US11208666B2 - Mutant xylan biosynthetic enzymes capable of dominant suppression of xylan biosynthesis - Google Patents

Mutant xylan biosynthetic enzymes capable of dominant suppression of xylan biosynthesis Download PDF

Info

Publication number
US11208666B2
US11208666B2 US15/847,788 US201715847788A US11208666B2 US 11208666 B2 US11208666 B2 US 11208666B2 US 201715847788 A US201715847788 A US 201715847788A US 11208666 B2 US11208666 B2 US 11208666B2
Authority
US
United States
Prior art keywords
plant
promoter
amino acid
nucleic acid
naturally occurring
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active, expires
Application number
US15/847,788
Other versions
US20180251774A1 (en
Inventor
Andrew Brandon
Henrik Vibe Scheller
Dominique Loque
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of California San Diego UCSD
Original Assignee
University of California San Diego UCSD
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of California San Diego UCSD filed Critical University of California San Diego UCSD
Priority to US15/847,788 priority Critical patent/US11208666B2/en
Assigned to THE REGENTS OF THE UNIVERSITY OF CALIFORNIA reassignment THE REGENTS OF THE UNIVERSITY OF CALIFORNIA ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: LOQUE, DOMINIQUE, SCHELLER, HENRIK VIBE, BRANDON, ANDREW
Assigned to UNITED STATES DEPARTMENT OF ENERGY reassignment UNITED STATES DEPARTMENT OF ENERGY CONFIRMATORY LICENSE (SEE DOCUMENT FOR DETAILS). Assignors: UNIVERSITY OF CALIF-LAWRENC BERKELEY LAB
Publication of US20180251774A1 publication Critical patent/US20180251774A1/en
Application granted granted Critical
Publication of US11208666B2 publication Critical patent/US11208666B2/en
Active legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8216Methods for controlling, regulating or enhancing expression of transgenes in plant cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
    • C12N15/8243Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
    • C12N15/8245Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine involving modified carbohydrate or sugar alcohol metabolism, e.g. starch biosynthesis
    • C12N15/8246Non-starch polysaccharides, e.g. cellulose, fructans, levans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/415Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8201Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation
    • C12N15/8202Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation by biological means, e.g. cell mediated or natural vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1048Glycosyltransferases (2.4)
    • C12N9/1077Pentosyltransferases (2.4.2)

Definitions

  • the present invention is in the field of xylan biosynthesis in plants.
  • Xylan is the most abundant non-cellulosic polysaccharide in plant biomass and one of the most abundant biopolymers on earth.
  • the xylan backbone is a homopolymer of ⁇ -(1,4)-linked xylose, decorated at regular intervals with GlcA, 4-O-MeGlcA and acetyl groups.
  • GlcA GlcA
  • 4-O-MeGlcA 4-O-MeGlcA
  • acetyl groups As a hemicellulose, xylan is thought to coat and crosslink cellulose microfibrils, promoting their crystallinity. Indeed, xylan is critical for the overall health and mechanical strength of the plant. Xylan biosynthesis mutants are severely dwarfed due to cell wall collapse in the water-conducting xylem vessels.
  • xylan While important, the relatively high amount of xylan in plant biomass creates several problems for the development of advanced biofuels. Xylose, a 5-carbon sugar, is poorly utilized by microorganisms and strongly inhibits the fermentation of 6-carbon sugars like glucose. Additionally, the acetate released from the xylan backbone creates a toxic environment for microbial growth. Any way to reduce the amount of xylan in plant biomass could have a significant effect on the conversion efficiency to biofuel. Since few, if any, mutants of biotechnologically relevant crops exist, the ideal approach would act as a dominant suppressor of xylan biosynthesis.
  • the present invention provides for a polypeptide capable of dominant suppression of a first naturally occurring IRX10, wherein the polypeptide comprises an amino acid sequence having at least 70% identity as compared to a second naturally occurring IRX10 wherein the polypeptide comprises one or more of the conserved amino acid indicated in FIG. 2 substituted with a different amino acid residue.
  • the conserved amino acid residues are the ones which are identical for IRX10, IRX10-L, OsIRX10, PpIRX10, as indicated in FIG. 2 .
  • the conserved amino acid residue is indicated by an asterisk in FIG. 2 .
  • the first naturally occurring IRX10 and the second naturally occurring IRX10 are the same IRX10.
  • the conserved amino acid residue corresponds to the histidine at position 146, the phenylalanine at position 277, the cysteine at position 278, the glycine at position 283, or glutamate at position 293 of Arabidopsis IRX10.
  • the polypeptide has one or more of the following substitutions: H146D, F277A, C278A, G283D, or E293Q.
  • the naturally occurring IRX10 for the first or second naturally occurring IRX10, or both, is Arabidopsis IRX10, IRX10-L, OsIRX10, PpIRX10, or HsEXO1.
  • This invention provides for a means to identify potential catalytic residues in the xylan biosynthetic enzyme IRX10 and mutating them. Overexpression of the mutated IRX10 outcompetes the native form of the enzyme, suppressing the biosynthesis of the polymer.
  • the present invention provides for a genetically modified eukaryotic host cell comprising (a) a gene encoding a polypeptide of the present invention operably linked to a promoter, wherein the gene and/or the promoter is heterologous to the cell.
  • the host cell has a native IRX10. In some embodiment, the native IRX10 is disrupted.
  • the modified cell is altered in producing xylan and produces modified cellulose and/or cell wall that comprises less xylan.
  • the host cell is a plant cell. In some embodiments, the host cell is part of a plant. In some embodiments, the host cell is a plant cell wherein all of the cells of the plant are similarly modified.
  • the present invention provides for a seed from the plant of the present invention.
  • the method results in a decrease of the amount of xylan in a plant comprising the plant cell.
  • the present invention provides for a method of engineering a plant to increase the content of a sugar in a desired tissue, comprising: (a) introducing an expression cassette into the plant, wherein the expression cassette comprises a polynucleotide encoding the polypeptide of the present invention operably linked to a heterologous promoter, and (b) culturing the plant under conditions in which the polypeptide is expressed in the desired tissue; wherein the heterologous promoter specifically expresses in the desired tissue.
  • the desired tissue is plant vessel tissue.
  • FIG. 1 shows the function of IRX10 in the synthesis of cellulose.
  • FIG. 2 shows a comparison the amino acid sequences between Arabidopsis IRX10, IRX10-L, OsIRX10, PpIRX10, and HsEXO1 (SEQ ID NOs:1 to 5, respectively).
  • IRX10 is well conserved within diverse homologs, including human EXO1. conserveed amino acid residues are indicated.
  • FIG. 3 shows that mutant plants overexpressing the mutant IRX10 have a phenotype consistent with reduced xylan.
  • FIG. 5 shows the monosaccharide analysis of T2 stems.
  • polynucleotide and “nucleic acid” are used interchangeably and refer to a single or double-stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5′ to the 3′ end.
  • the nucleic acid may be DNA, both genomic and cDNA, RNA or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases, including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, isoguanine, etc.
  • nucleic acid sequences or polypeptide sequences are said to be “identical” if the sequence of nucleotides or amino acid residues, respectively, in the two sequences is the same when aligned for maximum correspondence as described below.
  • the terms “identical” or percent “identity,” in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence over a comparison window, as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.
  • a conservative substitution is given a score between zero and 1.
  • the scoring of conservative substitutions is calculated according to, e.g., the algorithm of Meyers & Miller, Computer Applic. Biol. Sci. 4:11-17 (1988) e.g., as implemented in the program PC/GENE (Intelligenetics, Mountain View, Calif., USA).
  • a “comparison window,” as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol.
  • These initial neighborhood word hits acts as seeds for initiating searches to find longer HSPs containing them.
  • the word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always ⁇ 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
  • Nucleic acid or protein sequences that are substantially identical to a reference sequence include “conservatively modified variants.” With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
  • amino acid sequences one of skill will recognize that individual substitutions, in a nucleic acid, peptide, polypeptide, or protein sequence which alters a single amino acid or a small percentage of amino acids in the encoded sequence is a “conservatively modified variant” where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art.
  • the following six groups each contain amino acids that are illustrative conservative substitutions for one another: (1) Alanine (A), Serine (S), Threonine (T); (2) Aspartic acid (D), Glutamic acid (E); (3) Asparagine (N), Glutamine (Q); (4) Arginine (R), Lysine (K); (5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); and (6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W). (see, e.g., Creighton, Proteins (1984)).
  • nucleotide sequences are substantially identical if two molecules hybridize to each other, or a third nucleic acid, under stringent conditions.
  • Stringent conditions are sequence dependent and will be different in different circumstances. Generally, stringent conditions are selected to be about 5° C. lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe.
  • stringent conditions will be those in which the salt concentration is about 0.02 molar at pH 7 and the temperature is at least about 60° C.
  • stringent conditions for hybridization such as RNA-DNA hybridizations in a blotting technique are those which include at least one wash in 0.2 ⁇ SSC at 55° C. for 20 minutes, or equivalent conditions.
  • promoter refers to a polynucleotide sequence capable of driving transcription of a DNA sequence in a cell.
  • promoters used in the polynucleotide constructs of the invention include cis- and trans-acting transcriptional control elements and regulatory sequences that are involved in regulating or modulating the timing and/or rate of transcription of a gene.
  • a promoter can be a cis-acting transcriptional control element, including an enhancer, a promoter, a transcription terminator, an origin of replication, a chromosomal integration sequence, 5′ and 3′ untranslated regions, or an intronic sequence, which are involved in transcriptional regulation.
  • a promoter is typically referred to by the name of the gene for which it naturally regulates expression.
  • a promoter used in an expression construct of the invention is referred to by the name of the gene.
  • Reference to a promoter by name includes a wildtype, native promoter as well as variants of the promoter that retain the ability to induce expression.
  • Reference to a promoter by name is not restricted to a particular species, but also encompasses a promoter from a corresponding gene in other species.
  • a polynucleotide is “heterologous” to an organism or a second polynucleotide sequence if it originates from a foreign species, or, if from the same species, is modified from its original form.
  • a polynucleotide encoding a polypeptide sequence is said to be operably linked to a heterologous promoter, it means that the polynucleotide coding sequence encoding the polypeptide is derived from one species whereas the promoter sequence is derived from another, different species; or, if both are derived from the same species, the coding sequence is not naturally associated with the promoter (e.g., is a genetically engineered coding sequence, e.g., from a different gene in the same species, or an allele from a different ecotype or variety).
  • operably linked refers to a functional relationship between two or more polynucleotide (e.g., DNA) segments. Typically, it refers to the functional relationship of a transcriptional regulatory sequence to a transcribed sequence.
  • a promoter or enhancer sequence is operably linked to a DNA or RNA sequence if it stimulates or modulates the transcription of the DNA or RNA sequence in an appropriate host cell or other expression system.
  • promoter transcriptional regulatory sequences that are operably linked to a transcribed sequence are physically contiguous to the transcribed sequence, i.e., they are cis-acting.
  • some transcriptional regulatory sequences, such as enhancers need not be physically contiguous or located in close proximity to the coding sequences whose transcription they enhance.
  • expression cassette or “DNA construct” or “expression construct” refers to a nucleic acid construct that, when introduced into a host cell, results in transcription and/or translation of an RNA or polypeptide, respectively. Antisense or sense constructs that are not or cannot be translated are expressly included by this definition. In the case of both expression of transgenes and suppression of endogenous genes (e.g., by antisense, RNAi, or sense suppression) one of skill will recognize that the inserted polynucleotide sequence need not be identical, but may be only substantially identical to a sequence of the gene from which it was derived. As explained herein, these substantially identical variants are specifically covered by reference to a specific nucleic acid sequence.
  • an expression cassette is a polynucleotide construct that comprises a polynucleotide sequence encoding a protein operably linked to a heterologous promoter.
  • an expression cassette comprises a polynucleotide sequence encoding a protein that is targeted to a position in a plant genome such that expression of the polynucleotide sequence is driven by a promoter that is present in the plant
  • plant as used herein can refer to a whole plant or part of a plant, e.g., seeds, and includes plants of a variety of ploidy levels, including aneuploid, polyploid, diploid and haploid.
  • plant part refers to shoot vegetative organs and/or structures (e.g., leaves, stems and tubers), branches, roots, flowers and floral organs (e.g., bracts, sepals, petals, stamens, carpels, anthers), ovules (including egg and central cells), seed (including zygote, embryo, endosperm, and seed coat), fruit (e.g., the mature ovary), seedlings, and plant tissue (e.g., vascular tissue, ground tissue, and the like), as well as individual plant cells, groups of plant cells (e.g., cultured plant cells), protoplasts, plant extracts, and seeds.
  • plant part refers to shoot vegetative organs and/or structures (e.g., leaves, stems and tub
  • the class of plants that can be used in the methods of the invention is generally as broad as the class of higher and lower plants amenable to transformation techniques, including angiosperms (monocotyledonous and dicotyledonous plants), gymnosperms, ferns, bryophytes, and multicellular algae.
  • biomass refers to plant material that is processed to provide a product, e.g., a biofuel such as ethanol, or livestock feed, or a cellulose for paper and pulp industry products.
  • a product e.g., a biofuel such as ethanol, or livestock feed, or a cellulose for paper and pulp industry products.
  • plant material can include whole plants, or parts of plants, e.g., stems, leaves, branches, shoots, roots, tubers, and the like.
  • soluble sugar refers to monomeric, dimeric, or trimeric sugar that is produced from the saccharification of biomass.
  • corresponding biomass from a wild-type plant refers to plant material that is from the same part of the plant as the biomass from a plant engineered to have modified sugar levels.
  • increased amount or increased yield is based upon comparisons of the same amount of corresponding plant material.
  • a conversion reaction e.g., combustion, gasification, pyrolysis, or polysaccharide hydrolysis
  • This invention is useful for engineering bioenergy plants with a cell wall composition that makes their sugars easier accessible. This will be interesting for a variety of industries, such as biofuel production or sugar producing industries. Likewise, the invention could be useful for developing plants for other purposes, such as for feed and forage.
  • the invention provides a method of engineering plants to decrease xylan content.
  • Eukaryotic cells can be engineered to overexpress one or more polypeptide in a cell by genetically modifying the cell to overexpress one or more polypeptide genes as described herein.
  • plants can be engineered to overexpress express one or more polypeptide in the plant by genetically modifying the plant to overexpress one or more polypeptide genes as described herein.
  • overexpression is targeted to cell wall using a tissue-specific promoter.
  • An example of a method for fine-tuning gene expression to increase expression in the cell wall is taught in PCT/US2012/023182, which is incorporated by reference.
  • the invention employs various routine recombinant nucleic acid techniques.
  • nomenclature and the laboratory procedures in recombinant DNA technology described below are those well known and commonly employed in the art.
  • Many manuals that provide direction for performing recombinant DNA manipulations are available, e.g., Sambrook & Russell, Molecular Cloning, A Laboratory Manual (3rd Ed, 2001); and Current Protocols in Molecular Biology (Ausubel, et al., John Wiley and Sons, New York, 2009).
  • the IRX10 is an IRX10 of Arabidopsis , poplar, eucalyptus, rice, corn, cotton, switchgrass, sorghum, millet, miscanthus, sugarcane, pine, alfalfa, wheat, soy, barley, turfgrass, tobacco, hemp, bamboo, rape, sunflower, willow, or Brachypodium.
  • amino acid sequence of Arabidopsis thaliana IRX10 is as follows:
  • the amino acid sequence of rice OsIRX10 (as known as Os01g70200) is as follows:
  • PpIRX10 The amino acid sequence of Physcomitrella patens IRX10 (PpIRX10) is as follows:
  • DNA vectors suitable for transformation of plant cells are prepared.
  • Techniques for transformation are well known and described in the technical and scientific literature.
  • a DNA sequence encoding the polypeptide can be combined with transcriptional and other regulatory sequences which will direct the transcription of the sequence from the gene in the intended cells, e.g., grass or other crop plant cells.
  • an expression vector that comprises an expression cassette that comprises the polypeptide gene further comprises a promoter operably linked to the polypeptide gene.
  • a promoter and/or other regulatory elements that direct transcription of the polypeptide gene are endogenous to the plant and an expression cassette comprising the polypeptide gene is introduced, e.g., by homologous recombination, such that the heterologous polypeptide gene is operably linked to an endogenous promoter and is expression driven by the endogenous promoter.
  • Regulatory sequences include promoters, which may be either constitutive or inducible, or tissue-specific.
  • tissue-specific promoters are transcriptional control elements that are only active in particular cells or tissues at specific times during plant development, such as in vegetative tissues or reproductive tissues.
  • tissue-specific promoters under developmental control include promoters that initiate transcription only (or primarily only) in certain tissues, such as vegetative tissues, cell walls, including e.g., roots or leaves.
  • tissue-specific promoters include promoters that initiate transcription only (or primarily only) in certain tissues, such as vegetative tissues, cell walls, including e.g., roots or leaves.
  • a variety of promoters specifically active in vegetative tissues, such as leaves, stems, roots and tubers are known.
  • promoters controlling patatin the major storage protein of the potato tuber
  • the ORF13 promoter from Agrobacterium rhizogenes that exhibits high activity in roots can also be used (Hansen, Mol. Gen. Genet. 254:337-343, 1997).
  • tarn promoters include: the tarn promoter of the gene encoding a globulin from a major taro ( Colocasia esculenta L. Schott ) corm protein family, tarin (Bezerra, Plant Mol. Biol. 28:137-144, 1995); the curculin promoter active during taro corm development (de Castro, Plant Cell 4:1549-1559, 1992) and the promoter for the tobacco root-specific gene TobRB7, whose expression is localized to root meristem and immature central cylinder regions (Yamamoto, Plant Cell 3:371-382, 1991).
  • Leaf-specific promoters such as the ribulose biphosphate carboxylase (RBCS) promoters can be used.
  • RBCS ribulose biphosphate carboxylase
  • the tomato RBCS1, RBCS2 and RBCS3A genes are expressed in leaves and light-grown seedlings, only RBCS1 and RBCS2 are expressed in developing tomato fruits (Meier, FEBS Lett. 415:91-95, 1997).
  • a ribulose bisphosphate carboxylase promoters expressed almost exclusively in mesophyll cells in leaf blades and leaf sheaths at high levels (e.g., Matsuoka, Plant J. 6:311-319, 1994), can be used.
  • Another leaf-specific promoter is the light harvesting chlorophyll a/b binding protein gene promoter (see, e.g., Shiina, Plant Physiol. 115:477-483, 1997; Casal, Plant Physiol. 116:1533-1538, 1998).
  • the Arabidopsis thaliana myb-related gene promoter (Atmyb5) (Li, et al., FEBS Lett. 379:117-121 1996), is leaf-specific.
  • the Atmyb5 promoter is expressed in developing leaf trichomes, stipules, and epidermal cells on the margins of young rosette and cauline leaves, and in immature seeds.
  • Atmyb5 mRNA appears between fertilization and the 16 cell stage of embryo development and persists beyond the heart stage.
  • a leaf promoter identified in maize e.g., Busk et al., Plant J. 11:1285-1295, 1997) can also be used.
  • Another class of useful vegetative tissue-specific promoters are meristematic (root tip and shoot apex) promoters.
  • meristematic (root tip and shoot apex) promoters For example, the “SHOOTMERISTEMLESS” and “SCARECROW” promoters, which are active in the developing shoot or root apical meristems, (e.g., Di Laurenzio, et al., Cell 86:423-433, 1996; and, Long, et al., Nature 379:66-69, 1996); can be used.
  • Another useful promoter is that which controls the expression of 3-hydroxy-3-methylglutaryl coenzyme A reductase HMG2 gene, whose expression is restricted to meristematic and floral (secretory zone of the stigma, mature pollen grains, gynoecium vascular tissue, and fertilized ovules) tissues (see, e.g., Enjuto, Plant Cell. 7:517-527, 1995).
  • Also useful are kn1-related genes from maize and other species which show meristem-specific expression, (see, e.g., Granger, Plant Mol. Biol. 31:373-378, 1996; Kerstetter, Plant Cell 6:1877-1887, 1994; Hake, Philos. Trans. R. Soc. Lond. B. Biol. Sci. 350:45-51, 1995).
  • the Arabidopsis thaliana KNAT1 promoter see, e.g., Lincoln, Plant Cell 6:1859-1876, 1994 can be used.
  • the promoter is substantially identical to the native promoter of a promoter that drives expression of a gene involved in secondary wall deposition.
  • promoters are promoters from IRX1, IRX3, IRX5, IRX8, IRX9, IRX14, IRX7, IRX10, GAUT13, or GAUT14 genes.
  • Specific expression in fiber cells can be accomplished by using a promoter such as the NST1 promoter and specific expression in vessels can be accomplished by using a promoter such as VND6 or VND7. (See, e.g., PCT/US2012/023182 for illustrative promoter sequences).
  • tissue-specific promoter may drive expression of operably linked sequences in tissues other than the target tissue.
  • a tissue-specific promoter is one that drives expression preferentially in the target tissue, but may also lead to some expression in other tissues as well.
  • a promoter, or an active fragment thereof can be employed which will direct expression of a nucleic acid encoding a fusion protein of the invention, in all or most transformed cells or tissues, e.g. as those of a regenerated plant.
  • Such promoters are referred to herein as “constitutive” promoters and are active under most environmental conditions and states of development or cell differentiation.
  • constitutive promoters include those from viruses which infect plants, such as the cauliflower mosaic virus (CaMV) 35S transcription initiation region (see, e.g., Dagless, Arch. Virol.
  • the 1′- or 2′-promoter derived from T-DNA of Agrobacterium tumefaciens see, e.g., Mengiste supra (1997); O'Grady, Plant Mol. Biol. 29:99-108, 1995
  • the promoter of the tobacco mosaic virus the promoter of Figwort mosaic virus (see, e.g., Maiti, Transgenic Res. 6:143-156, 1997)
  • actin promoters such as the Arabidopsis actin gene promoter (see, e.g., Huang, Plant Mol. Biol.
  • Alcohol dehydrogenase (Adh) gene promoters see, e.g., Millar, Plant Mol. Biol. 31:897-904, 1996
  • Adh alcohol dehydrogenase gene promoters
  • ACT11 from Arabidopsis (Huang et al., Plant Mol. Biol. 33:125-139, 1996)
  • Cat3 from Arabidopsis (GenBank No. U43147, Zhong et al., Mol. Gen. Genet. 251:196-203, 1996)
  • the gene encoding stearoyl-acyl carrier protein desaturase from Brassica napus Genbank No. X74782, Solocombe et al., Plant Physiol.
  • a plant promoter may direct expression of the nucleic acids under the influence of changing environmental conditions or developmental conditions.
  • environmental conditions that may effect transcription by inducible promoters include anaerobic conditions, elevated temperature, drought or other environmental stress, or the presence of light.
  • developmental conditions that may effect transcription by inducible promoters include senescence and embryogenesis.
  • inducible promoters are referred to herein as “inducible” promoters.
  • the invention can incorporate drought-specific promoter such as the drought-inducible promoter of maize (Busk et al., Plant J, 11: 1285-95, 1997); or alternatively the cold, drought, and high salt inducible promoter from potato (Kirch Plant Mol. Biol. 33:897-909, 1997).
  • Suitable promoters responding to biotic or abiotic stress conditions include the pathogen inducible PRP1-gene promoter (Ward et al., Plant. Mol. Biol. 22:361-366, 1993), the heat inducible hsp80-promoter from tomato (U.S. Pat. No. 5,187,267), cold inducible alpha-amylase promoter from potato (PCT Publication No. WO 96/12814) or the wound-inducible pinII-promoter (European Patent No. 375091).
  • the pathogen inducible PRP1-gene promoter Ward et al., Plant. Mol. Biol. 22:361-366, 1993
  • the heat inducible hsp80-promoter from tomato
  • cold inducible alpha-amylase promoter from potato
  • the wound-inducible pinII-promoter European Patent No. 375091
  • drought, cold, and salt-inducible promoters such as the RD29A
  • auxin-response elements E1 promoter fragment (AuxREs) in the soybean ( Glycine max L.) (Liu, Plant Physiol. 115:397-407, 1997); the auxin-responsive Arabidopsis GST6 promoter (also responsive to salicylic acid and hydrogen peroxide) (Chen, Plant J. 10: 955-966, 1996); the auxin-inducible parC promoter from tobacco (Sakai, 37:906-913, 1996); a plant biotin response element (Streit, Mol. Plant Microbe Interact. 10:933-937, 1997); and, the promoter responsive to the stress hormone abscisic acid (Sheen, Science 274:1900-1902, 1996).
  • auxin-response elements E1 promoter fragment (AuxREs) in the soybean ( Glycine max L.) (Liu, Plant Physiol. 115:397-407, 1997); the auxin-responsive Arabidopsis GST6 promoter (also responsive to
  • a plant can be engineered to overexpress the polypeptide using a positive feedback loop to express the polypeptide in a desired tissue.
  • a promoter for use in the polypeptide expression construct is responsive to a transcription factor that mediates expression in the desired tissue.
  • the polypeptide expression construct is used in a genetically modified plant comprising an expression construct encoding a transcription factor where expression is also driven by a promoter that is responsive to the transcription factor. Examples of such expression systems are provided in PCT/US2012/023182, hereby incorporated by reference.
  • the plant is genetically modified to express a transcription factor that regulates the production of secondary cell wall.
  • transcription factors include NST1, NST2, NST3, SND2, SND3, MYB103, MBY85, MYB46, MYB83, MYB58, and MYB63 (See, e.g., Mitsuda et al., Plant Cell 17:2993-3006 (2005); Mitsuda et al., Plant Cell 19:270-80 (2007); Ohashi-Ito et al., Plant Cell 22:3461-73 (2010); Zhong et al., Plant Cell 20:2763-82 (2008); Zhong et al., Plant Cell 19:2776-92 (2007); Ko et al., Plant J.
  • the polynucleotide encoding the transcription factor that regulates secondary cell wall production is operably linked to a promoter that is a downstream target of the transcription factor.
  • the polypeptide nucleic acid sequence is also linked to a promoter that is a downstream target of the transcription factor.
  • the promoter may be the same promoter or different promoters.
  • a promoter is suitable for use with the transcription factor that regulates secondary cell wall production if expression of the promoter is induced, directly or indirectly, by the transcription factor to be expressed, and if the promoter is expressed in the desired location, e.g., the stem of the plant.
  • the polynucleotide encoding the polypeptide is expressed through a transposable element.
  • This allows for constitutive, yet periodic and infrequent expression of the constitutively active polypeptide.
  • the invention also provides for use of tissue-specific promoters derived from viruses including, e.g., the tobamovirus subgenomic promoter (Kumagai, Proc. Natl. Acad. Sci.
  • RTBV rice tungro bacilliform virus
  • CVMV cassava vein mosaic virus
  • a vector comprising nucleic acid sequences encoding the polypeptide will typically comprise a marker gene that confers a selectable phenotype on the cell to which it is introduced.
  • markers are known.
  • the marker may encode antibiotic resistance, such as resistance to kanamycin, G418, bleomycin, hygromycin, and the like.
  • Nucleic acid sequences encoding the polypeptide of the invention are expressed recombinantly in plant cells as described.
  • expression constructs can be designed taking into account such properties as codon usage frequencies of the plant in which the nucleic acid encoding the polypeptide is to be expressed. Codon usage frequencies can be tabulated using known methods (see, e.g., Nakamura et al. Nucl. Acids Res. 28:292, 2000). Codon usage frequency tables are available in the art (e.g., from the Codon Usage Database at the internet site at kazusa.or.jp/codon/.)
  • Additional sequence modifications may be made that are also known to enhance gene expression in a plant. These include elimination of sequences encoding spurious polyadenylation signals, exon-intron splice site signals, transposon-like repeats, and other such well-characterized sequences that may be deleterious to gene expression.
  • the G-C content of the sequence may be adjusted to levels average for a given cellular host, as calculated by reference to known genes expressed in the host cell. When possible, the sequence may also be modified to avoid predicted hairpin secondary mRNA structures.
  • the modified eukaryotic cell is a plant cell.
  • Techniques for genetically modifying eukaryotic cells, such as plant, animal and fungal cells are well known to those skilled in the art.
  • U.S. Provisional Patent Application Ser. No. 61/676,811 teaches such methods for yeast.
  • the plant is a grass plant.
  • the plant of plant cell is Arabidopsis , poplar, eucalyptus, rice, corn, cotton, switchgrass, sorghum, millet, miscanthus, sugarcane, pine, alfalfa, wheat, soy, barley, turfgrass, tobacco, hemp, bamboo, rape, sunflower, willow, or Brachypodium
  • transgenic plants comprising recombinant expression cassettes either for expressing the polypeptide.
  • transgenic plants encompasses the plant or plant cell in which the expression cassette is introduced as well as progeny of such plants or plant cells that contain the expression cassette, including the progeny that have the expression cassette stably integrated in a chromosome.
  • Transformation and regeneration of plants is known in the art, and the selection of the most appropriate transformation technique will be determined by the practitioner. Suitable methods may include, but are not limited to: electroporation of plant protoplasts; liposome-mediated transformation; polyethylene glycol (PEG) mediated transformation; transformation using viruses; micro-injection of plant cells; micro-projectile bombardment of plant cells; vacuum infiltration; and Agrobacterium tumeficiens mediated transformation. Transformation means introducing a nucleotide sequence in a plant in a manner to cause stable or transient expression of the sequence. Examples of these methods in various plants include: U.S. Pat. Nos.
  • Transformed plant cells derived by any of the above transformation techniques can be cultured to regenerate a whole plant that possesses the transformed genotype and thus the desired phenotype such as enhanced drought-resistance.
  • Such regeneration techniques rely on manipulation of certain phytohormones in a tissue culture growth medium, typically relying on a biocide and/or herbicide marker which has been introduced together with the desired nucleotide sequences.
  • Plant regeneration from cultured protoplasts is described in Evans et al., Protoplasts Isolation and Culture, Handbook of Plant Cell Culture, pp. 124-176, MacMillilan Publishing Company, New York, 1983; and Binding, Regeneration of Plants, Plant Protoplasts, pp. 21-73, CRC Press, Boca Raton, 1985. Regeneration can also be obtained from plant callus, explants, organs, or parts thereof.
  • Such regeneration techniques are described generally, e.g., in Klee et al. Ann. Rev. of Plant Phys. 38:4
  • the expression cassette is stably incorporated in transgenic plants and confirmed to be operable, it can be introduced into other plants by sexual crossing. Any of a number of standard breeding techniques can be used, depending upon the species to be crossed.
  • the expression constructs of the invention can be used to increase the sugar content of cell walls of essentially any plant.
  • the plant may be a monocotyledonous plant or a dicotyledonous plant.
  • the plant is a green field plant.
  • the plant is a gymnosperm or conifer.
  • the invention has use over a broad range of plants, including species from the genera Asparagus, Atropa, Avena, Brassica, Cannabis, Citrus, Citrullus, Camelina, Capsicum, Cucumis, Cucurbita, Daucus, Fragaria, Glycine, Gossypium, Helianthus, Heterocallis, Hordeum, Hyoscyamus, Lactuca, Linum, Lolium, Lycopersicon, Malus, Manihot, Majorana, Medicago, Nicotiana, Oryza, Panieum, Pannesetum, Persea, Pisum, Pyrus, Prunus, Raphanus, Secale, Senecio, Sinapis, Solanum, Sorghum, Trigonella, Triticum, Vitis, Vigna , and, Zea .
  • the plant is corn, switchgrass, sorghum, miscanthus, sugarcane, poplar, pine, wheat, rice, soy, cotton, barley, turf grass, tobacco, potato, bamboo, rape, sugar beet, sunflower, willow, and eucalyptus.
  • the plant is reed canarygrass ( Phalaris arundinacea ), Miscanthus x giganteus, Miscanthus sp., sericea lespedeza ( Lespedeza cuneata ), millet, ryegrass ( Lolium multiflorum, Lolium sp.), timothy, Kochia ( Kochia scoparia ), forage soybeans, alfalfa, clover, sunn hemp, kenaf, bahiagrass, bermudagrass, dallisgrass, pangolagrass, big bluestem, indiangrass, fescue ( Festuca sp.), Dactylis sp., Brachypodium distachyon , smooth bromegrass, orchardgrass, or Kentucky bluegrass among others.
  • canarygrass Phalaris arundinacea
  • Miscanthus x giganteus Miscanthus sp.
  • miscanthus sp. Sericea lespedez
  • the plant is an ornamental plant. In some embodiments, the plant is a grass plant. In some embodiment, the plant is a vegetable- or fruit-producing plant. In some embodiments, the plant is a plant that is suitable for generating biomass, including plants as noted above, e.g., Arabidopsis , poplar, eucalyptus, rice, corn, switchgrass, sorghum, millet, miscanthus, sugarcane, pine, alfalfa, wheat, soy, barley, turfgrass, tobacco, hemp, bamboo, rape, sunflower, willow, Jatropha , and Brachypodium.
  • plants as noted above e.g., Arabidopsis , poplar, eucalyptus, rice, corn, switchgrass, sorghum, millet, miscanthus, sugarcane, pine, alfalfa, wheat, soy, barley, turfgrass, tobacco, hemp, bamboo, rape, sunflower, willow, Jatropha , and
  • the plant into which the expression construct comprising a nucleic acid sequence that encodes the polypeptide is introduced is the same species of plant from which the mutant IRX10 sequence, and/or the promoter driving expression of the mutant IRX10 sequence, is obtained. In some embodiments, the plant into which the expression construct is introduced is a different species of plant compared to the species from which the mutant IRX10 and/or promoter sequence was obtained.
  • Plants that overexpress the mutant IRX10 can be identified using any known assay, including analysis of RNA, protein, or xylan composition.
  • the xylan levels can be determined directly or indirectly, wherein such methods are well known in the art.
  • An expression cassette comprising a polynucleotide encoding the polypeptide operably linked to a promoter, as described herein, can be expressed in various kinds of plants.
  • the plant may be a monocotyledonous plant or a dicotyledonous plant.
  • the plant is a green field plant.
  • the plant is a gymnosperm or conifer.
  • the plant is a plant that is suitable for generating biomass.
  • suitable plants include, but are not limited to, Arabidopsis , poplar, eucalyptus, rice, corn, switchgrass, sorghum, millet, miscanthus, sugarcane, pine, alfalfa, wheat, soy, barley, turfgrass, tobacco, hemp, bamboo, rape, sunflower, willow, Jatropha , and Brachypodium.
  • the plant into which the expression cassette is introduced is the same species of plant as the promoter and/or as the polynucleotide encoding the polypeptide or transcription factor (e.g., a vessel-specific promoter and/or transcription factor from Arabidopsis is expressed in an Arabidopsis plant).
  • the plant into which the expression cassette is introduced is a different species of plant than the promoter and/or than the polynucleotide encoding the polypeptide or transcription factor (e.g., a vessel-specific promoter and/or transcription factor from Arabidopsis is expressed in a poplar plant). See, e.g., McCarthy et al., Plant Cell Physiol. 51:1084-90 (2010); and Zhong et al., Plant Physiol. 152:1044-55 (2010).
  • IRX10 Potential catalytic residues in the xylan biosynthetic enzyme IRX10 are identified and mutated.
  • the overexpression of the mutated IRX10 out competes the native form of the enzyme resulting in the suppression of the biosynthesis of the polymer.
  • FIG. 2 shows a comparison the amino acid sequences between Arabidopsis IRX10, IRX10-L, OsIRX10, PpIRX10, and HsEXO1.
  • IRX10 is well conserved within diverse homologs, including human EXO1.
  • the indicated IRX10 mutants shown in FIG. 2 are generated and are overexpressed in plants.
  • FIG. 3 shows that the mutant plants overexpressing the mutant IRX10s have a phenotype consistent with reduced xylan.
  • FIG. 3 shows Cell wall material from the plants in FIG. 3 are isolated and digested with Xylanase C, an enzyme that cleaves xylan specifically at glucuronic acid substitutions. The digestion products are then fluorescently labelled and separated by size.
  • FIG. 4 shows the distribution of glucuronic acid residues along the xylan chain.
  • FIG. 4 shows that suppressors may alter the substitution pattern of the xylan backbone.
  • FIG. 5 shows the monosaccharide analysis of T2 stems. The results indicate that the biosynthesis of xylan is reduced in the plants with the mutant IRX10.
  • FIG. 6 shows a construct for restricting the expression of the suppressor in the plant vessels.
  • IRX10 is at least 70% conserved in all land plants and potential catalytic residues can be identified. Mutations in some of the residues chosen are able to dominantly suppress xylan biosynthesis and reduce the amount of xylose in the plant by as much as about 55%.
  • the mutation G283D is the same mutation linked to cancer in the human homolog EXO1, exhibits significant suppression.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Plant Pathology (AREA)
  • Nutrition Science (AREA)
  • Medicinal Chemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Botany (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)

Abstract

The present invention provides for a polypeptide capable of dominant suppression of a first naturally occurring IRX10, wherein the polypeptide comprises an amino acid sequence having at least 70% identity as compared to a second naturally occurring IRX10 wherein the polypeptide comprises one or more of the conserved amino acid indicated in FIG. 2 substituted with a different amino acid residue.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS
This application claims priority to U.S. Provisional Patent Application Ser. No. 62/435,687, filed on Dec. 16, 2016, which is hereby incorporated by reference.
STATEMENT OF GOVERNMENTAL SUPPORT
The invention was made with government support under Contract No. DE-AC02-05CH11231 awarded by the U.S. Department of Energy. The government has certain rights in the invention.
FIELD OF THE INVENTION
The present invention is in the field of xylan biosynthesis in plants.
BACKGROUND OF THE INVENTION
Xylan is the most abundant non-cellulosic polysaccharide in plant biomass and one of the most abundant biopolymers on earth. The xylan backbone is a homopolymer of β-(1,4)-linked xylose, decorated at regular intervals with GlcA, 4-O-MeGlcA and acetyl groups. As a hemicellulose, xylan is thought to coat and crosslink cellulose microfibrils, promoting their crystallinity. Indeed, xylan is critical for the overall health and mechanical strength of the plant. Xylan biosynthesis mutants are severely dwarfed due to cell wall collapse in the water-conducting xylem vessels. While important, the relatively high amount of xylan in plant biomass creates several problems for the development of advanced biofuels. Xylose, a 5-carbon sugar, is poorly utilized by microorganisms and strongly inhibits the fermentation of 6-carbon sugars like glucose. Additionally, the acetate released from the xylan backbone creates a toxic environment for microbial growth. Any way to reduce the amount of xylan in plant biomass could have a significant effect on the conversion efficiency to biofuel. Since few, if any, mutants of biotechnologically relevant crops exist, the ideal approach would act as a dominant suppressor of xylan biosynthesis.
SUMMARY OF THE INVENTION
The present invention provides for a polypeptide capable of dominant suppression of a first naturally occurring IRX10, wherein the polypeptide comprises an amino acid sequence having at least 70% identity as compared to a second naturally occurring IRX10 wherein the polypeptide comprises one or more of the conserved amino acid indicated in FIG. 2 substituted with a different amino acid residue. The conserved amino acid residues are the ones which are identical for IRX10, IRX10-L, OsIRX10, PpIRX10, as indicated in FIG. 2. In some embodiments, the conserved amino acid residue is indicated by an asterisk in FIG. 2. In some embodiments, the first naturally occurring IRX10 and the second naturally occurring IRX10 are the same IRX10.
In some embodiments, the conserved amino acid residue corresponds to the histidine at position 146, the phenylalanine at position 277, the cysteine at position 278, the glycine at position 283, or glutamate at position 293 of Arabidopsis IRX10. In some embodiments, the polypeptide has one or more of the following substitutions: H146D, F277A, C278A, G283D, or E293Q.
In some embodiments, the naturally occurring IRX10, for the first or second naturally occurring IRX10, or both, is Arabidopsis IRX10, IRX10-L, OsIRX10, PpIRX10, or HsEXO1.
This invention provides for a means to identify potential catalytic residues in the xylan biosynthetic enzyme IRX10 and mutating them. Overexpression of the mutated IRX10 outcompetes the native form of the enzyme, suppressing the biosynthesis of the polymer.
The present invention provides for a genetically modified eukaryotic host cell comprising (a) a gene encoding a polypeptide of the present invention operably linked to a promoter, wherein the gene and/or the promoter is heterologous to the cell. The host cell has a native IRX10. In some embodiment, the native IRX10 is disrupted. The modified cell is altered in producing xylan and produces modified cellulose and/or cell wall that comprises less xylan. In some embodiments, the host cell is a plant cell. In some embodiments, the host cell is part of a plant. In some embodiments, the host cell is a plant cell wherein all of the cells of the plant are similarly modified.
The present invention provides for a plant comprising the cell of the present invention, or a progeny thereof.
The present invention provides for a seed from the plant of the present invention.
The present invention provides for a biomass comprising plant tissue from the plant of the present invention.
The present invention provides for a method of obtaining a polypeptide of the present invention, comprising: (a) providing a nucleic acid encoding a naturally occurring IRX10, (b) introducing or generating a mutation into an open reading frame (ORF) encoding the naturally occurring IRX10 which results in an amino acid substitution of a conserved amino acid residue, as indicated in FIG. 2, in the naturally occurring IRX10, (c) optionally introducing the nucleic acid into a eukaryotic host cell, and (d) optionally culturing or growing the eukaryotic host cell.
In some embodiments, the method results in a decrease of the amount of xylan in a plant comprising the plant cell.
In some embodiments, host cell is part of a plant and the method further comprises: collecting plant material from the plant, and optionally incubating the plant material from the plant in a saccharification reaction.
The present invention provides for a method of improving the amount of soluble sugar obtained from a plant biomass material, comprising: (a) providing plant biomass material from a plant which expresses the polypeptide of the present invention, (b) performing a saccharification reaction on the plant biomass material, and (c) obtaining soluble sugar.
The present invention provides for a saccharification reaction comprising grass plant biomass material from a plant which expresses the polypeptide of the present invention.
The present invention provides for a method of engineering a plant to increase the content of a sugar in a desired tissue, comprising: (a) introducing an expression cassette into the plant, wherein the expression cassette comprises a polynucleotide encoding the polypeptide of the present invention operably linked to a heterologous promoter, and (b) culturing the plant under conditions in which the polypeptide is expressed in the desired tissue; wherein the heterologous promoter specifically expresses in the desired tissue. In some embodiments, the desired tissue is plant vessel tissue.
BRIEF DESCRIPTION OF THE DRAWINGS
The foregoing aspects and others will be readily appreciated by the skilled artisan from the following description of illustrative embodiments when read in conjunction with the accompanying drawings.
FIG. 1 shows the function of IRX10 in the synthesis of cellulose.
FIG. 2 shows a comparison the amino acid sequences between Arabidopsis IRX10, IRX10-L, OsIRX10, PpIRX10, and HsEXO1 (SEQ ID NOs:1 to 5, respectively). IRX10 is well conserved within diverse homologs, including human EXO1. Conserved amino acid residues are indicated.
FIG. 3 shows that mutant plants overexpressing the mutant IRX10 have a phenotype consistent with reduced xylan.
FIG. 4 shows that suppressors may alter the substitution pattern of the xylan backbone.
FIG. 5 shows the monosaccharide analysis of T2 stems.
FIG. 6 shows a construct for restricting the expression of the suppressor in the plant vessels.
DETAILED DESCRIPTION OF THE INVENTION
Before the present invention is described, it is to be understood that this invention is not limited to particular embodiments described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited.
The terms “polynucleotide” and “nucleic acid” are used interchangeably and refer to a single or double-stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5′ to the 3′ end. A nucleic acid of the present invention will generally contain phosphodiester bonds, although in some cases, nucleic acid analogs may be used that may have alternate backbones, comprising, e.g., phosphoramidate, phosphorothioate, phosphorodithioate, or O-methylphophoroamidite linkages (see Eckstein, Oligonucleotides and Analogues: A Practical Approach, Oxford University Press); positive backbones; non-ionic backbones, and non-ribose backbones. Thus, nucleic acids or polynucleotides may also include modified nucleotides that permit correct read-through by a polymerase. “Polynucleotide sequence” or “nucleic acid sequence” includes both the sense and antisense strands of a nucleic acid as either individual single strands or in a duplex. As will be appreciated by those in the art, the depiction of a single strand also defines the sequence of the complementary strand; thus the sequences described herein also provide the complement of the sequence. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. The nucleic acid may be DNA, both genomic and cDNA, RNA or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases, including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, isoguanine, etc.
Two nucleic acid sequences or polypeptide sequences are said to be “identical” if the sequence of nucleotides or amino acid residues, respectively, in the two sequences is the same when aligned for maximum correspondence as described below. The terms “identical” or percent “identity,” in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence over a comparison window, as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. When percentage of sequence identity is used in reference to proteins or peptides, it is recognized that residue positions that are not identical often differ by conservative amino acid substitutions, where amino acids residues are substituted for other amino acid residues with similar chemical properties (e.g., charge or hydrophobicity) and therefore do not change the functional properties of the molecule. Where sequences differ in conservative substitutions, the percent sequence identity may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well known to those of skill in the art. Typically this involves scoring a conservative substitution as a partial rather than a full mismatch, thereby increasing the percentage sequence identity. Thus, for example, where an identical amino acid is given a score of 1 and a non-conservative substitution is given a score of zero, a conservative substitution is given a score between zero and 1. The scoring of conservative substitutions is calculated according to, e.g., the algorithm of Meyers & Miller, Computer Applic. Biol. Sci. 4:11-17 (1988) e.g., as implemented in the program PC/GENE (Intelligenetics, Mountain View, Calif., USA).
For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
A “comparison window,” as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection.
Algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1977) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (NCBI) web site. The algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al, supra). These initial neighborhood word hits acts as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a word size (W) of 28, an expectation (E) of 10, M=1, N=−2, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a word size (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).
The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.01, more preferably less than about 10−5, and most preferably less than about 10−20.
Nucleic acid or protein sequences that are substantially identical to a reference sequence include “conservatively modified variants.” With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are “silent variations,” which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described sequence.
As to amino acid sequences, one of skill will recognize that individual substitutions, in a nucleic acid, peptide, polypeptide, or protein sequence which alters a single amino acid or a small percentage of amino acids in the encoded sequence is a “conservatively modified variant” where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art.
The following six groups each contain amino acids that are illustrative conservative substitutions for one another: (1) Alanine (A), Serine (S), Threonine (T); (2) Aspartic acid (D), Glutamic acid (E); (3) Asparagine (N), Glutamine (Q); (4) Arginine (R), Lysine (K); (5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); and (6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W). (see, e.g., Creighton, Proteins (1984)).
Another indication that nucleotide sequences are substantially identical is if two molecules hybridize to each other, or a third nucleic acid, under stringent conditions. Stringent conditions are sequence dependent and will be different in different circumstances. Generally, stringent conditions are selected to be about 5° C. lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe. Typically, stringent conditions will be those in which the salt concentration is about 0.02 molar at pH 7 and the temperature is at least about 60° C. For example, stringent conditions for hybridization, such as RNA-DNA hybridizations in a blotting technique are those which include at least one wash in 0.2×SSC at 55° C. for 20 minutes, or equivalent conditions.
The term “promoter,” as used herein, refers to a polynucleotide sequence capable of driving transcription of a DNA sequence in a cell. Thus, promoters used in the polynucleotide constructs of the invention include cis- and trans-acting transcriptional control elements and regulatory sequences that are involved in regulating or modulating the timing and/or rate of transcription of a gene. For example, a promoter can be a cis-acting transcriptional control element, including an enhancer, a promoter, a transcription terminator, an origin of replication, a chromosomal integration sequence, 5′ and 3′ untranslated regions, or an intronic sequence, which are involved in transcriptional regulation. These cis-acting sequences typically interact with proteins or other biomolecules to carry out (turn on/off, regulate, modulate, etc.) gene transcription. Promoters are located 5′ to the transcribed gene, and as used herein, include the sequence 5′ from the translation start codon (i.e., including the 5′ untranslated region of the mRNA, typically comprising 100-200 bp). Most often the core promoter sequences lie within 1-2 kb of the translation start site, more often within 1 kbp and often within 500 bp of the translation start site. By convention, the promoter sequence is usually provided as the sequence on the coding strand of the gene it controls. In the context of this application, a promoter is typically referred to by the name of the gene for which it naturally regulates expression. A promoter used in an expression construct of the invention is referred to by the name of the gene. Reference to a promoter by name includes a wildtype, native promoter as well as variants of the promoter that retain the ability to induce expression. Reference to a promoter by name is not restricted to a particular species, but also encompasses a promoter from a corresponding gene in other species.
A “constitutive promoter” in the context of this invention refers to a promoter that is capable of initiating transcription in nearly all cell types, whereas a “cell type-specific promoter” or “tissue-specific promoter” initiates transcription only in one or a few particular cell types or groups of cells forming a tissue (for a multi-cellular organism). In some embodiments, a plant promoter is tissue-specific if the transcription levels initiated by the promoter in the cell wall are at least 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 50-fold, 100-fold, 500-fold, 1000-fold higher or more as compared to the transcription levels initiated by the promoter in non-cell wall tissues
A polynucleotide is “heterologous” to an organism or a second polynucleotide sequence if it originates from a foreign species, or, if from the same species, is modified from its original form. For example, when a polynucleotide encoding a polypeptide sequence is said to be operably linked to a heterologous promoter, it means that the polynucleotide coding sequence encoding the polypeptide is derived from one species whereas the promoter sequence is derived from another, different species; or, if both are derived from the same species, the coding sequence is not naturally associated with the promoter (e.g., is a genetically engineered coding sequence, e.g., from a different gene in the same species, or an allele from a different ecotype or variety).
The term “operably linked” refers to a functional relationship between two or more polynucleotide (e.g., DNA) segments. Typically, it refers to the functional relationship of a transcriptional regulatory sequence to a transcribed sequence. For example, a promoter or enhancer sequence is operably linked to a DNA or RNA sequence if it stimulates or modulates the transcription of the DNA or RNA sequence in an appropriate host cell or other expression system. Generally, promoter transcriptional regulatory sequences that are operably linked to a transcribed sequence are physically contiguous to the transcribed sequence, i.e., they are cis-acting. However, some transcriptional regulatory sequences, such as enhancers, need not be physically contiguous or located in close proximity to the coding sequences whose transcription they enhance.
The term “expression cassette” or “DNA construct” or “expression construct” refers to a nucleic acid construct that, when introduced into a host cell, results in transcription and/or translation of an RNA or polypeptide, respectively. Antisense or sense constructs that are not or cannot be translated are expressly included by this definition. In the case of both expression of transgenes and suppression of endogenous genes (e.g., by antisense, RNAi, or sense suppression) one of skill will recognize that the inserted polynucleotide sequence need not be identical, but may be only substantially identical to a sequence of the gene from which it was derived. As explained herein, these substantially identical variants are specifically covered by reference to a specific nucleic acid sequence. One example of an expression cassette is a polynucleotide construct that comprises a polynucleotide sequence encoding a protein operably linked to a heterologous promoter. In some embodiments, an expression cassette comprises a polynucleotide sequence encoding a protein that is targeted to a position in a plant genome such that expression of the polynucleotide sequence is driven by a promoter that is present in the plant
The term “plant” as used herein can refer to a whole plant or part of a plant, e.g., seeds, and includes plants of a variety of ploidy levels, including aneuploid, polyploid, diploid and haploid. The term “plant part,” as used herein, refers to shoot vegetative organs and/or structures (e.g., leaves, stems and tubers), branches, roots, flowers and floral organs (e.g., bracts, sepals, petals, stamens, carpels, anthers), ovules (including egg and central cells), seed (including zygote, embryo, endosperm, and seed coat), fruit (e.g., the mature ovary), seedlings, and plant tissue (e.g., vascular tissue, ground tissue, and the like), as well as individual plant cells, groups of plant cells (e.g., cultured plant cells), protoplasts, plant extracts, and seeds. The class of plants that can be used in the methods of the invention is generally as broad as the class of higher and lower plants amenable to transformation techniques, including angiosperms (monocotyledonous and dicotyledonous plants), gymnosperms, ferns, bryophytes, and multicellular algae.
The term “biomass,” as used herein, refers to plant material that is processed to provide a product, e.g., a biofuel such as ethanol, or livestock feed, or a cellulose for paper and pulp industry products. Such plant material can include whole plants, or parts of plants, e.g., stems, leaves, branches, shoots, roots, tubers, and the like.
The term “saccharification reaction” refers to a process of converting biomass, usually cellulosic or lignocellulosic biomass, into monomeric sugars, such as glucose and xylose.
The term “soluble sugar” refers to monomeric, dimeric, or trimeric sugar that is produced from the saccharification of biomass.
The term “increased amount,” when referring to an amount of sugar or soluble sugar obtained from an engineered plant of the present invention, refers to an increase in the amount or yield of sugar that is obtained from saccharification of biomass per amount of starting material, in comparison to corresponding biomass from a wild-type (i.e., naturally occurring) plant. In the context of the present invention, “corresponding biomass from a wild-type plant” refers to plant material that is from the same part of the plant as the biomass from a plant engineered to have modified sugar levels. As understood in the art, increased amount or increased yield is based upon comparisons of the same amount of corresponding plant material.
The term “conversion reaction,” as used herein, refers to a reaction that converts biomass into a form of bioenergy. Examples of conversion reactions include, but are not limited to, combustion (burning), gasification, pyrolysis, and polysaccharide hydrolysis (enzymatic or chemical).
The term “increased production,” when referring to an amount of bioenergy production obtained from an engineered plant of the present invention, refers to an increased amount of bioenergy that is produced from subjecting biomass from an engineered plant to a conversion reaction (e.g., combustion, gasification, pyrolysis, or polysaccharide hydrolysis) as compared to the amount of bioenergy that is produced from corresponding biomass from a wild-type (i.e., naturally occurring) plant.
The terms “optional” or “optionally” as used herein mean that the subsequently described feature or structure may or may not be present, or that the subsequently described event or circumstance may or may not occur, and that the description includes instances where a particular feature or structure is present and instances where the feature or structure is absent, or instances where the event or circumstance occurs and instances where it does not.
These and other objects, advantages, and features of the invention will become apparent to those persons skilled in the art upon reading the details of the invention as more fully described below.
This invention is useful for engineering bioenergy plants with a cell wall composition that makes their sugars easier accessible. This will be interesting for a variety of industries, such as biofuel production or sugar producing industries. Likewise, the invention could be useful for developing plants for other purposes, such as for feed and forage.
In one aspect, the invention provides a method of engineering plants to decrease xylan content. Eukaryotic cells can be engineered to overexpress one or more polypeptide in a cell by genetically modifying the cell to overexpress one or more polypeptide genes as described herein. In some embodiments, plants can be engineered to overexpress express one or more polypeptide in the plant by genetically modifying the plant to overexpress one or more polypeptide genes as described herein. Typically, overexpression is targeted to cell wall using a tissue-specific promoter. An example of a method for fine-tuning gene expression to increase expression in the cell wall is taught in PCT/US2012/023182, which is incorporated by reference.
The invention employs various routine recombinant nucleic acid techniques. Generally, the nomenclature and the laboratory procedures in recombinant DNA technology described below are those well known and commonly employed in the art. Many manuals that provide direction for performing recombinant DNA manipulations are available, e.g., Sambrook & Russell, Molecular Cloning, A Laboratory Manual (3rd Ed, 2001); and Current Protocols in Molecular Biology (Ausubel, et al., John Wiley and Sons, New York, 2009).
In some embodiments, the IRX10 is an IRX10 of Arabidopsis, poplar, eucalyptus, rice, corn, cotton, switchgrass, sorghum, millet, miscanthus, sugarcane, pine, alfalfa, wheat, soy, barley, turfgrass, tobacco, hemp, bamboo, rape, sunflower, willow, or Brachypodium.
The amino acid sequence of Arabidopsis thaliana IRX10 is as follows:
(SEQ ID NO: 1)
        10         20         30         40
MKIHSCLSAI LLFLFFSASS AKQNVRTERI SGSAGDVLED
        50         60         70         80
DPVGKLKVYV YELPSKYNKK LLQKDPRCLT HMFAAEIFMH
        90        100        110        120
RFLLSSPVRT RNPDEADWFY TPIYPTCDLT PTGLPLPFKS
       130        140        150        160
PRMMRSSIQL ISSNWPYWNR TEGADHFFVV PHDFGACFHY
       170        180        190        200
QEEKAIERGI LPLLQRATLV QTFGQRNHVC LDEGSITIPP
       210        220        230        240
FAPPQKMQAH FIPPDIPRSI FVYFRGLFYD VNNDPEGGYY
       250        260        270        280
ARGARAAVWE NFKNNPLFDI STDHPTTYYE DMQRAIFCLC
       290        300        310        320
PLGWAPWSPR LVEAVVFGCI PVIIADDIVL PFADAIPWEE
       330        340        350        360
IGVFVAEKDV PELDTILTSI PTEVILRKQR LLANPSMKRA
       370        380        390        400
MLFPQPAQPG DAFHQILNGL ARKLPHDKSI YLKTGEKALN
       410
WTAGPVADLK PW
The amino acid sequence of Arabidopsis thaliana IRX10L is as follows:
(SEQ ID NO: 2)
        10         20         30         40
MKLSSCVLIF LLCNTFSSIS AFRLSRSQPT ERISGSAGDV
        50         60         70         80
LEDDPVGRLK VFVYELPSKY NKKILQKDPR CLNHMFAAEI
        90        100        110        120
YMQRFLLSSP VRTLNPEEAD WFYVPVYTTC DLTPNGLPLP
       130        140        150        160
FKSPRMMRSA IQLIASNWPY WNRTEGADHF FVVPHDFGAC
       170        180        190        200
FHYQEEKAIG RGILPLLQRA TLVQTFGQRN HVCLKEGSIT
       210        220        230        240
VPPYAPPQKM QSHLIPEKTP RSIFVYFRGL FYDVGNDPEG
       250        260        270        280
GYYARGARAA VWENFKDNPL FDISTEHPTT YYEDMQRAIF
       290        300        310        320
CLCPLGWAPW SPRLVEAVIF GCIPVIIADD IVLPFADAIP
       330        340        350        360
WEDIGVFVDE KDVPYLDTIL TSIPPEVILR KQRLLANPSM
       370        380        390        400
KQAMLFPQPA QPGDAFHQVL NGLARKLPHE RSVYLRPGEK
       410
LLNWTAGPVA DLKPW
The amino acid sequence of rice OsIRX10 (as known as Os01g70200) is as follows:
(SEQ ID NO: 3)
MRRWVLAIAILAAAVCFFLGAQAQEVRQGHQTERISGSAGDVLEDDPVGR
LKVYVYDLPSKYNKKLLKKDPRCLNHMFAAEIFMHRFLLSSAVRTFNPEE
ADWFYTPVYTTCDLTPSGLPLPFKSPRMMRSAIELIATNWPYWNRSEGAD
HFFVTPHDFGACFHYQEEKAIGRGILPLLQRATLVQTFGQKNHVCLKDGS
ITIPPYAPPQKMQAHLIPPDTPRSIFVYFRGLFYDTSNDPEGGYYARGAR
ASVWENFKNNPLFDISTDHPPTYYEDMQRSVFCLCPLGWAPWSPRLVEAV
VFGCIPVIIADDIVLPFADAIPWEEIGVFVAEEDVPKLDSILTSIPTDVI
LRKQRLLANPSMKQAMLFPQPAQAGDAFHQILNGLARKLPHGENVFLKPG
ERALNWTAGPVGDLKPW
The amino acid sequence of Physcomitrella patens IRX10 (PpIRX10) is as follows:
(SEQ ID NO: 4)
        10         20         30         40
MEHPLECADS CSLAMSWFCN KKCRGWGLMK RTVVASGLRS
        50         60         70         80
VVLLLLFIYF VQDVTAEMGH QRISGSAGDV LEDNPVGRLK
        90        100        110        120
VFIYDIPSKY NTDWLKKDPR CLTHMFAVEE YLHDFLTESP
       130        140        150        160
VRTLNPEEAD WFYTPVYTTC DLTPNGLPLP FKSPRVMRSA
       170        180        190        200
ISYISSHWPY WNRTDGADHF FVVPHDFAAC FHYQEEKAIE
       210        220        230        240
RGILPLLKRA TLIQTFGQNH HVCLKEDSIV IPPYAPPERM
       250        260        270        280
QTRLNPPSTP RSIFAYFRGL FYDPGNDPEG GYYARGARAA
       290        300        310        320
IWENFKDNPL FDISTEHPAT YYEDMQRAIF CLCPLGWAPW
       330        340        350        360
SPRLVEGVIF GCIPVIIADD IVLPFADAIP WEKIGVFVEE
       370        380        390        400
KDVPILDKIL CTINHEEVLE KQRLLANPAM KQAMLFPRPA
       410        420        430        440
KPGDAFHQIL NGLARKLPHD PSIYLQPGQS FLNWTEGPPG
DLYPWGNDL
To use isolated sequences in the above techniques, recombinant DNA vectors suitable for transformation of plant cells such as crop plant cells are prepared. Techniques for transformation are well known and described in the technical and scientific literature. For example, a DNA sequence encoding the polypeptide can be combined with transcriptional and other regulatory sequences which will direct the transcription of the sequence from the gene in the intended cells, e.g., grass or other crop plant cells. In some embodiments, an expression vector that comprises an expression cassette that comprises the polypeptide gene further comprises a promoter operably linked to the polypeptide gene. In other embodiments, a promoter and/or other regulatory elements that direct transcription of the polypeptide gene are endogenous to the plant and an expression cassette comprising the polypeptide gene is introduced, e.g., by homologous recombination, such that the heterologous polypeptide gene is operably linked to an endogenous promoter and is expression driven by the endogenous promoter. Regulatory sequences include promoters, which may be either constitutive or inducible, or tissue-specific.
Tissue-Specific Promoters
In some embodiments, a plant promoter to direct expression of the polypeptide of the present invention in a specific tissue is employed (tissue-specific promoters). Tissue specific promoters are transcriptional control elements that are only active in particular cells or tissues at specific times during plant development, such as in vegetative tissues or reproductive tissues.
Examples of tissue-specific promoters under developmental control include promoters that initiate transcription only (or primarily only) in certain tissues, such as vegetative tissues, cell walls, including e.g., roots or leaves. A variety of promoters specifically active in vegetative tissues, such as leaves, stems, roots and tubers are known. For example, promoters controlling patatin, the major storage protein of the potato tuber, can be used (see, e.g., Kim, Plant Mol. Biol. 26:603-615, 1994; Martin, Plant J. 11:53-62, 1997). The ORF13 promoter from Agrobacterium rhizogenes that exhibits high activity in roots can also be used (Hansen, Mol. Gen. Genet. 254:337-343, 1997). Other useful vegetative tissue-specific promoters include: the tarn promoter of the gene encoding a globulin from a major taro (Colocasia esculenta L. Schott) corm protein family, tarin (Bezerra, Plant Mol. Biol. 28:137-144, 1995); the curculin promoter active during taro corm development (de Castro, Plant Cell 4:1549-1559, 1992) and the promoter for the tobacco root-specific gene TobRB7, whose expression is localized to root meristem and immature central cylinder regions (Yamamoto, Plant Cell 3:371-382, 1991).
Leaf-specific promoters, such as the ribulose biphosphate carboxylase (RBCS) promoters can be used. For example, the tomato RBCS1, RBCS2 and RBCS3A genes are expressed in leaves and light-grown seedlings, only RBCS1 and RBCS2 are expressed in developing tomato fruits (Meier, FEBS Lett. 415:91-95, 1997). A ribulose bisphosphate carboxylase promoters expressed almost exclusively in mesophyll cells in leaf blades and leaf sheaths at high levels (e.g., Matsuoka, Plant J. 6:311-319, 1994), can be used. Another leaf-specific promoter is the light harvesting chlorophyll a/b binding protein gene promoter (see, e.g., Shiina, Plant Physiol. 115:477-483, 1997; Casal, Plant Physiol. 116:1533-1538, 1998). The Arabidopsis thaliana myb-related gene promoter (Atmyb5) (Li, et al., FEBS Lett. 379:117-121 1996), is leaf-specific. The Atmyb5 promoter is expressed in developing leaf trichomes, stipules, and epidermal cells on the margins of young rosette and cauline leaves, and in immature seeds. Atmyb5 mRNA appears between fertilization and the 16 cell stage of embryo development and persists beyond the heart stage. A leaf promoter identified in maize (e.g., Busk et al., Plant J. 11:1285-1295, 1997) can also be used.
Another class of useful vegetative tissue-specific promoters are meristematic (root tip and shoot apex) promoters. For example, the “SHOOTMERISTEMLESS” and “SCARECROW” promoters, which are active in the developing shoot or root apical meristems, (e.g., Di Laurenzio, et al., Cell 86:423-433, 1996; and, Long, et al., Nature 379:66-69, 1996); can be used. Another useful promoter is that which controls the expression of 3-hydroxy-3-methylglutaryl coenzyme A reductase HMG2 gene, whose expression is restricted to meristematic and floral (secretory zone of the stigma, mature pollen grains, gynoecium vascular tissue, and fertilized ovules) tissues (see, e.g., Enjuto, Plant Cell. 7:517-527, 1995). Also useful are kn1-related genes from maize and other species which show meristem-specific expression, (see, e.g., Granger, Plant Mol. Biol. 31:373-378, 1996; Kerstetter, Plant Cell 6:1877-1887, 1994; Hake, Philos. Trans. R. Soc. Lond. B. Biol. Sci. 350:45-51, 1995). For example, the Arabidopsis thaliana KNAT1 promoter (see, e.g., Lincoln, Plant Cell 6:1859-1876, 1994) can be used.
In some embodiments, the promoter is substantially identical to the native promoter of a promoter that drives expression of a gene involved in secondary wall deposition. Examples of such promoters are promoters from IRX1, IRX3, IRX5, IRX8, IRX9, IRX14, IRX7, IRX10, GAUT13, or GAUT14 genes. Specific expression in fiber cells can be accomplished by using a promoter such as the NST1 promoter and specific expression in vessels can be accomplished by using a promoter such as VND6 or VND7. (See, e.g., PCT/US2012/023182 for illustrative promoter sequences).
One of skill will recognize that a tissue-specific promoter may drive expression of operably linked sequences in tissues other than the target tissue. Thus, as used herein a tissue-specific promoter is one that drives expression preferentially in the target tissue, but may also lead to some expression in other tissues as well.
Constitutive Promoters
A promoter, or an active fragment thereof, can be employed which will direct expression of a nucleic acid encoding a fusion protein of the invention, in all or most transformed cells or tissues, e.g. as those of a regenerated plant. Such promoters are referred to herein as “constitutive” promoters and are active under most environmental conditions and states of development or cell differentiation. Examples of constitutive promoters include those from viruses which infect plants, such as the cauliflower mosaic virus (CaMV) 35S transcription initiation region (see, e.g., Dagless, Arch. Virol. 142:183-191, 1997); the 1′- or 2′-promoter derived from T-DNA of Agrobacterium tumefaciens (see, e.g., Mengiste supra (1997); O'Grady, Plant Mol. Biol. 29:99-108, 1995); the promoter of the tobacco mosaic virus; the promoter of Figwort mosaic virus (see, e.g., Maiti, Transgenic Res. 6:143-156, 1997); actin promoters, such as the Arabidopsis actin gene promoter (see, e.g., Huang, Plant Mol. Biol. 33:125-139, 1997); alcohol dehydrogenase (Adh) gene promoters (see, e.g., Millar, Plant Mol. Biol. 31:897-904, 1996); ACT11 from Arabidopsis (Huang et al., Plant Mol. Biol. 33:125-139, 1996), Cat3 from Arabidopsis (GenBank No. U43147, Zhong et al., Mol. Gen. Genet. 251:196-203, 1996), the gene encoding stearoyl-acyl carrier protein desaturase from Brassica napus (Genbank No. X74782, Solocombe et al., Plant Physiol. 104:1167-1176, 1994), GPc1 from maize (GenBank No. X15596, Martinez et al., J. Mol. Biol. 208:551-565, 1989), Gpc2 from maize (GenBank No. U45855, Manjunath et al., Plant Mol. Biol. 33:97-112, 1997), other transcription initiation regions from various plant genes known to those of skill. See also Holtorf, “Comparison of different constitutive and inducible promoters for the overexpression of transgenes in Arabidopsis thaliana,” Plant Mol. Biol. 29:637-646, 1995).
Inducible Promoters
In some embodiments, a plant promoter may direct expression of the nucleic acids under the influence of changing environmental conditions or developmental conditions. Examples of environmental conditions that may effect transcription by inducible promoters include anaerobic conditions, elevated temperature, drought or other environmental stress, or the presence of light. Examples of developmental conditions that may effect transcription by inducible promoters include senescence and embryogenesis. Such promoters are referred to herein as “inducible” promoters. For example, the invention can incorporate drought-specific promoter such as the drought-inducible promoter of maize (Busk et al., Plant J, 11: 1285-95, 1997); or alternatively the cold, drought, and high salt inducible promoter from potato (Kirch Plant Mol. Biol. 33:897-909, 1997).
Suitable promoters responding to biotic or abiotic stress conditions include the pathogen inducible PRP1-gene promoter (Ward et al., Plant. Mol. Biol. 22:361-366, 1993), the heat inducible hsp80-promoter from tomato (U.S. Pat. No. 5,187,267), cold inducible alpha-amylase promoter from potato (PCT Publication No. WO 96/12814) or the wound-inducible pinII-promoter (European Patent No. 375091). For other examples of drought, cold, and salt-inducible promoters, such as the RD29A promoter, see, e.g., Yamaguchi-Shinozalei et al., Mol. Gen. Genet. 236:331-340, 1993 are also known.
Alternatively, plant promoters which are inducible upon exposure to plant hormones, such as auxins, may be used to express the polypeptide gene. For example, the invention can use the auxin-response elements E1 promoter fragment (AuxREs) in the soybean (Glycine max L.) (Liu, Plant Physiol. 115:397-407, 1997); the auxin-responsive Arabidopsis GST6 promoter (also responsive to salicylic acid and hydrogen peroxide) (Chen, Plant J. 10: 955-966, 1996); the auxin-inducible parC promoter from tobacco (Sakai, 37:906-913, 1996); a plant biotin response element (Streit, Mol. Plant Microbe Interact. 10:933-937, 1997); and, the promoter responsive to the stress hormone abscisic acid (Sheen, Science 274:1900-1902, 1996).
In further embodiments, a plant can be engineered to overexpress the polypeptide using a positive feedback loop to express the polypeptide in a desired tissue. In some embodiments, a promoter for use in the polypeptide expression construct is responsive to a transcription factor that mediates expression in the desired tissue. The polypeptide expression construct is used in a genetically modified plant comprising an expression construct encoding a transcription factor where expression is also driven by a promoter that is responsive to the transcription factor. Examples of such expression systems are provided in PCT/US2012/023182, hereby incorporated by reference.
In some embodiments in which a positive feedback loop is employed, the plant is genetically modified to express a transcription factor that regulates the production of secondary cell wall. Examples of such transcription factors include NST1, NST2, NST3, SND2, SND3, MYB103, MBY85, MYB46, MYB83, MYB58, and MYB63 (See, e.g., Mitsuda et al., Plant Cell 17:2993-3006 (2005); Mitsuda et al., Plant Cell 19:270-80 (2007); Ohashi-Ito et al., Plant Cell 22:3461-73 (2010); Zhong et al., Plant Cell 20:2763-82 (2008); Zhong et al., Plant Cell 19:2776-92 (2007); Ko et al., Plant J. 60:649-65 (2009); and McCarthy et al., Plant Cell Physiol. 50:1950-64 (2009)). Illustrative examples of gene and protein sequences and/or accession numbers for NST1, NST2, NST3, SND2, SND3, MYB103, MBY85, MYB46, MYB83, MYB58, and MYB63 are provided in PCT/US2012/023182, hereby incorporated by reference.
In some embodiments, the polynucleotide encoding the transcription factor that regulates secondary cell wall production is operably linked to a promoter that is a downstream target of the transcription factor. Similarly, the polypeptide nucleic acid sequence is also linked to a promoter that is a downstream target of the transcription factor. The promoter may be the same promoter or different promoters. In such an embodiment, a promoter is suitable for use with the transcription factor that regulates secondary cell wall production if expression of the promoter is induced, directly or indirectly, by the transcription factor to be expressed, and if the promoter is expressed in the desired location, e.g., the stem of the plant.
In another embodiment, the polynucleotide encoding the polypeptide is expressed through a transposable element. This allows for constitutive, yet periodic and infrequent expression of the constitutively active polypeptide. The invention also provides for use of tissue-specific promoters derived from viruses including, e.g., the tobamovirus subgenomic promoter (Kumagai, Proc. Natl. Acad. Sci. USA 92:1679-1683, 1995); the rice tungro bacilliform virus (RTBV), which replicates only in phloem cells in infected rice plants, with its promoter which drives strong phloem-specific reporter gene expression; the cassava vein mosaic virus (CVMV) promoter, with highest activity in vascular elements, in leaf mesophyll cells, and in root tips (Verdaguer, Plant Mol. Biol. 31:1129-1139, 1996).
A vector comprising nucleic acid sequences encoding the polypeptide will typically comprise a marker gene that confers a selectable phenotype on the cell to which it is introduced. Such markers are known. For example, the marker may encode antibiotic resistance, such as resistance to kanamycin, G418, bleomycin, hygromycin, and the like.
Nucleic acid sequences encoding the polypeptide of the invention are expressed recombinantly in plant cells as described. As appreciated by one of skill in the art, expression constructs can be designed taking into account such properties as codon usage frequencies of the plant in which the nucleic acid encoding the polypeptide is to be expressed. Codon usage frequencies can be tabulated using known methods (see, e.g., Nakamura et al. Nucl. Acids Res. 28:292, 2000). Codon usage frequency tables are available in the art (e.g., from the Codon Usage Database at the internet site at kazusa.or.jp/codon/.)
Additional sequence modifications may be made that are also known to enhance gene expression in a plant. These include elimination of sequences encoding spurious polyadenylation signals, exon-intron splice site signals, transposon-like repeats, and other such well-characterized sequences that may be deleterious to gene expression. The G-C content of the sequence may be adjusted to levels average for a given cellular host, as calculated by reference to known genes expressed in the host cell. When possible, the sequence may also be modified to avoid predicted hairpin secondary mRNA structures.
Production of Modified Cells or Transgenic Plants
In some embodiments, the modified eukaryotic cell is a plant cell. Techniques for genetically modifying eukaryotic cells, such as plant, animal and fungal cells are well known to those skilled in the art. For example, U.S. Provisional Patent Application Ser. No. 61/676,811 teaches such methods for yeast.
In some embodiments, the plant is a grass plant. In some embodiments, the plant of plant cell is Arabidopsis, poplar, eucalyptus, rice, corn, cotton, switchgrass, sorghum, millet, miscanthus, sugarcane, pine, alfalfa, wheat, soy, barley, turfgrass, tobacco, hemp, bamboo, rape, sunflower, willow, or Brachypodium
The present invention provides for transgenic plants comprising recombinant expression cassettes either for expressing the polypeptide. It should be recognized that the term “transgenic plants” as used here encompasses the plant or plant cell in which the expression cassette is introduced as well as progeny of such plants or plant cells that contain the expression cassette, including the progeny that have the expression cassette stably integrated in a chromosome.
Once an expression cassette comprising a polynucleotide encoding the polypeptide has been constructed, standard techniques may be used to introduce the polynucleotide into a plant in order to modify gene expression. See, e.g., protocols described in Ammirato et al. (1984) Handbook of Plant Cell Culture—Crop Species. Macmillan Publ. Co. Shimamoto et al. (1989) Nature 338:274-276; Fromm et al. (1990) Bio/Technology 8:833-839; and Vasil et al. (1990) Bio/Technology 8:429-434.
Transformation and regeneration of plants is known in the art, and the selection of the most appropriate transformation technique will be determined by the practitioner. Suitable methods may include, but are not limited to: electroporation of plant protoplasts; liposome-mediated transformation; polyethylene glycol (PEG) mediated transformation; transformation using viruses; micro-injection of plant cells; micro-projectile bombardment of plant cells; vacuum infiltration; and Agrobacterium tumeficiens mediated transformation. Transformation means introducing a nucleotide sequence in a plant in a manner to cause stable or transient expression of the sequence. Examples of these methods in various plants include: U.S. Pat. Nos. 5,571,706; 5,677,175; 5,510,471; 5,750,386; 5,597,945; 5,589,615; 5,750,871; 5,268,526; 5,780,708; 5,538,880; 5,773,269; 5,736,369 and 5,610,042.
Transformed plant cells derived by any of the above transformation techniques can be cultured to regenerate a whole plant that possesses the transformed genotype and thus the desired phenotype such as enhanced drought-resistance. Such regeneration techniques rely on manipulation of certain phytohormones in a tissue culture growth medium, typically relying on a biocide and/or herbicide marker which has been introduced together with the desired nucleotide sequences. Plant regeneration from cultured protoplasts is described in Evans et al., Protoplasts Isolation and Culture, Handbook of Plant Cell Culture, pp. 124-176, MacMillilan Publishing Company, New York, 1983; and Binding, Regeneration of Plants, Plant Protoplasts, pp. 21-73, CRC Press, Boca Raton, 1985. Regeneration can also be obtained from plant callus, explants, organs, or parts thereof. Such regeneration techniques are described generally, e.g., in Klee et al. Ann. Rev. of Plant Phys. 38:467-486, 1987.
One of skill will recognize that after the expression cassette is stably incorporated in transgenic plants and confirmed to be operable, it can be introduced into other plants by sexual crossing. Any of a number of standard breeding techniques can be used, depending upon the species to be crossed.
The expression constructs of the invention can be used to increase the sugar content of cell walls of essentially any plant. The plant may be a monocotyledonous plant or a dicotyledonous plant. In some embodiments of the invention, the plant is a green field plant. In some embodiments, the plant is a gymnosperm or conifer. Thus, the invention has use over a broad range of plants, including species from the genera Asparagus, Atropa, Avena, Brassica, Cannabis, Citrus, Citrullus, Camelina, Capsicum, Cucumis, Cucurbita, Daucus, Fragaria, Glycine, Gossypium, Helianthus, Heterocallis, Hordeum, Hyoscyamus, Lactuca, Linum, Lolium, Lycopersicon, Malus, Manihot, Majorana, Medicago, Nicotiana, Oryza, Panieum, Pannesetum, Persea, Pisum, Pyrus, Prunus, Raphanus, Secale, Senecio, Sinapis, Solanum, Sorghum, Trigonella, Triticum, Vitis, Vigna, and, Zea. In some embodiments, the plant is corn, switchgrass, sorghum, miscanthus, sugarcane, poplar, pine, wheat, rice, soy, cotton, barley, turf grass, tobacco, potato, bamboo, rape, sugar beet, sunflower, willow, and eucalyptus. In further embodiments, the plant is reed canarygrass (Phalaris arundinacea), Miscanthus x giganteus, Miscanthus sp., sericea lespedeza (Lespedeza cuneata), millet, ryegrass (Lolium multiflorum, Lolium sp.), timothy, Kochia (Kochia scoparia), forage soybeans, alfalfa, clover, sunn hemp, kenaf, bahiagrass, bermudagrass, dallisgrass, pangolagrass, big bluestem, indiangrass, fescue (Festuca sp.), Dactylis sp., Brachypodium distachyon, smooth bromegrass, orchardgrass, or Kentucky bluegrass among others. In some embodiments, the plant is an ornamental plant. In some embodiments, the plant is a grass plant. In some embodiment, the plant is a vegetable- or fruit-producing plant. In some embodiments, the plant is a plant that is suitable for generating biomass, including plants as noted above, e.g., Arabidopsis, poplar, eucalyptus, rice, corn, switchgrass, sorghum, millet, miscanthus, sugarcane, pine, alfalfa, wheat, soy, barley, turfgrass, tobacco, hemp, bamboo, rape, sunflower, willow, Jatropha, and Brachypodium.
In some embodiments, the plant into which the expression construct comprising a nucleic acid sequence that encodes the polypeptide is introduced is the same species of plant from which the mutant IRX10 sequence, and/or the promoter driving expression of the mutant IRX10 sequence, is obtained. In some embodiments, the plant into which the expression construct is introduced is a different species of plant compared to the species from which the mutant IRX10 and/or promoter sequence was obtained.
Plants that overexpress the mutant IRX10 can be identified using any known assay, including analysis of RNA, protein, or xylan composition. The xylan levels can be determined directly or indirectly, wherein such methods are well known in the art.
An expression cassette comprising a polynucleotide encoding the polypeptide operably linked to a promoter, as described herein, can be expressed in various kinds of plants. The plant may be a monocotyledonous plant or a dicotyledonous plant. In some embodiments of the invention, the plant is a green field plant. In some embodiments, the plant is a gymnosperm or conifer.
In some embodiments, the plant is a plant that is suitable for generating biomass. Examples of suitable plants include, but are not limited to, Arabidopsis, poplar, eucalyptus, rice, corn, switchgrass, sorghum, millet, miscanthus, sugarcane, pine, alfalfa, wheat, soy, barley, turfgrass, tobacco, hemp, bamboo, rape, sunflower, willow, Jatropha, and Brachypodium.
In some embodiments, the plant into which the expression cassette is introduced is the same species of plant as the promoter and/or as the polynucleotide encoding the polypeptide or transcription factor (e.g., a vessel-specific promoter and/or transcription factor from Arabidopsis is expressed in an Arabidopsis plant). In some embodiments, the plant into which the expression cassette is introduced is a different species of plant than the promoter and/or than the polynucleotide encoding the polypeptide or transcription factor (e.g., a vessel-specific promoter and/or transcription factor from Arabidopsis is expressed in a poplar plant). See, e.g., McCarthy et al., Plant Cell Physiol. 51:1084-90 (2010); and Zhong et al., Plant Physiol. 152:1044-55 (2010).
Methods of enzymatic saccharification are also known in the art. Briefly, plants or plant biomass material (e.g., leaves and stems) are optionally pre-treated with hot water, dilute acid, alkali, or ionic liquid followed by enzymatic saccharification using a mixture of cellulases and hemicellulases and pectinases in buffer and incubation of the plants or plant biomass material with the enzymatic mixture. Following incubation, the yield of the saccharification reaction can be readily determined by measuring the amount of reducing sugar released, using a standard method for sugar detection, e.g. the dinitrosalicylic acid method well known to those skilled in the art. Plants engineered in accordance with the invention provide a higher sugar yield as compared to wild-type plants.
It is to be understood that, while the invention has been described in conjunction with the preferred specific embodiments thereof, the foregoing description is intended to illustrate and not limit the scope of the invention. Other aspects, advantages, and modifications within the scope of the invention will be apparent to those skilled in the art to which the invention pertains.
All patents, patent applications, and publications mentioned herein are hereby incorporated by reference in their entireties.
The invention having been described, the following examples are offered to illustrate the subject invention by way of illustration, not by way of limitation.
EXAMPLE 1 Dominant Suppression of Xylan Biosynthesis Using IRX10
Potential catalytic residues in the xylan biosynthetic enzyme IRX10 are identified and mutated. The overexpression of the mutated IRX10 out competes the native form of the enzyme resulting in the suppression of the biosynthesis of the polymer.
FIG. 2 shows a comparison the amino acid sequences between Arabidopsis IRX10, IRX10-L, OsIRX10, PpIRX10, and HsEXO1. IRX10 is well conserved within diverse homologs, including human EXO1. The indicated IRX10 mutants shown in FIG. 2 are generated and are overexpressed in plants. FIG. 3 shows that the mutant plants overexpressing the mutant IRX10s have a phenotype consistent with reduced xylan.
Cell wall material from the plants in FIG. 3 are isolated and digested with Xylanase C, an enzyme that cleaves xylan specifically at glucuronic acid substitutions. The digestion products are then fluorescently labelled and separated by size. FIG. 4 shows the distribution of glucuronic acid residues along the xylan chain. FIG. 4 shows that suppressors may alter the substitution pattern of the xylan backbone. Cell wall material from the basal stem of at least 3 biological replicates is fully hydrolyzed with TFA and the monosaccharides separated and quantified via HPAEC. FIG. 5 shows the monosaccharide analysis of T2 stems. The results indicate that the biosynthesis of xylan is reduced in the plants with the mutant IRX10.
To eliminate the yield reduction associated with reduced xylan, expression of the suppressor is restricted specifically to the vessels. This can be accomplished by expressing the Cre recombinase under the vessel specific promoter pVND7. Cre recognizes cognate loxP sites, looping out any sequence between the sites from the genome. FIG. 6 shows a construct for restricting the expression of the suppressor in the plant vessels.
The results demonstrate the following: IRX10 is at least 70% conserved in all land plants and potential catalytic residues can be identified. Mutations in some of the residues chosen are able to dominantly suppress xylan biosynthesis and reduce the amount of xylose in the plant by as much as about 55%. The mutation G283D, is the same mutation linked to cancer in the human homolog EXO1, exhibits significant suppression.
While the present invention has been described with reference to the specific embodiments thereof, it should be understood by those skilled in the art that various changes may be made and equivalents may be substituted without departing from the true spirit and scope of the invention. In addition, many modifications may be made to adapt a particular situation, material, composition of matter, process, process step or steps, to the objective, spirit and scope of the present invention. All such modifications are intended to be within the scope of the claims appended hereto.

Claims (11)

What is claimed is:
1. A non-naturally occurring nucleic acid encoding a mutant polypeptide operably linked to a heterologous promoter, wherein the mutant polypeptide exhibits dominant suppression of the naturally occurring IRX10 polypeptide as set forth in SEQ ID NO: 1, wherein the mutant polypeptide comprises one or more of the following mutations in the amino acid sequence as set forth in SEQ ID NO: 1: the histidine at position 146 of SEQ ID NO: 1 is substituted with the aspartate amino acid residue, the cysteine at position 278 of SEQ ID NO: 1 is substituted with the alanine amino acid residue, the glycine at position 283 of SEQ ID NO: 1 is substituted with the aspartate amino acid residue, and the glutamic acid at position 293 of SEQ ID NO: 1 is substituted with the glutamine amino acid residue,
and wherein overexpression of said mutant polypeptide in a plant reduces xylan biosynthesis in said plant.
2. A host cell comprising the non-naturally occurring nucleic acid of claim 1.
3. A plant transformed with the non-naturally occurring nucleic acid of claim 1.
4. A method of reducing xylan biosynthesis in a plant, comprising: (a) transforming a plant with the non-naturally occurring nucleic acid of claim 2, and (b) culturing or growing the transformed plant for overexpression of the non-naturally occurring nucleic acid encoding the mutant polypeptide in said transformed plant to reduce biosynthesis of xylan in the transformed plant as compared to a corresponding control plant of the same plant species lacking the non-naturally occurring nucleic acid and grown under similar growth conditions.
5. The method of claim 4, wherein the heterologous promoter is a constitutive promoter.
6. The method of claim 4, wherein the heterologous promoter is an inducible promoter.
7. The method of claim 4, wherein the heterologous promoter is a tissue specific promoter.
8. The method of claim 7, wherein the tissue specific promoter is a vessel specific promoter.
9. The method of claim 7, wherein the tissue specific promoter is a secondary wall specific promoter.
10. The method of claim 4, wherein the glutamic acid at position 293 of SEQ ID NO: 1 is substituted with the glutamine amino acid residue in the mutant polypeptide.
11. The non-naturally occurring nucleic acid of claim 1, wherein the glycine at position 283 of SEQ ID NO: 1 is substituted with the aspartate amino acid residue in the mutant polypeptide.
US15/847,788 2016-12-16 2017-12-19 Mutant xylan biosynthetic enzymes capable of dominant suppression of xylan biosynthesis Active 2038-12-05 US11208666B2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/847,788 US11208666B2 (en) 2016-12-16 2017-12-19 Mutant xylan biosynthetic enzymes capable of dominant suppression of xylan biosynthesis

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662435687P 2016-12-16 2016-12-16
US15/847,788 US11208666B2 (en) 2016-12-16 2017-12-19 Mutant xylan biosynthetic enzymes capable of dominant suppression of xylan biosynthesis

Publications (2)

Publication Number Publication Date
US20180251774A1 US20180251774A1 (en) 2018-09-06
US11208666B2 true US11208666B2 (en) 2021-12-28

Family

ID=63357278

Family Applications (1)

Application Number Title Priority Date Filing Date
US15/847,788 Active 2038-12-05 US11208666B2 (en) 2016-12-16 2017-12-19 Mutant xylan biosynthetic enzymes capable of dominant suppression of xylan biosynthesis

Country Status (1)

Country Link
US (1) US11208666B2 (en)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170107542A1 (en) * 2015-10-20 2017-04-20 University Of Georgia Research Foundation, Inc. Transgenic plants having altered expression of a xylan xylosyltransferase and methods of using same

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170107542A1 (en) * 2015-10-20 2017-04-20 University Of Georgia Research Foundation, Inc. Transgenic plants having altered expression of a xylan xylosyltransferase and methods of using same

Non-Patent Citations (34)

* Cited by examiner, † Cited by third party
Title
Altschul et al, "Basic Local Alignment Search Tool." J. Mol. Biol.., vol. 215, pp. 403-410 (1990).
Altschul et al., "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs." Oxford University Press Nucleic Acids Research, vol. 25, No. 17 , pp. 3389-3402 (1997).
Ausubel et al., "Current Protocols in Molecular Biology." John Wiley & Sons Inc; ringbou edition (2003). ISBN: 047150338X.
Bezerra et al., "A corm-specific gene encodes tarin, a major globulin of taro (Colocasia esculenta L. Schott)." Plant Molecular Biology, vol. 28, pp. 137-144 (1995).
Bowie et al, (1990, "Deciphering the Message in Protein Sequences: Tolerance to Amino Acid written Substitutions", Science 247: 1306-1310). *
Brandon, et al., "Dominant suppression of xylan biosynthesis using IRX10." Joint BioEnergy Institute and Biological Systems and Engineering Division, Lawrence Berkeley National Laboratory, Berkeley, CA 94720, USA. Poster submission Dec. 16, 2016 at: International Conference on Plant Synthetic Biology and Bioengineering (ICPSBB) 2016. https://www.aiche.org/sbe/conferences/international-conference-on-plant-synthetic-biology-and-bioengineering/2016/.
Busk et al., "In Vivo Footprinting of Plant Tissues." Plant Molecular Biology Reporter, vol. 20, pp. 287-297 (2002).
Casal et al, "Different Phototransduction Kinetics of Phytochrome A and Phytochrome B in Arabidopsis thaliana1." Plant Physiol., vol. 116, pp. 1533-1538 (1998).
Decastro et al., "Spatial and Temporal Gene Expression Patterns Occur during Corm Development." American Society of Plant Physiologists, The Plant Cell, vol. 4, pp. 1549-1559, (1992).
Dilaurenzio et al., "The SCARECROW Gene Regulates an Asymmetric Cell Division That is Essential for Generating the Radial Organization of the Arabidopsis Root." Cell Press, Cell, vol. 86, pp. 423-433 (1996).
Enjuto et al., "Expression of the Arabidopsis HMG2 Gene, Encoding 3-Hydroxy-3-Methylglutaryl Coenzyme A Reductase, 1s Restricted to Meristematic and Floral Tissues." American Society of Plant Physiologists, The Plant Cell, vol. 7, pp. 517-527, May 1995.
Hake et al., "Homeobox genes in the functioning of plant meristems." Phil. Trans. R. Soc. Lond. B., vol. 350, pp. 45-51 (1995). Downloaded Jun. 12, 2018 from http://rstb.royalsocietypublishing.org/.
Hansen et al., "Wound-inducible and organ-speci® c expression of ORF13 from Agrobacterium rhizogenes 8196 T-DNA in transgenic tobacco plants." Springer-Verlag, Mol Gen Genet, vol. 254, pp. 337-343 (1997).
Henikoff et al., "Amino acid substitution matrices from protein blocks." Biochemistry, Proc. Natl. Acad. Sci. USA vol. 89, pp. 10915-10919 (1992).
Kano-Murakami et al (1993, "A Rice Homeotic Gene, OSH1, Causes Unusual Phenotypes in Transgenic Tobacco", FEBS 334:365-368). *
Karlin et al., "Methods for assessing the statistical significance of molecular sequence features by using general scoring schemes." Evolution, Proc. Natl. Acad. Sci. USA vol. 87, pp. 2264-2268 (1990).
Kerstetter et al., "Sequence Analysis and Expression Patterns Divide the Maize knotted-like Homeobox Genes into Two Classes." American Society of Plant Physiologists, The Plant Cell, vol. 6, pp. 1877-1887 (1994).
Kim et al., "Nuclear protein factors binding to a class I patatin promoter region are tuber-specific and sucrose-inducible." Plant Molecular Biology vol. 26, pp. 603-615 (1994).
Lao et al (2020, NCBI Accession No. Q9FZJ1). *
Li et al., "A novel myb-related gene from Arabidopsis thaliana." School of Botany and Centre for Protein and Enzyme Technology, La Trobe University, Bundoora, Melbourne, Victoria. Australia. FEBS Letters, vol. 379, pp. 117-121 (1996).
Lincoln et al., "A knotted1-like Homeobox Gene in Arabidopsis is Expressed in the Vegetative Meristem and Dramatically Alters Leaf Morphology When Overexpressed in Transgenic Plants. American Society of Plant Physiologists." The Plant Cell, vol. 6, 1859-1876 (1994).
Long et al., "A member of the KNOTTED Class of homeodomain proteins encoded by the STM gene Arabidopsis." Letters to Nature, Dept of Genetics, and Program in Cellular and Molecular Biology, Univ of Wisconsin, Madison, WI., 53706 USA, vol. 379, No. 4, pp. 66-69 (1996).
Martin et al., "Identification of mutants in metabolically regulated gene expression." The Plant Journal vol. 1, No. 11, pp. 53-62 (1997).
Matsuoka et al., "The promoters of two carboxylases in a C4 plant (maize) direct cell-specific, light-regulated expression in a C3 plant (rice)." The Plant Journal, vol. 6, No. 3, pp. 311-319 (1994).
McConnell et al, (2001, "Radial Patterning of Arabidopsis Shoots By Class III HD-ZIP and KANADI Genes", Nature 411 (6838):709-713). *
Meier et al., "Real-time detection of central carbon metabolism in living Escherichia coli and its response to perturbations." FEBS Letters, vol. 585, pp. 3133-3138 (2011).
Needleman et al., "A General Method Applicable to the Search for Similarities in the Amino Acid Sequence of Two Proteins." J. Mol. Biol., vol. 48, pp. 443-453 (1970).
Pearson et al., "Improved tools for biological sequence comparison." Biochemistry, Proc. Natl. Acad. Sci. USA vol. 85, pp. 2444-2448 (1988).
Sambrook, "Molecular Cloning: A Laboratory Manual, Third Edition (3 volume set)" QF-22862 US/Data/Medical-Books. Uploaded: Jul. 10, 2018 http://eaststemcell.com/files/storage.cloud.php?id=MDg3OTY5NTc3Mw==.
Shiina et al., "Identification of Promoter Elements Involved in the Cytosolic Ca2+-Mediated Photoregulation of Maize cab-ml Expression." Plant Physiol., vol. 1, No. 5, pp. 477-483 (1997).
Smith et al., "Comparison of Biosequences." Advances in Applied Mathematics, vol. 2, pp. 482-489 (1981).
Wu et al (2009, "The Arabidopsis IRX10 and IRX10-LIKE Glycosyltransferases are Critical for Glucuronoxylan Biosynthesis during Secondary Cell Wall Formation", The Plant Journal 57:718-731). *
Wu, Ai-Min, et al. "The Arabidopsis IRX10 and IRX10-LIKE glycosyltransferases are critical for glucuronoxylan biosynthesis during secondary cell wall formation." The Plant Journal 57.4 (2009): 718-731. (Year: 2009). *
Yamamoto et al., "Characterization of cís-Acting Sequences Regulating Root-Specific Gene Expression in Tobacco." American Society of Plant Physiologists, The Plant Cell, vol. 3, pp. 371-382, (1991).

Also Published As

Publication number Publication date
US20180251774A1 (en) 2018-09-06

Similar Documents

Publication Publication Date Title
US10597669B2 (en) Method of reducing acetylation in plants to improve biofuel production
AU2008264202B2 (en) Enhanced silk exsertion under stress
WO2018113702A1 (en) Plant grain trait-related protein, gene, promoter and snps and haplotypes
US20110004958A1 (en) Compositions for silencing the expression of gibberellin 2-oxidase and uses thereof
US11193133B2 (en) Modulation of expression of acyltransferases to modify hydroxycinnamic acid content
CN116676331A (en) Application of ZmST1 protein and coding gene thereof in regulation and control of green-keeping, disease resistance and yield of plants
CA2727564A1 (en) Methods and means of increasing the water use efficiency of plants
MX2014007711A (en) Methods for improving crop yield.
CA2856244C (en) Use of fructokinases and sucrose synthases for increasing cell wall polymers
US9738901B2 (en) Regulation of galactan synthase expression to modify galactan content in plants
US11208666B2 (en) Mutant xylan biosynthetic enzymes capable of dominant suppression of xylan biosynthesis
US20150082480A1 (en) Methods to alter plant cell wall composition for improved biofuel production and silage digestibility
US20170107542A1 (en) Transgenic plants having altered expression of a xylan xylosyltransferase and methods of using same
WO2013057681A1 (en) Drought-tolerant transgenic plants comprising decreased myc4 activity and methods for their use
US20120117686A1 (en) Stress-tolerant plants expressing mannosylglycerate-producing enzymes
US10947551B2 (en) Compositions and methods for engineering oil content in plants
CN1330719A (en) Means and methods for influencing flowering behavious of plants
AU765102B2 (en) Maize DNA ligase I orthologue and uses thereof
Brandon Reducing Xylan and Improving Lignocellulosic Biomass through Antimorphic and Heterologous Enzyme Expression
US20150082494A1 (en) Cell Modified in the Expression of a Nucleotide Sugar Transporter
US20120054914A1 (en) High starch accumulation in plants

Legal Events

Date Code Title Description
FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

Free format text: ENTITY STATUS SET TO MICRO (ORIGINAL EVENT CODE: MICR); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

FEPP Fee payment procedure

Free format text: PETITION RELATED TO MAINTENANCE FEES GRANTED (ORIGINAL EVENT CODE: PTGR); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

AS Assignment

Owner name: THE REGENTS OF THE UNIVERSITY OF CALIFORNIA, CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BRANDON, ANDREW;SCHELLER, HENRIK VIBE;LOQUE, DOMINIQUE;SIGNING DATES FROM 20180122 TO 20180125;REEL/FRAME:044733/0226

Owner name: THE REGENTS OF THE UNIVERSITY OF CALIFORNIA, CALIF

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BRANDON, ANDREW;SCHELLER, HENRIK VIBE;LOQUE, DOMINIQUE;SIGNING DATES FROM 20180122 TO 20180125;REEL/FRAME:044733/0226

AS Assignment

Owner name: UNITED STATES DEPARTMENT OF ENERGY, DISTRICT OF COLUMBIA

Free format text: CONFIRMATORY LICENSE;ASSIGNOR:UNIVERSITY OF CALIF-LAWRENC BERKELEY LAB;REEL/FRAME:046790/0028

Effective date: 20171220

Owner name: UNITED STATES DEPARTMENT OF ENERGY, DISTRICT OF CO

Free format text: CONFIRMATORY LICENSE;ASSIGNOR:UNIVERSITY OF CALIF-LAWRENC BERKELEY LAB;REEL/FRAME:046790/0028

Effective date: 20171220

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

FEPP Fee payment procedure

Free format text: PETITION RELATED TO MAINTENANCE FEES GRANTED (ORIGINAL EVENT CODE: PTGR); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT RECEIVED

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED

STCF Information on status: patent grant

Free format text: PATENTED CASE

MAFP Maintenance fee payment

Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YR, SMALL ENTITY (ORIGINAL EVENT CODE: M2551); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

Year of fee payment: 4