40 antibodies, uses and methods |
| US20140120103A1 (en) | 2012-10-30 | 2014-05-01 | Apexigen, Inc. | Anti-cd40 antibodies and methods of use |
| WO2014065402A1 (en) | 2012-10-26 | 2014-05-01 | 株式会社ペルセウスプロテオミクス | Anti-human cd40 monoclonal antibody, and use thereof |
| US9234044B2 (en) | 2009-04-20 | 2016-01-12 | Kyowa Hakko Kirin Co., Ltd | Agonistic anti-CD40 IGG2 antibodies having amino acid mutations introduced therein |
| US20160017040A1 (en) | 2013-03-14 | 2016-01-21 | Genentech, Inc. | Anti-b7-h4 antibodies and immunoconjugates |
| WO2016028810A1 (en) | 2014-08-18 | 2016-02-25 | Biogen Ma Inc. | Anti-cd40 antibodies and uses thereof |
| WO2016177771A1 (en) | 2015-05-04 | 2016-11-10 | Apogenix Ag | Single-chain cd40-receptor agonist proteins |
| WO2017004016A1 (en) | 2015-06-29 | 2017-01-05 | The Rockefeller University | Antibodies to cd40 with enhanced agonist activity |
| US20170253659A1 (en) * | 2016-03-04 | 2017-09-07 | The Rockefeller University | Antibodies to cd40 with enhanced agonist activity |
| WO2017205742A1 (en) | 2016-05-27 | 2017-11-30 | Abbvie Biotherapeutics Inc. | Anti-cd40 antibodies and their uses |
| US20180066053A1 (en) | 2016-04-18 | 2018-03-08 | Celldex Therapeutics, Inc. | Agonistic antibodies that bind human cd40 and uses thereof |
| WO2018144955A1 (en) | 2017-02-02 | 2018-08-09 | Silverback Therapeutics, Inc. | Construct-peptide compositions and methods of use thereof |
| US20180346569A1 (en) | 2015-11-18 | 2018-12-06 | Lyvgen Biopharma Holdings Limited | Anti-pd-1 antibodies and therapeutic uses thereof |
| US20190010233A1 (en) | 2016-01-04 | 2019-01-10 | Pharmaexplorer Limited | Anti-pd-l1 antibodies and uses thereof |
| WO2020065409A2 (en) | 2018-09-28 | 2020-04-02 | Lyvgen Biopharma Co., Ltd. | Anti-cd40 binding molecules having engineered fc domains and therapeutic uses thereof |
| WO2021081303A1 (en) | 2019-10-23 | 2021-04-29 | Lyvgen Biopharma (Suzhou) Co., Ltd. | Anti-cd40 binding molecules and bi-specific antibodies comprising such |
-
2019
- 2019-04-19 EP EP19788294.7A patent/EP3781203A4/en not_active Withdrawn
- 2019-04-19 CN CN201980031824.6A patent/CN112512572B/en active Active
- 2019-04-19 JP JP2020558040A patent/JP2021521804A/en active Pending
- 2019-04-19 KR KR1020207033043A patent/KR20210005082A/en not_active Withdrawn
- 2019-04-19 US US17/048,954 patent/US11976123B2/en active Active
- 2019-04-19 WO PCT/US2019/028364 patent/WO2019204756A1/en not_active Ceased
- 2019-04-19 CA CA3097007A patent/CA3097007A1/en active Pending
- 2019-04-19 AU AU2019255781A patent/AU2019255781A1/en not_active Abandoned
Patent Citations (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7193064B2 (en) | 2001-04-27 | 2007-03-20 | Kirin Beer Kabushiki Kaisha | Anti-CD40 monoclonal antibody |
| WO2003040170A2 (en) | 2001-11-09 | 2003-05-15 | Pfizer Products Inc. | Antibodies to cd40 |
| US20120263732A1 (en) | 2003-12-22 | 2012-10-18 | Pfizer Inc. | Cd40 antibody formulation and methods |
| US20070148163A1 (en) | 2003-12-25 | 2007-06-28 | Kirin Beer Kabushiki Kaisha | Mutants of anti-cd40 antibody |
| WO2007066082A1 (en) | 2005-12-09 | 2007-06-14 | Ucb Pharma S.A. | Antibody molecules having specificity for human il-6 |
| US20080085531A1 (en) | 2006-05-09 | 2008-04-10 | Pangenetics B.V. | Antagonistic anti-human CD40 monoclonal antibody |
| WO2008091954A2 (en) | 2007-01-23 | 2008-07-31 | Xencor, Inc. | Optimized cd40 antibodies and methods of using the same |
| US9234044B2 (en) | 2009-04-20 | 2016-01-12 | Kyowa Hakko Kirin Co., Ltd | Agonistic anti-CD40 IGG2 antibodies having amino acid mutations introduced therein |
| US20120294796A1 (en) | 2010-03-04 | 2012-11-22 | Macrogenics, Inc. | Antibodies Reactive with B7-H3 and Uses Thereof |
| WO2013034904A1 (en) | 2011-09-05 | 2013-03-14 | Alligator Bioscience Ab | Anti-cd40 antibodies, uses and methods |
| WO2014065402A1 (en) | 2012-10-26 | 2014-05-01 | 株式会社ペルセウスプロテオミクス | Anti-human cd40 monoclonal antibody, and use thereof |
| US20140120103A1 (en) | 2012-10-30 | 2014-05-01 | Apexigen, Inc. | Anti-cd40 antibodies and methods of use |
| US20160017040A1 (en) | 2013-03-14 | 2016-01-21 | Genentech, Inc. | Anti-b7-h4 antibodies and immunoconjugates |
| WO2016028810A1 (en) | 2014-08-18 | 2016-02-25 | Biogen Ma Inc. | Anti-cd40 antibodies and uses thereof |
| WO2016177771A1 (en) | 2015-05-04 | 2016-11-10 | Apogenix Ag | Single-chain cd40-receptor agonist proteins |
| WO2017004016A1 (en) | 2015-06-29 | 2017-01-05 | The Rockefeller University | Antibodies to cd40 with enhanced agonist activity |
| US20180346569A1 (en) | 2015-11-18 | 2018-12-06 | Lyvgen Biopharma Holdings Limited | Anti-pd-1 antibodies and therapeutic uses thereof |
| US20190010233A1 (en) | 2016-01-04 | 2019-01-10 | Pharmaexplorer Limited | Anti-pd-l1 antibodies and uses thereof |
| US20170253659A1 (en) * | 2016-03-04 | 2017-09-07 | The Rockefeller University | Antibodies to cd40 with enhanced agonist activity |
| WO2017151176A1 (en) | 2016-03-04 | 2017-09-08 | The Rockefeller University | Antibodies to cd40 with enhanced agonist activity |
| US20180066053A1 (en) | 2016-04-18 | 2018-03-08 | Celldex Therapeutics, Inc. | Agonistic antibodies that bind human cd40 and uses thereof |
| WO2017205742A1 (en) | 2016-05-27 | 2017-11-30 | Abbvie Biotherapeutics Inc. | Anti-cd40 antibodies and their uses |
| WO2018144955A1 (en) | 2017-02-02 | 2018-08-09 | Silverback Therapeutics, Inc. | Construct-peptide compositions and methods of use thereof |
| WO2020065409A2 (en) | 2018-09-28 | 2020-04-02 | Lyvgen Biopharma Co., Ltd. | Anti-cd40 binding molecules having engineered fc domains and therapeutic uses thereof |
| WO2021081303A1 (en) | 2019-10-23 | 2021-04-29 | Lyvgen Biopharma (Suzhou) Co., Ltd. | Anti-cd40 binding molecules and bi-specific antibodies comprising such |
Non-Patent Citations (10)
| Title |
|---|
| [No Author Listed], GenBank Accession No. CAF28444.1. Jul. 26, 2016. 2 pages. |
| Bjorck et al., The CD40 agonistic monoclonal antibody APX005M has potent immune stimulatory capabilities. J ImmunoTherapy Cancer. Nov. 4-8, 2015;3:p. 198. |
| Brown et al. Tolerance of single, but not multiple, amino acid replacements in antibody VH CDR 2: a means of minimizing B cell wastage from somatic hypermutation? J. Immuno. May 1996, 3285-91. (Year: 1996). * |
| Li et al., Inhibitory Fcγ receptor engagement drives adjuvant and anti-tumor activities of agonistic CD40 antibodies. Science. Aug. 19, 2011;333(6045):1030-4. |
| Ma et al., Abstract 4936: Combination CD40 agonist and PD-1 antagonist antibody therapy enhances vaccine induced T cell responses in non-immunogenic cancers. Cancer Res. Jul. 1, 2018;78(13 Supplement):4936(1-2). |
| Paul, Fundamental Immunology, 3rd Edition, 1993, pp. 292-295. (Year: 1993). * |
| Rudikoff et al Single amino acid substitution altering antigen-binding specificity. Proc Natl Acad Sci U S A. Mar. 1982;79(6):1979-83. (Year: 1982). * |
| Strohl, Optimization of Fc-mediated effector functions of monoclonal antibodies. Curr Opin Biotechnol. Dec. 2009;20(6):685-91. Epub Nov. 4, 2009. |
| U.S. Appl. No. 17/206,685, filed Mar. 19, 2021, Wang et al. |
| Vajdos et al. Comprehensive functional maps of the antigen-binding site of an anti-ErbB2 antibody obtained with shotgun scanning mutagenesis. J. Mol. Biol. Jul. 5, 2002, 320(2):415-28. (Year: 2002). * |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20210005082A (en) | 2021-01-13 |
| AU2019255781A1 (en) | 2020-10-29 |
| CN112512572A (en) | 2021-03-16 |
| CA3097007A1 (en) | 2019-10-24 |
| EP3781203A4 (en) | 2022-04-13 |
| WO2019204756A1 (en) | 2019-10-24 |
| JP2021521804A (en) | 2021-08-30 |
| US20210179727A1 (en) | 2021-06-17 |
| EP3781203A1 (en) | 2021-02-24 |
| CN112512572B (en) | 2024-12-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11505615B2 (en) | Anti-CD137 antibodies and uses thereof | |
| US20220372155A1 (en) | Anti-cd40 binding molecules and bi-specific antibodies comprising such | |
| AU2019349874A1 (en) | Anti-CD40 binding molecules having engineered Fc domains and therapeutic uses thereof | |
| AU2018244574A1 (en) | Therapeutic agents and methods for enhancing immune responses in tumor microenvironment | |
| WO2020069382A1 (en) | Anti-cd137 binding molecules having engineered fc domains and therapeutic uses thereof | |
| US20220081487A1 (en) | Anti-cd40 binding molecules having engineered fc domains and therapeutic uses thereof | |
| US20240218069A1 (en) | Bi-specific antibodies comprising anti-b7h3 binding molecules | |
| US11976123B2 (en) | Anti-CD40 antibodies and uses thereof | |
| US20240336683A1 (en) | Antibodies specific to sialic acid-binding ig-like lectin 15 and uses thereof | |
| CA3150462A1 (en) | Anti-cd19 antibodies and uses thereof | |
| US20230406950A1 (en) | Bi-specific antibodies comprising anti-cd137 binding molecules | |
| WO2014204898A1 (en) | Use of il-20 antagonists for alleviating obesity |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: LYVGEN BIOPHARMA CO. LTD., CHINA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:WANG, JIEYI;WU, YI;REEL/FRAME:054099/0620 Effective date: 20190606 |
|
| FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: APPLICATION UNDERGOING PREEXAM PROCESSING |
|
| FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY |
|
| AS | Assignment |
Owner name: LYVGEN BIOPHARMA HOLDINGS LIMITED, CAYMAN ISLANDS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:LYVGEN BIOPHARMA CO., LTD.;REEL/FRAME:059416/0726 Effective date: 20211115 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED |
|
| STCF | Information on status: patent grant |
Free format text: PATENTED CASE |

