US11904004B2 - Anti-CD277 antibodies - Google Patents
Anti-CD277 antibodies Download PDFInfo
- Publication number
- US11904004B2 US11904004B2 US16/896,556 US202016896556A US11904004B2 US 11904004 B2 US11904004 B2 US 11904004B2 US 202016896556 A US202016896556 A US 202016896556A US 11904004 B2 US11904004 B2 US 11904004B2
- Authority
- US
- United States
- Prior art keywords
- cells
- antibody
- mab
- seq
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active, expires
Links
- 210000004027 cell Anatomy 0.000 claims description 167
- 230000014509 gene expression Effects 0.000 claims description 96
- 238000000034 method Methods 0.000 claims description 42
- 150000007523 nucleic acids Chemical class 0.000 claims description 29
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 27
- 210000004408 hybridoma Anatomy 0.000 claims description 27
- 108020004707 nucleic acids Proteins 0.000 claims description 26
- 102000039446 nucleic acids Human genes 0.000 claims description 26
- 239000013604 expression vector Substances 0.000 claims description 21
- LWGJTAZLEJHCPA-UHFFFAOYSA-N n-(2-chloroethyl)-n-nitrosomorpholine-4-carboxamide Chemical compound ClCCN(N=O)C(=O)N1CCOCC1 LWGJTAZLEJHCPA-UHFFFAOYSA-N 0.000 claims description 21
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 18
- 238000004519 manufacturing process Methods 0.000 claims description 15
- 241001529936 Murinae Species 0.000 claims description 7
- 238000012258 culturing Methods 0.000 claims description 5
- 210000001744 T-lymphocyte Anatomy 0.000 abstract description 235
- 210000001616 monocyte Anatomy 0.000 abstract description 44
- 230000000694 effects Effects 0.000 abstract description 39
- 230000001461 cytolytic effect Effects 0.000 abstract description 24
- 210000004443 dendritic cell Anatomy 0.000 abstract description 23
- 230000004083 survival effect Effects 0.000 abstract description 20
- 230000004940 costimulation Effects 0.000 abstract description 11
- 238000002560 therapeutic procedure Methods 0.000 abstract description 5
- 101000984934 Homo sapiens Butyrophilin subfamily 3 member A1 Proteins 0.000 description 126
- 102100027138 Butyrophilin subfamily 3 member A1 Human genes 0.000 description 124
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 67
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 66
- 230000009089 cytolysis Effects 0.000 description 62
- 108090000623 proteins and genes Proteins 0.000 description 62
- 230000006870 function Effects 0.000 description 46
- 210000000822 natural killer cell Anatomy 0.000 description 46
- 241000282414 Homo sapiens Species 0.000 description 45
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 38
- 102000004169 proteins and genes Human genes 0.000 description 37
- 235000018102 proteins Nutrition 0.000 description 36
- 230000000638 stimulation Effects 0.000 description 36
- 238000011282 treatment Methods 0.000 description 32
- 230000004913 activation Effects 0.000 description 31
- 235000001014 amino acid Nutrition 0.000 description 31
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 30
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 30
- 206010028980 Neoplasm Diseases 0.000 description 29
- 229940024606 amino acid Drugs 0.000 description 28
- 150000001413 amino acids Chemical class 0.000 description 28
- 230000027455 binding Effects 0.000 description 25
- 230000016396 cytokine production Effects 0.000 description 25
- 230000001404 mediated effect Effects 0.000 description 24
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 24
- 230000035755 proliferation Effects 0.000 description 24
- 239000000427 antigen Substances 0.000 description 22
- 108091007433 antigens Proteins 0.000 description 22
- 102000036639 antigens Human genes 0.000 description 22
- 108091008874 T cell receptors Proteins 0.000 description 21
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 21
- 102000005962 receptors Human genes 0.000 description 20
- 108020003175 receptors Proteins 0.000 description 20
- 102000000588 Interleukin-2 Human genes 0.000 description 19
- 239000000556 agonist Substances 0.000 description 19
- 108010002350 Interleukin-2 Proteins 0.000 description 18
- 201000011510 cancer Diseases 0.000 description 18
- 239000012636 effector Substances 0.000 description 18
- 102000004127 Cytokines Human genes 0.000 description 17
- 108090000695 Cytokines Proteins 0.000 description 17
- 238000002474 experimental method Methods 0.000 description 17
- 239000000203 mixture Substances 0.000 description 17
- 239000013598 vector Substances 0.000 description 17
- 102100027155 Butyrophilin subfamily 3 member A2 Human genes 0.000 description 16
- 241000699666 Mus <mouse, genus> Species 0.000 description 16
- 239000003446 ligand Substances 0.000 description 16
- 238000012360 testing method Methods 0.000 description 16
- XRASPMIURGNCCH-UHFFFAOYSA-N zoledronic acid Chemical compound OP(=O)(O)C(P(O)(O)=O)(O)CN1C=CN=C1 XRASPMIURGNCCH-UHFFFAOYSA-N 0.000 description 16
- 229960004276 zoledronic acid Drugs 0.000 description 16
- 238000004458 analytical method Methods 0.000 description 15
- 238000003556 assay Methods 0.000 description 15
- 238000000684 flow cytometry Methods 0.000 description 15
- 208000037581 Persistent Infection Diseases 0.000 description 14
- 108010029485 Protein Isoforms Proteins 0.000 description 14
- 102000001708 Protein Isoforms Human genes 0.000 description 14
- 239000011324 bead Substances 0.000 description 14
- 230000000139 costimulatory effect Effects 0.000 description 14
- 230000001965 increasing effect Effects 0.000 description 14
- 239000002953 phosphate buffered saline Substances 0.000 description 14
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 13
- YKAYCWPQDPILSA-UHFFFAOYSA-N bromohydrin pyrophosphate Chemical compound BrCC(O)(C)CCOP(O)(=O)OP(O)(O)=O YKAYCWPQDPILSA-UHFFFAOYSA-N 0.000 description 13
- 239000000243 solution Substances 0.000 description 13
- 241000699670 Mus sp. Species 0.000 description 12
- 239000004698 Polyethylene Substances 0.000 description 12
- 230000006044 T cell activation Effects 0.000 description 12
- 239000012634 fragment Substances 0.000 description 12
- 108010007457 Extracellular Signal-Regulated MAP Kinases Proteins 0.000 description 11
- 108010074328 Interferon-gamma Proteins 0.000 description 11
- 102100024193 Mitogen-activated protein kinase 1 Human genes 0.000 description 11
- 238000005516 engineering process Methods 0.000 description 11
- 238000011534 incubation Methods 0.000 description 11
- 238000010186 staining Methods 0.000 description 11
- 239000012099 Alexa Fluor family Substances 0.000 description 10
- 108020004414 DNA Proteins 0.000 description 10
- 108060003951 Immunoglobulin Proteins 0.000 description 10
- 101710120708 Selection and upkeep of intraepithelial T-cells protein 1 Proteins 0.000 description 10
- 230000003013 cytotoxicity Effects 0.000 description 10
- 231100000135 cytotoxicity Toxicity 0.000 description 10
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 10
- 102000018358 immunoglobulin Human genes 0.000 description 10
- 230000026731 phosphorylation Effects 0.000 description 10
- 238000006366 phosphorylation reaction Methods 0.000 description 10
- 108090000765 processed proteins & peptides Proteins 0.000 description 10
- -1 BT2.3 Proteins 0.000 description 9
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 9
- 102100037850 Interferon gamma Human genes 0.000 description 9
- 101100519207 Mus musculus Pdcd1 gene Proteins 0.000 description 9
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 9
- 210000000612 antigen-presenting cell Anatomy 0.000 description 9
- 230000033228 biological regulation Effects 0.000 description 9
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 9
- 210000004698 lymphocyte Anatomy 0.000 description 9
- 229920001184 polypeptide Polymers 0.000 description 9
- 230000003389 potentiating effect Effects 0.000 description 9
- 238000002360 preparation method Methods 0.000 description 9
- 102000004196 processed proteins & peptides Human genes 0.000 description 9
- 230000001105 regulatory effect Effects 0.000 description 9
- 230000028327 secretion Effects 0.000 description 9
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 8
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 8
- 229940045513 CTLA4 antagonist Drugs 0.000 description 8
- 101000984917 Homo sapiens Butyrophilin subfamily 3 member A2 Proteins 0.000 description 8
- 101001023379 Homo sapiens Lysosome-associated membrane glycoprotein 1 Proteins 0.000 description 8
- 102100035133 Lysosome-associated membrane glycoprotein 1 Human genes 0.000 description 8
- 239000012980 RPMI-1640 medium Substances 0.000 description 8
- 230000006052 T cell proliferation Effects 0.000 description 8
- 125000000539 amino acid group Chemical group 0.000 description 8
- 210000004102 animal cell Anatomy 0.000 description 8
- 230000007423 decrease Effects 0.000 description 8
- 210000001165 lymph node Anatomy 0.000 description 8
- 229960005486 vaccine Drugs 0.000 description 8
- 101000984916 Homo sapiens Butyrophilin subfamily 3 member A3 Proteins 0.000 description 7
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 7
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 7
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 7
- 241001465754 Metazoa Species 0.000 description 7
- 241000288906 Primates Species 0.000 description 7
- 241000283984 Rodentia Species 0.000 description 7
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 7
- 210000003719 b-lymphocyte Anatomy 0.000 description 7
- 150000001875 compounds Chemical class 0.000 description 7
- 230000000875 corresponding effect Effects 0.000 description 7
- 238000004132 cross linking Methods 0.000 description 7
- 238000001514 detection method Methods 0.000 description 7
- 238000003745 diagnosis Methods 0.000 description 7
- 231100000673 dose–response relationship Toxicity 0.000 description 7
- 239000002158 endotoxin Substances 0.000 description 7
- 238000000338 in vitro Methods 0.000 description 7
- 230000002401 inhibitory effect Effects 0.000 description 7
- 210000001519 tissue Anatomy 0.000 description 7
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical group COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 6
- 208000023275 Autoimmune disease Diseases 0.000 description 6
- 241000894006 Bacteria Species 0.000 description 6
- 102100027154 Butyrophilin subfamily 3 member A3 Human genes 0.000 description 6
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 6
- 241000124008 Mammalia Species 0.000 description 6
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 6
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- 102000002689 Toll-like receptor Human genes 0.000 description 6
- 108020000411 Toll-like receptor Proteins 0.000 description 6
- 230000003213 activating effect Effects 0.000 description 6
- 230000006907 apoptotic process Effects 0.000 description 6
- 230000001472 cytotoxic effect Effects 0.000 description 6
- 238000002784 cytotoxicity assay Methods 0.000 description 6
- 231100000263 cytotoxicity test Toxicity 0.000 description 6
- 201000010099 disease Diseases 0.000 description 6
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 230000013595 glycosylation Effects 0.000 description 6
- 238000006206 glycosylation reaction Methods 0.000 description 6
- 230000003834 intracellular effect Effects 0.000 description 6
- 238000002372 labelling Methods 0.000 description 6
- 244000005700 microbiome Species 0.000 description 6
- 239000013612 plasmid Substances 0.000 description 6
- 150000003839 salts Chemical class 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- 238000007619 statistical method Methods 0.000 description 6
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 238000002965 ELISA Methods 0.000 description 5
- 239000004593 Epoxy Substances 0.000 description 5
- 241000206602 Eukaryota Species 0.000 description 5
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 5
- 208000009329 Graft vs Host Disease Diseases 0.000 description 5
- 108010058597 HLA-DR Antigens Proteins 0.000 description 5
- 102000006354 HLA-DR Antigens Human genes 0.000 description 5
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 5
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 5
- 229930040373 Paraformaldehyde Natural products 0.000 description 5
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 5
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 5
- 238000011529 RT qPCR Methods 0.000 description 5
- 230000005867 T cell response Effects 0.000 description 5
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 5
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 5
- 241000700605 Viruses Species 0.000 description 5
- 230000000735 allogeneic effect Effects 0.000 description 5
- 239000005557 antagonist Substances 0.000 description 5
- 230000000259 anti-tumor effect Effects 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 150000001720 carbohydrates Chemical group 0.000 description 5
- 230000004069 differentiation Effects 0.000 description 5
- 239000006185 dispersion Substances 0.000 description 5
- 239000003623 enhancer Substances 0.000 description 5
- 210000001280 germinal center Anatomy 0.000 description 5
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 239000002609 medium Substances 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 239000008194 pharmaceutical composition Substances 0.000 description 5
- 239000004033 plastic Substances 0.000 description 5
- 229920003023 plastic Polymers 0.000 description 5
- 239000013641 positive control Substances 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 230000035945 sensitivity Effects 0.000 description 5
- 230000019491 signal transduction Effects 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 230000005883 trogocytosis Effects 0.000 description 5
- 238000001262 western blot Methods 0.000 description 5
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 4
- 102100027207 CD27 antigen Human genes 0.000 description 4
- 206010057248 Cell death Diseases 0.000 description 4
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 4
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 description 4
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 4
- 101000934738 Homo sapiens Butyrophilin-like protein 2 Proteins 0.000 description 4
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 4
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 4
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 4
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 4
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 4
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- 239000004365 Protease Substances 0.000 description 4
- 108020004511 Recombinant DNA Proteins 0.000 description 4
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 4
- 206010070834 Sensitisation Diseases 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- 239000007864 aqueous solution Substances 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 238000012512 characterization method Methods 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 230000006690 co-activation Effects 0.000 description 4
- 238000003501 co-culture Methods 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- 230000003247 decreasing effect Effects 0.000 description 4
- 238000011156 evaluation Methods 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 210000002443 helper t lymphocyte Anatomy 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 239000003018 immunosuppressive agent Substances 0.000 description 4
- 229940125721 immunosuppressive agent Drugs 0.000 description 4
- 230000002147 killing effect Effects 0.000 description 4
- 239000002502 liposome Substances 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 229920002866 paraformaldehyde Polymers 0.000 description 4
- 230000001575 pathological effect Effects 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 230000008313 sensitization Effects 0.000 description 4
- 235000000346 sugar Nutrition 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 238000002054 transplantation Methods 0.000 description 4
- 230000001960 triggered effect Effects 0.000 description 4
- YXHLJMWYDTXDHS-IRFLANFNSA-N 7-aminoactinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=C(N)C=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 YXHLJMWYDTXDHS-IRFLANFNSA-N 0.000 description 3
- 108700012813 7-aminoactinomycin D Proteins 0.000 description 3
- 108090000672 Annexin A5 Proteins 0.000 description 3
- 102000004121 Annexin A5 Human genes 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 3
- 208000035143 Bacterial infection Diseases 0.000 description 3
- 102100025429 Butyrophilin-like protein 2 Human genes 0.000 description 3
- 108010017533 Butyrophilins Proteins 0.000 description 3
- 102000004555 Butyrophilins Human genes 0.000 description 3
- 102100031658 C-X-C chemokine receptor type 5 Human genes 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 108010087819 Fc receptors Proteins 0.000 description 3
- 102000009109 Fc receptors Human genes 0.000 description 3
- 206010017533 Fungal infection Diseases 0.000 description 3
- 101000922405 Homo sapiens C-X-C chemokine receptor type 5 Proteins 0.000 description 3
- 101100005713 Homo sapiens CD4 gene Proteins 0.000 description 3
- 101000599852 Homo sapiens Intercellular adhesion molecule 1 Proteins 0.000 description 3
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 3
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 3
- 101000669447 Homo sapiens Toll-like receptor 4 Proteins 0.000 description 3
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 3
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 3
- 102000003814 Interleukin-10 Human genes 0.000 description 3
- 108090000174 Interleukin-10 Proteins 0.000 description 3
- 208000030289 Lymphoproliferative disease Diseases 0.000 description 3
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 3
- 208000031888 Mycoses Diseases 0.000 description 3
- 230000006051 NK cell activation Effects 0.000 description 3
- 102000002356 Nectin Human genes 0.000 description 3
- 108060005251 Nectin Proteins 0.000 description 3
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 3
- 240000007817 Olea europaea Species 0.000 description 3
- 208000030852 Parasitic disease Diseases 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 102100039360 Toll-like receptor 4 Human genes 0.000 description 3
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 3
- 208000036142 Viral infection Diseases 0.000 description 3
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 3
- 230000001640 apoptogenic effect Effects 0.000 description 3
- 239000012736 aqueous medium Substances 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 208000022362 bacterial infectious disease Diseases 0.000 description 3
- 210000001185 bone marrow Anatomy 0.000 description 3
- 150000001768 cations Chemical class 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 230000008878 coupling Effects 0.000 description 3
- 238000010168 coupling process Methods 0.000 description 3
- 238000005859 coupling reaction Methods 0.000 description 3
- 238000004163 cytometry Methods 0.000 description 3
- 231100000433 cytotoxic Toxicity 0.000 description 3
- 230000002950 deficient Effects 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 208000035475 disorder Diseases 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 238000002825 functional assay Methods 0.000 description 3
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 3
- 208000024908 graft versus host disease Diseases 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 230000001506 immunosuppresive effect Effects 0.000 description 3
- 238000009169 immunotherapy Methods 0.000 description 3
- 230000006698 induction Effects 0.000 description 3
- 206010022000 influenza Diseases 0.000 description 3
- 238000001802 infusion Methods 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 238000010212 intracellular staining Methods 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 208000032839 leukemia Diseases 0.000 description 3
- 208000019420 lymphoid neoplasm Diseases 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 201000006512 mast cell neoplasm Diseases 0.000 description 3
- 208000006971 mastocytoma Diseases 0.000 description 3
- 239000010445 mica Substances 0.000 description 3
- 229910052618 mica group Inorganic materials 0.000 description 3
- 239000002105 nanoparticle Substances 0.000 description 3
- 238000013081 phylogenetic analysis Methods 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 238000011533 pre-incubation Methods 0.000 description 3
- 230000002265 prevention Effects 0.000 description 3
- 238000003753 real-time PCR Methods 0.000 description 3
- 206010039073 rheumatoid arthritis Diseases 0.000 description 3
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 230000002103 transcriptional effect Effects 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- 230000003827 upregulation Effects 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 108010074708 B7-H1 Antigen Proteins 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- 208000026310 Breast neoplasm Diseases 0.000 description 2
- 208000011691 Burkitt lymphomas Diseases 0.000 description 2
- 101710185679 CD276 antigen Proteins 0.000 description 2
- 102100038078 CD276 antigen Human genes 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 108010012236 Chemokines Proteins 0.000 description 2
- 102000019034 Chemokines Human genes 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 2
- 229930105110 Cyclosporin A Natural products 0.000 description 2
- 108010036949 Cyclosporine Proteins 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- 206010011968 Decreased immune responsiveness Diseases 0.000 description 2
- 206010061818 Disease progression Diseases 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 2
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 2
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 101000984929 Homo sapiens Butyrophilin subfamily 1 member A1 Proteins 0.000 description 2
- 101000746373 Homo sapiens Granulocyte-macrophage colony-stimulating factor Proteins 0.000 description 2
- 101000604993 Homo sapiens Lysosome-associated membrane glycoprotein 2 Proteins 0.000 description 2
- 101000831496 Homo sapiens Toll-like receptor 3 Proteins 0.000 description 2
- 101000669402 Homo sapiens Toll-like receptor 7 Proteins 0.000 description 2
- 101000607306 Homo sapiens UL16-binding protein 1 Proteins 0.000 description 2
- 101000607320 Homo sapiens UL16-binding protein 2 Proteins 0.000 description 2
- 102000003839 Human Proteins Human genes 0.000 description 2
- 108090000144 Human Proteins Proteins 0.000 description 2
- 208000022361 Human papillomavirus infectious disease Diseases 0.000 description 2
- 102100034980 ICOS ligand Human genes 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 102000008070 Interferon-gamma Human genes 0.000 description 2
- 102000013462 Interleukin-12 Human genes 0.000 description 2
- 108010065805 Interleukin-12 Proteins 0.000 description 2
- 102000003812 Interleukin-15 Human genes 0.000 description 2
- 108090000172 Interleukin-15 Proteins 0.000 description 2
- 102000004890 Interleukin-8 Human genes 0.000 description 2
- 108090001007 Interleukin-8 Proteins 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 102100038225 Lysosome-associated membrane glycoprotein 2 Human genes 0.000 description 2
- 102000043136 MAP kinase family Human genes 0.000 description 2
- 108091054455 MAP kinase family Proteins 0.000 description 2
- 108091054437 MHC class I family Proteins 0.000 description 2
- 102000043129 MHC class I family Human genes 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 description 2
- 230000004988 N-glycosylation Effects 0.000 description 2
- 102000057297 Pepsin A Human genes 0.000 description 2
- 108090000284 Pepsin A Proteins 0.000 description 2
- 201000005702 Pertussis Diseases 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 102100029740 Poliovirus receptor Human genes 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 108010093965 Polymyxin B Proteins 0.000 description 2
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 2
- 208000024313 Testicular Neoplasms Diseases 0.000 description 2
- 102100024324 Toll-like receptor 3 Human genes 0.000 description 2
- 102100039390 Toll-like receptor 7 Human genes 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 2
- 102100040012 UL16-binding protein 1 Human genes 0.000 description 2
- 102100039989 UL16-binding protein 2 Human genes 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 230000000719 anti-leukaemic effect Effects 0.000 description 2
- 210000000628 antibody-producing cell Anatomy 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229940009098 aspartate Drugs 0.000 description 2
- 239000012298 atmosphere Substances 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 210000004970 cd4 cell Anatomy 0.000 description 2
- 230000024245 cell differentiation Effects 0.000 description 2
- 230000003915 cell function Effects 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 229960001265 ciclosporin Drugs 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 230000001186 cumulative effect Effects 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 230000005750 disease progression Effects 0.000 description 2
- 239000002612 dispersion medium Substances 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 230000003325 follicular Effects 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 238000011990 functional testing Methods 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 238000003633 gene expression assay Methods 0.000 description 2
- 238000003197 gene knockdown Methods 0.000 description 2
- 238000012637 gene transfection Methods 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 208000006454 hepatitis Diseases 0.000 description 2
- 239000000833 heterodimer Substances 0.000 description 2
- 102000046157 human CSF2 Human genes 0.000 description 2
- 230000003463 hyperproliferative effect Effects 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 230000002452 interceptive effect Effects 0.000 description 2
- 229960003130 interferon gamma Drugs 0.000 description 2
- 229940117681 interleukin-12 Drugs 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000010253 intravenous injection Methods 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 238000012417 linear regression Methods 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- 210000005210 lymphoid organ Anatomy 0.000 description 2
- 210000003563 lymphoid tissue Anatomy 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- 230000036210 malignancy Effects 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 230000001613 neoplastic effect Effects 0.000 description 2
- 238000010606 normalization Methods 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 238000004806 packaging method and process Methods 0.000 description 2
- 230000003071 parasitic effect Effects 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 229940111202 pepsin Drugs 0.000 description 2
- 210000005259 peripheral blood Anatomy 0.000 description 2
- 239000011886 peripheral blood Substances 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 229940115272 polyinosinic:polycytidylic acid Drugs 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 229920000024 polymyxin B Polymers 0.000 description 2
- 229960005266 polymyxin b Drugs 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000003757 reverse transcription PCR Methods 0.000 description 2
- 201000000306 sarcoidosis Diseases 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- YEENEYXBHNNNGV-XEHWZWQGSA-M sodium;3-acetamido-5-[acetyl(methyl)amino]-2,4,6-triiodobenzoate;(2r,3r,4s,5s,6r)-2-[(2r,3s,4s,5r)-3,4-dihydroxy-2,5-bis(hydroxymethyl)oxolan-2-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound [Na+].CC(=O)N(C)C1=C(I)C(NC(C)=O)=C(I)C(C([O-])=O)=C1I.O[C@H]1[C@H](O)[C@@H](CO)O[C@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 YEENEYXBHNNNGV-XEHWZWQGSA-M 0.000 description 2
- 230000002269 spontaneous effect Effects 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 210000000130 stem cell Anatomy 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 230000002195 synergetic effect Effects 0.000 description 2
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- GETQZCLCWQTVFV-UHFFFAOYSA-N trimethylamine Chemical compound CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 2
- 201000002311 trypanosomiasis Diseases 0.000 description 2
- 229960004799 tryptophan Drugs 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- BHNQPLPANNDEGL-UHFFFAOYSA-N 2-(4-octylphenoxy)ethanol Chemical compound CCCCCCCCC1=CC=C(OCCO)C=C1 BHNQPLPANNDEGL-UHFFFAOYSA-N 0.000 description 1
- 125000000979 2-amino-2-oxoethyl group Chemical group [H]C([*])([H])C(=O)N([H])[H] 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 239000013607 AAV vector Substances 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 206010001513 AIDS related complex Diseases 0.000 description 1
- 208000026872 Addison Disease Diseases 0.000 description 1
- REAQAWSENITKJL-DDWPSWQVSA-N Ala-Met-Asp-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O REAQAWSENITKJL-DDWPSWQVSA-N 0.000 description 1
- 239000012114 Alexa Fluor 647 Substances 0.000 description 1
- 206010001935 American trypanosomiasis Diseases 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 1
- 208000032467 Aplastic anaemia Diseases 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- 201000002909 Aspergillosis Diseases 0.000 description 1
- 208000036641 Aspergillus infections Diseases 0.000 description 1
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 1
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 1
- 208000028564 B-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 108010045634 B7 Antigens Proteins 0.000 description 1
- 102000005738 B7 Antigens Human genes 0.000 description 1
- 238000009020 BCA Protein Assay Kit Methods 0.000 description 1
- 208000004429 Bacillary Dysentery Diseases 0.000 description 1
- 241000193738 Bacillus anthracis Species 0.000 description 1
- 208000023328 Basedow disease Diseases 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 208000003508 Botulism Diseases 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006500 Brucellosis Diseases 0.000 description 1
- 102100027140 Butyrophilin subfamily 1 member A1 Human genes 0.000 description 1
- 102100027157 Butyrophilin subfamily 2 member A1 Human genes 0.000 description 1
- 102100027156 Butyrophilin subfamily 2 member A2 Human genes 0.000 description 1
- 102100036301 C-C chemokine receptor type 7 Human genes 0.000 description 1
- 102100038077 CD226 antigen Human genes 0.000 description 1
- 206010051226 Campylobacter infection Diseases 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 206010007134 Candida infections Diseases 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 208000017897 Carcinoma of esophagus Diseases 0.000 description 1
- 231100000023 Cell-mediated cytotoxicity Toxicity 0.000 description 1
- 206010057250 Cell-mediated cytotoxicity Diseases 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 208000024699 Chagas disease Diseases 0.000 description 1
- 201000006082 Chickenpox Diseases 0.000 description 1
- 241001227713 Chiron Species 0.000 description 1
- 206010008631 Cholera Diseases 0.000 description 1
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 1
- 206010008909 Chronic Hepatitis Diseases 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- 241000223205 Coccidioides immitis Species 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 208000015943 Coeliac disease Diseases 0.000 description 1
- 208000009802 Colorado tick fever Diseases 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 201000007336 Cryptococcosis Diseases 0.000 description 1
- 241000221204 Cryptococcus neoformans Species 0.000 description 1
- 208000008953 Cryptosporidiosis Diseases 0.000 description 1
- 206010011502 Cryptosporidiosis infection Diseases 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- 101150074155 DHFR gene Proteins 0.000 description 1
- 241001269238 Data Species 0.000 description 1
- 208000001490 Dengue Diseases 0.000 description 1
- 206010012310 Dengue fever Diseases 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 238000008157 ELISA kit Methods 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 201000011001 Ebola Hemorrhagic Fever Diseases 0.000 description 1
- 208000030820 Ebola disease Diseases 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 206010014612 Encephalitis viral Diseases 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 102100036825 Erythroid membrane-associated protein Human genes 0.000 description 1
- 108010040476 FITC-annexin A5 Proteins 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 201000006353 Filariasis Diseases 0.000 description 1
- 208000007212 Foot-and-Mouth Disease Diseases 0.000 description 1
- 241000710198 Foot-and-mouth disease virus Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 206010017918 Gastroenteritis viral Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 206010018612 Gonorrhoea Diseases 0.000 description 1
- 208000024869 Goodpasture syndrome Diseases 0.000 description 1
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 1
- 108010064885 HLA-DR3 Antigen Proteins 0.000 description 1
- 206010066476 Haematological malignancy Diseases 0.000 description 1
- 208000001204 Hashimoto Disease Diseases 0.000 description 1
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 1
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 description 1
- 208000033981 Hereditary haemochromatosis Diseases 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 208000007514 Herpes zoster Diseases 0.000 description 1
- 201000002563 Histoplasmosis Diseases 0.000 description 1
- 101000690301 Homo sapiens Aldo-keto reductase family 1 member C4 Proteins 0.000 description 1
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 1
- 101000984926 Homo sapiens Butyrophilin subfamily 2 member A1 Proteins 0.000 description 1
- 101000716065 Homo sapiens C-C chemokine receptor type 7 Proteins 0.000 description 1
- 101000884298 Homo sapiens CD226 antigen Proteins 0.000 description 1
- 101000884279 Homo sapiens CD276 antigen Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101000851733 Homo sapiens Erythroid membrane-associated protein Proteins 0.000 description 1
- 101000640758 Homo sapiens General transcription factor IIF subunit 1 Proteins 0.000 description 1
- 101000640770 Homo sapiens General transcription factor IIF subunit 2 Proteins 0.000 description 1
- 101001019455 Homo sapiens ICOS ligand Proteins 0.000 description 1
- 101000599940 Homo sapiens Interferon gamma Proteins 0.000 description 1
- 101001076407 Homo sapiens Interleukin-1 receptor antagonist protein Proteins 0.000 description 1
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 1
- 101001002709 Homo sapiens Interleukin-4 Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 description 1
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 1
- 101000586618 Homo sapiens Poliovirus receptor Proteins 0.000 description 1
- 101001116548 Homo sapiens Protein CBFA2T1 Proteins 0.000 description 1
- 101000933542 Homo sapiens Transcription factor BTF3 Proteins 0.000 description 1
- 241000725303 Human immunodeficiency virus Species 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- 206010020850 Hyperthyroidism Diseases 0.000 description 1
- 101710093458 ICOS ligand Proteins 0.000 description 1
- 206010021245 Idiopathic thrombocytopenic purpura Diseases 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 102000053646 Inducible T-Cell Co-Stimulator Human genes 0.000 description 1
- 108700013161 Inducible T-Cell Co-Stimulator Proteins 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 108010066719 Interleukin Receptor Common gamma Subunit Proteins 0.000 description 1
- 102000018682 Interleukin Receptor Common gamma Subunit Human genes 0.000 description 1
- 102000013691 Interleukin-17 Human genes 0.000 description 1
- 101150069255 KLRC1 gene Proteins 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 241000235649 Kluyveromyces Species 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- LEVWYRKDKASIDU-IMJSIDKUSA-N L-cystine Chemical compound [O-]C(=O)[C@@H]([NH3+])CSSC[C@H]([NH3+])C([O-])=O LEVWYRKDKASIDU-IMJSIDKUSA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 206010023927 Lassa fever Diseases 0.000 description 1
- 208000004554 Leishmaniasis Diseases 0.000 description 1
- 206010024641 Listeriosis Diseases 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 206010024971 Lower respiratory tract infections Diseases 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 241000023320 Luma <angiosperm> Species 0.000 description 1
- 208000032376 Lung infection Diseases 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 108700005092 MHC Class II Genes Proteins 0.000 description 1
- 101100404845 Macaca mulatta NKG2A gene Proteins 0.000 description 1
- 208000007466 Male Infertility Diseases 0.000 description 1
- 208000000932 Marburg Virus Disease Diseases 0.000 description 1
- 201000011013 Marburg hemorrhagic fever Diseases 0.000 description 1
- 238000007476 Maximum Likelihood Methods 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 206010027202 Meningitis bacterial Diseases 0.000 description 1
- 206010027260 Meningitis viral Diseases 0.000 description 1
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 1
- 208000003250 Mixed connective tissue disease Diseases 0.000 description 1
- 229930191564 Monensin Natural products 0.000 description 1
- GAOZTHIDHYLHMS-UHFFFAOYSA-N Monensin A Natural products O1C(CC)(C2C(CC(O2)C2C(CC(C)C(O)(CO)O2)C)C)CCC1C(O1)(C)CCC21CC(O)C(C)C(C(C)C(OC)C(C)C(O)=O)O2 GAOZTHIDHYLHMS-UHFFFAOYSA-N 0.000 description 1
- 108090000143 Mouse Proteins Proteins 0.000 description 1
- 208000003445 Mouth Neoplasms Diseases 0.000 description 1
- 208000005647 Mumps Diseases 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 101000884277 Mus musculus CD276 antigen Proteins 0.000 description 1
- 101100341510 Mus musculus Itgal gene Proteins 0.000 description 1
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 1
- 206010028665 Myxoedema Diseases 0.000 description 1
- OVRNDRQMDRJTHS-CBQIKETKSA-N N-Acetyl-D-Galactosamine Chemical compound CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@H](O)[C@@H]1O OVRNDRQMDRJTHS-CBQIKETKSA-N 0.000 description 1
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 1
- MBLBDJOUHNCFQT-UHFFFAOYSA-N N-acetyl-D-galactosamine Natural products CC(=O)NC(C=O)C(O)C(O)C(O)CO MBLBDJOUHNCFQT-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 1
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 1
- 108091008877 NK cell receptors Proteins 0.000 description 1
- 102100022682 NKG2-A/NKG2-B type II integral membrane protein Human genes 0.000 description 1
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 description 1
- 229910020700 Na3VO4 Inorganic materials 0.000 description 1
- 108010004217 Natural Cytotoxicity Triggering Receptor 1 Proteins 0.000 description 1
- 102000010648 Natural Killer Cell Receptors Human genes 0.000 description 1
- 102100032870 Natural cytotoxicity triggering receptor 1 Human genes 0.000 description 1
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 1
- 101100058698 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) cln3 gene Proteins 0.000 description 1
- 241001263478 Norovirus Species 0.000 description 1
- 230000004989 O-glycosylation Effects 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 238000010222 PCR analysis Methods 0.000 description 1
- 238000002944 PCR assay Methods 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 206010034133 Pathogen resistance Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 206010034277 Pemphigoid Diseases 0.000 description 1
- 201000011152 Pemphigus Diseases 0.000 description 1
- 208000031845 Pernicious anaemia Diseases 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- 108010089430 Phosphoproteins Proteins 0.000 description 1
- 102000007982 Phosphoproteins Human genes 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 206010035148 Plague Diseases 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 206010035737 Pneumonia viral Diseases 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 241000282405 Pongo abelii Species 0.000 description 1
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 238000001190 Q-PCR Methods 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 206010037742 Rabies Diseases 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101100431670 Rattus norvegicus Ybx3 gene Proteins 0.000 description 1
- 208000033464 Reiter syndrome Diseases 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 101100378956 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) AMD2 gene Proteins 0.000 description 1
- 101100437920 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) BTN2 gene Proteins 0.000 description 1
- 101100480850 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) TDA3 gene Proteins 0.000 description 1
- 206010039438 Salmonella Infections Diseases 0.000 description 1
- 206010039587 Scarlet Fever Diseases 0.000 description 1
- 206010039710 Scleroderma Diseases 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 description 1
- 208000019802 Sexually transmitted disease Diseases 0.000 description 1
- 206010040550 Shigella infections Diseases 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 208000001203 Smallpox Diseases 0.000 description 1
- KEAYESYHFKHZAL-UHFFFAOYSA-N Sodium Chemical compound [Na] KEAYESYHFKHZAL-UHFFFAOYSA-N 0.000 description 1
- 206010072148 Stiff-Person syndrome Diseases 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- OUUQCZGPVNCOIJ-UHFFFAOYSA-M Superoxide Chemical compound [O-][O] OUUQCZGPVNCOIJ-UHFFFAOYSA-M 0.000 description 1
- 230000020385 T cell costimulation Effects 0.000 description 1
- 230000037453 T cell priming Effects 0.000 description 1
- 210000000662 T-lymphocyte subset Anatomy 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 206010043376 Tetanus Diseases 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 description 1
- 208000024799 Thyroid disease Diseases 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 201000005485 Toxoplasmosis Diseases 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 241000223109 Trypanosoma cruzi Species 0.000 description 1
- 239000006035 Tryptophane Substances 0.000 description 1
- 208000034784 Tularaemia Diseases 0.000 description 1
- 102100040247 Tumor necrosis factor Human genes 0.000 description 1
- 208000037386 Typhoid Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 206010046851 Uveitis Diseases 0.000 description 1
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 description 1
- 206010046980 Varicella Diseases 0.000 description 1
- 241000870995 Variola Species 0.000 description 1
- 241000700647 Variola virus Species 0.000 description 1
- 238000001793 Wilcoxon signed-rank test Methods 0.000 description 1
- 208000003152 Yellow Fever Diseases 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 210000001789 adipocyte Anatomy 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 125000003368 amide group Chemical group 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 210000004507 artificial chromosome Anatomy 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 230000003190 augmentative effect Effects 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 201000000448 autoimmune hemolytic anemia Diseases 0.000 description 1
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- 201000009904 bacterial meningitis Diseases 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 230000002051 biphasic effect Effects 0.000 description 1
- 239000002981 blocking agent Substances 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 206010006451 bronchitis Diseases 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 201000004927 campylobacteriosis Diseases 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 229940022399 cancer vaccine Drugs 0.000 description 1
- 201000003984 candidiasis Diseases 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000005890 cell-mediated cytotoxicity Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 239000011651 chromium Substances 0.000 description 1
- 229910052804 chromium Inorganic materials 0.000 description 1
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 201000003486 coccidioidomycosis Diseases 0.000 description 1
- 206010009887 colitis Diseases 0.000 description 1
- 229910000366 copper(II) sulfate Inorganic materials 0.000 description 1
- JZCCFEFSEZPSOG-UHFFFAOYSA-L copper(II) sulfate pentahydrate Chemical compound O.O.O.O.O.[Cu+2].[O-]S([O-])(=O)=O JZCCFEFSEZPSOG-UHFFFAOYSA-L 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 229930182912 cyclosporin Natural products 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 229960003067 cystine Drugs 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 230000022811 deglycosylation Effects 0.000 description 1
- 208000025729 dengue disease Diseases 0.000 description 1
- 238000000432 density-gradient centrifugation Methods 0.000 description 1
- 201000001981 dermatomyositis Diseases 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 230000008034 disappearance Effects 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 229910000397 disodium phosphate Inorganic materials 0.000 description 1
- 235000019800 disodium phosphate Nutrition 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 210000002308 embryonic cell Anatomy 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 206010014881 enterobiasis Diseases 0.000 description 1
- 208000028104 epidemic louse-borne typhus Diseases 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 208000006275 fascioliasis Diseases 0.000 description 1
- ZNOLGFHPUIJIMJ-UHFFFAOYSA-N fenitrothion Chemical compound COP(=S)(OC)OC1=CC=C([N+]([O-])=O)C(C)=C1 ZNOLGFHPUIJIMJ-UHFFFAOYSA-N 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 238000013467 fragmentation Methods 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 239000012458 free base Substances 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 239000012737 fresh medium Substances 0.000 description 1
- 210000004475 gamma-delta t lymphocyte Anatomy 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 102000054766 genetic haplotypes Human genes 0.000 description 1
- 201000006592 giardiasis Diseases 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 150000002338 glycosides Chemical class 0.000 description 1
- 208000001786 gonorrhea Diseases 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 230000003118 histopathologic effect Effects 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 102000052434 human BTN3A1 Human genes 0.000 description 1
- 102000046824 human IL1RN Human genes 0.000 description 1
- 102000055229 human IL4 Human genes 0.000 description 1
- 102000054751 human RUNX1T1 Human genes 0.000 description 1
- 210000003917 human chromosome Anatomy 0.000 description 1
- 210000004754 hybrid cell Anatomy 0.000 description 1
- 235000011167 hydrochloric acid Nutrition 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 150000004679 hydroxides Chemical class 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 1
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 238000002991 immunohistochemical analysis Methods 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 230000003259 immunoinhibitory effect Effects 0.000 description 1
- 238000012744 immunostaining Methods 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 201000008319 inclusion body myositis Diseases 0.000 description 1
- 201000001371 inclusion conjunctivitis Diseases 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 201000006747 infectious mononucleosis Diseases 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 210000005007 innate immune system Anatomy 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940076144 interleukin-10 Drugs 0.000 description 1
- 230000031261 interleukin-10 production Effects 0.000 description 1
- 230000019734 interleukin-12 production Effects 0.000 description 1
- 230000003996 interleukin-20 production Effects 0.000 description 1
- 229940096397 interleukin-8 Drugs 0.000 description 1
- XKTZWUACRZHVAN-VADRZIEHSA-N interleukin-8 Chemical compound C([C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@@H](NC(C)=O)CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N1[C@H](CCC1)C(=O)N1[C@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC(O)=CC=1)C(=O)N[C@H](CO)C(=O)N1[C@H](CCC1)C(N)=O)C1=CC=CC=C1 XKTZWUACRZHVAN-VADRZIEHSA-N 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- JJWLVOIRVHMVIS-UHFFFAOYSA-N isopropylamine Chemical compound CC(C)N JJWLVOIRVHMVIS-UHFFFAOYSA-N 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 238000011813 knockout mouse model Methods 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 231100000225 lethality Toxicity 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 201000002364 leukopenia Diseases 0.000 description 1
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 238000002826 magnetic-activated cell sorting Methods 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 210000003071 memory t lymphocyte Anatomy 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- OSWPMRLSEDHDFF-UHFFFAOYSA-N methyl salicylate Chemical compound COC(=O)C1=CC=CC=C1O OSWPMRLSEDHDFF-UHFFFAOYSA-N 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 239000003068 molecular probe Substances 0.000 description 1
- 229960005358 monensin Drugs 0.000 description 1
- GAOZTHIDHYLHMS-KEOBGNEYSA-N monensin A Chemical compound C([C@@](O1)(C)[C@H]2CC[C@@](O2)(CC)[C@H]2[C@H](C[C@@H](O2)[C@@H]2[C@H](C[C@@H](C)[C@](O)(CO)O2)C)C)C[C@@]21C[C@H](O)[C@@H](C)[C@@H]([C@@H](C)[C@@H](OC)[C@H](C)C(O)=O)O2 GAOZTHIDHYLHMS-KEOBGNEYSA-N 0.000 description 1
- 210000005087 mononuclear cell Anatomy 0.000 description 1
- 229910000403 monosodium phosphate Inorganic materials 0.000 description 1
- 235000019799 monosodium phosphate Nutrition 0.000 description 1
- 208000010805 mumps infectious disease Diseases 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 210000000066 myeloid cell Anatomy 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 229950006780 n-acetylglucosamine Drugs 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 201000009240 nasopharyngitis Diseases 0.000 description 1
- 230000012177 negative regulation of immune response Effects 0.000 description 1
- 230000005375 negative regulation of lymphocyte activation Effects 0.000 description 1
- 210000005170 neoplastic cell Anatomy 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 238000001543 one-way ANOVA Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 210000004789 organ system Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- VYNDHICBIRRPFP-UHFFFAOYSA-N pacific blue Chemical compound FC1=C(O)C(F)=C2OC(=O)C(C(=O)O)=CC2=C1 VYNDHICBIRRPFP-UHFFFAOYSA-N 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 239000000123 paper Substances 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 201000001976 pemphigus vulgaris Diseases 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 235000011007 phosphoric acid Nutrition 0.000 description 1
- 150000003016 phosphoric acids Chemical class 0.000 description 1
- 108091005981 phosphorylated proteins Proteins 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920000771 poly (alkylcyanoacrylate) Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M potassium chloride Inorganic materials [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 230000007112 pro inflammatory response Effects 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 238000000575 proteomic method Methods 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000013094 purity test Methods 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 208000002574 reactive arthritis Diseases 0.000 description 1
- 230000019908 regulation of T cell activation Effects 0.000 description 1
- 230000025915 regulation of apoptotic process Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 201000003068 rheumatic fever Diseases 0.000 description 1
- 201000005404 rubella Diseases 0.000 description 1
- 206010039447 salmonellosis Diseases 0.000 description 1
- 201000004409 schistosomiasis Diseases 0.000 description 1
- HOZOZZFCZRXYEK-HNHWXVNLSA-M scopolamine butylbromide Chemical compound [Br-].C1([C@@H](CO)C(=O)OC2C[C@@H]3[N+]([C@H](C2)[C@@H]2[C@H]3O2)(C)CCCC)=CC=CC=C1 HOZOZZFCZRXYEK-HNHWXVNLSA-M 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 201000005113 shigellosis Diseases 0.000 description 1
- 238000004904 shortening Methods 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 230000037436 splice-site mutation Effects 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000007801 sublethal irradiation Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 208000006379 syphilis Diseases 0.000 description 1
- 230000007474 system interaction Effects 0.000 description 1
- 238000012353 t test Methods 0.000 description 1
- 208000004441 taeniasis Diseases 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 208000005057 thyrotoxicosis Diseases 0.000 description 1
- 230000036962 time dependent Effects 0.000 description 1
- 201000004647 tinea pedis Diseases 0.000 description 1
- 230000024664 tolerance induction Effects 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 206010044325 trachoma Diseases 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000001296 transplacental effect Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 208000003982 trichinellosis Diseases 0.000 description 1
- ITMCEJHCFYSIIV-UHFFFAOYSA-N triflic acid Chemical compound OS(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-N 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- IHIXIJGXTJIKRB-UHFFFAOYSA-N trisodium vanadate Chemical compound [Na+].[Na+].[Na+].[O-][V]([O-])([O-])=O IHIXIJGXTJIKRB-UHFFFAOYSA-N 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 208000035408 type 1 diabetes mellitus 1 Diseases 0.000 description 1
- 201000008297 typhoid fever Diseases 0.000 description 1
- 206010061393 typhus Diseases 0.000 description 1
- 239000011882 ultra-fine particle Substances 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 239000002691 unilamellar liposome Substances 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 208000019206 urinary tract infection Diseases 0.000 description 1
- 239000012646 vaccine adjuvant Substances 0.000 description 1
- 229940124931 vaccine adjuvant Drugs 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 201000002498 viral encephalitis Diseases 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 201000010044 viral meningitis Diseases 0.000 description 1
- 208000009421 viral pneumonia Diseases 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 238000012447 xenograft mouse model Methods 0.000 description 1
- 238000002689 xenotransplantation Methods 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001129—Molecules with a "CD" designation not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
Definitions
- the invention relates to anti-CD277 antibodies and uses thereof.
- White blood cells are cells of the immune system involved in defending the body against pathogens. Among these cells, lymphocytes, monocytes, and dendritic cells can be cited. Monocytes may migrate from the bloodstream to other tissues and differentiate into tissue resident macrophages or dendritic cells. Dendritic cells play a role as antigen presenting cells (APC) that activate lymphocytes. Among lymphocytes, T cells can be divided into ⁇ T cells and ⁇ T cells.
- V ⁇ 9/V ⁇ 2 T cells are important effectors of the immune defence. They lyse directly pathogen infected or abnormal cells. In addition, they regulate immune responses by inducing dendritic cell (DC) maturation as well as the isotypic switching and immunoglobulin production. This important cell platform of the immune system is strictly regulated by surface receptors, chemokines and cytokines.
- T-cell activation is the result of two synergistic events.
- the first is the interaction between the receptor of T cell (TCR) and the major histocompatibility complex (MHC) conjugated with processed antigen on the surface of the antigen presenting cells (APC).
- the second event is a co-stimulatory antigen-independent signal involving B7 molecules.
- the lack of co-stimulatory signal induces anergy, i.e. the inhibition of T cells proliferation, cytokines secretion and cytotoxic activities.
- the study of these pathways may provide insight about the triggering of pathologic events, such as autoimmune or lymphoproliferative disorders.
- the B7 family is an extended group of costimulatory molecules (Coyle et al., 2001).
- B7-1 CD80
- B7-2 CD86
- their receptors are CD28, which leads to T cell activation (Linsley and Ledbetter, 1993, June, et al., 1994, Lenschow et al., 1996)
- CTLA-4 CD152
- the critical role of CD152 as a negative regulator of T cell activation is demonstrated by the occurrence of lymphoproliferative disorders in CTLA-4 deficient mice (Waterhouse et al., 1995).
- CD152 is expressed following T-lymphocyte activation and inhibits the cytolytic functions of CTL clones obtained following PHA stimulation or Ag selection (Saverino et al., 1998).
- B7-H1 (PD-L1, CD274) and B7-DC (PD-L2, CD273), whose receptor is PD-1 (CD279), proved to inhibit T-cell proliferation and cytokine secretion (Freeman et al., 2000, Latchman et al., 2001). Otherwise, different studies showed that PD-L1 and PD-L2 engagement increase T cell proliferation and IL-10 or IFN- ⁇ production (Dong et al., 1999, Freeman et al., 2000, Latchman et al., 2001, Chapoval et al., 2001, Tseng et al., 2001).
- B7-H2 B7-H2
- B7-H3, B7-H4 B7-H3 whose roles are not fully understood (Hutloff et al., 1999, Sun et al., 2002).
- BT butyrophilin
- Bt2 and Bt3 coding for a new group of co-stimulatory molecules belonging to the Ig superfamily (IgSF) (Williams and Barclay, 1988) and related to B7 family by sequence similarity analysis: in particular, it shows similarity with the Ig-V like extracellular domain of CD80 and CD86 (Linsley et al., 1992).
- IgSF Ig superfamily
- BT3.1 is also called BTF5 (Rhodes et al., 2001), or BTN3A1 (Ruddy et al., 1997), or more recently CD277 (Bensussan and Olive, 2005);
- BT3.2 is also called BTF4 (Rhodes et al., 2001), or BTN3A2 (Ruddy et al., 1997);
- BT3.3 appears also as BTF3 (Rhodes et al., 2001) or BTN3A3 (Ruddy et al., 1997).
- BT3 has two Ig-like extracellular domains that characterize the IgSF.
- b7 genes and MHC class I and II genes may have a common ancestral gene and could encode for proteins involved in similar function, such as T cell activation (Rhodes et al., 2001).
- BT3 molecules have been found on immune cells, such as T, B and NK cells, monocytes and dendritic cells as well as hematopoietic precursors and some neoplastic cell lines (Compte et al., 2004).
- the present invention relates to an anti-CD277 antibody, which activates or inhibits the cytolytic function, cytokine production and proliferation of V ⁇ 9/V ⁇ 2 T cells.
- the present invention also relates to an anti-CD277 antibody, which costimulates T cells together with CD3-TCR, and/or which costimulates T cells in addition to CD28-B7 costimulation.
- the present invention also relates to an anti-CD277 antibody, which increases the activity and/or survival of monocytes and dendritic cells.
- the antibody according to the invention is an anti-CD277 antibody, which:
- the present invention relates to an anti-CD277 antibody (chosen from mAbs 20.1, 7.2 and 103.2) which is obtainable from one of the hybridomas accessible under CNCM deposit number I-4401, I-4402 and I-4403.
- the invention also relates to an anti-CD277 antibody which comprises the CDRs of mAb 20.1.
- the invention also relates to an anti-CD277 antibody which comprises the CDRs of mAb 7.2.
- the invention also relates to an anti-CD277 antibody which comprises the CDRs of mAb 103.2.
- the invention also relates to an anti-CD277 antibody which comprises the CDRs of mAb 108.5.
- the invention also relates to one of the mAbs 20.1, 7.2 and 103.2, or a derivative thereof, for the use in therapy.
- the invention relates to one of the mAbs 20.1 and 7.2, or a derivative thereof, for use for the treatment of a cancer or a chronic infection.
- the invention relates to a vaccine for the treatment of a cancer or a chronic infection comprising one of the mAbs 20.1 and 7.2, or a derivative thereof.
- the invention relates to a kit for the treatment of a cancer or a chronic infection comprising:
- the invention relates to an anti-CD277 antibody as defined above for the use in therapy.
- the invention finally relates to an anti-CD277 antibody which inhibits the functions of V ⁇ 9/V ⁇ 2 T cells, particularly for use for the treatment of an autoimmune disease, transplantation rejection or a graft versus host disease.
- antibody or “immunoglobulin” have the same meaning, and will be used equally in the present invention.
- the term “antibody” as used herein refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that immunospecifically binds an antigen.
- the term antibody encompasses not only whole antibody molecules, but also antibody fragments or derivatives.
- Antibody fragments include but are not limited to Fv, Fab, F(ab′)2, Fab′, dsFv, scFv, Sc(Fv) 2 and diabodies.
- each heavy chain is linked to each other by disulfide bonds and each heavy chain is linked to a light chain by a disulfide bond.
- the light chain includes two domains, a variable domain (VL) and a constant domain (CL).
- the heavy chain includes four domains, a variable domain (VH) and three constant domains (CH1, CH2 and CH3, collectively referred to as CH).
- the variable regions of both light (VL) and heavy (VH) chains determine binding recognition and specificity to the antigen.
- the constant region domains of the light (CL) and heavy (CH) chains confer important biological properties such as antibody chain association, secretion, trans-placental mobility, complement binding, and binding to Fc receptors (FcR).
- the Fv fragment is the N-terminal part of the Fab fragment of an immunoglobulin and consists of the variable portions of one light chain and one heavy chain.
- CDRs Complementarity Determining Regions
- FRs Framework Regions
- a “monoclonal antibody” in its various grammatical forms refers to a population of antibodies that contains only one species of antibody combining sites capable of immunoreacting with a particular epitope.
- a monoclonal antibody thus typically displays a single binding affinity for any epitope with which it immunoreacts.
- a monoclonal antibody may therefore contain an antibody molecule having a plurality of antibody combining sites, each immunospecific for a different epitope, e.g. a bispecific monoclonal antibody.
- a monoclonal antibody was produced by immortalization of a clonally pure immunoglobulin secreting cell line, a monoclonally pure population of antibody molecules can also be prepared by the methods of the present invention.
- Monoclonal antibodies may be prepared by immunizing purified CD277 into a mammal, e.g. a mouse, rat, human and the like mammals.
- the antibody-producing cells in the immunized mammal are isolated and fused with myeloma or heteromyeloma cells to produce hybrid cells (hybridoma).
- the hybridoma cells producing the monoclonal antibodies are utilized as a source of the desired monoclonal antibody. This standard method of hybridoma culture is described in Kohler and Milstein (1975).
- mAbs can be produced by hybridoma culture the invention is not to be so limited. Also contemplated is the use of mAbs produced by an expressing nucleic acid cloned from a hybridoma of this invention. That is, the nucleic acid expressing the molecules secreted by a hybridoma of this invention can be transferred into another cell line to produce a transformant.
- the transformant is genotypically distinct from the original hybridoma but is also capable of producing antibody molecules of this invention, including immunologically active fragments of whole antibody molecules, corresponding to those secreted by the hybridoma. See, for example, U.S. Pat. No. 4,642,334 to Reading; PCT Publication No.; European Patent Publications No.
- Antibody generation techniques not involving immunisation are also contemplated such as for example using phage display technology to examine naive libraries (from non-immunised animals); see Barbas et al. (1992), and Waterhouse et al. (1993).
- chimeric antibody refers to a genetically engineered fusion of parts of an animal antibody, typically a mouse antibody, with parts of a human antibody. Generally, chimeric antibodies contain approximately 33% mouse protein and 67% human protein. Developed to reduce the Human Anti-animal Antibodies response elicited by animal antibodies, they combine the specificity of the animal antibody with the efficient human immune system interaction of a human antibody.
- humanized antibody refers to an antibody having variable region framework and constant regions from a human antibody but retains the CDRs of the animal antibody.
- fragment of an antibody refers to a portion of said antibody comprising at least the antigen-binding domain. Said fragments are for example Fab, fab′, F′ab′)2 and Fv.
- Fab denotes an antibody fragment having a molecular weight of about 50,000 and antigen binding activity, in which about a half of the N-terminal side of H chain and the entire L chain, among fragments obtained by treating IgG with a protease, papaine, are bound together through a disulfide bond.
- F(ab′) 2 refers to an antibody fragment having a molecular weight of about 100,000 and antigen binding activity, which is slightly larger than the Fab bound via a disulfide bond of the hinge region, among fragments obtained by treating IgG with a protease, pepsin.
- Fab′ refers to an antibody fragment having a molecular weight of about 50,000 and antigen binding activity, which is obtained by cutting a disulfide bond of the hinge region of the F(ab′)2.
- a single chain Fv (“scFv”) polypeptide is a covalently linked VH::VL heterodimer which is usually expressed from a gene fusion including VH and VL encoding genes linked by a peptide-encoding linker.
- divalent and multivalent antibody fragments can form either spontaneously by association of monovalent scFvs, or can be generated by coupling monovalent scFvs by a peptide linker, such as divalent sc(Fv) 2 .
- diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH-VL).
- VH heavy-chain variable domain
- VL light-chain variable domain
- linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
- the expression “derivative of an antibody” refers to an antibody which comprises the 6 CDRs of said antibody.
- the inventors have cloned and sequenced the variable domain (VL) of the light chain, and the variable domain (VH) of the heavy chain of the murine monoclonal antibodies described above.
- the location of the sequences encoding the complementarity determining regions (CDRs) of said antibody have been determined with reference to other antibody sequences (Kabat E A et al., 1991).
- This system is set forth in Kabat et al., 1987, in Sequences of Proteins of Immunological Interest, US Department of Health and Human Services, NIH, USA (hereafter “Kabat et al.”). This numbering system is used in the present specification.
- the Kabat residue designations do not always correspond directly with the linear numbering of the amino acid residues in SEQ ID sequences.
- the actual linear amino acid sequence may contain fewer or additional amino acids than in the strict Kabat numbering corresponding to a shortening of, or insertion into, a structural component, whether framework or complementarity determining region (CDR), of the basic variable domain structure.
- CDR complementarity determining region
- the correct Kabat numbering of residues may be determined for a given antibody by alignment of residues of homology in the sequence of the antibody with a “standard” Kabat numbered sequence.
- the CDRs of the heavy chain variable domain are located at residues 31-35B (H-CDR1), residues 50-65 (H-CDR2) and residues 95-102 (H-CDR3) according to the Kabat numbering system.
- the CDRs of the light chain variable domain are located at residues 24-34 (L-CDR1), residues 50-56 (L-CDR2) and residues 89-97 (L-CDR3) according to the Kabat numbering system.
- purified and “isolated” it is meant, when referring to a polypeptide (i.e. an antibody according to the invention) or to a nucleotide sequence, that the indicated molecule is present in the substantial absence of other biological macromolecules of the same type.
- purified preferably means at least 75% by weight, more preferably at least 85% by weight, more preferably still at least 95% by weight, and most preferably at least 98% by weight, of biological macromolecules of the same type are present.
- nucleic acid molecule which encodes a particular polypeptide refers to a nucleic acid molecule which is substantially free of other nucleic acid molecules that do not encode the polypeptide; however, the molecule may include some additional bases or moieties which do not deleteriously affect the basic characteristics of the composition.
- treating means reversing, alleviating, inhibiting the progress of, or preventing the disorder or condition to which such term applies, or one or more symptoms of such disorder or condition.
- a “therapeutically effective amount” is intended for a minimal amount of active agent which is necessary to impart therapeutic benefit to a subject.
- a “therapeutically effective amount” to a mammal is such an amount which induces, ameliorates or otherwise causes an improvement in the pathological symptoms, disease progression or physiological conditions associated with or resistance to succumbing to a disorder.
- prevention refers to preventing the disease or condition from occurring in a subject which has not yet been diagnosed as having it.
- the term “subject” denotes a mammal, such as a rodent, a feline, a canine, and a primate.
- a subject according to the invention is a human.
- cancer refers to cells having the capacity for autonomous growth, i.e., an abnormal state or condition characterized by rapidly proliferating cell growth.
- hyperproliferative and neoplastic disease states may be categorized as pathologic, i.e., characterizing or constituting a disease state, or may be categorized as non-pathologic, i.e., a deviation from normal but not associated with a disease state.
- pathologic i.e., characterizing or constituting a disease state
- non-pathologic i.e., a deviation from normal but not associated with a disease state.
- the term is meant to include all types of cancerous growths or oncogenic processes, metastatic tissues or malignantly transformed cells, tissues, or organs, irrespective of histopathologic type or stage of invasiveness.
- cancer or “neoplasms” include malignancies of the various organ systems, such as affecting lung, breast, thyroid, lymphoid, gastrointestinal, and genito-urinary tract, as well as adenocarcinomas which include malignancies such as most colon cancers, renal-cell carcinoma, prostate cancer and/or testicular tumors, non-small cell carcinoma of the lung, cancer of the small intestine and cancer of the esophagus.
- the inventors have deposited a murine anti-CD277 antibody (mAb 20.1) producing hybridoma at the Collection Nationale de Cultures de Microorganismes (CNCM, Institut Pasteur, 25 rue du Dondel Roux, 75724 Paris Cedex 15, France), in accordance with the terms of Budapest Treaty, on Nov. 24, 2010.
- mAb 20.1 murine anti-CD277 antibody
- the deposited hybridoma for mAb 20.1 has CNCM deposit number I-4402.
- mAb 20.1 refers to an isolated anti-CD277 antibody which is obtainable from the hybridoma accessible under CNCM deposit number I-4402.
- the expression “a derivative of mAb 20.1” refers to an anti-CD277 antibody which comprises the 6 CDRs of mAb 20.1.
- the 6 CDRs of the mAb 20.1 are as follows:
- H-CDR1 RYYLY SEQ ID NO: 7
- H-CDR2 EINPNNGGTKFNEKFKS SEQ ID NO: 8
- H-CDR3 EDDYDGTPDAMDY SEQ ID NO: 9
- L-CDR1 HASQNINLWLS SEQ ID NO: 10
- L-CDR2 RASNLHT SEQ ID NO: 11
- L-CDR3 QQGHSYPYT SEQ ID NO: 12
- the inventors have deposited a murine anti-CD277 antibody (mAb 7.2) producing hybridoma at the Collection Nationale de Cultures de Microorganismes (CNCM, Institut Pasteur, 25 rue du Dondel Roux, 75724 Paris Cedex 15, France), in accordance with the terms of Budapest Treaty, on Nov. 24, 2010.
- mAb 7.2 murine anti-CD277 antibody
- the deposited hybridoma for mAb 7.2 has CNCM deposit number I-4401.
- mAb 7.2 refers to an isolated anti-CD277 antibody which is obtainable from the hybridoma accessible under CNCM deposit number I-4401.
- the expression “a derivative of mAb 7.2” refers to an anti-CD277 antibody which comprises the 6 CDRs of mAb 7.2.
- the 6 CDRs of the mAb 7.2 are as follows:
- H-CDR1 RYYMY (SEQ ID NO: 27) H-CDR2 EINPNNGGTKFNEKFKN (SEQ ID NO: 28) H-CDR3 EDDYDGTPFAMDY (SEQ ID NO: 29) L-CDR1 HASQNINVWLS (SEQ ID NO: 30) L-CDR2 KASNLHT (SEQ ID NO: 31) L-CDR3 QQGQTYPYT (SEQ ID NO: 32)
- the inventors have deposited a murine anti-CD277 antibody (mAb 103.2) producing hybridoma at the Collection Nationale de Cultures de Microorganismes (CNCM, Institut Pasteur, 25 rue du Dondel Roux, 75724 Paris Cedex 15, France), in accordance with the terms of Budapest Treaty, on Nov. 24, 2010.
- mAb 103.2 murine anti-CD277 antibody
- the deposited hybridoma for mAb 103.2 has CNCM deposit number I-4403.
- mAb 103.2 refers to an isolated anti-CD277 antibody which is obtainable from the hybridoma accessible under CNCM deposit number I-4403.
- the expression “a derivative of 103.2” refers to an anti-CD277 antibody which comprises the 6 CDRs of mAb 103.2.
- the present invention relates to an isolated anti-CD277 antibody, which activates the cytolytic function, cytokine production and proliferation of V ⁇ 9/V ⁇ 2 T cells.
- V ⁇ 9/V ⁇ 2 T cells By activating the cytolytic function of V ⁇ 9/V ⁇ 2 T cells, it is meant that a significant increase of the cytotoxicity of V ⁇ 9/V ⁇ 2 T cells, i.e. a significant increase of the specific lysis of the target cells by V ⁇ 9/V ⁇ 2 T cells, is observed.
- V ⁇ 9/V ⁇ 2 T cells By increasing the cytokine production by V ⁇ 9/V ⁇ 2 T cells, it is meant that a significant increase of the cytokine production by V ⁇ 9/V ⁇ 2 T cells is observed, as compared to control V ⁇ 9/V ⁇ 2 T cells (i.e. non stimulated and non treated).
- V ⁇ 9/V ⁇ 2 T cells By increasing the proliferation of V ⁇ 9/V ⁇ 2 T cells, it is meant that a significant increase of the proliferation of V ⁇ 9/V ⁇ 2 T cells is observed, as compared to control V ⁇ 9/V ⁇ 2 T cells (i.e. non stimulated and non treated).
- the activation of the cytolytic function of V ⁇ 9/V ⁇ 2 T cells may be measured according to the method described in example 3 (i.e. “Analysis of V ⁇ 9V ⁇ 2 T cell responses by direct cytotoxicity assay”, and for example the results “CD277 potentiate the anti-tumor cytolysis mediated by V ⁇ 9V ⁇ 2 T cells”).
- Examples of isolated anti-CD277 antibodies, which activate the cytolytic function, cytokine production and proliferation of V ⁇ 9/V ⁇ 2 T cells are mAbs 20.1 or 7.2, or derivatives thereof.
- the present invention also relates to an anti-CD277 antibody, which costimulates T cells together with CD3-TCR.
- costimulating T cells together with CD3-TCR it is meant that the reaction cascade following the binding of CD3 with TCR is activated.
- costimulation of T cells together with CD3-TCR may be measured according to the method described in example 2 (particularly “CD277 costimulates CD3 signals”).
- isolated anti-CD277 antibodies, which costimulate T cells together with CD3-TCR are mAbs 20.1 or 7.2, or derivatives thereof.
- the present invention also relates to an anti-CD277 antibody, which costimulates T cells in addition to CD28-B7 costimulation.
- costimulating T cells together with CD28-B7 it is meant that the reaction cascade following the binding of CD28 with B7 is activated.
- costimulation of T cells together with CD28-B7 may be measured according to the method described in example 2 (particularly “CD277 costimulates CD3 signals”).
- isolated anti-CD277 antibodies, which costimulate T cells together with CD28-B7 are mAbs 20.1 or 7.2, or derivatives thereof.
- the present invention also relates to an anti-CD277 antibody, which increases the activity and/or survival of monocytes and dendritic cells.
- an anti-CD277 antibody increases the activity and/or survival of monocytes and dendritic cells.
- said anti-CD277 antibody increases costimulatory molecules expression (like CD86, CD80 and HLA-DR) on the surface of monocytes and dendritic cells, and increases the proinflammatory responses induced by TLR ligands in these cells.
- the increase of the activity and/or survival of monocytes and dendritic cells may be measured according to the method described in example 1 (particularly “Apoptosis detection” and “Cytokines production”).
- Examples of isolated anti-CD277 antibodies, which increase the activity and/or survival of monocytes and dendritic cells are mAb 20.1, or derivatives thereof.
- the present invention also relates to an isolated anti-CD277 antibody (mAb 20.1) which is obtainable from the hybridoma accessible under CNCM deposit number I-4402.
- the present invention relates to the hybridoma accessible under CNCM deposit number I-4402.
- the invention relates to an antibody which comprises the 6 CDRs of mAb 20.1.
- the invention relates to a derivative of mAb 20.1 which comprises the VL chains and the VH chains of mAb 20.1.
- the invention relates to a derivative of mAb 20.1 which is a chimeric antibody, which comprises the variable domains of mAb 20.1.
- the 6 CDRs of 20.1 mAb are as in Table 1 below:
- variable regions (VH and VL) of mAb 20.1 are the following:
- the present invention also refers to antibodies comprising SEQ ID NO:18 in their heavy chain and SEQ ID NO:20 in their light chain. It also refers to antibodies encoded by at least nucleotidic sequences SEQ ID NO:17 for the heavy chain and SEQ ID NO:19 for the light chain:
- Heavy chain DNA sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQ ID NO: 17) CAGGTCCAACTGCAGCAGTCTGGGGCTGAACTGGTGAAGCCTGGGGCTTCAGTGAAGTTG TCCTGCAAGGCTTCTGGCTACACCTTCACC AGGTACTATTTGTAC TGGGTGAAACAGAGGC CTGGACAAGGCCTTGAGTGGATTGGA GAGATAAATCCTAACAATGGTGGTACTAAGTTCAA TGAGAAGTTCAAGAGC AAGGCCACACTGACTGTAGACAAATCCTCCAGAACAACATACATA CAACTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTTCAAGA GAGGATGATT ACGACGGGACCCCCGATGCTATGGACTAC TGGGGTCAAGGAACCGCAGTCACCGTCCT CA Heavy chain: Amino acids sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQ ID NO: 18
- the present invention also relates to an isolated anti-CD277 antibody (mAb 7.2) which is obtainable from the hybridoma accessible under CNCM deposit number I-4401.
- mAb 7.2 isolated anti-CD277 antibody
- the present invention relates to the hybridoma accessible under CNCM deposit number I-4401.
- the invention relates to an antibody which comprises the 6 CDRs of mAb 7.2.
- the invention relates to a derivative of mAb 7.2 which comprises the VL chains and the VH chains of mAb 7.2.
- the invention relates to a derivative of mAb 7.2 which is a chimeric antibody, which comprises the variable domains of mAb 7.2.
- the 6 CDRs of the 7.2mAb are as in Table 2 below:
- variable regions (VH and VL) of mAb 7.2 are the following:
- the present invention also refers to antibodies comprising SEQ ID NO:38 in their heavy chain and SEQ ID NO:40 in their light chain. It also refers to antibodies encoded by at least nucleotidic sequences SEQ ID NO:37 for the heavy chain and SEQ ID NO:39 for the light chain:
- Heavy chain DNA sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQ ID NO: 37) CAGGTCCAACTGCAGCAGTCTGGGGCTGAACTGGTGAAGCCTGGGGCTTCAGTGAAGTTG TCCTGCAAGGCTTCTGGCTACATCTTCACC AGATACTATATGTAT TGGGTGAAGCAGAGGC CTGGACAAGGCCTTGAGTGGATTGGA GAGATTAATCCTAACAATGGTGGTACTAAGTTCAA TGAGAAGTTCAAGAAC AAGGCCACACTGACTGTAGACAAATTTTCCAGCACAGCATACATG CAACTCAGGAGCCTGACATCTGAGGACTCTGCGGTCTATTATTGTTCAA GAGAGGATGATT ACGACGGGACCCCCTTTGCTATGGACTAC TGGGGTCAAGGAACCTCAGTCACCGTCTCCT CA Heavy chain: Amino acids sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQ ID NO: 38
- the antibodies of the invention are chosen from 20.1 mAb, 7.2 mAb, their fragments and derivatives.
- the present invention relates to an isolated anti-CD277 antibody, which inhibits the cytolytic function, cytokine production and proliferation of V ⁇ 9/V ⁇ 2 T cells.
- V ⁇ 9/V ⁇ 2 T cells By inhibiting the cytolytic function of V ⁇ 9/V ⁇ 2 T cells, it is meant that a significant decrease of the cytotoxicity of V ⁇ 9/V ⁇ 2 T cells, i.e. a significant decrease of the specific lysis of the target cells by V ⁇ 9/V ⁇ 2 T cells, is observed, as compared to control V ⁇ 9/V ⁇ 2 T cells (i.e. non stimulated and non treated).
- V ⁇ 9/V ⁇ 2 T cells By inhibiting the cytokine production by V ⁇ 9/V ⁇ 2 T cells, it is meant that a significant decrease of the cytokine production by V ⁇ 9/V ⁇ 2 T cells is observed, as compared to control V ⁇ 9/V ⁇ 2 T cells (i.e. non stimulated and non treated).
- V ⁇ 9/V ⁇ 2 T cells By inhibiting the proliferation of V ⁇ 9/V ⁇ 2 T cells, it is meant that a significant decrease of the proliferation of V ⁇ 9/V ⁇ 2 T cells is observed, as compared to control V ⁇ 9/V ⁇ 2 T cells (i.e. non stimulated and non treated).
- the inhibition of the cytolytic function of V ⁇ 9/V ⁇ 2 T cells may be measured according to the method described in example 3 (i.e. “Analysis of V ⁇ 9V ⁇ 2 T cell responses by direct cytotoxicity assay”).
- An example of an isolated anti-CD277 antibody, which inhibits the cytolytic function, cytokine production and proliferation of V ⁇ 9/V ⁇ 2 T cells, is mAbs 103.2, or derivatives thereof.
- the present invention also relates to an isolated anti-CD277 antibody (mAb 103.2) which is obtainable from the hybridoma accessible under CNCM deposit number I-4403.
- mAb 103.2 isolated anti-CD277 antibody
- the present invention relates to the hybridoma accessible under CNCM deposit number I-4403.
- the invention relates to an antibody which comprises the 6 CDRs of mAb 103.2.
- the invention relates to a derivative of mAb 103.2 which comprises the VL chains and the VH chains of mAb 103.2.
- the invention relates to a derivative of mAb 103.2 which is a chimeric antibody, which comprises the variable domains of mAb 103.2.
- the present invention also relates to an isolated anti-CD277 antibody (mAb 108.5) or an antibody which comprises the 6 CDRs of mAb 108.5.
- the invention relates to a derivative of mAb 108.5 which comprises the VL chains and the VH chains of mAb 108.5.
- the invention relates to a derivative of mAb 108.5 which is a chimeric antibody, which comprises the variable domains of mAb 108.5.
- the 6 CDRs of the 108.5 mAb are as in Table 3 below:
- variable regions (VH and VL) of mAb 108.5 are the following:
- the present invention also refers to antibodies comprising SEQ ID NO:58 in their heavy chain and SEQ ID NO:60 in their light chain. It also refers to antibodies encoded by at least nucleotidic sequences SEQ ID NO:57 for the heavy chain and SEQ ID NO:59 for the light chain:
- Heavy chain DNA sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQ ID NO: 57) GAGGTCCAGTTGCAACAGTCTGGACCTGAGCTGGTGAAGCCTGGAGCTTCAATGAAGATATCCT GCAAGGCTTCTGGTTACTCATTCACT GGCTTCGCCATTAAC TGGGTGAAACAGAGCCATGGACA GAACCTTGAGTGGATTGGG CTTATTTATCCTTACAATGGTGGTACTACCTACAGCCAGAGGTTC AAGGGC AAGGCCACATTAACTGTAGACAAGTCATCCACCACAGCCTACATGGAGCTCCTCAGTC TGACATCTGAAGACTCTGCAGTCTATTACTGTGCAAGA CGGCGGGATGGTTACTCCTGGTTTGC TTAC TGGGGCCAAGGGACTCTGGTCACTGTCTCTGCA Heavy chain: Amino acids sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (SEQ ID NO: 58) EVQ
- the antibody of the invention is chosen from 108.5, its fragments and derivatives.
- an antibody of the invention is a monoclonal antibody.
- an antibody of the invention is a chimeric antibody.
- an antibody of the invention is a humanized antibody.
- a further embodiment of the invention relates to a nucleic acid sequence encoding an antibody of the invention.
- the invention relates to a nucleic acid sequence encoding the VH domain or the VL domain of an antibody of the invention.
- said nucleic acid is a DNA or RNA molecule, which may be included in any suitable vector, such as a plasmid, cosmid, episome, artificial chromosome, phage or a viral vector.
- vector means the vehicle by which a DNA or RNA sequence (e.g. a foreign gene) can be introduced into a host cell, so as to transform the host and promote expression (e.g. transcription and translation) of the introduced sequence.
- a further object of the invention relates to a vector comprising a nucleic acid of the invention.
- Such vectors may comprise regulatory elements, such as a promoter, enhancer, terminator and the like, to cause or direct expression of said antibody upon administration to a subject.
- regulatory elements such as a promoter, enhancer, terminator and the like.
- promoters and enhancers used in the expression vector for animal cell include early promoter and enhancer of SV40, LTR promoter and enhancer of Moloney mouse leukemia virus, promoter and enhancer of immunoglobulin H chain and the like.
- Any expression vector for animal cell can be used, so long as a gene encoding the human antibody C region can be inserted and expressed.
- suitable vectors include pAGE107, pAGE103, pHSG274, pKCR, pSGI beta d2-4- and the like.
- plasmids include replicating plasmids comprising an origin of replication, or integrative plasmids, such as for instance pUC, pcDNA, pBR, and the like.
- viral vector include adenoviral, retroviral, herpes virus and AAV vectors.
- recombinant viruses may be produced by techniques known in the art, such as by transfecting packaging cells or by transient transfection with helper plasmids or viruses.
- virus packaging cells include PA317 cells, PsiCRIP cells, GPenv+ cells, 293 cells, etc.
- a further object of the present invention relates to a cell which has been transfected, infected or transformed by a nucleic acid and/or a vector according to the invention.
- transformation means the introduction of a “foreign” (i.e. extrinsic or extracellular) gene, DNA or RNA sequence to a host cell, so that the host cell will express the introduced gene or sequence to produce a desired substance, typically a protein or enzyme coded by the introduced gene or sequence.
- a host cell that receives and expresses introduced DNA or RNA bas been “transformed”.
- the nucleic acids of the invention may be used to produce an antibody of the invention in a suitable expression system.
- expression system means a host cell and compatible vector under suitable conditions, e.g. for the expression of a protein coded for by foreign DNA carried by the vector and introduced to the host cell.
- Common expression systems include E. coli host cells and plasmid vectors, insect host cells and Baculovirus vectors, and mammalian host cells and vectors.
- Other examples of host cells include, without limitation, prokaryotic cells (such as bacteria) and eukaryotic cells (such as yeast cells, mammalian cells, insect cells, plant cells, etc.). Specific examples include E.
- mammalian cell lines e.g., Vero cells, CHO cells, 3T3 cells, COS cells, etc.
- primary or established mammalian cell cultures e.g., produced from lymphoblasts, fibroblasts, embryonic cells, epithelial cells, nervous cells, adipocytes, etc.
- Examples also include mouse SP2/0-Agl4 cell (ATCC CRL1581), mouse P3X63-Ag8.653 cell (ATCC CRL1580), CHO cell in which a dihydrofolate reductase gene (hereinafter referred to as “DHFR gene”) is defective, rat YB2/3HL.P2.G11.16Ag.2O cell (ATCC CRL1662, hereinafter referred to as “YB2/0 cell”), and the like.
- DHFR gene dihydrofolate reductase gene
- YB2/0 cell rat YB2/3HL.P2.G11.16Ag.2O cell
- the present invention also relates to a method of producing a recombinant host cell expressing an antibody according to the invention, said method comprising the steps of:
- Antibodies of the invention may be produced by any technique known in the art, such as, without limitation, any chemical, biological, genetic or enzymatic technique, either alone or in combination.
- antibodies of the desired sequence can readily produce said antibodies, by standard techniques for production of polypeptides. For instance, they can be synthesized using well-known solid phase method, preferably using a commercially available peptide synthesis apparatus (such as that made by Applied Biosystems, Foster City, Calif.) and following the manufacturer's instructions.
- antibodies of the invention can be synthesized by recombinant DNA techniques well-known in the art. For example, antibodies can be obtained as DNA expression products after incorporation of DNA sequences encoding the antibodies into expression vectors and introduction of such vectors into suitable eukaryotic or prokaryotic hosts that will express the desired antibodies, from which they can be later isolated using well-known techniques.
- the invention further relates to a method of producing an antibody of the invention, which method comprises the steps consisting of:
- the method comprises the steps of:
- Antibodies of the invention are suitably separated from the culture medium by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
- the human chimeric antibody of the present invention can be produced by obtaining nucleic sequences encoding VL and VH domains as previously described, constructing a human chimeric antibody expression vector by inserting them into an expression vector for animal cell having genes encoding human antibody CH and human antibody CL, and expressing the coding sequence by introducing the expression vector into an animal cell.
- the CH domain of a human chimeric antibody it may be any region which belongs to human immunoglobulin, but those of IgG class are suitable and any one of subclasses belonging to IgG class, such as IgGI, IgG2, IgG3 and IgG4, can also be used.
- the CL of a human chimeric antibody may be any region which belongs to Ig, and those of kappa class or lambda class can be used.
- Methods for producing chimeric antibodies involve conventional recombinant DNA and gene transfection techniques are well known in the art (See patent documents U.S. Pat. Nos. 5,202,238; and 5,204,244).
- the humanized antibody of the present invention may be produced by obtaining nucleic acid sequences encoding CDR domains, as previously described, constructing a humanized antibody expression vector by inserting them into an expression vector for animal cell having genes encoding (i) a heavy chain constant region identical to that of a human antibody and (ii) a light chain constant region identical to that of a human antibody, and expressing the genes by introducing the expression vector into an animal cell.
- the humanized antibody expression vector may be either of a type in which a gene encoding an antibody heavy chain and a gene encoding an antibody light chain exists on separate vectors or of a type in which both genes exist on the same vector (tandem type).
- tandem type humanized antibody expression vector examples include pKANTEX93 (WO 97/10354), pEE18 and the like.
- Antibodies can be humanized using a variety of techniques known in the art including, for example, CDR-grafting (EP 239,400; PCT publication WO91/09967; U.S. Pat. Nos. 5,225,539; 5,530,101; and 5,585,089), veneering or resurfacing (EP 592,106; EP 519,596), and chain shuffling (U.S. Pat. No. 5,565,332).
- CDR-grafting EP 239,400; PCT publication WO91/09967; U.S. Pat. Nos. 5,225,539; 5,530,101; and 5,585,089)
- veneering or resurfacing EP 592,106; EP 519,596
- chain shuffling U.S. Pat. No. 5,565,332
- the general recombinant DNA technology for preparation of such antibodies is also known (see European Patent Application EP 125023 and International Patent Application WO 96/02576).
- the Fab of the present invention can be obtained by treating an antibody which specifically reacts with CD277 with a protease, papaine. Also, the Fab can be produced by inserting DNA encoding Fab of the antibody into a vector for prokaryotic expression system, or for eukaryotic expression system, and introducing the vector into a procaryote or eucaryote (as appropriate) to express the Fab.
- the F(ab′)2 of the present invention can be obtained treating an antibody which specifically reacts with CD277 with a protease, pepsin.
- the F(ab′)2 can be produced by binding Fab′ described below via a thioether bond or a disulfide bond.
- the Fab′ of the present invention can be obtained by treating F(ab′)2 which specifically reacts with human CD277 with a reducing agent, dithiothreitol. Also, the Fab′ can be produced by inserting DNA encoding Fab′ fragment of the antibody into an expression vector for prokaryote, or an expression vector for eukaryote, and introducing the vector into a prokaryote or eukaryote (as appropriate) to perform its expression.
- the scFv of the present invention can be produced by obtaining cDNA encoding the VH and VL domains as previously described, constructing DNA encoding scFv, inserting the DNA into an expression vector for prokaryote, or an expression vector for eukaryote, and then introducing the expression vector into a prokaryote or eukaryote (as appropriate) to express the scFv.
- CDR grafting involves selecting the complementary determining regions (CDRs) from a donor scFv fragment, and grafting them onto a human scFv fragment framework of known three dimensional structure (see, e. g., WO98/45322; WO 87/02671; U.S. Pat. Nos. 5,859,205; 5,585,089; 4,816,567; EP0173494).
- Amino acid sequence modification(s) of the antibodies described herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody. It is known that when a humanized antibody is produced by simply grafting only CDRs in VH and VL of an antibody derived from a non-human animal in FRs of the VH and VL of a human antibody, the antigen binding activity is reduced in comparison with that of the original antibody derived from a non-human animal. It is considered that several amino acid residues of the VH and VL of the non-human antibody, not only in CDRs but also in FRs, are directly or indirectly associated with the antigen binding activity. Hence, substitution of these amino acid residues with different amino acid residues derived from FRs of the VH and VL of the human antibody would reduce of the binding activity.
- hydropathic index of amino acids may be considered.
- the importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art. It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.
- Each amino acid has been assigned a hydropathic index on the basis of their hydrophobicity and charge characteristics these are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine ( ⁇ 0.4); threonine ( ⁇ 0.7); serine ( ⁇ 0.8); tryptophane ( ⁇ 0.9); tyrosine ( ⁇ 1.3); proline ( ⁇ 1.6); histidine ( ⁇ 3.2); glutamate ( ⁇ 3.5); glutamine ( ⁇ 3.5); aspartate ( ⁇ 3.5); asparagine ( ⁇ 3.5); lysine ( ⁇ 3.9); and arginine ( ⁇ 4.5).
- a further embodiment of the present invention also encompasses function-conservative variants of the antibodies of the present invention.
- “Function-conservative variants” are those in which a given amino acid residue in a protein or enzyme has been changed without altering the overall conformation and function of the polypeptide, including, but not limited to, replacement of an amino acid with one having similar properties (such as, for example, polarity, hydrogen bonding potential, acidic, basic, hydrophobic, aromatic, and the like).
- Amino acids other than those indicated as conserved may differ in a protein so that the percent protein or amino acid sequence similarity between any two proteins of similar function may vary and may be, for example, from 70% to 99% as determined according to an alignment scheme such as by the Cluster Method, wherein similarity is based on the MEGALIGN algorithm.
- a “function-conservative variant” also includes a polypeptide which has at least 60% amino acid identity as determined by BLAST or FASTA algorithms, preferably at least 75%, more preferably at least 85%, still preferably at least 90%, and even more preferably at least 95%, and which has the same or substantially similar properties or functions as the native or parent protein to which it is compared.
- Two amino acid sequences are “substantially homologous” or “substantially similar” when greater than 80%, preferably greater than 85%, preferably greater than 90% of the amino acids are identical, or greater than about 90%, preferably grater than 95%, are similar (functionally identical) over the whole length of the shorter sequence.
- the similar or homologous sequences are identified by alignment using, for example, the GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wis.) pileup program, or any of sequence comparison algorithms such as BLAST, FASTA, etc.
- GCG Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wis.
- sequence comparison algorithms such as BLAST, FASTA, etc.
- amino acids may be substituted by other amino acids in a protein structure without appreciable loss of activity. Since the interactive capacity and nature of a protein define the protein's biological functional activity, certain amino acid substitutions can be made in a protein sequence, and, of course, in its DNA encoding sequence, while nevertheless obtaining a protein with like properties. It is thus contemplated that various changes may be made in the antibodies sequences of the invention, or corresponding DNA sequences which encode said antibodies, without appreciable loss of their biological activity.
- amino acids may be substituted by other amino acids having a similar hydropathic index or score and still result in a protein with similar biological activity, i.e. still obtain a biological functionally equivalent protein.
- amino acid substitutions are generally therefore based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- substitutions which take various of the foregoing characteristics into consideration are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
- Another type of amino acid modification of the antibody of the invention may be useful for altering the original glycosylation pattern of the antibody.
- altering is meant deleting one or more carbohydrate moieties found in the antibody, and/or adding one or more glycosylation sites that are not present in the antibody.
- N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
- the tripeptide sequences asparagine-X-serine and asparagines-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
- X is any amino acid except proline
- Another type of covalent modification involves chemically or enzymatically coupling glycosides to the antibody. These procedures are advantageous in that they do not require production of the antibody in a host cell that has glycosylation capabilities for N- or O-linked glycosylation.
- the sugar(s) may be attached to (a) arginine and histidine, (b) free carboxyl groups, (c) free sulfhydryl groups such as thoseof cysteine, (d) free hydroxyl groups such as those of serine, threonine, orhydroxyproline, (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan, or (f) the amide group of glutamine.
- such methods are described in WO87/05330.
- Removal of any carbohydrate moieties present on the antibody may be accomplished chemically or enzymatically. Chemical deglycosylation requires exposure of the antibody to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N-acetylgalactosamine), while leaving the antibody intact.
- Enzymatic cleavage of carbohydrate moieties on antibodies can be achieved by the use of a variety of endo- and exo-glycosidases.
- Another type of covalent modification of the antibody comprises linking the antibody to one of a variety of non proteinaceous polymers, eg., polyethylene glycol, polypropylene glycol, or polyoxyalkylenes, in the manner set forth in U.S. Pat. Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or 4,179,337. It may be also desirable to modify the antibody of the invention with respect to effector function, e.g. so as to enhance antigen-dependent cell-mediated cytotoxicity (ADCC) and/or complement dependent cytotoxicity (CDC) of the antibody. This may be achieved by introducing one or more amino acid substitutions in an Fc region of the antibody.
- ADCC antigen-dependent cell-mediated cytotoxicity
- CDC complement dependent cytotoxicity
- cysteine residue(s) may be introduced in the Fc region, thereby allowing inter-chain disulfide bond formation in this region.
- the homodimeric antibody thus generated may have improved internalization capability and/or increased complement-mediated cell killing and/or antibody-dependent cellular cytotoxicity (ADCC) (Caron P C. et al. J Exp Med. 1992 Oct. 1; 176(4):1191-5 and Shopes B. J Immunol. 1992 May I; 148(9):2918-22).
- ADCC antibody-dependent cellular cytotoxicity
- Some antibodies like mAbs 20.1 and 7.2, activate the cytolytic function, cytokine production and proliferation of V ⁇ 9/V ⁇ 2 T cells, and thereby may be used to overcome the immunosuppressive mechanisms observed in cancer patients and during chronic infections.
- Some antibodies costimulate T cells together with CD3-TCR, or costimulate T cells in addition to CD28-B7 costimulation; said antibodies may be used in the same therapeutic applications.
- Some antibodies increase the survival of monocytes and dendritic cells; said antibodies may be used in the same therapeutic applications.
- the invention relates to mAbs 20.1 or 7.2 or a derivative thereof for the use in therapy.
- the invention relates to mAbs 20.1 or 7.2 or a derivative thereof for use for treating a cancer or a chronic infection.
- the invention also relates to a method for treating a cancer or a chronic infection, wherein said method comprises the step of administering to a subject in need thereof a therapeutically effective amount of mAbs 20.1 or 7.2 or of a derivative thereof.
- cancers include, but are not limited to, hematological malignancies such as B-cell lymphoid neoplasm, T-cell lymphoid neoplasm, non-Hodgkin lymphoma (NHL), B-NHL, T-NHL, chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), mantle cell lymphoma (MCL), NK-cell lymphoid neoplasm and myeloid cell lineage neoplasm.
- said hematological malignancy is acute myeloid leukemia (AML).
- non-hematological cancers include, but are not limited to, colon cancer, breast cancer, lung cancer, brain cancer, prostate cancer, head and neck cancer, pancreatic cancer, bladder cancer, colorectal cancer, bone cancer, cervical cancer, liver cancer, oral cancer, esophageal cancer, thyroid cancer, kidney cancer, stomach cancer, testicular cancer and skin cancer.
- chronic infections include, but are not limited to, viral, bacterial, parasitic or fungal infections such as chronic hepatitis, lung infections, lower respiratory tract infections, bronchitis, influenza, pneumoniae and sexually transmitted diseases.
- viral infections include include, but are not limited to, hepatitis (HAV, HBV, HCV), herpes simplex (HSV), herpes zoster, HPV, influenza (Flu), AIDS and AIDS related complex, chickenpox (varicella), common cold, cytomegalovirus (CMV) infection, smallpox (variola), Colorado tick fever, dengue fever, ebola hemorrhagic fever, foot and mouth disease, lassa fever, measles, marburg hemorrhagic fever, infectious mononucleosis, mumps, norovirus, poliomyelitis, progressive multifocal leukencephalopathy (PML), rabies, rubella, SARS, viral encephalitis, viral gastroenteritis, viral meningitis, viral pneumonia, West Nile disease and yellow fever.
- HCV hepatitis
- HBV herpes simplex
- HCV herpes zoster
- HPV influenza
- influenza Flu
- bacterial infections include include, but are not limited to, pneumonia, bacterial meningitis, cholera, diphtheria, tuberculosis, anthrax, botulism, brucellosis, campylobacteriosis, typhus, gonorrhea, listeriosis, lyme disease, rheumatic fever, pertussis (Whooping Cough), plague, salmonellosis, scarlet fever, shigellosis, syphilis, tetanus, trachoma, tularemia, typhoid fever, and urinary tract infections.
- parasitic infections include include, but are not limited to, malaria, leishmaniasis, trypanosomiasis, chagas disease, cryptosporidiosis, fascioliasis, filariasis, amebic infections, giardiasis, pinworm infection, schistosomiasis, taeniasis, toxoplasmosis, trichinellosis, and trypanosomiasis.
- fungal infections include include, but are not limited to, candidiasis, aspergillosis, coccidioidomycosis, cryptococcosis, histoplasmosis and tinea pedis.
- mAbs 20.1 or 7.2 or a derivative thereof may be used as a vaccine adjuvant for the treatment of a cancer or a chronic infection.
- the invention relates to a vaccine for the treatment of a cancer or a chronic infection comprising mAbs 20.1 or 7.2 or a derivative thereof.
- the invention relates to a kit for the treatment of a cancer or a chronic infection comprising:
- the two elements of the kit may be administered concomitantly or sequentially over time.
- Examples of vaccine for the treatment of a cancer or a chronic infection include, but are not limited to vaccines against viral, bacterial, parasitic or fungal infections such as HIV and HBV and vaccines against viral associated cancers (for instance HPV or HBV) or anti cancer vaccines for instance used to treat patients with melanoma, leukemia, breast cancers, lung cancers.
- the mAbs 20.1 or 7.2 or derivatives thereof can be used in combination with phosphoantigens.
- phosphoantigens have been shown to activate the cytolytic function, the cytokine production and the proliferation of V ⁇ 9/V ⁇ 2 T cells.
- Phosphoantigens have described in the art.
- phosphoantigens include, but are not limited to, the compounds described in international patent applications WO2007057440 and WO2008059052.
- anti-CD277 antibodies which inhibit the cytolytic function, the cytokine production and the proliferation of V ⁇ 9/V ⁇ 2 T cells.
- anti-CD277 antibodies may be used as immunosuppressive agents.
- the invention relates to an anti-CD277 antibody, which inhibits the cytolytic function, the cytokine production and the proliferation of V ⁇ 9/V ⁇ 2 T cells, for the use in therapy.
- the invention relates to an anti-CD277 antibody, the cytolytic function, the cytokine production and the proliferation of V ⁇ 9/V ⁇ 2 T cells, for the treatment of an autoimmune disease, transplantation rejection or a graft versus host disease.
- the invention also relates to a method for treating an autoimmune disease, transplantation rejection or a graft versus host disease, wherein said method comprises the step of administering to a subject in need thereof a therapeutically effective amount of anti-CD277 antibody, which inhibits the cytolytic function, the cytokine production and the proliferation of V ⁇ 9/V ⁇ 2 T cells.
- the anti-CD277 antibodies which inhibit the cytolytic function, the cytokine production and the proliferation of V ⁇ 9/V ⁇ 2 T cells, may be mAb 103.2 or a derivative thereof.
- autoimmune diseases which may be treated include but are not limited to rheumatoid arthritis (RA), insulin dependent diabetes mellitus (Type 1 diabetes), multiple sclerosis (MS), Crohn's disease, systemic lupus erythematosus (SLE), scleroderma, Sjogren's syndrome, pemphigus vulgaris, pemphigoid, addison's disease, ankylosing spondylitis, aplastic anemia, autoimmune hemolytic anemia, autoimmune hepatitis, coeliac disease, dermatomyositis, Goodpasture's syndrome, Graves' disease, Guillain-Barre syndrome, Hashimoto's disease, idiopathic leucopenia, idiopathic thrombocytopenic purpura, male infertility, mixed connective tissue disease, myasthenia gravis, pernicious anemia, phacogenic uveitis, primary biliary cirrhosis, primary myxo
- an anti-CD277 antibody which inhibits the cytolytic function, the cytokine production and the proliferation of V ⁇ 9/V ⁇ 2 T cells, may be used in combination with other immunosuppressive and chemotherapeutic agents such as, but not limited to, prednisone, azathioprine, cyclosporin, methotrexate, and cyclophosphamide.
- the invention also relates to pharmaceutical composition comprising an antibody of the invention.
- an antibody of the invention may be combined with pharmaceutically acceptable excipients, and optionally sustained-release matrices, such as biodegradable polymers, to form therapeutic compositions.
- “Pharmaceutically” or “pharmaceutically acceptable” refers to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to a mammal, especially a human, as appropriate.
- a pharmaceutically acceptable carrier or excipient refers to a non-toxic solid, semi-solid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
- compositions for example, the route of administration, the dosage and the regimen naturally depend upon the condition to be treated, the severity of the illness, the age, weight, and sex of the patient, etc.
- compositions of the invention can be formulated for a topical, oral, parenteral, intranasal, intravenous, intramuscular, subcutaneous or intraocular administration and the like.
- the pharmaceutical compositions contain vehicles which are pharmaceutically acceptable for a formulation capable of being injected.
- vehicles which are pharmaceutically acceptable for a formulation capable of being injected.
- These may be in particular isotonic, sterile, saline solutions (monosodium or disodium phosphate, sodium, potassium, calcium or magnesium chloride and the like or mixtures of such salts), or dry, especially freeze-dried compositions which upon addition, depending on the case, of sterilized water or physiological saline, permit the constitution of injectable solutions.
- the doses used for the administration can be adapted as a function of various parameters, and in particular as a function of the mode of administration used, of the relevant pathology, or alternatively of the desired duration of treatment.
- an effective amount of the antibody may be dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium.
- the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In all cases, the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- Solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils.
- An antibody of the invention can be formulated into a composition in a neutral or salt form.
- Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
- the carrier can also be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetables oils.
- a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetables oils.
- the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
- antibacterial and antifungal agents for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars or sodium chloride.
- Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminium monostearate and gelatin.
- Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- solutions Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective.
- the formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above, but drug release capsules and the like can also be employed.
- the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline or glucose.
- aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration.
- sterile aqueous media which can be employed will be known to those of skill in the art in light of the present disclosure.
- one dosage could be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, “Remington's Pharmaceutical Sciences” 15th Edition, pages 1035-1038 and 1570-1580).
- Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
- the antibodies of the invention may be formulated within a therapeutic mixture to comprise about 0.0001 to 1.0 milligrams, or about 0.001 to 0.1 milligrams, or about 0.1 to 1.0 or even about 10 milligrams per dose or so. Multiple doses can also be administered.
- other pharmaceutically acceptable forms include, e.g. tablets or other solids for oral administration; time release capsules; and any other form currently used.
- liposomes and/or nanoparticles are contemplated for the introduction of antibodies into host cells.
- the formation and use of liposomes and/or nanoparticles are known to those of skill in the art.
- Nanocapsules can generally entrap compounds in a stable and reproducible way.
- ultrafine particles sized around 0.1 ⁇ m
- Biodegradable polyalkyl-cyanoacrylate nanoparticles that meet these requirements are contemplated for use in the present invention, and such particles may be are easily made.
- Liposomes are formed from phospholipids that are dispersed in an aqueous medium and spontaneously form multilamellar concentric bilayer vesicles (also termed multilamellar vesicles (MLVs)).
- MLVs generally have diameters of from 25 nm to 4 ⁇ m. Sonication of MLVs results in the formation of small unilamellar vesicles (SUVs) with diameters in the range of 200 to 500 A, containing an aqueous solution in the core.
- SUVs small unilamellar vesicles
- the physical characteristics of liposomes depend on pH, ionic strength and the presence of divalent cations.
- FIGS. 1 A and 1 B BT3 receptors are constitutively expressed on the surface of monocytes and iDCs.
- the expression on freshly isolated monocytes and iDC using both clone 20.1 anti-BT3 mAb are shown.
- the experiment shown is representative of five donors studied (the intensity of fluorescence variation among the five experiments was ⁇ 2%).
- FIGS. 1 C- 1 J BT3 ligation provides a survival signal for monocytes and iDC.
- FIGS. 1 C- 1 F Freshly isolated monocytes (upper row; FIGS. 1 C- 1 F ) and iDC (lower row; FIGS. 1 G- 1 J ) were stimulated with plastic-coated mAb (anti-CD19, and anti-BT3) or 20 ng/ml GM-CSF as indicated. After stimulation for 72 hours, cells were harvested and analyzed for Annexin V binding, as a marker of apoptotic cells. Numbers in the corners correspond to the percentage of positive cells for Annexin V. Data shown are representative of five independent experiments.
- FIGS. 1 K- 1 Z BT3 engagement increases costimulatory molecules expression on the surface of monocytes.
- FIGS. 1 AA- 1 AP BT3 engagement increases costimulatory molecules expression on the surface of iDC.
- FIG. 2 Regulation of AKT phosphorylation and ERK phosphorylation on CD277 activated CD4+ T cells.
- CD4+ T cells from thawed PBMCs from 4 healthy donors stimulated or not with antibody-coated Epoxy dynabeads (1 ⁇ g/ml of anti-CD3 plus various concentrations of anti-CD277.20.1clone or IgG1 (isotype control). Every 2, 5, 10 and 30 minutes, the intracellular phosphorylation of AKT and B, ERK on CD4+ T cells are measured by flow cytometry. Data are representative of four independent studies.
- Results are represented as MFI (mean fluorescence intensity expression) on CD4+ T cells at different time points after treatments for 2-30 minutes.
- CD277 is a costimulatory molecule of CD4+ T cells
- CD4+ T cells were purified from PBMCs from 4 healthy donors. Purified CD4+ T cells were stimulated with antibody-coated Epoxy dynabeads (1 ⁇ g/ml of anti-CD3 and 2 ⁇ g/ml of anti-CD28 plus various concentrations of anti-CD277 (20.1) or IgG1 (isotype control) Supernatants were collected on day 2 of culture for cytokine assay by ELISA. INFg, IL-2 and IL-10 production assay.
- FIG. 4 Expression of CD277 in lymph nodes
- FIG. 5 Anti-CD277 mAb 20.1 stimulates the expansion of V ⁇ 9V ⁇ 2 T cells
- ex vivo expansion 15 days+IL-2: PBMC were stimulated by 20.1 mAb abd IL-2 and V ⁇ 9V ⁇ 2 T cells were monitored by staining with V ⁇ 9V ⁇ 2 T cells specific mAb.
- CFSE assay (4 days+IL-2): PBMC were stimulated by 20.1 mAb abd IL-2 and V ⁇ 9V ⁇ 2 T cells proliferation was monitored CFSE analysis.
- FIG. 6 Activating (20.1) and inhibitory (103.2) CD277 mAbs regulating V ⁇ 9V ⁇ 2 T cells were monitored by staining with V ⁇ 9V ⁇ 2 cells specific mAb.
- Antagonist CD77 mAb 103.2 inhibits the phosphoantigen mediated activation of V ⁇ 9V ⁇ 2
- BTN3 mAb inhibits phosphoantigen-induced activation of Jurkat TCR V ⁇ 9/V ⁇ 2 T cells as determined by CD69 expression.
- FIG. 7 CD277 potentiate the anti-tumor cytolysis mediated by V ⁇ 9V ⁇ 2 T cells
- V ⁇ 9N/82 Tumor cell lines were incubated with V ⁇ 9N/82 with or without 20.1 agonist mAb.
- the activation of V ⁇ 9V ⁇ 2 was evaluated by CD107a/b degranulation.
- FIG. 8 Comparison of NK cells and VI/9M T cells cytotoxicity against primary AML blasts
- FIG. 9 Correlation between expression of activating molecules on primary AML blasts and their lysis by V ⁇ 9V ⁇ 2 T cells.
- Linear regression of normalized AML blasts lysis (n 23) by V ⁇ 9V ⁇ 2 T cells compared to the level of expression of (A) Nectin-2, (B) ULBP2 (C) ICAM1 and (D) BTN3A.
- the surface expression was assessed by Flow Cytometry analysis.
- the results are expressed as Median Fluorescence Intensity ratio (rMFI) compared to Isotype control.
- the lysis is expressed as the mean percentage of specific lysis of DAUDI and K562 cell lines. Correlations were established using the nonparametric Spearman correlation coefficient (r s ).
- FIG. 10 Specific BTN3A-mediated enhancement of V ⁇ 9V ⁇ 2 T cells lysis of primary AML blasts by TCR agonists.
- AML blasts were pre-incubated for 1 hour with Control Isotype, BrHpp (2 ⁇ M) anti-BTN3A agonist 20.1 mAb (10 ⁇ g/ml) or O/N with ZOL (45 ⁇ M), before addition of V ⁇ 9V ⁇ 2T cells (A) Comparison of TCR agonists.
- the lysis is expressed as percentage of specific lysis of DAUDI cell line.
- B Effect of TCR and BTN3A blocking.
- the blasts were treated with ZOL, agonist (20.1) or antagonist (108.5) anti-BTN3A mAb or combination. Data are shown for E:T 30:1.
- the lysis is expressed as percentage of specific lysis and compared to DAUDI specific lysis.
- FIG. 11 Triggering of BTN3A on primary AML blasts with mAb enhances their recognition by V ⁇ 9V ⁇ 2 T cells and bypasses N-BP-resistance.
- T or E cells were preincubated for 90 minutes with anti-BTN3A 20.1 mAb (10 ⁇ g/ml), and then extensively washed before E+T co-culture. Representative data from 2 independent experiments. Data are shown for E:T 1:1, 10:1, 30:1. The lysis is expressed as a mean percentage of specific lysis ⁇ SEM and compared to DAUDI lysis.
- B Representative experiment showing trogocytosis of AML blasts from patient UPN01 by V ⁇ 9V ⁇ 2 T cells from HV (full grey histogram) and after 1 hour in co-culture with IgG1 (dashed line) or anti BTN3A 20.1 mAb (full line).
- V ⁇ 9V ⁇ 2 T cells trogocytosis (PKH67 MFI ⁇ SEM) of AML blasts (n 10). Cumulative data at 0 and 60 min from 3 different experiments.
- the lysis is expressed as percentage of DAUDI specific lysis. Results were expressed as mean ⁇ SEM and statistical significance was established using the non-parametric paired Wilcoxon U-test. *p ⁇ 0.05; **0.001 ⁇ p ⁇ 0.01; ***p ⁇ 0.001.
- FIG. 12 Primary AML blasts mainly express BTN3A2 isoform irrespectively of their sensitivity to N-BP.
- C Western-blot analysis of total protein extracts from primary AML blasts poorly (B) or well sensitized by ZOL (C).
- BTN3A knock-down HEK293FT (sh #284; clone #30) transiently transfected with BTN3A1m, BTN3A2m, BTN3A3m are used as size controls. Extracts were loaded in 10% SDS PAGE gel and membranes were hybridized with anti-BTN3A 20.1 mAb and anti-Grb2 as a loading control.
- FIG. 13 Evaluation of anti-BTN3A agonist 20.1 mAb anti-leukemic activity in vivo in an AML xenograft model.
- iDC immature dendritic cells
- monocytes and iDC were cultured with 10 ng/ml of LPS, ligand for TLR4, 30 ⁇ g/ml of 8848 (Sigma-Aldrich, Milano, Italy), ligand for TLR7/8 and with 2.5 mg/ml of poly (I:C) (Sigma-Aldrich), ligand for TLR3, and were harvested after 48 h.
- the cells were cultured in RPMI 1640 supplemented with 10% heat-inactivated FCS, 5 mM L-glutamine and 50 IU/ml penicillin-streptomycin (from here on referred to as complete medium).
- Monocytes and iDCs before and after stimulation were analysed by imunofluorescence flow cytometry (FACScalibur Becton Dickinson, Milano, Italy) to verify their activation state.
- mAb specific for CD80, CD86, HLA-DR, CD1a, CD14 (BD Becton Dickinson), BT3 (clone 20.1, IgG1) and BT3 Fab 2 were previously selected, purified and characterised (Bensussan and Olive, 2005, Compte et al., 2004) or irrelevant molecules (anti-CD19, Becton Dickinson, and anti-CD31, clone Moon-1, provided by F. Malavasi, both IgG1) were used.
- anti-tubulin mAb (clone: 6-11B-1, IgG1, Invitrogen, Milano, Italy) was used.
- Monocytes and iDC were cultured on plastic coated with anti-BT3 mAb (clone 20.1) or with isotype-matched irrelevant mAb.
- the cells were stimulated with 20 ng/ml recombinant human GM-CSF (Schering-Plough Research Institute). After three days, cells were harvested, stained with Annexin V-FITC (Bender MedSystems, Wien, Austria) and analysed by flow cytometry.
- qRT-PCR analysis was performed with the Applied Biosystems 7900HT Fast Real-Time PCR system using TAQMAN® probe detection. Briefly, total RNA was isolated from THP-1 cells using the standard TRIZOL® reagent protocol (Invitrogen Life Technologies). 2 ⁇ g of the obtained RNA was reverse transcribed using oligo(dT). Each PCR assay was performed in a 25 ⁇ l reaction containing 2 ⁇ TAQMAN® probe universal Mix (Applied Biosystems) reagent, 20 ⁇ primers and 2 ⁇ l cDNA (equivalent to 40 ng of total RNA). Thermal cycle conditions were 95° C. for 15 s and 60° C. for 60 s (40 cycles).
- BT3.1, BT3.2, BT3.3 and GAPDH TAQMAN® Gene Expression assays were purchased from Applied Biosystems.
- BT3 Receptors are Constitutively Expressed on the Surface of Monocytes and iDCs.
- FIGS. 1 A and 1 B shows BT3 expression on freshly isolated monocytes and iDC using clone 20.1 anti-BT3 mAb.
- FIGS. 1 A and 1 B shows BT3 expression on freshly isolated monocytes and iDC using clone 20.1 anti-BT3 mAb.
- the differentiation of monocytes in DC was verified by expression of cell surface markers: CD14 was down-regulated and remained low in both immature and mature DC, whereas CD1a and HLA-DR was up-regulated (data not shown).
- the experiment shown is representative of five on different donors.
- the level of expression of BT3 was slightly higher on monocytes.
- BT3 receptors are constitutively expressed on the surface of monocytes and iDC, independently on their activation state.
- BT3 Ligation Provides a Survival Signal for Monocytes and iDC in Culture.
- BT3 is a stably expressed receptor family
- survival factors i.e. completed medium with serum
- BT3 receptors are able to promote monocytes and iDC survival and to extend the duration of cells responses by attenuating apoptosis.
- survival differences following anti-BT3 versus control isotype-matched mAb was statistically significant (as for GM-CSF treatment).
- a dose response effect of anti-BT3 mAb on survival of both monocytes and iDC is apparent (data not shown).
- the lowest anti-BT3 mAb dilution able to promote a good survival capability was 10 ⁇ g/ml.
- BT3 To investigate the role of BT3 in primary inflammatory responses, freshly isolated blood monocytes and monocyte-derived dendritic cells were stimulated by mAb, coated on tissue culture plates, or by TLR ligands known to stimulate monocytes and dendritic cells (LPS). After 24 h stimulation, coated anti-BT3 mAb was able to trigger the activation of monocytes, as shown by up-regulation of the cell surface costimulatory molecule CD86 ( FIGS. 1 K- 1 Z ). The isotype-matched control mAb (whose antigen is not expressed on these cells), had no significant effect. Thus, the activation observed using anti-BT3.1 mAb was specific and not due to the engagement of FcR.
- PBMCs Peripheral blood mononuclear cells
- ETS-Marseille-France Exableau Frangais du Sang
- Human CD4 + T cells were negatively selected from isolated PBMCs by depletion of non-CD4 + T cells with magnetic beads using the T cell isolation kit II from Miltenyi Biotec®. Isolated CD4 cells were used for further experiments when purity was superior to 90%.
- mice anti-human programmed death-1 (PD-1) mAB and three different clones of mouse anti-human CD277 were purified from ascites in our laboratory: Anti-PD-1 (clone PD1 3.1 with an IgG1 isotype) (ghiotto et al. Int Immunol., 2010), Anti-CD277 (clone 103.2 with an IgG2a isotype, clones 20.1 and 7.2 both with an IgG1 isotype) (compte et al.).
- the anti-CD277 (clone 20.1) mAb was labelled with Alexa Fluor 647 using a commercial kit (Invitrogen, Eugene, Oreg.).
- ECD-conjugated anti-CD3, PC5-conjugated anti-CD14, PC5-conjugated anti-CD19 (to select CD3 + CD14 ⁇ CD19 ⁇ cells) all from Beckman Coulter, Marseilles, France
- PACIFIC BLUETM antibody label
- ALEXA FLUOR®700 antibody label
- APC ALEXA FLUOR®750-conjugated anti-CD27 from Caltag, Invitrogen, USA
- PC7-conjugated anti-CD45RA from BD Biosciences
- ALEXA FLUOR®647-conjugated anti-CD277 (clone 20.1, homemade).
- APC-conjugated IgG1 (Beckman Coulter) was used as control and LIVE/DEAD® Fixable Dead Cell Stain Kit was used for viability.
- Cells were incubated 20 minutes at 4° C. then washed twice in phosphate-buffered saline (PBS, Lonza) fixed with 2% paraformaldehyde, and analyzed on a FACSARIA® flow cytometer (BD Biosciences). Data were analyzed using FLOWJO® Software (TreeStar, Ashland, OR).
- Purified CD4 + T cells (200 ⁇ 10 3 cells/well) from thawed human PBMCs were cultured during 96h in RPMI 1640 10% FBS in flat bottom 96-well plates (MICROTESTTM 96, Becton Dickinson) with previously plate-immobilized mouse anti-human CD3/CD28 or not (unstimulated).
- Anti-CD3 (clone OKT3)
- anti-CD28 (clone CD28.2, home-made) were used at 0.3 ⁇ g/ml and 10 ⁇ g/ml respectively. Cells were placed into an atmosphere of 5% CO 2 at 37° C. in a humidified incubator.
- TF H Folliculat T Helper cells
- NK cells Thawed alive NK cells (LIVE/DEAD® negative cells) were selected based on the expression of CD56+CD3- from healthy human PBMCs after 20 minutes incubation at 4° C. with the anti-CD277 ALEXA FLUOR®647 (clone 20.1). Cells were further washed twice in PBS (PBS, Lonza), then fixed with 2% formaldehyde and analyzed on a FACSARIA® flow cytometer (BD Biosciences). Data were analyzed using FLOWJO® Software (TreeStar, Ashland).
- Purified CD4+ T cells (200 ⁇ 10 3 cells/well) from thawed human PBMCs were cultured in RPMI 1640 10% FBS in flat bottom 96-well plates (MICROTESTTM 96, BD) with previously plate-immobilized mouse anti-human CD3 (clone OKT3)/CD28 (clone CD28.2) or anti-CD3/anti-CD277 (clone 20.1) or anti-CD3/isotypic control (IgG1). Purified anti-CD3 was used at 0, 3 ⁇ g/ml. Anti-CD28, anti-CD277 and isotypic control were used at 10 ⁇ g/ml. Cells were placed into an atmosphere of 5% CO2 at 37° C. in a humidified incubator.
- cytokines production (Interleukine-2, IL-2 and Interferon gamma, IFN- ⁇ ) was measured by ELISA assay according to the manufacturer's protocol (OPTEIA®, human IFN- ⁇ or IL-2 Set, BD Pharmingen). After 5 days, cells were stained with 3 ⁇ l of PE-conjugated anti-CD25 (BD Biosciences), and 50 of 7-AAD for 30 minutes at 4° C. then washed twice in PBS, fixed with 2% paraformaldehyde and analyzed on a BD FACS CANTO® (BD Bioscience). Data were analyzed using FLOWJO® Software (TreeStar, Ashland, OR).
- CD4 + T cells were purified by negative selection from PBMCs using magnetic beads (Miltenyi Biotec) according to the manufacturer's protocol. CD4+ T cells were routinely more than 97% pure.
- CD4 + T cells were labelled with 0.5 ⁇ M CFSE (Invitrogen) for 10 min at 37° C., washed and stimulated (1.5 ⁇ 10 5 cells/well) with aAPC at a ratio of 1:1 (cells to beads) comprised of magnetic beads in triplicate in 96-well round-bottom plates (Falcon; BD Biosciences). Cultures were incubated at 37° C., 5% CO2 for 5 days and then proliferation of CFSE labelled CD4 + T cells were measured by flow cytometry (FACS Canto, Beckman Coulter).
- NK cells were sorted with EASY SEP® negative selection kit and incubated over night in medium completed with sub-optimal concentrations of IL-2 (100 U/ml) and IL-15 (10 ng/ml). NK cell receptors functions were tested in re-directed cytolytic experiments against the Fc ⁇ R positive P815 mastocytoma murine cell line.
- effector cells were incubated with P815 cells pre-coated for 30 minutes with the mAb of interest (irrelevant mouse IgG1: 11 ⁇ g/ml, anti-NKp46: 1 ⁇ g/ml, anti-DNAM: 5 ⁇ g/ml, anti-CD277 20.1: 10 ⁇ g/ml) according to a 1:1 Effector:Target (E/T) ratio.
- the mAb of interest irrelevant mouse IgG1: 11 ⁇ g/ml
- anti-NKp46 1 ⁇ g/ml
- anti-DNAM 5 ⁇ g/ml
- anti-CD277 20.1 10 ⁇ g/ml
- Cytotoxic tests were performed in 4-hours assays in the presence of GOLGISTOP® (protein transport inhibitor) and soluble CD107 (a&b)-FITC (both from BD Biosciences), afterward cells were stained for surface markers (CD56-PeCy7 (Beckman Coulter, Immunotech), fixed and permeabilized (CYTOFIX/CYTOPERM®) then stained with intracellular mAb (IFN- ⁇ (Beckman Coulter, Immunotech)). Cells were finally re-suspended in PBS 2% para-formaldehyde and extemporaneously analyzed on a BD FACS CANTO® (BD Biosciences, San Jose, Calif.). The degree of activation of NK cells was measured based on the percentage of cells positive for CD107a and CD107b (degranulation) and/or the production of inflammatory cytokine (IFN- ⁇ ).
- Magnetic beads (DYNABEADS® M-450 Epoxy, Dynal Biotech) were coated with the following mAbs as described in Serriari et al. (serriari, ji 2010): anti-CD3 (OKT3), anti-human CD28 (CD28.2), and/or various concentrations of anti-human CD277 (CD277, 20.1) or IgG1 or anti-MHC class I (MHC I) (YJ4) or IgG1.
- aAPCs were coated with suboptimal anti-CD3 Ab (5%), suboptimal levels of anti-CD28 Ab (10%), and either IgG1 Ab (CD3/CD28/IgG1), anti-CD277 Ab (CD3/CD28/CD277+IgG1) or anti-MHC class I (CD3/28/anti-MHC class I+IgG1), constituting the remaining 85% of protein added to the bead.
- the amount of protein was kept constant at 20 mg/ml by the addition of control IgG 1.
- cytokines To determine the production of cytokines, cell-free supernatants were collected at 48 h and assayed for IL-2, IL-10 and IFN- ⁇ by ELISA using OPTEIA® kits (BD Pharmingen) according to the manufacturer's instructions.
- CD277 immunostainings were performed on total frozen sections of reactive lymph nodes as previously described (25). The final dilution for CD277.20.1 mAbs was 1/800. Negative control samples were prepared by omitting the primary mAb.
- CD8 and CD4 data were retrieved from the public GEO datasets (Sharp et al.) (ncbi.nlm.nih.gov/gds), while NK and gamma delta sets were personal.
- RMA Robust Multichip Average
- RMA was applied to the raw data collected from the various series. Quantile normalization and Loess' correction were done in R using Bioconductor and associated packages.
- the probe set corresponding to the three isoforms of BTN3A were retrieved from the normalized data sets and the corresponding log values were linearized for graphical representation.
- CD4 + T cells were purified by negative selection from PBMCs using magnetic beads (MILTENYI BIOTEC®) according to the manufacturer's protocol. CD4 T cells were routinely more than 97% pure. Cells were incubated 24 hours in RPMI 1640 10% FBS at 37° C.
- CD4 + T cells were washed and stimulated at different times (2, 5, 10 and 30 minutes) with aAPC at a ratio of 1:3 (cells to beads) comprised of magnetic beads (DYNABEADS® M-450 Epoxy, Dynal Biotech) were coated with the following mAbs: anti-CD3 (OKT3), anti-human CD28 (CD28.2), and/or various concentrations of anti-human CD277 (CD277. 20.1 clone) or isotype control IgG1.
- aAPCs were coated with suboptimal anti-CD3 Ab (5%), suboptimal levels of anti-CD28 Ab (10%), and either IgG1 Ab (CD3/CD28/IgG1), anti-CD277.20.1 Ab (CD3/CD28/CD277.20.1+IgG1), constituting the remaining 85% of protein added to the bead.
- the amount of protein was kept constant at 20 mg/ml by the addition of control IgG1.
- PHOSPHOFLOW® proteomic method [27], which uses state-specific antibodies to detect target phosphoproteins by fluorescence-activated cell sorting (FACS).
- FACS data were acquired on a FACSCANTO® flow cytometer (BD Biosciences) using DIVA® software.FACS data were analyzed using FLOWJO® software (TreeStar, Ashland, OR).
- NK cells In parallel, we monitored CD277 expression on another population of lymphocytes belonging to the innate immune system, the NK (data not shown). We found that 100% of NK cells also expressed high level of CD277, independently of their CD56 Bright (helper) or CD56 Dim (cytotoxic) phenotype, showing that molecules related to the B7/CD28 family are similarly found on the two major subsets of NK cells.
- TCR T Cell Receptor
- CD4 + T cells from four healthy donors were thus incubated from 24 to 96 hours with monoclonal antibodies directed against CD3 and CD28 or with the respective control isotypes.
- CD3/CD28 treatment results in a seven-fold increase of PD1 expression after 72 hours of culture, whereas CD277 expression was not modified at any time point (data not shown). Similar results were obtained with CD8 T cells (data not shown).
- TF H Follicular T helper cells
- CD277 is expressed on all subtypes of T lymphocytes in the peripheral blood as well as in lymph nodes and NK cells, but its expression is not modulated under stimulation as it is often the case for the molecules of the B7/CD28 family, or any other molecules involved in lymphocytes regulation.
- AKT and ERK Phosphorylation is Augmented after CD277 Engagement on CD4 + T Cells
- CD277 triggering was able to induce the phosphorylation of the two most important kinases of the lymphocyte signaling pathway: ERK from the mitogen-activated protein kinase and the serine threonine kinase AKT. It is known that Akt and ERK signaling plays a central role in T cell functions including proliferation, protein synthesis and regulation of apoptosis.
- CD277 20.1 induced the phosphorylation of AKT and ERK ( FIG. 2 ), demonstrating that CD277 stimulation is involved in the regulation of T cell activation (purified CD4+ T cells were stimulated with antibody-coated Epoxy dynabeads with mAb anti-CD3 plus mAb anti-CD277.20.1)
- CD277 as a co-modulator of the TCR signaling pathway, we stimulated purified CD4+ T cells with various concentrations of mAb to CD277.20.1 clone or isotype control IgG1, together with anti-CD3 plus anti-CD28 at different times (2, 5, 10 and 30 minutes). We observed that the cross-linking of CD277 with mAb CD277.20.1 clone strongly up regulated the phosphorylation of AKT and ERK induced by CD3+CD28 stimulation. This effect was dose and time dependent (data not shown).
- CD277 Costimulates CD3 Signals
- CD277 engagement was investigated by CD3 mediated signals.
- Purified CD4 + T cells from at least 4 healthy donors were cultured during 24 to 72 hours with anti-CD3/anti-CD28 or anti-CD3/anti-CD277 (clone 20.1) or anti-CD3/IgG1 (control condition).
- IL-2 and IFN- ⁇ production by CD4+ T cells were measured by ELISA.
- IFN- ⁇ secretion was strongly enhanced by CD3/CD277 co-activation compared to the control situation, and surprisingly, the production was even greater than the one obtained after CD3/CD28 co-activation (data not shown).
- a similar effect was obtained regarding the expression profile of the activation marker CD25 after CD3/CD277 co-stimulation.
- This CD4 + T cells co-stimulation induced a significant increase to 45% of CD25 activated positive cells, whereas CD3/CD28 co-activation only induced an increase to 25% of activated CD25 positive cells compared with the controlled condition (data not shown).
- CD277 is a co-stimulatory molecule of T lymphocytes activation signal.
- CD277 Further Enhances CD3-CD28 Costimulation and can Act as a Third Signal to Enhance T Cell Proliferation and Cytokine Production
- CD277 cosignals on T cell proliferation and cytokine production induced by CD3+CD28 signals We stimulated purified CD4 + T cells with with various concentrations of mAb to CD277, together with anti-CD3 plus anti-CD28. We kept the amount of antibody on the beads constant by adding isotype control IgG1 and anti-MHC class I (MHC I). We demonstrated that the cross-linking of CD277 on CD4 + T cells strongly activated CD4 + T cell proliferation mediated by anti-CD3 plus anti-CD28 in a dose-dependent way. Indeed, we measured the proliferation of CD4 cells by measuring the dilution of cytosolic dye CFSE (data not shown).
- NK cells we investigated whether a similar co-stimulatory effect was obtained in NK cells.
- CD277 alone did not have any effect on NK cell stimulation.
- CD277 has three isoforms btn3a1, btn3a2 and btn3a3, with (btn3a1 and btn3a3), or without (btn3a2) the B30.2 domain
- btn3a1 is the main form expressed by T lymphocytes whereas the decoy form (btn3a2) is mostly expressed on NK cells (data not shown). This result was validated by quantitative PCR on 4 healthy donors. We thus emitted the hypothesis that the absence of co-stimulation in response to CD277 stimulation of NK cells might be attributed to this form of BTN3A.
- Anti-CD277 anti-BT3-20.1 and 103.2 mAb were generated and validated as previously described [10]. Fab fragments of anti-BT3-20.1 were generated and purified with the IMMUNOPURE® Fab Preparation Kit following the manufacturer's recommendation (Pierce). Protein purity was assessed by nonreducing SDS-PAGE.
- FIGENIX FIGENIX Annotation Platform
- P815 mouse mastocytoma cell line
- K562 chronic myeloid leukaemia cell line
- Raji and Daudi Burkitt lymphoma cell lines
- RPMI 1640 medium Invitrogen
- FCS foetal calf serum
- the PBMC from healthy donors were distributed at 106/ml in 24-well culture plates at 37° C. in 5% CO2 in RPMI 1640 medium and 10% FCS.
- Polyclonal V ⁇ 9V ⁇ 2 T cells were specifically expanded with 3 ⁇ mol/l of Phosphostim (BrHPP molecule, Innate Pharma, Marseille, France) and 100 U/ml IL-2 (Chiron, Basel, Switzerland) for 12 days. Phosphostim was added once at the onset of the culture. Every 2 days, one-half of the culture medium volume was replaced with fresh medium containing 100 U/ml IL-2.
- ⁇ T cells and target cells were co-incubated at 37° C. with anti-CD107a FITC and anti-CD107b FITC in presence of monensin (10 ⁇ M, GOLIGISTOP®, BD Bioscience). Cells were collected and washed with PBS, 4 hours after incubation. ⁇ T cells were labelled with anti-pan ⁇ TCR PE and anti-CD3 PECy7 mAbs (BD Pharmingen). All samples were measured on FACSCANTO® or FACSARIA® flow cytometers (BD Biosciences) using FACSDIVA® software. Analyses were performed with FLOWJO® software (Tree Star).
- Intracellular staining was performed according to the recommended by BD PHARMINGEN® Fix and Perm Kit (BD Biosciences).100 ⁇ l of ⁇ T cells at 2.106cells/m1 were plated on 96-well plates. They were incubated in presence or not of BrHPP at 3 ⁇ M and with anti-CD277 or control isotypes at 10m/ml, for 30 min at 4° C. Cells were stimulated at different times at 37° C. Stimulation were stopped adding 100 ⁇ l CYTOFIX/CYTOPER® solution at 37° C. for 10 min.
- Intracellular phosphorylated proteins were stained with purified monoclonal rabbit antibodies: anti-pZap 70, anti-pAKT and anti-pErk from Cell Signaling Technology (Danvers, USA); labelled with Biotin-SP-conjugated F(ab′)2 Donkey anti-Rabbit (Jackson); and revealed with streptavindin-PE (Beckman Coulter).
- PBMC peripheral blood mononuclear cells
- ⁇ T cells were plated and stimulated as described in the paragraph: cell lines and expansion of ⁇ T cells, except cells were stimulated with anti-CD277 mAbs (10 ⁇ g/ml); or control isotypes (10 ⁇ g/ml); and with or without BrHPP at different concentrations. Cultures were stopped 9 days after. Percentages of V ⁇ 9V ⁇ 2 were measured the first day and the last day of culture as described above. Expanded ⁇ T cells effectors were stimulated with or without different doses of BrHPP added in anti-CD277 mAbs at 10 ⁇ g/ml; or with OKT3 (4 ng/ml) associated with anti-BT3 19.5 mAb in different concentrations. Activation of degranulation was measured by CD107 labelling assay as described above.
- P815 mastocytoma mouse cells were incubated 30 min, with mouse controls isotypes or anti-CD277 mAbs (10 ⁇ g/ml) or/and with anti-CD3 (OKT3, 4 ng/ml). After washing, P815 were incubated 4 h at 37° C., with expanded V ⁇ 9V ⁇ 2 T effectors cells at the same concentration.
- a Flow-based CD107a degranulation assay was performed as described above.
- STATXACT® software (version 8 PC) produced by the Cytel, was used for all statistical analyses. Significance values for comparisons between groups were determined by the nonparametric Mann and Whitney analysis. Assuming an unequal variance with 95% confidence levels, and p values ⁇ 0.05 were considered significant.
- the phylogeny shows that Skint-1 and CD277 form a monophylogenetic group with genes or genes family implied in immune response regulation: BTN 1 to 3, BTNL2 ERMAP; B-G and MOG (data not shown).
- This group also includes CD80 and CD86 from to B7 family, equally known for its involvement in immune response regulation. Every group forms a subfamily.
- Human Skint-1 gene is a likely pseudogene since two stop codons are present within its sequence.
- the first stop codon is located immediately downstream to the signal peptide, at the begining of the IgV sequence and the second downstream of the first transmembrane domain [7]. It is unlikely to be due to sequencing errors because we find the very same mutations in Pongo abelii DNA sequence.
- CD277 gene was absent in Ratus norvegicus and in Mus musculus DNA sequence using NCBI ntBlast. Indeed, within the BTN families only BTN2 sequence was present in these two species. These results indicated that CD277 really disappeared in rodents and consequently were not necessary for survival of these species. This suggests that CD277 function has been assumed by other gene(s).
- both molecules have similarities in their extracellular region within both IgV and IgC domains, but differ by the number of transmembrane domains and above all by their intracytoplasmic region (data not shown).
- CD277 has only one transmembrane domain instead of three for Skint-1.
- CD277 has a 830.2 domain. This domain is absent in Skint-1.
- CD277 is Expressed in V ⁇ 9V ⁇ 2 T Cells and not Modulated by their Differentiation
- CD277 was expressed on conventional T lymphocytes suggesting a role of CD277 in the regulation of T cell response.
- Anti-CD277mAb 20.1 induces proliferation of V ⁇ 9V ⁇ 2 T cells whereas 103.2 inhibits the stimulation mediated by optimal TCR stimulation by phosphoantigens.
- CD277 triggering might affect the stimulation of ⁇ T cells by optimal doses of the phosphoantigen BrHPP.
- IL-2 100 U/ml
- BrHPP 3000 nM
- V ⁇ 9V ⁇ 2 T cells After 15 days of culture V ⁇ 9V ⁇ 2 T cells were expanded ( FIG. 5 A ) upon anti-CD277 mAb 20.1 addition. This effect was associated with the proliferation of the V ⁇ 9V ⁇ 2 cells as demonstrated by the analysis of CFSE labeled cells ( FIG. 5 B ).
- CD277 Modulate the Degranulation in V ⁇ 9V ⁇ 2 T Cells Mediated by the TcR Complex
- CD107 expression was increased when combining CD277 with increasing doses of anti-CD3 up to 10 ng/ml. However, at higher doses of CD3 mAb CD107 expression decreased in a dose dependent manner.
- CD277 modulates the ability of ⁇ T cells to express CD107 and hence to degranulate following phosphoantigen or anti-CD3 stimulation.
- CD277 effect is biphasic: enhancing at low stimulation levels and decreasing at higher levels of TCR crosslinking the ⁇ T cell degranulation activity.
- CD227 engagement induced the robust release of IFN ⁇ and TNF ⁇ that was detected early as soon as 4 hours stimulation. So the degranulation induced by CD277 comes along with Th1 cytokines. This degranulation and cytokines release induction results of CD277 stimulation by anti-CD277 crosslinking without the need for TCR engagement.
- CD277 Potentiate the Anti-Tumor Cytolysis Mediated by V ⁇ 9V ⁇ 2 T Cells.
- CD277 mAbs potentiate or inhibit the anti-tumor cytolysis mediated by responding V ⁇ 9V ⁇ 2 T cells.
- EXAMPLE 4 The Activating Antibodies of the Invention can be Used to Treat Cancer, Particularly Acute Myeloid Leukemia
- PBMCs Peripheral Blood Mononuclear Cells
- EFS local Blood Bank
- PBMCs from AML patients and HV were isolated by density gradient centrifugation (Lymphoprep, Abcys) and viably frozen until use. Samples with more than 80% of blasts were selected for the study.
- BrHpp was from Innate Pharma (Marseilles, France). Zoledronate (ZOL) was from Novartis (United Kingdom).
- Recombinant human (Rh) IL2 and rhIL-15 were from BD Biosciences (San Jose, Calif., USA). The mAbs used for functional experiments and cytometry are listed in the following Table.
- Iso- m Ab/ reactive type Use Control isotype Functional Ig eBioscience in vitro and in grade G1 vivo Functional Anti-BTN3A clone 20.1 Ig Home Made tests Anti-BTN3A clone 108.5 Ig In vitro Anti-TCRV ⁇ 9 (IMMU510) Ig Functional tests Human CD45-Fitc Ig Human CD45-APC Ig CD112-PE Ig CD155-PE Ig Beckman Coulter Flow cytometry CD54-Fitc Ig TCR Pan ⁇ -PE Ig TOR V ⁇ 2-Fitc Ig CD33-PE Ig BD Biosciences CD107a/b-Fitc Ig IFNg-APC IgG MICA/B-PE IgG 7-AAD PE-Cy5 — CD3-AF700 Ig eBioscience G1 Murine CD45-APC eFluor78 Human CD45-V450 Ig BioLegend TNFa-eFluorV450 Ig CD
- Anti-BTN3A mAbs (clone 20.1 and 108.5) were generated as previously described 19 and labeled for cytometry using Alexa Fluor® 647 Protein Labeling Kit (Life Technologies).
- Effector ⁇ T cells were established and maintained as previously described 28 .
- PBMC from HV were stimulated with ZOL (1 ⁇ m) and rhlL-2 (200 IU/ml) at Day 0. From Day 5, rhIL-2 was renewed every two days and cells were kept at 1.5 ⁇ 10 6 /m1 for 15 days.
- NK cells were isolated using EASYSEP® Human NK cell enrichment kit (StemCell Technologies). The purity of ⁇ T cells and NK cells was determined by flow cytometry and respectively greater than 80% and 98%.
- the Burkitt lymphoma cell line, DAUDI, the human AML cell line, U937, and the erythroleukemic cell line, K562, were obtained from the American Type Culture Collection and cultured (0.5 ⁇ 10 6 /ml) in RPMI 1640 medium with 10% FCS.
- BTN3A Knock-down HEK293FT cells (sh #284; clone #30) were provided by E.Scotet (Inserm U892, France), cultured and transfected with BTN3A1, BTN3A2, BTN3A3 mutated cDNA-containing plasmids, as described 23 .
- 0.5 ⁇ 10 6 target cells were incubated with 50 pCi of 51 Cr (Perkin-Elmer) for AML blasts and 10 pCi for DAUDI and K562 cells for 90 minutes and mixed with effector cells in a Effector:Target (E:T) ratio of 30:1 ⁇ 15:1 ⁇ 10:1 ⁇ 1:1. After 4 hours of incubation at 37° C., 50p1 supernatant of each sample was transferred in LUMA® plates and radioactivity was determined by a gamma counter. The percentage of specific lysis was calculated using the formula [(experimental ⁇ spontaneous release/total ⁇ spontaneous release) ⁇ 100] and expressed as the mean of triplicate.
- RNA from AML blasts was performed with TRIZOL® (Life Technologies).
- the RNA was reverse-transcribed using oligo(dT) and M-MLV Reverse Transcriptase Protocol (Life Technologies).
- qRT-PCR was performed and analyzed with the Applied Bio-systems 7900HT Fast Real-Time PCR system.
- the Ct was calculated for each assay (Sequence Detection System Software 2.3, Applied Biosystems).
- Probes were BTN3A1 (Hs01063368_m1), BTN3A2 (Hs00389328_m1), BTN3A3 (Hs00757230_m1) and GAPDH (Hs99999905_m1) TAQMAN® gene expression Assays (Applied Biosystems).
- AML blasts were washed in cold PBS, and lysed in 110 ⁇ l of ice-cold TIT buffer (50 mM Tris pH 7.4, 200 ⁇ M NaF, 2.5 mM EDTA pH 7.4, 150 mM NaCl, 1% Triton X-100, 1% Nonidet-P40 and 5% glycerol) containing protease inhibitors (Roche Applied Science) and 1 mM Na3VO4. Proteins in all cell lysates were quantified according to the manufacturer's instructions (PierceTM BCA Protein Assay Kit).
- Proteins were resolved by SDS-PAGE 10%, followed by western blotting with primary antibodies anti-BTN3A 20.1 and anti-GrB2 (SantaCruz technology). They were detected with peroxidase-conjugated anti-mouse IgG1 and anti-rabbit IgG antibodies (Jackson Laboratory). Immunoreactive bands were detected using enhanced chemo-luminescent reagents (Pierce).
- Controls comprised NSG mice infused with PBS, or anti-BTN3A 20.1 mAb alone. Mice were imaged with a Photon Imager (Biospace Lab, Paris, France) at different days. For the Primary AML blasts model, NSG mice received sublethal irradiation (2 Gy). On the day after, they received 1 ⁇ 10 6 of CD3-depleted blasts (CD3 depletion Kit, Miltenyi Biotec) isolated from UPN09.
- CD3-depleted blasts CD3 depletion Kit, Miltenyi Biotec
- Treatments comprising intravenous infusions of expanded V ⁇ 9V ⁇ 2 T cells (15 ⁇ 10 6 , 90% CD3+TCRV ⁇ 2+) and either anti-BTN3A 20.1 mAb (250n) or IgG1 (250 ⁇ g), were administered twice a week, from 8 to 10 weeks post-graft.
- the peripheral blood number of blasts was quantified during engraftment, before and after treatment by Flow Cytometry (supplementary data 1B). Mice were sacrificed at week 11th post-graft and the number of blasts was quantified in their Bone Marrow (BM).
- Results are expressed as median ⁇ SEM. Statistical analysis was performed using Spearman correlation, Wilcoxon test and Mann-Whitney t test. P values ⁇ 0.05 were considered significant. Analyses were performed using GRAPHPAD PRISM® program.
- V ⁇ 9V ⁇ 2 T Cells Activating Molecules on Primary AML Blasts Correlates with their Sensitivity to V ⁇ 9V ⁇ 2 T Cells-Mediated Killing
- TCR Agonists Specifically Enhance V ⁇ 9V ⁇ 2 T Cells Lysis of Primary AML Blasts Through BTN3A Triggering
- BTN3A1 is a key player in V ⁇ 9V ⁇ 2 TCR activation 23 .
- the lysis of AML blasts is mainly TCR-mediated.
- Anti-BTN3A agonist mAb has been shown to sensitize tumor cell lines to killing by V ⁇ 9V ⁇ 2 T cells 23 .
- agonist anti-BTN3A 20.1 mAb could similarly sensitize primary tumors such as AML blasts to killing by V ⁇ 9V ⁇ 2 T cells.
- sensitization to killing occurred through the interaction of anti-BTN3A 20.1 mAb with AML blasts themselves, or rather as a consequence of anti-BTN3A 20.1 mAb exerting its effects upon V ⁇ 9V ⁇ 2 T cells.
- Treatment with BrHpp has been shown to enhance the contact-dependent capture of AML cell membrane via trogocytosis 13 leading us to hypothesize that the anti-BTN3A 20.1 agonist mAb might induce a similar effect.
- AML blasts are not equally sensitized to V ⁇ 9V ⁇ 2 T cells lysis by N—BP 18 .
- BTN3A1 and BTN3A3 were expressed at the transcriptional level but barely detected at the protein level. We found no differences regarding the expression of the three isoforms between N-BP-poorly sensitive ( FIG. 12 B ) and N-BP-sensitive AML blasts ( FIG. 12 C ).
- BTN3A1 can be triggered by N-BP. It nonetheless remains possible that BTN3A2, expressed at the highest level, might be triggered by the agonist 20.1 mAb, this leading to enhanced V ⁇ 9V ⁇ 2 T cell-mediated lysis through as-yet unknown mechanisms.
- Anti-BTN3A mAb Combined with ⁇ T Cells Infusion Decreases Leukemic Burden in AML Xenografted Mice Models
Landscapes
- Health & Medical Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Oncology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
Description
-
- activates the cytolytic function of Vγ9/Vδ2 T cells, and
- costimulates T cells together with CD3-TCR, and
- costimulates T cells in addition to CD28-B7 costimulation, and
- increases the activity and/or survival of monocytes and dendritic cells.
| Aminoacid sequence | |||
| H-CDR1 | RYYLY (SEQ ID NO: 7) | ||
| H-CDR2 | EINPNNGGTKFNEKFKS | ||
| (SEQ ID NO: 8) | |||
| H-CDR3 | EDDYDGTPDAMDY | ||
| (SEQ ID NO: 9) | |||
| L-CDR1 | HASQNINLWLS | ||
| (SEQ ID NO: 10) | |||
| L-CDR2 | RASNLHT (SEQ ID NO: 11) | ||
| L-CDR3 | QQGHSYPYT (SEQ ID NO: 12) | ||
| Amino acid sequence | |||
| H-CDR1 | RYYMY (SEQ ID NO: 27) | ||
| H-CDR2 | EINPNNGGTKFNEKFKN (SEQ ID | ||
| NO: 28) | |||
| H-CDR3 | EDDYDGTPFAMDY (SEQ ID | ||
| NO: 29) | |||
| L-CDR1 | HASQNINVWLS (SEQ ID NO: 30) | ||
| L-CDR2 | KASNLHT (SEQ ID NO: 31) | ||
| L-CDR3 | QQGQTYPYT (SEQ ID NO: 32) | ||
| TABLE 1 | ||
| DNA sequence | Aminoacid sequence | |
| H-CDR1 | AGGTACTATTTGTAC | RYYLY |
| (SEQ ID NO: 1) | (SEQ ID NO: 7) | |
| H-CDR2 | GAGATAAATCCTAACAATGGT | EINPNNGGTKFNEKFKS |
| GGTACTAAGTTCAATGAGAA | (SEQ ID NO: 8) | |
| GTTCAAGAGC (SEQ ID | ||
| NO: 2) | ||
| H-CDR3 | GAGGATGATTACGACGGGAC | EDDYDGTPDAMDY |
| CCCCGATGCTATGGACTAC | (SEQ ID NO: 9) | |
| (SEQ ID NO: 3) | ||
| L-CDR1 | CATGCCAGTCAGAACATTAAT | HASQNINLWLS |
| CTTTGGTTAAGC (SEQ ID | (SEQ ID NO: 10) | |
| NO: 4) | ||
| L-CDR2 | AGGGCTTCCAACTTGCACAC | RASNLHT |
| A | (SEQ ID NO: 11) | |
| (SEQ ID NO: 5) | ||
| L-CDR3 | CAACAGGGTCATAGTTATCC | QQGHSYPYT |
| GTACACG | (SEQ ID NO: 12) | |
| (SEQ ID NO: 6) | ||
| Heavy chain: DNA sequence (423 bp): Leader sequence-FR1-CDR1-FR2-CDR2-FR3- | |
| CDR3-FR4 | |
| (SEQ ID NO: 13) | |
| ATGGGATGGAGCTATATCATCCTCTTTTTGGTAACAACAGCAACAGGTGTCCACTCC CAG | |
| GTCCAACTGCAGCAGTCTGGGGCTGAACTGGTGAAGCCTGGGGCTTCAGTGAAGTTGTCC | |
| TGCAAGGCTTCTGGCTACACCTTCACC AGGTACTATTTGTAC TGGGTGAAACAGAGGCCTG | |
| GACAAGGCCTTGAGTGGATTGGA GAGATAAATCCTAACAATGGTGGTACTAAGTTCAATGA | |
| GAAGTTCAAGAGC AAGGCCACACTGACTGTAGACAAATCCTCCAGAACAACATACATACAA | |
| CTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTTCAAGA GAGGATGATTACG | |
| ACGGGACCCCCGATGCTATGGACTAC TGGGGTCAAGGAACCGCAGTCACCGTCTCCTCA | |
| Heavy chain: Amino acids sequence (141 AA): Leader sequence-FR1-CDR1-FR2-CDR2- | |
| FR3-CDR3-FR4 | |
| (SEQ ID NO: 14) | |
| MGWSYIILFLVTTATGVHS QVQLQQSGAELVKPGASVKLSCKASGYTFT RYYLY WVKQRPGQ | |
| GLEWIG EINPNNGGTKFNEKFKS KATLTVDKSSRTTYIQLSSLTSEDSAVYYCSR EDDYDGTPD | |
| AMDY WGQGTAVTVSS | |
| Light chain: DNA sequence (381 bp): Leader sequence-FR1-CDR1-FR2-CDR2-FR3-CDR3- | |
| FR4 | |
| (SEQ ID NO: 15) | |
| ATGAGGGTCCTTGCTGAGCTCCTGGGGCTGCTGCTGTTCTGCTTTTTAGGTGTGAGATGT | |
| GACATCCAGATGAACCAGTCTCCATCCAGTCTGTCTGCATCCCTTGGAGACACAATTACCA | |
| TCACTTGC CATGCCAGTCAGAACATTAATCTTTGGTTAAGC TGGTACCAGCAGAGACCAGG | |
| AAATATTCCTAAACTTCTGATCTAT AGGGCTTCCAACTTGCACACA GGCGTCCCATCAAGGT | |
| TTAGTGGCAGTGGATCTGCAACAGGTTTCACATTAACCATCAGCAGCCTGCAGCCTGAAGA | |
| CATTGCCACTTACTACTGT CAACAGGGTCATAGTTATCCGTACACG TTCGGAGGGGGGACC | |
| AAACTGGACATAAAA | |
| Light chain: Amino acids sequence (127 AA): Leader sequence-FR1-CDR1-FR2-CDR2- | |
| FR3-CDR3-FR4 | |
| (SEQ ID NO: 16) | |
| MRVLAELLGLLLFCFLGVRC DIQMNQSPSSLSASLGDTITITC HASONINLWLS WYQQRPGNIP | |
| KLLIY RASNLHT GVPSRFSGSGSATGFTLTISSLQPEDIATYYC QQGHSYPYT FGGGTKLDIK |
| Heavy chain: DNA sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 17) | |
| CAGGTCCAACTGCAGCAGTCTGGGGCTGAACTGGTGAAGCCTGGGGCTTCAGTGAAGTTG | |
| TCCTGCAAGGCTTCTGGCTACACCTTCACC AGGTACTATTTGTAC TGGGTGAAACAGAGGC | |
| CTGGACAAGGCCTTGAGTGGATTGGA GAGATAAATCCTAACAATGGTGGTACTAAGTTCAA | |
| TGAGAAGTTCAAGAGC AAGGCCACACTGACTGTAGACAAATCCTCCAGAACAACATACATA | |
| CAACTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTTCAAGA GAGGATGATT | |
| ACGACGGGACCCCCGATGCTATGGACTAC TGGGGTCAAGGAACCGCAGTCACCGTCTCCT | |
| CA | |
| Heavy chain: Amino acids sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 18) | |
| QVQLQQSGAELVKPGASVKLSCKASGYTFT RYYLY WVKQRPGQGLEWIG EINPNNGGTKFNE | |
| KFKSKATLTVDKSSRTTYIQLSSLTSEDSAVYYCSREDDYDGTPDAMDYWGQGTAVTVSS | |
| Light chain: DNA sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 19) | |
| GACATCCAGATGAACCAGTCTCCATCCAGTCTGTCTGCATCCCTTGGAGACACAATTACCA | |
| TCACTTGC CATGCCAGTCAGAACATTAATCTTTGGTTAAGC TGGTACCAGCAGAGACCAGG | |
| AAATATTCCTAAACTTCTGATCTAT AGGGCTTCCAACTTGCACACA GGCGTCCCATCAAGGT | |
| TTAGTGGCAGTGGATCTGCAACAGGTTTCACATTAACCATCAGCAGCCTGCAGCCTGAAGA | |
| CATTGCCACTTACTACTGT CAACAGGGTCATAGTTATCCGTACACG TTCGGAGGGGGGACC | |
| AAACTGGACATAAAA | |
| Light chain: Amino acids sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 20) | |
| DIQMNQSPSSLSASLGDTITITC HASQNINLWLS WYQQRPGNIPKLLIY RASNLHT GVPSRFSGS | |
| GSATGFTLTISSLQPEDIATYYC QQGHSYPYT FGGGTKLDIK |
| TABLE 2 | ||
| DNA sequence | Aminoacid sequence | |
| H-CDR1 | AGATACTATATGTAT | RYYMY |
| (SEQ ID NO: 21) | (SEQ ID NO: 27) | |
| H-CDR2 | GAGATTAATCCTAACAATGG | EINPNNGGTKFNEKFKN |
| TGGTACTAAGTTCAATGAGA | (SEQ ID NO: 28) | |
| AGTTCAAGAAC | ||
| (SEQ ID NO: 22) | ||
| H-CDR3 | GAGGATGATTACGACGGGA | EDDYDGTPFAMDY |
| CCCCCTTTGCTATGGACTAC | (SEQ ID NO: 29) | |
| (SEQ ID NO: 23) | ||
| L-CDR1 | CATGCCAGTCAGAACATTAA | HASQNINVWLS |
| TGTTTGGTTAAGC | (SEQ ID NO: 30) | |
| (SEQ ID NO: 24) | ||
| L-CDR2 | AAGGCTTCCAACTTGCACAC | KASNLHT |
| A | (SEQ ID NO: 31) | |
| (SEQ ID NO: 25) | ||
| L-CDR3 | CAACAGGGTCATAGTTATCC | QQGQTYPYT |
| GTACACG | (SEQ ID NO: 32) | |
| (SEQ ID NO: 26) | ||
| Heavy chain: DNA sequence (423 bp): Leader sequence-FR1-CDR1-FR2-CDR2-FR3- | |
| CDR3-FR4 | |
| (SEQ ID NO: 33) | |
| ATGGGATGGAGCTATATCATCCTCTTTTTGGTAGCAACAGCAACAGGTGTCCACTCC CAG | |
| GTCCAACTGCAGCAGTCTGGGGCTGAACTGGTGAAGCCTGGGGCTTCAGTGAAGTTGTCC | |
| TGCAAGGCTTCTGGCTACATCTTCACC AGATACTATATGTAT TGGGTGAAGCAGAGGCCTG | |
| GACAAGGCCTTGAGTGGATTGGA GAGATTAATCCTAACAATGGTGGTACTAAGTTCAATGA | |
| GAAGTTCAAGAAC AAGGCCACACTGACTGTAGACAAATTTTCCAGCACAGCATACATGCAA | |
| CTCAGGAGCCTGACATCTGAGGACTCTGCGGTCTATTATTGTTCAAGA GAGGATGATTACG | |
| ACGGGACCCCCTTTGCTATGGACTAC TGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA | |
| Heavy chain: Amino acids sequence (141 AA): Leader sequence-FR1-CDR1-FR2-CDR2- | |
| FR3-CDR3-FR4 | |
| (SEQ ID NO: 34) | |
| NIGWSYIILFLVATATGVHS QVQLQQSGAELVKPGASVKLSCKASGYIFT RYYMY WVKQRPGQ | |
| GLEWIG EINPNNGGTKFNEKFKN KATLTVDKFSSTAYMQLRSLTSEDSAVYYCSR EDDYDGTP | |
| FAMDY WGQGTSVTVSS | |
| Light chain: DNA sequence (381 bp): Leader sequence-FR1-CDR1-FR2-CDR2-FR3- | |
| CDR3-FR4 | |
| (SEQ ID NO: 35) | |
| ATGAGGGTCCTTGCTGAGCTCCTGGGGCTGCTGCTGTTCTGCTTTTTAGGTGTGAGATGT | |
| GACATCCAGATGAACCAGTCTCCATCCAGTCTGTCTGCATCCCTTGGAGACACAATTACCA | |
| TCACTTGC CATGCCAGTCAGAACATTAATGTTTGGTTAAGC TGGTACCAGCAGAAACCAGG | |
| AAATATTCCTAAACTATTGATCTAT AAGGCTTCCAACTTGCACACA GGCGTCCCATCAAGAT | |
| TTACTGGCAGTGGATCTGGAACAGGTTTCACATTAACCATCAGCAGCCTGCAGCCTGAAGA | |
| CATTGCCACTTACTACTGT CAACAGGGTCAAACTTATCCATACACG TTCGGAGGGGGGACC | |
| AAGTTGGAAATAAAG | |
| Light chain: Amino acids sequence (127 AA): Leader sequence-FR1-CDR1-FR2- | |
| CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 36) | |
| MRVLAELLGLLLFCFLGVRC DIQMNQSPSSLSASLGDTITITC HASQNINVWLS WYQQKPGNIP | |
| KLLIY KASNLHT GVPSRFTGSGSGTGFTLTISSLQPEDIATYYC QQGQTYPYT FGGGTKLEIK |
| Heavy chain: DNA sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 37) | |
| CAGGTCCAACTGCAGCAGTCTGGGGCTGAACTGGTGAAGCCTGGGGCTTCAGTGAAGTTG | |
| TCCTGCAAGGCTTCTGGCTACATCTTCACC AGATACTATATGTAT TGGGTGAAGCAGAGGC | |
| CTGGACAAGGCCTTGAGTGGATTGGA GAGATTAATCCTAACAATGGTGGTACTAAGTTCAA | |
| TGAGAAGTTCAAGAAC AAGGCCACACTGACTGTAGACAAATTTTCCAGCACAGCATACATG | |
| CAACTCAGGAGCCTGACATCTGAGGACTCTGCGGTCTATTATTGTTCAA GAGAGGATGATT | |
| ACGACGGGACCCCCTTTGCTATGGACTAC TGGGGTCAAGGAACCTCAGTCACCGTCTCCT | |
| CA | |
| Heavy chain: Amino acids sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 38) | |
| QVQLQQSGAELVKPGASVKLSCKASGYIFT RYYMY WVKQRPGQGLEWIG EINPNNGGTKFNE | |
| KFKN KATLTVDKFSSTAYMQLRSLTSEDSAVYYCSR EDDYDGTPFAMDY WGQGTSVTVSS | |
| Light chain: DNA sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 39) | |
| GACATCCAGATGAACCAGTCTCCATCCAGTCTGTCTGCATCCCTTGGAGACACAATTACCA | |
| TCACTTGC CATGCCAGTCAGAACATTAATGTTTGGTTAAGC TGGTACCAGCAGAAACCAGG | |
| AAATATTCCTAAACTATTGATCTAT AAGGCTTCCAACTTGCACACA GGCGTCCCATCAAGAT | |
| TTACTGGCAGTGGATCTGGAACAGGTTTCACATTAACCATCAGCAGCCTGCAGCCTGAAGA | |
| CATTGCCACTTACTACTGT CAACAGGGTCAAACTTATCCATACACG TTCGGAGGGGGGACC | |
| AAGTTGGAAATAAAG | |
| Light chain: Amino acids sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 40) | |
| DIQMNQSPSSLSASLGDTITITC HASQNINVWLS WYQQKPGNIPKLLIY KASNLHT GVPSRFTGS | |
| GSGTGFTLTISSLQPEDIATYYC QQGQTYPYT FGGGTKLEIK |
| TABLE 2 | ||
| DNA sequence | Aminoacid sequence | |
| H-CDR1 | GGCTTCGCCATTAAC | GFAIN |
| (SEQ ID NO: 41) | (SEQ ID NO: 47) | |
| H-CDR2 | CTTATTTATCCTTACAATGGT | LIYPYNGGTTYSQRFKG |
| GGTACTACCTACAGCCAGA | (SEQ ID NO: 48) | |
| GGTTCAAGGGC | ||
| (SEQ ID NO: 42) | ||
| H-CDR3 | CGGCGGGATGGTTACTCCT | RRDGYSWFAY |
| GGTTTGCTTAC (SEQ ID | (SEQ ID NO: 49) | |
| NO: 43) | ||
| L-CDR1 | AGAGCCAGCGAAAGTGTTG | RASESVENYGIIFMN |
| AGAATTATGGCATTATTTTTA | (SEQ ID NO: 50) | |
| TGAAC (SEQ ID NO: 44) | ||
| L-CDR2 | TCTGCATCCAACCAAGGATC | SASNQGS |
| C (SEQ ID NO: 45) | (SEQ ID NO: 51) | |
| L-CDR3 | CAGCAAAGTAAGGAGGCTC | QQSKEAPFT |
| CGTTCACG (SEQ ID NO: 46) | (SEQ ID NO: 52) | |
| Heavy chain: DNA sequence (bp): Leader sequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 53) | |
| ATGGGATGGAGCTGGATCTTTCTCTTCCTCCTGTCAGGAACTGCAGGTGTCCACTCT GAGGTCC | |
| AGTTGCAACAGTCTGGACCTGAGCTGGTGAAGCCTGGAGCTTCAATGAAGATATCCTGCAAGGC | |
| TTCTGGTTACTCATTCACT GGCTTCGCCATTAAC TGGGTGAAACAGAGCCATGGACAGAACCTT | |
| GAGTGGATTGGG CTTATTTATCCTTACAATGGTGGTACTACCTACAGCCAGAGGTTCAAGGGC A | |
| AGGCCACATTAACTGTAGACAAGTCATCCACCACAGCCTACATGGAGCTCCTCAGTCTGACATC | |
| TGAAGACTCTGCAGTCTATTACTGTGCAAGA CGGCGGGATGGTTACTCCTGGTTTGCTTAC TGG | |
| GGCCAAGGGACTCTGGTCACTGTCTCTGCA | |
| Heavy chain: Amino acids sequence (AA): Leader sequence-FR1-CDR1-FR2-CDR2-FR3- | |
| CDR3-FR4 | |
| (SEQ ID NO: 54) | |
| MGWSWIFLFLLSGTAGVHS EVQLQQSGPELVKPGASMKISCKASGYSFT GFAIN WVKQSHGQNL | |
| EWIG LIYPYNGGTTYSQRFKG KATLTVDKSSTTAYMELLSLTSEDSAVYYCAR RRDGYSWFAY W | |
| GQGTLVTVSA | |
| Light chain: DNA sequence (bp): Leader sequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 55) | |
| ATGGAGAAAGACACACTCCTGCTATGGGGCCTGCTTCTCTGGGTTCCAGCTTCCACAGGT GACA | |
| TTGTGCTGACCCAATCTCCAGCTTCTTTGGCTGTGTCTCTAGGGCAGAGGGCCACCATCTCCTG | |
| C AGAGCCAGCGAAAGTGTTGAGAATTATGGCATTATTTTTATGAAC TGGTTCCAACAGAAACCA | |
| GGACAGCCACCCAAACTCCTCATCTTT TCTGCATCCAACCAAGGATCC GGGGTCCCTGCCAGGT | |
| TTAATGGCAGTGGGTCTGGGACAGACTTCAGCCTCAACATCCATCCTATGGAGGAGGATGATAC | |
| TGCAATGTATTTCTGT CAGCAAAGTAAGGAGGCTCCGTTCACG TTCGGAGGGGGGACCAAGCTG | |
| GAAATAAAA | |
| Light chain: Amino acids sequence (AA): Leader sequence-FR1-CDR1-FR2-CDR2-FR3- | |
| CDR3-FR4 | |
| (SEQ ID NO: 56) | |
| MEKDTLLLWGLLLWVPASTG DIVLTQSPASLAVSLGQRATISC RASESVENYGIIFMN WFQQKP | |
| GQPPKLLIF SASNQGS GVPARFNGSGSGTDFSLNIHPMEEDDTAMYFC QQSKEAPFT FGGGTKL | |
| EIK |
| Heavy chain: DNA sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 57) | |
| GAGGTCCAGTTGCAACAGTCTGGACCTGAGCTGGTGAAGCCTGGAGCTTCAATGAAGATATCCT | |
| GCAAGGCTTCTGGTTACTCATTCACT GGCTTCGCCATTAAC TGGGTGAAACAGAGCCATGGACA | |
| GAACCTTGAGTGGATTGGG CTTATTTATCCTTACAATGGTGGTACTACCTACAGCCAGAGGTTC | |
| AAGGGC AAGGCCACATTAACTGTAGACAAGTCATCCACCACAGCCTACATGGAGCTCCTCAGTC | |
| TGACATCTGAAGACTCTGCAGTCTATTACTGTGCAAGA CGGCGGGATGGTTACTCCTGGTTTGC | |
| TTAC TGGGGCCAAGGGACTCTGGTCACTGTCTCTGCA | |
| Heavy chain: Amino acids sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 58) | |
| EVQLQQSGPELVKPGASMKISCKASGYSFI GFAIN WVKQSHGQNLEWIG LIYPYNGGTTYSQRF | |
| KG KATLTVDKSSTTAYMELLSLTSEDSAVYYCAR RRDGYSWFAY WGQGTLVTVSA | |
| Light chain: DNA sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 59) | |
| GACATTGTGCTGACCCAATCTCCAGCTTCTTTGGCTGTGTCTCTAGGGCAGAGGGCCACCATCT | |
| CCTGC AGAGCCAGCGAAAGTGTTGAGAATTATGGCATTATTTTTATGAA CTGGTTCCAACAGAA | |
| ACCAGGACAGCCACCCAAACTCCTCATCTTT TCTGCATCCAACCAAGGATCC GGGGTCCCTGCC | |
| AGGTTTAATGGCAGTGGGTCTGGGACAGACTTCAGCCTCAACATCCATCCTATGGAGGAGGATG | |
| ATACTGCAATGTATTTCTGT CAGCAAAGTAAGGAGGCTCCG TTCACGTTCGGAGGGGGGACCAA | |
| GCTGGAAATAAAA | |
| Light chain: Amino acids sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 | |
| (SEQ ID NO: 60) | |
| DIVLTQSPASLAVSLGQRATISC RASESVENYGIIFMN WFQQKPGQPPKLLIF SASNQGS GVPA | |
| RFNGSGSGTDFSLNIHPMEEDDTAMYFC QQSKEAPFT FGGGTKLEIK |
-
- (i) introducing in vitro or ex vivo a recombinant nucleic acid or a vector as described above into a competent host cell,
- (ii) culturing in vitro or ex vivo the recombinant host cell obtained, and
- (iii) optionally, selecting the cells which express and/or secrete said antibody. Such recombinant host cells can be used for the production of antibodies of the invention.
-
- (i) culturing a transformed host cell according to the invention under conditions suitable to allow expression of said antibody; and
- (ii) recovering the expressed antibody.
-
- (i) culturing the hybridoma deposited as CNCM I-4401, CNCM I-4402 or CNCM I-4403 under conditions suitable to allow expression of the antibody; and
- (ii) recovering the expressed antibody.
percent specific lysis=100×[(test release)−(spontaneous release)]/[(maximal release)−(spontaneous release)].
| WHO | FAB | % of | ||||||
| Age | Clinical | Classifi- | Classifi- | circulating | ||||
| Patients | Sex | (years) | condition | cation | cation | blasts | ||
| | H | 40 | | 1a | 4 | 80 | ||
| UPN02 | H | 47 | |
4 | 1 | 93 | ||
| UPN03 | F | 62 | |
4 | 2 | 98 | ||
| UPN04 | F | 59 | |
4 | 5a | 94 | ||
| UPN05 | H | 57 | | 1a | 4 | 95 | ||
| UPN06 | H | 81 | |
4 | 0 | 98 | ||
| UPN07 | F | 66 | |
4 | 5a | 92 | ||
| UPN08 | H | 71 | |
4 | 4 | 97 | ||
| UPN09 | H | 54 | Diagnosis | 1a | 5a | 89 | ||
| Iso- | |||
| m Ab/ reactive | type | Use | |
| Control isotype Functional | Ig | eBioscience | in vitro and in |
| grade | G1 | vivo Functional | |
| Anti-BTN3A clone 20.1 | Ig | Home Made | tests |
| Anti-BTN3A clone 108.5 | Ig | In vitro | |
| Anti-TCRVγ9 (IMMU510) | Ig | Functional tests | |
| Human CD45-Fitc | Ig | ||
| Human CD45-APC | Ig | ||
| CD112-PE | Ig | ||
| CD155-PE | Ig | Beckman Coulter | Flow cytometry |
| CD54-Fitc | Ig | ||
| TCR Pan γδ-PE | Ig | ||
| TOR Vδ2-Fitc | Ig | ||
| CD33-PE | Ig | BD Biosciences | |
| CD107a/b-Fitc | Ig | ||
| IFNg-APC | IgG | ||
| MICA/B-PE | IgG | ||
| 7-AAD PE-Cy5 | — | ||
| CD3-AF700 | Ig | eBioscience | |
| G1 | |||
| Murine CD45-APC | |||
| eFluor78 | |||
| Human CD45-V450 | Ig | BioLegend | |
| TNFa-eFluorV450 | Ig | ||
| CD56-PE-Vio770 | Ig | Miltenyi Biotech | |
| ULBP1-PE | IgG | R | |
| ULBP2-APC | IgG | & | |
| ULBP3-PE | IgG | — | |
| Live dead-Amcyan | — | Life technologies | |
| Live dead-Far Red | — | ||
| Count Bright Absolute | — | Quantification of | |
| Counting Beads | blastic cells | ||
- Arnett, H. A., Escobar, S. S., Gonzalez-Suarez, E., Budelsky, A. L., Steffen, L. A., Boiani, N., Zhang, M., Siu, G., Brewer, A. W., and Viney, J. L. 2007. BTNL2, a butyrophilin/B7-like molecule, is a negative costimulatory molecule modulated in intestinal inflammation. J. Immunol. 178: 1523-1533.
- Bensussan, A., Olive, D. 2005. T-cell: section report. Cellular Immunol. 236: 3-5.
- Carreno, B. M., and Collins, M. 2002. The B7 family of ligands and its receptors: new pathways for costimulation and inhibition of immune responses. Annu. Rev. Immunol. 20:29-53.
- Chambers, C. A., Kuhns, M. S., Egen, J. G., and Allison, J. P. 2001. CTLA-4-mediated inhibition in regulation of T cells responses: mechanisms and manipulation in tumor immunotherapy. Annu. Rev. Immunol. 19:565-594.
- Chapoval, A. I., Ni, J., Lau, J. S., Wilcox, R. A., Flies, D. B., Liu, D., Dong, H., Sica, G. L., Zhu, G., Tamada, K., and Chen, L. 2001. B7-H3: a costimulatory molecule for T cell activation and IFN-gamma production. Nat. Immunol. 2:269-274.
- Compte, E., Pontarotti, P., Collette, Y., Lopez, M., and Olive, D. 2004. Characterization of BT3 molecules belong to the B7 family expressed on immune cells. Eur. J. Immunol. 34:2089-2099.
- Coyle, A. J., and Gutierrez-Ramos, J. C. 2001. The expanding B7 superfamily: increasing complexity in costimulatory signals regulating T cell function. Nat. Immunol. 2:203-209.
- Dong, H., Zhu, G., Tamada, K., and Chen, L. 1999. B7-H1, a third member of B7 family, costimulates T cell proliferation and interleukin-10 secretion. Nat. Med. 5:1365-1369.
- Durum, S. K., Schmidt, J. A., and Oppenheim, J. J. 1985. Inteleukin 1: an immunological Perspective. Annu. Rev. Immunol. 3:263-287.
- Eisenberg, S. P., Evans, R. J., Arend, W. P., Verderber, E., Brewer, M. T., Hannun, C. H., Thompson, R. C. 1990. Primary structure and functional expression from complementary DNA of a human interleukin-1 receptor antagonist. Nature. 343:341-346.
- Freeman, G. J., Long, A. J., lwai, Y., Bourque, K., Chernova, T., Nishimura, H., Fitz, L. J., Malenkovich, N., Okazaki, T., Byrne M. C., Horton, H. F., Fouser, L., Carter, L., Ling, V., Bowman, M. R., Carreno, B. M., Collins, M., Wood, C. R., and Honjo, T. 2000. Engagement of the PD-1 immunoinhibitory receptor by a novel B7 family member leads to negative regulation of lymphocyte activation. J. Exp. Med. 192:1027-1034.
- Fulton, S. A., Johnsen, J. M., Wolf, S. F., Sieburth, D. S., and Boom, W. H. 1996. Interleukin-12 production by human monocytes infected with Mycobacterium tuberculosis: role of phagocytosis. Infect. Immun. 64:2523-2531.
- Grob, P. M., David, E., Warren, T. C., De Leon, R. P., Farina, P. R., and Homon, C. A. 1990. Characterization of a receptor for human monocyte-derived neutrophil chemotactic factor/interleukin-8. J. Biol. Chem. 265:8311-8316.
- Henry, J., Mather, I. H., McDermott, M. F., and Pontarotti, P. 1998. B30.2-like domain proteins: update and new insights into a rapidly expanding family of proteins. Mol. Biol. Evol. 15:1696-1705.
- Henry, J., Miller, M., and Pontarotti, P. 1999. Structure and evolution of the extended B7 family. Immunol. Today. 20:285-288.
- Hutloff, A., Dittrich, A. M., Beier, K. C., Eljaschewitsch, B., Kraft, R., Anagnostopoulos, I., and Kroczek, R. A. 1999. ICOS is an inducible T cell co-stimulator structurally and functionally related to CD28. Nature. 397: 263-266.
- June, C. H., Bluestone, J. A., Nadler, L. M., and Thompson, C. B. 1994. The B7 and CD28 receptor families. Immunol. Today. 15:321-331.
- Kaufman, J., and Salomonsen, J. 1992. B-G: we know what it is, but what does it do? Immunol. Today. 13: 1-3.
- Latchman, Y., Wood, C. R., Chernova, T., Chaudhary, D., Borde, M., Chernova, I., lwai, Y., Long, A. J., Brown, J. A., Nunes R., Greenfield, E. A., Bourque, K., Boussiotis, V. A., Carter, L. L., Carreno, B. M., Malenkovich, N., Nishimura, H., Okazaki, T., Honjo, T., Sharpe, A. H., and Freeman, G. J. 2001. PD-L2 is a second ligand for PD-1 and inhibits T cell activation. Nat. Immunol. 2:261-274.
- Ledbetter, J. A., Imboden, J. B., Schieven, G. L., Grosmaire, L. S., Rabinovitch, P. S., Lindsten, T., Thompson, C. B., and June, C. H. 1990. CD28 ligation in T-cell activation: evidence for two signal transduction pathways. Blood. 75:1531-1539.
- Lenschow, D. J., Walunas, T. L., and Bluestone, J. A. 1996. CD28/B7 of T cell co-stimulation. Annu. Rev. Immnuol. 14:233-258.
- Linsley, P. S., Greene, J. L., Tane, P., Bradshaw, J., Ledbetter, J. A., Anasetti, C., and Damle, N. K. 1992. Coexpression and functional cooperation of CTLA-4 and CD28 on activated T lymphocytes. J. Exp. Med. 176:1595-15604.
- Linsley, P. S., and Ledbetter, J. A. 1993. The role of the CD 28 receptor during T cell responses to antigen. Annu. Rev. Immunol. 11:191-212.
- Liu, Y., and Linsley, P. S. 1992. Costimulation of T-cell growth. Curr. Opin. Immunol. 4:265-270.
- Ma, X., Chow, J. M., Gri, G., Carra, G., Gerosa, F., Wolf, S. F., Dzialo, R., and Trinchieri, G. 1996. The interleukin-12 p40 gene promoter is primed by interferon gamma in monocytic cells. J. Exp. Med. 183:147-157.
- Medzhitov, R. 2001. Toll-like receptors and innate immunity. Nat. Rev. Immunol. 1:135-145.
- Nurieva, R., Thomas, S., Nguyen, T., Martin-Orozco, N., Wang, Y., Kaja, M. K., Yu, X. Z., and Dong, C. 2006. T-cell tolerance or function is determined by combinatorial costimulatory signals. Embo J. 25:2623-2633.
- Price, P., Santoso, F., Mastaglia, M., Garlepp, C., Kok, C., Allcock, R., and Laing, N. 2004. Two major histocompatibility complex haplotypes influence susceptibility to sporadic inclusion body myositis: critical evaluation of an association with HLA-DR3. Tissue Antigens. 64: 575-580.
- Rhodes, D. A., Stammers, M., Malcherek, G., Beck, S., and Trowsdale, J. 2001. The cluster of BTN genes in the extended major histocompatibility complex. Genomics. 71: 351-362.
- Ruddy, D. A., Kronmal, G. S., Lee, V. K., Mintier, G. A., Quintana, L., Domingo, R. Jr., Meyer, N. C., Irrinki, A., McClelland, E. E., Fullan, A., Mapa, F. A., Moore, T., Thomas, W., Loeb, D. B., Harmon, C., Tsuchihashi, Z., Wolff, R. K., Schatzman, R. C., Feder, J. N. 1997. A 1.1-Mb transcript map of the hereditary hemochromatosis locus. Genome Res. 7: 441-456.
- Rybicki, B. A., Walewski, J. L., Maliarik, M. J., Kian, H., and Iannuzzi, M. C. 2005. The BTNL2 gene and sarcoidosis susceptibility in African Americans and Whites. Am. J. Hum. Genet. 77: 491-499.
- Salmaso, C., Olive, D., Pesce, G., and Bagnasco, M. 2002. Costimulatory molecules and auoimmune thyroid diseases. Autoimmunity. 35:159-167.
- Saverino, D., Tenca, C., Zarcone, D., Merlo, A., Megiovanni, A. M., Valle, M. T., Manca, F., Grossi, C. E., and Ciccone, E. 1998. CTLA-4 (CD152) inhibits the specific lysis mediated by human cytolytic T lymphocytes in a clonally distributed fashion. J. Immunol. 162:651-658.
- Sun, M., Richards, S., Prasad, D. V., Mai, X. M., Rudensky, A., and Dong, C. 2002. Characterization of mouse and human B7-H3 genes. J. Immunol. 168:6294-6297.
- Takeda, K., and Akira, S. 2003. Toll receptors and pathogen resistance. Cell Microbiol. 5:143-153.
- Tseng, S. Y., Otsuji, M., Gorski, K., Huang, X., Slansky, J. E., Pai, S. I., Shalabi, A., Shin, T., Pardoll, D. M., and Tsuchiya, H. 2001. B7-DC, a new dendritic cell molecule with potent costimulatory properties for T cells. J. Exp. Med. 193:839-846.
- Valentonyte, R., Hampe, J., Huse, K., Rosenstiel, P., Albrecht, M., Stenzel, A., Nagy, M., Gaede, K. I., Franke, A., Haesler, R., Koch, A, Lengauer, T., Seegert, D., Reiling, N., Ehlers, S., Schwinger, E., Platzer, M., Krawczak, M., Müller-Quernheim, J., Schürmann, M., Schreiber, S. 2005. Sarcoidosis is associated with a truncating splice site mutation in BTNL2. Nat. Genet. 37: 357-364-364.
- Walunas, T. L., Lenschow, D. J., Bakker, C. Y., Linsley, P. S., Freeman, G. J., Green, J. M., Thompson, C. B., and Bluestone, J. A. 1994. CTLA-4 can function as a negative regulator of T cell activation. Immunity. 1:405-413.
- Walunas, T. L., and Bluestone, J. A. 1998. CTLA-4 regulates tolerance induction and T cell differentiation in vivo. J. Immunol. 160:3855-3860.
- Waterhouse, P., Penninger, J. M., Timms, E., Wakeham, A., Shahinian, A., Lee, K. P., Thompson, C. B., Griesser, H., and Mak, T. W. 1995. Lymphoproliferative disorders with early lethality in mice deficient in Ctla-4. Science. 270: 985-988.
- Waterhouse, P., Marengere, L. E. M., Mittrucker, H.-W., and Mak, T. W. 1996. CTLA-4, a negative regulator of T-lymphocyte activation. Immnunol. Rev. 153:183-207.
- Williams, A. F., and Barclay, A. N. 1988. The immunoglobulin superfamily-domains for cell surface recognition. Annu. Rev. Immunol. 6: 381-405.
- Wolf, S. F., Sieburth, D., and Sypek, J. 1994. Interleukin-12: a key modulator of immune function. Stem Cells Dayt. 12:154-168.
- Yi-qun, Z., Lorre, K., de Boer, M., and Ceuppens, J. L. 1997. B7-blocking agents, alone or in combination with cyclosporin A, induce antigen-specific anergy of human memory T cells. J. Immunol. 158:4734-4740.
- 1. Sharpe, A. H. and G. J. Freeman, The B7-CD28 superfamily. Nat Rev Immunol, 2002. 2(2): p. 116-26.
- 2. Greenwald, R. J., G. J. Freeman, and A. H. Sharpe, The B7 family revisited. Annu Rev Immunol, 2005. 23: p. 515-48.
- 3. Croft, M., Co-stimulatory members of the TNFR family: keys to effective T-cell immunity? Nat Rev Immunol, 2003. 3(8): p. 609-20.
- 4. Watts, T. H., TNF/TNFR family members in costimulation of T cell responses. Annu Rev Immunol, 2005. 23: p. 23-68.
- 5. Ishida, Y., et al., Induced expression of PD-1, a novel member of the immunoglobulin gene superfamily, upon programmed cell death. Embo J, 1992. 11(11): p. 3887-95.
- 6. Chambers, C. A. and J. P. Allison, Co-stimulation in T cell responses. Curr Opin Immunol, 1997. 9(3): p. 396-404.
- 7. Lenschow, D. J., T. L. Walunas, and J. A. Bluestone, CD28/B7 system of T cell costimulation. Annu Rev Immunol, 1996. 14: p. 233-58.
- 8. June, C. H., et al., The B7 and CD28 receptor families. Immunol Today, 1994. 15(7): p. 321-31.
- 9. Boise, L. H., et al., CD28 costimulation can promote T cell survival by enhancing the expression of Bcl-XL. Immunity, 1995. 3(1): p. 87-98.
- 10. Linsley, P. S., et al., CTLA-4 is a second receptor for the B cell activation antigen B7. J Exp Med, 1991. 174(3): p. 561-9.
- 11. Tazi-Ahnini, R., et al., Cloning, localization, and structure of new members of the butyrophilin gene family in the juxta-telomeric region of the major histocompatibility complex. Immunogenetics, 1997. 47(1): p. 55-63.
- 12. Rhodes, D. A., et al., The cluster of BTN genes in the extended major histocompatibility complex. Genomics, 2001. 71(3): p. 351-62.
- 13. Henry, J., et al., Cloning, structural analysis, and mapping of the B30 and B7 multigenic families to the major histocompatibility complex (MHC) and other chromosomal regions. Immunogenetics, 1997. 46(5): p. 383-95.
- 14. Henry, J., et al., B30.2-like domain proteins: a growing family. Biochem Biophys Res Commun, 1997. 235(1): p. 162-5.
- 15. Ogg, S. L., et al., Expression of butyrophilin (Btn1a1) in lactating mammary gland is essential for the regulated secretion of milk-lipid droplets. Proc Natl Acad Sci USA, 2004. 101(27): p. 10084-9.
- 16. Robenek, H., et al., Butyrophilin controls milk fat globule secretion. Proc Natl Acad Sci USA, 2006. 103(27): p. 10385-90.
- 17. Ishii, T., et al., Carboxy-terminal cytoplasmic domain of mouse butyrophilin specifically associates with a 150-kDa protein of mammary epithelial cells and milk fat globule membrane. Biochim Biophys Acta, 1995. 1245(3): p. 285-92.
- 18. Henry, J., et al., B30.2-like domain proteins: update and new insights into a rapidly expanding family of proteins. Mol Biol Evol, 1998. 15(12): p. 1696-705.
- 19. Ruddy, D. A., et al., A 1.1-Mb transcript map of the hereditary hemochromatosis locus.
- 20. Henry, J., M. M. Miller, and P. Pontarotti, Structure and evolution of the extended B7 family. Immunol Today, 1999. 20(6): p. 285-8.
- 21. Compte, E., et al., Frontline: Characterization of BT3 molecules belonging to the B7 family expressed on immune cells. Eur J Immunol, 2004. 34(8): p. 2089-99.
- 22. Malcherek, G., L. Mayr, P. Roda-Navarro, D. Rhodes, N. Miller, and J. Trowsdale. 2007. The B7 homolog butyrophilin BTN2A1 is a novel ligand for DC-SIGN. J. Immunol. 179: 3804-3811.
- 23. Nguyen, T., X. K. Liu, Y. Zhang, and C. Dong. 2006. BTNL2, a butyrophilin-like molecule that functions to inhibit T cell activation. J. Immunol. 176: 7354-736
- 24. Arnett, H. A., S. S. Escobar, E. Gonzalez-Suarez, A. L. Budelsky, L. A. Steffen, N. Boiani, M. Zhang, G. Siu, A. W. Brewer, and J. L. Viney. 2007. BTNL2, a butyrophilin/B7-like molecule, is a negative costimulatory molecule modulated in intestinal inflammation. J. Immunol. 178: 1523-1533.
- 25. Xerri L, Devilard E, Hassoun J, et al. In vivo expression of the CTLA4 inhibitory receptor in malignant and reactive cellsfrom human lymphomas. J Pathol. 1997; 183:182-187.
- 26. Yamashiro H, Yoshizaki S, Tadaki T, Egawa K and Seo N. 2010. Stimulation of human butyrophilin 3 molecules results in negative regulation of cellular immunity.
- 27. Firaguay G and Nunes J A. 2009. Analysis of signaling events by dynamic phosphoflow cytometry. Sience Signaling.
- 1. Tanaka, Y. et coll. Natural and synthetic non-peptide antigens recognized by human gamma delta T cells. Nature 375, 155-8(1995).
- 2. Halary, F. et coll. Control of self-reactive cytotoxic T lymphocytes expressing gamma delta T cell receptors by natural killer inhibitory receptors. Eur J Immunol 27, 2812-21(1997).
- 3. Das, H. et coll. MICA engagement by human Vgamma2Vdelta2 T cells enhances their antigen-dependent effector function.
Immunity 15, 83-93(2001). - 4. Deetz, C. O. et coll. Gamma interferon secretion by human Vgamma2Vdelta2 T cells after stimulation with antibody against the T-cell receptor plus the Toll-
Like receptor 2 agonist Pam3Cys. Infect Immun 74, 4505-11(2006). - 5. Wesch, D. et coll. Direct costimulatory effect of TLR3 ligand poly(I:C) on human gamma delta T lymphocytes. J Immunol 176, 1348-54(2006).
- 6. Rincon-Orozco, B. et coll. Activation of V gamma 9V delta 2 T cells by NKG2D. J Immunol 175, 2144-51(2005).
- 7. Boyden, L. M. et coll. Skint1, the prototype of a newly identified immunoglobulin superfamily gene cluster, positively selects epidermal gammadelta T cells.
Nat Genet 40, 656-62(2008). - 8. Stammers, M. et coll. BTL-II: a polymorphic locus with homology to the butyrophilin gene family, located at the border of the major histocompatibility complex class II and class III regions in human and mouse. Immunogenetics 51, 373-82(2000).
- 9. Arnett, H. A. et coll. BTNL2, a butyrophilin/B7-like molecule, is a negative costimulatory molecule modulated in intestinal inflammation. J Immunol 178, 1523-33(2007).
- 10. Compte, E. et coll. Frontline: Characterization of BT3 molecules belonging to the B7 family expressed on immune cells. Eur J Immunol 34, 2089-99(2004).
- 11. Mann, M. et coll. Analysis of protein phosphorylation using mass spectrometry: deciphering the phosphoproteome.
Trends Biotechnol 20, 261-8(2002). - 12. Cantin, G. T. et coll. Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res 7, 1346-51(2008).
- 13. Villén, J. et coll. Large-scale phosphorylation analysis of mouse liver. Proc Natl
Acad Sci USA 104, 1488-93(2007). - 14. Park, H. et coll. A point mutation in the murine Hem1 gene reveals an essential role for
Hematopoietic protein 1 in lymphopoiesis and innate immunity. J Exp Med 205, 2899-913(2008). - 15. Wang, Y. et coll. Profiling signaling polarity in chemotactic cells. Proc Natl
Acad Sci USA 104, 8328-33(2007). - 16. Tzivion, G., Luo, Z. & Avruch, J. A dimeric 14-3-3 protein is an essential cofactor for Raf kinase activity. Nature 394, 88-92(1998).
- 17. Di Bartolo, V. et coll. A novel pathway down-modulating T cell activation involves HPK-1-dependent recruitment of 14-3-3 proteins on SLP-76. J Exp Med 204, 681-91(2007).
- 18. Zhang, H. et coll. RIP1-mediated AIP1 phosphorylation at a 14-3-3-binding site is critical for tumor necrosis factor-induced ASK1-JNK/p38 activation. J Biol Chem 282, 14788-96(2007).
- 19. Parker, F. et coll. A Ras-GTPase-activating protein SH3-domain-binding protein. Mol Cell Biol 16, 2561-9(1996).
- 20. Tourrière, H. et coll. The RasGAP-associated endoribonuclease G3BP assembles stress granules.
J Cell Biol 160, 823-31(2003). - 21. Rahmouni, S. et coll. Removal of C-terminal SRC kinase from the immune synapse by a new binding protein.
Mol Cell Biol 25, 2227-41(2005). - 22. Grewal, T. et coll. Annexin A6 stimulates the membrane recruitment of p120GAP to modulate Ras and Raf-1 activity. Oncogene 24, 5809-20(2005).
- 23. Li, M., Makkinje, A. & Damuni, Z. The myeloid leukemia-associated protein SET is a potent inhibitor of protein phosphatase 2A. J Biol Chem 271, 11059-62(1996).
- 24. Grantham, J. et coll. Eukaryotic chaperonin containing T-
complex polypeptide 1 interacts with filamentous actin and reduces the initial rate of actin polymerization in vitro. Cell Stress Chaperones 7, 235-42(2002). - 25. Williams, J. C., Xie, H. & Hendrickson, W. A. Crystal structure of dynein light chain TcTex-1. J Biol Chem 280, 21981-6(2005).
- 26. Sachdev, P. et coll. G protein beta gamma subunit interaction with the dynein light-chain component Tctex-1 regulates neurite outgrowth. EMBO J 26, 2621-32(2007).
- 27. Schnapp, B. J. & Reese, T. S. Dynein is the motor for retrograde axonal transport of organelles. Proc Natl Acad Sci USA 86, 1548-52(1989).
- 28. Wang, Y. et coll. Rim is a putative Rab3 effector in regulating synaptic-vesicle fusion. Nature 388, 593-8(1997).
- 29. Martin-Cofreces, N. B. et coll. MTOC translocation modulates IS formation and controls sustained T cell signaling. J Cell Biol 182, 951-62(2008).
- 30. Stremlau, M. et coll. The cytoplasmic body component TRIM5alpha restricts HIV-1 infection in Old World monkeys. Nature 427, 848-53(2004).
- 31. Jéru, I. et coll. Interaction of pyrin with 14.3.3 in an isoform-specific and phosphorylation-dependent manner regulates its translocation to the nucleus. Arthritis Rheum 52, 1848-57(2005).
- 32. Mansfield, E. et coll. The familial Mediterranean fever protein, pyrin, associates with microtubules and colocalizes with actin filaments. Blood 98, 851-9(2001).
- 33. Yu, J. et coll. Pyrin activates the ASC pyroptosome in response to engagement by autoinflammatory PSTPIP1 mutants. Mol Cell 28, 214-27(2007).
- 34. Badour, K. et coll. The Wiskott-Aldrich syndrome protein acts downstream of CD2 and the CD2AP and PSTPIP1 adaptors to promote formation of the immunological synapse. Immunity 18, 141-54(2003).
- 35. Côté, J. et coll. PSTPIP is a substrate of PTP-PEST and serves as a scaffold guiding PTP-PEST toward a specific dephosphorylation of WASP. J Biol Chem 277, 2973-86(2002).
- 36. Maeda, Y. et coll. Critical role of host gammadelta T cells in experimental acute graftversus-host disease. Blood 106, 749-55(2005).
- 37. Pabst, C. et coll. The graft content of donor T cells expressing gamma delta TCR+ and CD4+foxp3+ predicts the risk of acute graft versus host disease after transplantation of allogeneic peripheral blood stem cells from unrelated donors. Clin Cancer Res 13, 2916-22(2007).
- 38. Fitch, W. Toward defining the courfe of evolution: minimum change for a specific tree topology. Systematic Zoology 406-416(1971).
- 39. Felsenstein, J. Evolutionary trees from DNA sequences: a maximum likelihood approach.
J Mol Evol 17, 368-76(1981). - 40. Saitou, N. & Nei, M. The neighbor-joining method: a new method for reconstructing phylogenetic trees.
Mol Biol Evol 4, 406-25(1987). - 41. Gouret, P. et coll. FIGENIX: Intelligent automation of genomic annotation: expertise integration in a new software platform.
BMC Bioinformatics 6, 198(2005).
- 1. Butturini A, Bortin M M, Gale R P. Graft-versus-leukemia following bone marrow transplantation. Bone Marrow Transplant. 1987; 2(3):233-242.
- 2. Kunzmann V, Bauer E, Feurle J, et al. Stimulation of gammadelta T cells by aminobisphosphonates and induction of antiplasma cell activity in multiple myeloma. Blood. 2000; 96(2):384-392.
- 3. Castella B, Vitale C, Coscia M, Massaia M. Vγ9Vδ2 T cell-based immunotherapy in hematological malignancies: from bench to bedside. Cell. Mol. Life Sci. CMLS. 2011; 68(14):2419-2432.
- 4. Kabelitz D, Wesch D, Pitters E, Zoller M. Characterization of tumor reactivity of human V
gamma 9V delta 2 gamma delta T cells in vitro and in SCID mice in vivo. J. Immunol. Baltim. Md 1950. 2004; 173(11):6767-6776. - 5. Norell H, Moretta A, Silva-Santos B, Moretta L. At the Bench: Preclinical rationale for exploiting NK cells and γδ T lymphocytes for the treatment of high-risk leukemias. J. Leukoc. Biol. 2013; 94(6):1123-1139.
- 6. Locatelli F, Merli P, Rutella S. At the Bedside: Innate immunity as an immunotherapy tool for hematological malignancies. J. Leukoc. Biol. 2013; 94(6):1141-1157.
- 7. Godder K T, Henslee-Downey P J, Mehta J, et al. Long term disease-free survival in acute leukemia patients recovering with increased gammadelta T cells after partially mismatched related donor bone marrow transplantation. Bone Marrow Transplant. 2007; 39(12):751-757.
- 8. Meeh P F, King M, O'Brien R L, et al. Characterization of the gammadelta T cell response to acute leukemia. Cancer Immunol. Immunother. CII. 2006; 55(9):1072-1080.
- 9. Gober H-J, Kistowska M, Angman L, et al. Human T cell receptor gammadelta cells recognize endogenous mevalonate metabolites in tumor cells. J. Exp. Med. 2003; 197(2):163-168.
- 10. Correia D V, Lopes A, Silva-Santos B. Tumor cell recognition by γδ T lymphocytes: T-cell receptor vs. N K-cell receptors. Oncoimmunology. 2013; 2(1):e22892.
- 11. Bottino C, Castriconi R, Pende D, et al. Identification of PVR (CD155) and Nectin-2 (CD112) as cell surface ligands for the human DNAM-1 (CD226) activating molecule. J. Exp. Med. 2003; 198(4):557-567.
- 12. Rincon-Orozco B, Kunzmann V, Wrobel P, et al. Activation of V gamma 9V delta 2 T cells by NKG2D. J. Immunol. Baltim. Md 1950. 2005; 175(4):2144-2151.
- 13. Gertner-Dardenne J, Castellano R, Mamessier E, et al. Human Vγ9Vδ2 T cells specifically recognize and kill acute myeloid leukemic blasts. J. Immunol. 2012; 188(9):4701-4708.
- 14. Li J, Herold M J, Kimmel B, et al. Reduced expression of the mevalonate pathway enzyme farnesyl pyrophosphate synthase unveils recognition of tumor cells by Vgamma9Vdelta2 T cells. J. Immunol. 2009; 182(12):8118-8124.
- 15. Kunzmann V, Smetak M, Kimmel B, et al. Tumor-promoting versus tumor-antagonizing roles of γδ T cells in cancer immunotherapy: results from a prospective phase I/II trial. J. Immunother. 2012; 35(2):205-213.
- 16. Coscia M, Vitale C, Peola S, et al. Dysfunctional Vγ9Vδ2 T cells are negative prognosticators and markers of dysregulated mevalonate pathway activity in chronic lymphocytic leukemia cells. Blood. 2012; 120(16):3271-3279.
- 17. Wilhelm M, Smetak M, Schaefer-Eckart K, et al. Successful adoptive transfer and in vivo expansion of haploidentical γδ T cells. J. Transl. Med. 2014; 12:45.
- 18. Gundermann S, Klinker E, Kimmel B, et al. A comprehensive analysis of primary acute myeloid leukemia identifies biomarkers predicting susceptibility to human allogeneic Vγ9Vδ2 T cells. J. Immunother. 2014; 37(6):321-330.
- 19. Compte E, Pontarotti P, Collette Y, Lopez M, Olive D. Frontline: Characterization of BT3 molecules belonging to the B7 family expressed on immune cells. Eur. J. Immunol. 2004; 34(8):2089-2099.
- 20. Le Page C, Marineau A, Bonza P K, et al. BTN3A2 expression in epithelial ovarian cancer is associated with higher tumor infiltrating T cells and a better prognosis. PloS One. 2012; 7(6):e38541.
- 21. Messal N, Mamessier E, Sylvain A, et al. Differential role for CD277 as a co-regulator of the immune signal in T and N K cells. Eur. J. Immunol. 2011; 41(12):3443-3454.
- 22. Simone R, Barbarat B, Rabellino A, et al. Ligation of the BT3 molecules, members of the B7 family, enhance the proinflammatory responses of human monocytes and monocyte-derived dendritic cells. Mol. Immunol. 2010; 48(1-3):109-118.
- 23. Harly C, Guillaume Y, Nedellec S, et al. Key implication of CD277/butyrophilin-3 (BTN3A) in cellular stress sensing by a major human γδ T-cell subset. Blood. 2012; 120(11):2269-2279.
- 24. Wang H, Henry O, Distefano M D, et al. Butyrophilin 3A1 plays an essential role in prenyl pyrophosphate stimulation of human Vγ2Vδ2 T cells. J. Immunol. 2013; 191(3):1029-1042.
- 25. Sandstrom A, Peigné C-M, Léger A, et al. The intracellular B30.2 domain of butyrophilin 3A1 binds phosphoantigens to mediate activation of human Vγ9Vδ2 T cells. Immunity. 2014; 40(4):490-500.
- 26. Palakodeti A, Sandstrom A, Sundaresan L, et al. The molecular basis for modulation of human Vγ9Vδ2 T cell responses by CD277/butyrophilin-3 (BTN3A)-specific antibodies. J. Biol. Chem. 2012; 287(39):32780-32790.
- 27. Mortier E, Quéméner A, Vusio P, et al. Soluble interleukin-15 receptor alpha (IL-15R alpha)-sushi as a selective and potent agonist of IL-15 action through IL-15R beta/gamma. Hyperagonist IL-15×IL-15R alpha fusion proteins. J. Biol. Chem. 2006; 281(3):1612-1619.
- 28. Gertner J, Wiedemann A, Poupot M, Fournié J-J. Human gammadelta T lymphocytes strip and kill tumor cells simultaneously. Immunol. Lett. 2007; 110(1):42-53.
- 29. Gertner-Dardenne J, Poupot M, Gray B, Fournié J-J. Lipophilic fluorochrome trackers of membrane transfers between immune cells. Immunol. Invest. 2007; 36(5-6):665-685.
- 30. Sanchez P V, Perry R L, Sarry J E, et al. A robust xenotransplantation model for acute myeloid leukemia. Leukemia. 2009; 23(11):2109-2117.
- 31. Pende D, Spaggiari G M, Marcenaro S, et al. Analysis of the receptor-ligand interactions in the natural killer-mediated lysis of freshly isolated myeloid or lymphoblastic leukemias: evidence for the involvement of the Poliovirus receptor (CD155) and Nectin-2 (CD112). Blood. 2005; 105(5):2066-2073.
- 32. Moretta L, Bottino C, Pende D, et al. Human natural killer cells: Molecular mechanisms controlling N K cell activation and tumor cell lysis. Immunol. Lett. 2005; 100(1):7-13.
- 33. Knorr D A, Bachanova V, Verneris M R, Miller J S. Clinical utility of natural killer cells in cancer therapy and transplantation. Semin. Immunol. 2014; 26(2):161-172.
- 34. Uchida R, Ashihara E, Sato K, et al. Gamma delta T cells kill myeloma cells by sensing mevalonate metabolites and ICAM-1 molecules on cell surface. Biochem. Biophys. Res. Commun. 2007; 354(2):613-618.
- 35. Liu Z, Guo B, Lopez R D. Expression of intercellular adhesion molecule (ICAM)-1 or ICAM-2 is critical in determining sensitivity of pancreatic cancer cells to cytolysis by human gammadelta-T cells: implications in the design of gammadelta-T-cell-based immunotherapies for pancreatic cancer. J. Gastroenterol. Hepatol. 2009; 24(5):900-911.
- 36. Ruggeri L, Capanni M, Urbani E, et al. Effectiveness of donor natural killer cell alloreactivity in mismatched hematopoietic transplants. Science. 2002; 295(5562):2097-2100.
- 37. Idrees A S M, Sugie T, Inoue C, et al. Comparison of γδ T cell responses and farnesyl diphosphate synthase inhibition in tumor cells pretreated with zoledronic acid. Cancer Sci. 2013; 104(5):536-542.
- 38. Decaup E, Duault C, Bezombes C, et al. Phosphoantigens and butyrophilin 3A1 induce similar intracellular activation signaling in human TCRVγ9+γδ T lymphocytes. Immunol. Lett. 2014; 161(1):133-137.
- 39. Wilhelm M, Kunzmann V, Eckstein S, et al. Gammadelta T cells for immune therapy of patients with lymphoid malignancies. Blood. 2003; 102(1):200-206.
- 40. Riaño F, Karunakaran M M, Starick L, et al. Vγ9Vδ2 TCR-activation by phosphorylated antigens requires butyrophilin 3 A1 (BTN3A1) and additional genes on
human chromosome 6. Eur. J. Immunol. 2014; 44(9):2571-2576. - 41. Hodi F S, O'Day S J, McDermott D F, et al. Improved survival with ipilimumab in patients with metastatic melanoma. N. Engl. J. Med. 2010; 363(8):711-723.
- 42. Topalian S L, Hodi F S, Brahmer J R, et al. Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. N. Engl. J. Med. 2012; 366(26):2443-2454.
- 43. Bashey A, Medina B, Corringham S, et al. CTLA4 blockade with ipilimumab to treat relapse of malignancy after allogeneic hematopoietic cell transplantation. Blood. 2009; 113(7):1581-1588.
- 44. Ansell S M, Lesokhin A M, Borrello I, et al. PD-1 Blockade with Nivolumab in Relapsed or Refractory Hodgkin's Lymphoma. N. Engl. J. Med. 2014;
Claims (11)
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/896,556 US11904004B2 (en) | 2010-12-15 | 2020-06-09 | Anti-CD277 antibodies |
| US18/061,791 US20230285527A1 (en) | 2010-12-15 | 2022-12-05 | Anti-cd277 antibodies and uses thereof |
Applications Claiming Priority (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| WOPCT/IB2010/003417 | 2010-12-15 | ||
| IBPCT/IB2010/003417 | 2010-12-15 | ||
| PCT/IB2010/003417 WO2012080769A1 (en) | 2010-12-15 | 2010-12-15 | Anti-cd277 antibodies and uses thereof |
| PCT/EP2011/072787 WO2012080351A1 (en) | 2010-12-15 | 2011-12-14 | Anti-cd277 antibodies and uses thereof |
| US14/791,528 US20150353643A1 (en) | 2013-09-24 | 2015-07-06 | Anti-cd277 antibodies and uses thereof |
| US16/283,733 US11052960B2 (en) | 2018-02-22 | 2019-02-22 | Transportation device with selective enabling of fore-aft auto-balancing |
| US16/896,556 US11904004B2 (en) | 2010-12-15 | 2020-06-09 | Anti-CD277 antibodies |
Related Parent Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/283,733 Continuation US11052960B2 (en) | 2010-12-15 | 2019-02-22 | Transportation device with selective enabling of fore-aft auto-balancing |
| US16/282,733 Continuation US10716838B2 (en) | 2010-12-15 | 2019-02-22 | Anti-CD277 antibodies |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US18/061,791 Continuation US20230285527A1 (en) | 2010-12-15 | 2022-12-05 | Anti-cd277 antibodies and uses thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20200376104A1 US20200376104A1 (en) | 2020-12-03 |
| US11904004B2 true US11904004B2 (en) | 2024-02-20 |
Family
ID=89898268
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/896,556 Active 2033-04-11 US11904004B2 (en) | 2010-12-15 | 2020-06-09 | Anti-CD277 antibodies |
Country Status (1)
| Country | Link |
|---|---|
| US (1) | US11904004B2 (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN121532424A (en) * | 2023-08-04 | 2026-02-13 | 江苏恒瑞医药股份有限公司 | BTN3A binding protein and medical application thereof |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100166740A1 (en) * | 2004-09-17 | 2010-07-01 | Roche Palo Alto Llc | Anti-OX40L antibodies |
| US10716838B2 (en) * | 2010-12-15 | 2020-07-21 | Inserm (Institut National De La Sante Et De La Recherche Medicale) | Anti-CD277 antibodies |
-
2020
- 2020-06-09 US US16/896,556 patent/US11904004B2/en active Active
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100166740A1 (en) * | 2004-09-17 | 2010-07-01 | Roche Palo Alto Llc | Anti-OX40L antibodies |
| US10716838B2 (en) * | 2010-12-15 | 2020-07-21 | Inserm (Institut National De La Sante Et De La Recherche Medicale) | Anti-CD277 antibodies |
Non-Patent Citations (1)
| Title |
|---|
| Elsa Compte et al., ,Characterization of BT3 molecules belonging to the B7 family expressed on immune cells, Eur. J. Immunol. 34: 2089-2099, 2004. (Year: 2004). * |
Also Published As
| Publication number | Publication date |
|---|---|
| US20200376104A1 (en) | 2020-12-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10716838B2 (en) | Anti-CD277 antibodies | |
| EP2946791B1 (en) | Anti-CD277 antibodies and uses thereof | |
| US9896507B2 (en) | BTLA antibodies and uses thereof | |
| KR102098985B1 (en) | Cs1-specific chimeric antigen receptor engineered immune effector cells | |
| JP2020510657A (en) | Combination of anti-CD16A antibody with cytokine | |
| AU2025203410A1 (en) | Anti-TCR antibody molecules and uses thereof | |
| JP7358369B2 (en) | CD83-binding chimeric antigen receptor | |
| WO2019152743A1 (en) | Combination therapy using adoptive cell therapy and checkpoint inhibitor | |
| JP2025083396A (en) | Chimeric antigen receptors for treating myeloid malignancies | |
| US11904004B2 (en) | Anti-CD277 antibodies | |
| US20230285527A1 (en) | Anti-cd277 antibodies and uses thereof | |
| AU2024276506A1 (en) | Immune effector cell and use thereof | |
| KR20250172548A (en) | Novel CD19-targeting polypeptides and CD19-directed immunotherapies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE (CNRS), FRANCE Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM);INSTITUT JEAN PAOLI & IRENE CALMETTES;UNIVERSITE D'AIX-MARSEILLE;SIGNING DATES FROM 20151113 TO 20151129;REEL/FRAME:052880/0560 Owner name: INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM), FRANCE Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM);INSTITUT JEAN PAOLI & IRENE CALMETTES;UNIVERSITE D'AIX-MARSEILLE;SIGNING DATES FROM 20151113 TO 20151129;REEL/FRAME:052880/0560 Owner name: INSTITUT JEAN PAOLI & IRENE CALMETTES, FRANCE Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM);INSTITUT JEAN PAOLI & IRENE CALMETTES;UNIVERSITE D'AIX-MARSEILLE;SIGNING DATES FROM 20151113 TO 20151129;REEL/FRAME:052880/0560 Owner name: INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM), FRANCE Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:OLIVE, DANIEL;BONNEVILLE, MARC;SCOTET, EMMANUEL;AND OTHERS;SIGNING DATES FROM 20150907 TO 20150915;REEL/FRAME:052880/0244 Owner name: UNIVERSITE D'AIX-MARSEILLE, FRANCE Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM);INSTITUT JEAN PAOLI & IRENE CALMETTES;UNIVERSITE D'AIX-MARSEILLE;SIGNING DATES FROM 20151113 TO 20151129;REEL/FRAME:052880/0560 Owner name: INSTITUT JEAN PAOLI & IRENE CALMETTES, FRANCE Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:OLIVE, DANIEL;BONNEVILLE, MARC;SCOTET, EMMANUEL;AND OTHERS;SIGNING DATES FROM 20150907 TO 20150915;REEL/FRAME:052880/0244 Owner name: UNIVERSITE DE NANTES, FRANCE Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM);INSTITUT JEAN PAOLI & IRENE CALMETTES;UNIVERSITE D'AIX-MARSEILLE;SIGNING DATES FROM 20151113 TO 20151129;REEL/FRAME:052880/0560 Owner name: UNIVERSITE D'AIX MARSEILLE, FRANCE Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:OLIVE, DANIEL;BONNEVILLE, MARC;SCOTET, EMMANUEL;AND OTHERS;SIGNING DATES FROM 20150907 TO 20150915;REEL/FRAME:052880/0244 |
|
| FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| AS | Assignment |
Owner name: IMCHECK THERAPEUTICS, FRANCE Free format text: LICENSE;ASSIGNORS:INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM);UNIVERSITE D'AIX-MARSEILLE;INSTITUT JEAN PAOLI & IRENE CALMETTES;AND OTHERS;REEL/FRAME:060109/0917 Effective date: 20160523 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: AWAITING TC RESP., ISSUE FEE NOT PAID |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONMENT FOR FAILURE TO CORRECT DRAWINGS/OATH/NONPUB REQUEST |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED |
|
| STCF | Information on status: patent grant |
Free format text: PATENTED CASE |