US11007259B2 - High-affinity anti-VEGF antibody - Google Patents

High-affinity anti-VEGF antibody Download PDF

Info

Publication number
US11007259B2
US11007259B2 US16/067,931 US201716067931A US11007259B2 US 11007259 B2 US11007259 B2 US 11007259B2 US 201716067931 A US201716067931 A US 201716067931A US 11007259 B2 US11007259 B2 US 11007259B2
Authority
US
United States
Prior art keywords
amino acid
antibody
acid sequence
seq
vegf
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active, expires
Application number
US16/067,931
Other versions
US20200165330A1 (en
Inventor
Yasufumi MURAKAMI
Shigeki MUKOUBATA
Hirotada AKIYAMA
Koji Konomi
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
ORDER-MADE MEDICAL RESEARCH Inc
Santen Pharmaceutical Co Ltd
Original Assignee
ORDER-MADE MEDICAL RESEARCH Inc
Santen Pharmaceutical Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by ORDER-MADE MEDICAL RESEARCH Inc, Santen Pharmaceutical Co Ltd filed Critical ORDER-MADE MEDICAL RESEARCH Inc
Assigned to SANTEN PHARMACEUTICAL CO., LTD., ORDER-MADE MEDICAL RESEARCH INC. reassignment SANTEN PHARMACEUTICAL CO., LTD. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: AKIYAMA, Hirotada, MUKOUBATA, Shigeki, MURAKAMI, YASUFUMI, KONOMI, KOJI
Publication of US20200165330A1 publication Critical patent/US20200165330A1/en
Application granted granted Critical
Publication of US11007259B2 publication Critical patent/US11007259B2/en
Active legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/00113Growth factors
    • A61K39/001135Vascular endothelial growth factor [VEGF]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention relates to a high-affinity anti-VEGF antibody.
  • VEGF Vascular endothelial growth factor
  • angiogenesis vasculogenesis
  • Human VEGF protein was purified and identified in 1989. The gene thereof has been cloned and thus the gene sequence has been determined.
  • VEGF can accelerate vasculogenesis, and all members belonging to the VEGF family bind to receptors (VEGFR) corresponding to respective family molecules existing on cell membrane surfaces and thus to activate cells. As a result of dimerization due to binding of VEGF, the group of these receptors undergoes auto-phosphorylation and is thus activated.
  • VEGFR consists of seven immunoglobulin-like extracellular domains, one transmembrane domain, and one intracellular domain containing a tyrosine kinase region.
  • VEGF-A can bind to VEGF receptor-1 (receptor Flt-1) and VEGF receptor-2 (KDR/Flk-1).
  • Non Patent Literature 1 Angiogenesis in ischemic disease. Thromb. Haemost. 1999. Supplement 1: 44-52
  • Non Patent Literature 2 VEGF Receptor Signal Transduction. Sci. STKE. 2001. re21
  • Avastin® (bevacizumab) that is a recombinant anti-VEGF humanized monoclonal antibody is used for treatment of colorectal cancer, breast cancer, non-small-cell lung cancer, glioma in the central nervous system, and age-related macular degeneration (AMD).
  • Avastin does not have high affinity for VEGF (Non Patent Literature 3: Aflibercept as a Treatment for Age-related Macular Degeneration. US Ophthalimic Rev. 2013. 6:58-63).
  • the exclusive production and exclusive form of selling of Avastin force patients who need to use Avastin to pay high medical expenses. Therefore, development of a new anti-VEGF monoclonal antibody is required also from viewpoints of easing the burden of patients and reducing the costs of treatment.
  • Patent Literature 1 JP Laid-Open Publication No. 2013-502445.
  • a technical problem to be solved by the present invention is to provide a novel antibody that inhibits the physiological activity of VEGF by binding to a vascular endothelial growth factor (VEGF) with its high affinity for VEGF compared to the prior art to inhibit binding of VEGF to a VEGF receptor.
  • VEGF vascular endothelial growth factor
  • the present inventors have prepared an antibody that binds to VEGF with high affinity, have discovered that the antibody inhibits the physiological action of VEGF, and thus have completed the present invention.
  • the present invention is as follows.
  • a monoclonal antibody against VEGF that binds to a vascular endothelial growth factor (VEGF) with a dissociation constant of 1 ⁇ 10 ⁇ 11 mol/L or less.
  • VEGF vascular endothelial growth factor
  • VEGF vascular endothelial growth factor
  • VFGFR1 vascular endothelial growth factor receptor-1
  • VGFR2 vascular endothelial growth factor receptor-2
  • the antibody according to any one of (1) to (4) above comprising: CDR-H1 that comprises the amino acid sequence of SEQ ID NO: 14, CDR-112 that comprises the amino acid sequence of SEQ ID NO: 16, and CDR-H3 that comprises the amino acid sequence of SEQ ID NO: 18; and CDR-L1 that comprises the amino acid sequence of SEQ ID NO: 20, CDR-L2 that comprises the amino acid sequence of Trp-Ala-Ser, and CDR-L3 that comprises the amino acid sequence of SEQ ID NO: 22.
  • the antibody according to any one of (1) to (4) above comprising CDR-H1 that comprises the amino acid sequence of SEQ ID NO: 24, CDR-H2 that comprises the amino acid sequence of SEQ ID NO: 26, and CDR-H3 that comprises the amino acid sequence of SEQ ID NO: 28.
  • the antibody according to any one of (1) to (4) above comprising CDR-L1 that comprises the amino acid sequence of SEQ ID NO: 30, CDR-L2 that comprises the amino acid sequence of Gly-Thr-Asn, and CDR-L3 that comprises the amino acid sequence of SEQ ID NO: 32.
  • an amino acid sequence derived from a canine IgGB heavy chain constant region comprises the amino acid sequence of SEQ ID NO: 46
  • an amino acid sequence derived from a canine Ig light chain ( ⁇ chain) constant region comprises the amino acid sequence of SEQ ID NO: 48
  • an amino acid sequence derived from a canine Ig light chain ( ⁇ chain) constant region comprises the amino acid sequence of SEQ ID NO: 50.
  • the antibody according to (15) above comprising: a heavy chain that comprises the amino acid sequence of SEQ ID NO: 34 or 38 and the amino acid sequence of SEQ ID NO: 46; and a light chain that comprises the amino acid sequence of SEQ ID NO: 36 or 40 and the amino acid sequence of SEQ ID NO: 48 or 50.
  • (17) A fragment of the monoclonal antibody according to any one of (1) to (16) above.
  • (18) The fragment according to (17) above, wherein the fragment is an antigen-binding fragment.
  • the antigen-binding fragment is a single-chain antibody or a double-chain antibody.
  • (20) A hybridoma that produces the monoclonal antibody according to any one of (1) to (3) above.
  • a pharmaceutical composition comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
  • (22) The pharmaceutical composition according to (21) above, for use in treatment or prevention of a VEGF-mediated disease.
  • the pharmaceutical composition according to (22) above, wherein the VEGF-mediated disease is a cancer or a VEGF-mediated eye disease.
  • the pharmaceutical composition according to (23) above, wherein the treatment or prevention of the cancer or the VEGF-mediated eye disease is by inhibiting angiogenesis or vascular hyperpermeability.
  • the pharmaceutical composition according to (24) above, wherein the angiogenesis is pathological angiogenesis.
  • (26) The pharmaceutical composition according to (23) or (24) above, wherein the cancer is solid cancer or hematologic neoplasm.
  • cancer selected from the group consisting of colorectal cancer, rectal cancer, breast cancer, non-small-cell lung cancer, non-Hodgkin's lymphoma (NHL), renal cell cancer, prostate cancer, liver cancer, pancreas cancer, soft tissue sarcoma, Kaposi's sarcoma, carcinoid tumor, head and neck cancer, melanoma, ovarian cancer, mesothelioma, and multiple myeloma.
  • the cancer is selected from the group consisting of colorectal cancer, rectal cancer, breast cancer, non-small-cell lung cancer, non-Hodgkin's lymphoma (NHL), renal cell cancer, prostate cancer, liver cancer, pancreas cancer, soft tissue sarcoma, Kaposi's sarcoma, carcinoid tumor, head and neck cancer, melanoma, ovarian cancer, mesothelioma, and multiple myeloma.
  • VEGF-mediated eye disease is at least one selected from age-related macular degeneration, diabetic retinopathy, diabetic macular edema, neovascular glaucoma, retinal vein occlusion, retinopathy of prematurity, choroidal neovascularization associated with pathological myopia, pterygium, rubeosis, pannus, Stevens-Johnson syndrome, and an immunological rejection in a transplanted tissue of the eye.
  • An angiogenesis inhibitor comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
  • a reagent comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
  • a kit comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
  • a method for treating or preventing a cancer or a VEGF-mediated eye disease comprising a step of administering to a subject a therapeutically effective amount of the antibody or the fragment thereof according to any one of (1) to (19) above.
  • the antibody or the fragment thereof according to any one of (1) to (19) above for use in a method for treating or preventing a cancer or a VEGF-mediated eye disease.
  • the antibody or the fragment thereof according to any one of (1) to (19) above for use in the manufacture of a medicament for treatment or prevention of a cancer or a VEGF-mediated eye disease.
  • VEGF vascular endothelial growth factor
  • FIG. 1 shows the results of examining the capability of inhibiting binding of VEGF to VEGFR2 of the antibody of present invention.
  • FIG. 2 shows the results of examining the inhibiting effect of the antibody of the present invention on cell proliferation.
  • FIG. 3 shows the results of examining the in vivo inhibiting effect of KLHa505, that is the antibody of the present invention, on tumor growth.
  • FIG. 4 shows the results of examining the in vivo inhibiting effect of KLHb1501, that is the antibody of the present invention, on tumor growth.
  • FIG. 5 shows the results of examining the in vivo inhibiting effect of KLHb1501HC, that is the humanized chimeric antibody of the present invention, on tumor growth.
  • FIG. 6 shows the results of binding of KLHb1501CC, that is a caninized chimeric antibody of the present invention to canine VEGFA.
  • FIG. 7 shows the results of examining KLHb1501CC, that is the caninized chimeric antibody of the present invention, for its in vivo inhibiting effect on tumor growth in human-derived cancer cells.
  • FIG. 8 shows the results of examining the in vivo inhibiting effect of KLHb1501CC, that is the caninized chimeric antibody of the present invention, on tumor growth in a canine-derived cancer cells.
  • FIG. 9 shows the results of examining KLHa505HC, that is the humanized chimeric antibody of the present invention, for the capability of binding to VEGF165, VEGF121 and VEGF165b.
  • FIG. 10 shows the results of examining KLHb1501HC, that is the humanized chimeric antibody of the present invention, for the capability of binding to VEGF165, VEGF121 and VEGF165b.
  • Avastin is known as an anti-VEGF antibody effective for treatment of cancer and age-related macular degeneration, however, Avastin is known to have low affinity for VEGF.
  • the present inventors have developed an antibody having significantly high affinity for VEGF compared to the prior art, and thus have discovered that the antibody is effective for suppression of angiogenesis and treatment of cancer.
  • the present invention has been completed based on these findings.
  • VEGF Vascular Endothelial Growth Factor
  • VEGFs are proteins playing an important role in angiogenesis. VEGFs involve cell division and migration, induction of differentiation, vascular hyperpermeability, activation of monocytes and macrophages, and the like through binding to their receptors to cause intracellular signal transduction.
  • examples of VEGF include VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, PIGF-1, and PIGF-2, and a preferable example thereof is VEGF-A.
  • VEGF in the present invention may be derived from any mammal.
  • Examples of such a mammal include mice, rats, rabbits, dogs, goats, monkeys and humans, preferably, mice, rats, dogs and humans.
  • VEGF-A examples include VEGF (VEGF 165 ) consisting of 165 amino acid residues, a subtype thereof; that is, VEGF (VEGF 121 ) consisting of 121 amino acid residues, VEGF (VEGF 145 ) consisting of 145 amino acid residues, VEGF (VEGF 183 ) consisting of 183 amino acid residues, VEGF (VEGF 189 ) consisting of 189 amino acid residues, VEGF (VEGF 206 ) consisting of 206 amino acid residues, VEGF (VEGF 165b ) differing from the above VEGF 165 in the amino acid sequence of the C-terminal region, and naturally-occurring allelic variants thereof and processing variants thereof.
  • VEGF 121 and VEGF 165 are preferred.
  • VEGF is encoded on chromosome 6p12, and the mRNA is 16,272 bp long.
  • VEGF is consisting of exons 1 to 5, and 6a, 6b, 7a, 7b, 8a and 8b.
  • VEGF 165 binds to all of NRP1, VEGFR1 and VEGFR2.
  • examples of canine VEGF include, but are not limited to, VEGF (VEGF 164 ) consisting of 164 amino acid residues, VEGF (VEGF 120 ) consisting of 120 amino acid residues, VEGF (VEGF 144 ) consisting of 144 amino acid residues, VEGF (VEGF 147 ) consisting of 147 amino acid residues, VEGF (VEGF 162 ) consisting of 162 amino acid residues, VEGF (VEGF 182 ) consisting of 182 amino acid residues, VEGF (VEGF 188 ) consisting of 188 amino acid residues, VEGF (VEGF 205 ) consisting of 205 amino acid residues, VEGF (VEGF 164b ) differing from the above VEGF 164 in the amino acid sequence of the C-terminal region, and naturally occurring allelic variants thereof and processing variants thereof.
  • amino acid sequences of mouse, rat, canine and human VEGFs, and VEGF 121 and VEGF 165 are represented by SEQ ID NOS: 2, 4, 6, 8, 10, and 12, respectively.
  • base (nucleotide) sequences of DNA encoding mouse, rat, canine and human VEGFs, and VEGF 121 and VEGF 165 are represented by SEQ ID NOS: 1, 3, 5, 7, 9 and 11, respectively.
  • Rat VEGF amino acid sequence NP_114024.2 (SEQ ID NO: 4)
  • Canine VEGF amino acid sequence NP_001003175 (SEQ ID NO: 6)
  • Human VEGF-A amino acid sequence NP_001020537.2 (SEQ ID NO: 8)
  • VEGF 121 amino acid sequence ABO26344.1 (SEQ ID NO: 10)
  • VEGF 165 amino acid sequence AAM03108.1 (SEQ ID NO: 12)
  • Rat VEGF-encoding DNA nucleotide sequence NM_031836.2 (SEQ ID NO: 3)
  • Canine VEGF-encoding DNA nucleotide sequence NM_001003175.2 (SEQ ID NO: 5)
  • Human VEGF-A-encoding DNA nucleotide sequence NM_001025366.2 (SEQ ID NO: 7)
  • VEGF 121 -encoding DNA nucleotide sequence: EF424789.1 (SEQ ID NO: 9)
  • VEGFs to be used in the present invention include the following proteins (a) to (c):
  • a protein comprising an amino acid sequence on which one or several amino acids are deleted, substituted or added with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, and having binding activity to a VEGF receptor; and (c) a protein comprising an amino acid sequence that has 80% or higher homology (identity) with the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, and having binding activity to a VEGF receptor.
  • examples of “a protein comprising the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12” include a protein consisting of the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12.
  • amino acid sequence on which one or several amino acids are deleted, substituted or added with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12 include:
  • amino acid sequence on which 1 to 10 (for example, 1 to 5, preferably 1 to 3, more preferably 1 to 2, and further preferably 1) amino acids are deleted with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12;
  • amino acid sequence on which 1 to 10 (for example, 1 to 5, preferably 1 to 3, more preferably 1 to 2, and further preferably 1) amino acids are substituted with other amino acids with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12; (iii) an amino acid sequence on which (for example, 1 to 5, preferably 1 to 3, more preferably 1 to 2, and further preferably 1) amino acids are added with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12; and (iv) an amino acid sequence mutated as a combination of (i) to (iii) above.
  • VEGF receptor is at least one VEGF receptor selected from the group consisting of vascular endothelial growth factor receptor-1 (VEGFR1 (another name: Flt-1)), vascular endothelial growth factor receptor-2 (VEGFR2 (another name: KDR)) and vascular endothelial growth factor receptor-3 (VEGFR3), and is preferably vascular endothelial growth factor receptor-1 (VEGFR1) and/or vascular endothelial growth factor receptor-2 (VEGFR2), and more preferably vascular endothelial growth factor receptor-2 (VEGFR2).
  • binding activity to a VEGF receptor means activity of specifically binding to a VEGF receptor.
  • binding activity to a VEGF receptor means having at least 10% or more, 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, and preferably 90% or more activity, when compared to the activity of the protein consisting of the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, which is set to 100%.
  • examples of VEGF in the present invention include, in addition to a protein having the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, a protein having an amino acid sequence that has 80% or more homology (identity) with the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, and having binding activity to a VEGF receptor.
  • Examples of such a protein also include a protein having an amino acid sequence that has about 80% or more, 85% or more, 90% or more, 95% or more, 96% or more, 97% or more, 98% or more, or 99% or more homology with the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, and having binding activity to a VEGF receptor (an amino acid sequence substantially equivalent to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12).
  • Homology can be determined using a homology search site on the Internet, for example, by performing a homology search program such as FASTA, BLAST, PSI-BLAST or the like on the DNA Data Bank of Japan (DDBJ). Homology search can also be performed using BLAST on the National Center for Biotechnology Information (NCBI).
  • NCBI National Center for Biotechnology Information
  • Mutagenesis of DNA encoding the relevant protein in order to prepare a protein having the above mutation can be performed using a kit for mutagenesis using site-directed mutagenesis such as Kunkel method, Gapped duplex method or the like, such as QuikChangeTM Site-Directed Mutagenesis Kit (Stratagene), GeneTailorTM Site-Directed Mutagenesis System (Invitrogen), TaKaRa Site-Directed Mutagenesis System (Mutan-K, Mutan-Super Express Km and the like: Takara Bio) or the like.
  • a method such as a site-directed mutagenesis method described in “Molecular Cloning, A Laboratory Manual (4th edition)” (Cold Spring Harbor Laboratory Press (2012)) can be used.
  • anti-VEGF antibody refers to an antibody that specifically binds to the above VEGF.
  • the anti-VEGF antibody of the present invention binds to VEGF with high affinity compared to the prior art to inhibit binding of VEGF to a VEGF receptor (VEGFR).
  • bevacizumab (Avastin®) that is well known as an anti-VEGF antibody is known to have a dissociation constant of 47.9 nmol/L for binding to VEGF.
  • the term “inhibit binding” does not always means 100% inhibition of the binding of VEGF to the VEGFR.
  • the antibody of the present invention inhibits binding of VEGF to the VEGFR, for example, 50% or more, preferably 60% or more, 70% or more, 80% or more, 90% or more, 95% or more, 96% or more, 97% or more, 98% or more, and 99% or more thereof.
  • An inhibiting effect on the binding can be evaluated using a known method for a binding inhibition test, such as a method used in Example 2 of the Description.
  • the antibody of the present invention is a neutralizing antibody that neutralizes VEGF activity through its specific binding to VEGF.
  • the term “specifically bind to” means binding to (reacting with) a target molecule, but substantially not binding (not reacting with) molecules other than the target molecule.
  • the term “neutralize” at least means to inhibit (suppress) the activity of VEGF to bind to VEGFR. Whether or not binding is specific can be confirmed by immunological techniques, such as ELISA, Western blot method or immunohistological staining.
  • VEGF is used as an immunogen for preparing the antibody of the present invention.
  • VEGF When VEGF is used as an immunogen, a peptide comprising an amino acid sequence that is a portion of the full length sequence of VEGF can also be used. VEGF to be used as an antigen or an immunogen and methods for introducing mutations are as described in the above “2. VEGF”.
  • VEGF may be natural VEGF purified from a mouse, rat, dog, or human tissues or cells, for example, or VEGF produced via genetic engineering techniques.
  • a biological sample confirmed to contain VEGF is fractionated into a soluble fraction and an insoluble fraction using various surfactants, such as Triton-X or Sarkosyl.
  • the insoluble fraction is further dissolved in urea, guanidine hydrochloride or the like, and allow to bind to various columns, such as a heparin column or a binding resin, so that VEGF can be obtained.
  • VEGF to be used as an antigen can also be synthesized by specifying the amino acid sequence and then using a known protein synthesis method such as a solid phase method or a commercially available protein synthesizer.
  • a synthesized peptide is bound to a carrier protein such as Keyhole Limpet Hemocyanin (KLH) or thyroglobulin and thus the resultant can be used as an immunogen.
  • KLH Keyhole Limpet Hemocyanin
  • thyroglobulin thyroglobulin
  • the above-prepared VEGF or a partial peptide alone is administered or the same is administered together with a carrier, a diluent or the like to a non-human mammal, such as a rabbit, a dog, a guinea pig, a mouse, a rat, or a goat for immunization.
  • a carrier such as a rabbit, a dog, a guinea pig, a mouse, a rat, or a goat for immunization.
  • the dosage of the antigen per animal ranges from 0.1 mg to 10 mg when an adjuvant is used.
  • the adjuvant include Freund's complete adjuvant (FCA), Freund's incomplete adjuvant (FIA), and an aluminum hydroxide adjuvant. Immunization is performed by mainly intravenous, subcutaneous, intraperitoneal injection, or the like.
  • the immunization interval is not particularly limited, and immunization is performed at intervals of several days to several weeks, and preferably at intervals of 1 to 2 weeks for 2 to 10 times and preferably 3 to 5 times.
  • the immunization interval can be determined by persons skilled in the art considering the resulting antibody titer.
  • blood is sampled when subcutaneous immunization is performed 3 to 4 times and then the antibody titer is measured.
  • Antibody titer in serum can be measured by ELISA (enzyme-linked immunosorbent assay), EIA (enzyme immunoassay), radioimmunoassay (RIA) or the like.
  • an antibody can be separated and purified by a generally employed method.
  • separation and purification a known method such as an ammonium sulfate salting-out method, ion exchange chromatography, gel filtration chromatography, and affinity chromatography is adequately selected or combined, and then purification can be performed. That is, a serum containing a target antibody is applied to a column to which proteins other than VEGF have been bound, a flow-through fraction is collected, and then a polyclonal antibody having improved specificity to VEGF can be obtained.
  • VEGF or a partial peptide alone or the same together with a carrier or a diluent is administered to a non-human mammal for immunization.
  • the dosage of an antigen per animal, the type of an adjuvant to be used, an immunization method, and immunization intervals are similar to those for preparation of a polyclonal antibody.
  • One to 30 days, and preferably 2 to 5 days after the final immunization date individuals confirmed to have antibody titers are selected, and then antibody-producing cells are collected. Examples of antibody-producing cells include spleen cells, lymph node cells, and peripheral blood cells, and among them spleen cells or lymph node cells are preferred.
  • cell fusion of antibody-producing cells and myeloma cells is performed.
  • Cell fusion procedures can be implemented according to a known method such as the method of Kohler et al.
  • myeloma cells to be fused to antibody-producing cells generally available established cell lines of an animal such as a mouse can be used.
  • Cell lines that can be preferably used herein have drug selectivity and have a property of being unable to survive in HAT selective medium (containing hypoxanthine, aminopterin, and thymidine) when the cells are in an unfused state, but able to survive only in a state fused to antibody-producing cells.
  • HAT selective medium containing hypoxanthine, aminopterin, and thymidine
  • myeloma cells examples include mouse myeloma cell lines such as P3-x63-Ag8U.1, SP2/O-Ag14, PAI, P3U1, NSI/1-Ag4-1, and NSO/I, and rat myeloma cell lines such as YB2/0.
  • the cell fusion of myeloma cells and antibody-producing cells described above is performed by mixing 1 ⁇ 10 8 to 5 ⁇ 10 8 antibody-producing cells and 2 ⁇ 10 7 to 10 ⁇ 10 7 myeloma cells in animal cell culture medium such as serum-free DMEM and RPMI-1640 medium (the cell ratio of antibody-producing cells to myeloma cells ranges from 10:1 to 1:1), and then performing fusion reaction in the presence of a cell fusion accelerator.
  • a cell fusion accelerator polyethylene glycol having an average molecular weight of 1000-6000 daltons or Sendai virus can be used, for example.
  • antibody-producing cells and myeloma cells can be fused using a commercially available cell fusion device utilizing electrical stimulation (for example, electroporation).
  • a target hybridoma is selected from cells after cell fusion treatment.
  • Such a method is performed by appropriately diluting a cell suspension with 10% to 20% fetal calf serum-containing RPMI-1640 medium or the like, placing the resultant on a microtiter plate at about 0.3 cells/well as calculated by a limiting dilution method, adding selective medium such as HAT medium to each well, and then culturing while appropriately exchanging selective media.
  • selective medium such as HAT medium
  • Hybridoma screening may be performed according to a general method and is not particularly limited. For example, a portion of a culture supernatant contained in wells in which hybridomas have been cultured is collected and then can be screened by enzyme immunoassay, radioimmunoassay or the like. As a specific example, an antigen is adsorbed to a 96-well plate, followed by blocking with calf serum. The culture supernatant of hybridoma cells is reacted with an immobilized antigen at 37° C. for 1 hour, and then reacted with peroxidase-labeled anti-mouse IgG at 37° C.
  • Hybridomas producing a monoclonal antibody found positive as a result of the above measurement method is cloned by a limiting dilution method or the like. Finally, hybridomas that are cells producing the monoclonal antibody that specifically binds to VEGF are established.
  • the hybridomas are cultured in animal cell culture medium such as 10% fetal calf serum-containing RPMI-1640 medium, MEM, or serum free medium under general culture conditions (for example, 37° C., 5% CO 2 concentration) for 7 to 14 days, and then an antibody is obtained from the culture supernatant.
  • animal cell culture medium such as 10% fetal calf serum-containing RPMI-1640 medium, MEM, or serum free medium under general culture conditions (for example, 37° C., 5% CO 2 concentration) for 7 to 14 days, and then an antibody is obtained from the culture supernatant.
  • an ascites formation method about 5 ⁇ 10 6 to 2 ⁇ 10 7 hybridomas are administered intraperitoneally to an animal of the same species as that of a mammal from which myeloma cells are derived, such as mouse (BALB/c), so that hybridomas are grown in large amounts.
  • a mammal from which myeloma cells are derived such as mouse (BALB/c)
  • ascites is collected.
  • purification can be performed by appropriately selecting a known method such as an ammonium sulfate salting-out method, ion exchange chromatography, gel filtration, and affinity chromatography, or using these methods in combination.
  • Examples of the antibody of the present invention include, but are not limited to, an antibody wherein:
  • a heavy chain variable region comprises a heavy chain complementarity determining region (CDR)1 (CDR-H1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 14, heavy chain CDR2 (CDR-112) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 16, and/or heavy chain CDR3 (CDR-113) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 18; and/or a light chain variable region (VL) comprises light chain CDR1 (CDR-L1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 20, light chain CDR2 (CDR-L2) comprising or consisting of the amino acid sequence that consists of tryptophan (W)-alanine (A)-serine (S) (may also be referred to as “amino acid sequence WAS”, “amino acid sequence Trp-Ala-Ser”), and/or light chain CDR3 (CDR-L3) comprising or consisting of the amino acid
  • examples of the antibody of the present invention include, but are not limited to, an antibody wherein:
  • a heavy chain variable region comprises heavy chain CDR1 (CDR-H1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 24, heavy chain CDR2 (CDR-H2) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 26 and/or heavy chain CDR3 (CDR-H3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 28; and/or a light chain variable region comprises light chain CDR1 (CDR-L1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 30, light chain CDR2 (CDR-L2) comprising or consisting of the amino acid sequence that consists of glycine (G)-threonine (T)-asparagine (N) (may also be referred to as “amino acid sequence GTN”, “amino acid sequence Gly-Thr-Asn”) and/or light chain CDR3 (CDR-L3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 32.
  • examples of the antibody of the present invention include, but are not limited to, an antibody wherein: the amino acid sequence of a heavy chain variable region comprises or consists of the amino acid sequence represented by SEQ ID NO: 34 or 38; and/or the amino acid sequence of a light chain variable region comprises or consists of the amino acid sequence represented by SEQ ID NO: 36 or 40.
  • a preferred aspect of the antibody of the present invention is a recombinant antibody.
  • the recombinant antibody include, but are not limited to, a chimeric antibody, a humanized antibody, and a caninized antibody.
  • a chimeric antibody refers to an antibody prepared by linking immunoglobulin gene fragments of animals of different species.
  • examples of a chimeric antibody include a humanized chimeric antibody, and a caninized chimeric antibody, but the types of animals, from which chimeric antibody variable and constant regions are derived, are not limited.
  • a humanized chimeric antibody is an antibody prepared by linking (joining) a mouse-derived antibody variable region to a human-derived constant region, for example (see Proc. Natl. Acad. Sci. U.S.A. 81, 6851-6855, (1984), for example).
  • a caninized chimeric antibody is an antibody prepared by linking a mouse-derived antibody variable region to a dog-derived constant region, for example.
  • mice-derived antibody variable region include, but are not limited to, a heavy chain variable region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 34 or 38, and a light chain variable region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 36 or 40.
  • CDR grafting is a method for preparing a reconstructed variable region, whereby a complementarity determining region (CDR) is grafted from a mouse antibody variable region to a human variable region, so that the framework region (FR) is human-derived and CDR is mouse-derived.
  • CDR complementarity determining region
  • FR framework region
  • CDR mouse-derived
  • Such humanized reconstructed human variable region is ligated to a human constant region.
  • Such a method for preparing a humanized antibody is known in the art (see e.g., Nature, 321, 522-525 (1986); J. Mol. Biol., 196, 901-917 (1987); Queen C et al., Proc. Natl. Acad. Sci. USA, 86: 10029-10033 (1989); and Japanese Patent No. 2828340).
  • CDR1-3 of a heavy chain variable region (CDR-H1, CDR-H2 and CDR-H3) comprising or consisting of the amino acid sequences represented by SEQ ID NO: 14, 16 and 18, respectively,
  • CDR1-3 of a light chain variable region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 20, the amino acid sequence that consists of tryptophan (W)-alanine (A)-serine (S) (amino acid sequence Trp-Ala-Ser), and/or the amino acid sequence represented by SEQ ID NO: 22, respectively.
  • amino acid sequences of mouse-derived CDRs that can be used for the humanized antibody of the present invention include, but are not limited to,
  • CDR1-3 of a heavy chain variable region (CDR-H1, CDR-H2 and CDR-H3) comprising or consisting of the amino acid sequences represented by SEQ ID NO: 24, 26, and 28, respectively,
  • CDR1-3 of a light chain variable region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 30, the amino acid sequence that consists of glycine (G)-threonine (T)-asparagine (N) (amino acid sequence Gly-Thr-Asn), and/or the amino acid sequence represented by SEQ ID NO: 32, respectively.
  • a caninized antibody can also be prepared by a technique similar to the above method for preparing a humanized antibody.
  • examples of a human heavy chain constant region that can be used for a chimeric antibody and a humanized antibody include, but are not limited to, a human heavy chain constant region comprising an amino acid sequence derived from a human IgG1 heavy chain constant region, and for example, a human heavy chain constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 42
  • examples of a human light chain constant region include, but are not limited to, a human light chain constant region comprising an amino acid sequence derived from a human IgG1 light chain constant region, and for example, a human light chain constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 44.
  • examples of DNA encoding a human heavy chain constant region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 41.
  • examples of DNA encoding a human light chain constant region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 43.
  • examples of a canine heavy chain constant region that can be used for a chimeric antibody and a caninized antibody include, but are not limited to, a canine heavy chain constant region comprising an amino acid sequence derived from the canine IgGB heavy chain constant region, and for example, a canine heavy chain constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 46.
  • examples of a canine light chain constant region that can be used for a chimeric antibody and a caninized antibody include, but are not limited to, a canine light chain constant region comprising an amino acid sequence derived from a canine Ig light chain ( ⁇ chain) constant region or an amino acid sequence derived from a canine Ig light chain ( ⁇ chain) constant region, and for example, a canine light chain ( ⁇ chain) constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 48, or a canine light chain ( ⁇ chain) constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 50.
  • examples of DNA encoding a canine heavy chain constant region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 45.
  • examples of DNA encoding a canine light chain ( ⁇ chain or ⁇ chain) constant region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 47 or 49.
  • a chimeric antibody, a humanized antibody, and a caninized antibody can be prepared according to the above-mentioned known method using a hybridoma or DNA, RNA or the like extracted from the hybridoma as a raw material.
  • the antibody of the present invention in the form of a fusion protein can be prepared according to a known gene recombination technique using antibody variable regions and another protein.
  • the fusion protein can also be prepared by cross-linking a monoclonal antibody and another protein using a cross-linker.
  • a fragment of the antibody against VEGF to be used in the present invention specifically binds to VEGF.
  • An antibody fragment refers to a polypeptide containing a partial region of the antibody of the present invention.
  • an antigen-binding fragment is preferred.
  • the antigen-binding fragment include, but are not limited to, single-chain antibodies (scFv (single chain Fv)), sc (Fv) 2 ), double-chain antibodies (Fab, Fab′, diabody (diabody (dibodies), dsFv), and F(ab′) 2 .
  • the above antibody fragment can be obtained by cleaving the antibody of the present invention with various proteases depending on purposes.
  • Fab can be obtained by treating an antibody molecule with papain, and F (ab′) 2 can be obtained by treating an antibody molecule with pepsin. Moreover, Fab′ can be obtained by cleaving the disulfide bond of the above F(ab′) 2 hinge region.
  • scFv cDNA encoding antibody H chain V region and L chain V region is obtained and then DNA encoding scFv is constructed.
  • the DNA is inserted into an expression vector, and then the expression vector is introduced into a host organism for expression, so that scFv can be produced.
  • a diabody In the case of a diabody, cDNA encoding antibody H chain V region and L chain V region is obtained, and then DNA encoding scFv is constructed so that a peptide linker has an amino acid sequence with a length of 8 or less residues.
  • the DNA is inserted into an expression vector, and then the expression vector is introduced into a host organism for expression, so that a diabody can be produced.
  • dsFv cDNA encoding antibody H chain V region and L chain V region is obtained, and then DNA encoding dsFv is constructed.
  • the DNA is inserted into an expression vector, and then the expression vector is introduced into a host organism for expression, so that dsFv can be produced.
  • examples of the nucleotide sequence of DNA encoding a heavy chain variable region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 33 or 37
  • examples of the nucleotide sequence of DNA encoding a light chain variable region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 35 or 39.
  • antibody fragment of the present invention include, but are not limited to, an antibody fragment comprising:
  • VH heavy chain variable region
  • CDR-H1 heavy chain CDR1
  • CDR-H2 heavy chain CDR2
  • CDR-H3 heavy chain CDR3
  • VL light chain variable region
  • antibody fragment of the present invention include, but are not limited to, an antibody fragment comprising:
  • a heavy chain variable region comprises heavy chain CDR1 (CDR-H1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 24, heavy chain CDR2 (CDR-H2) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 26 and/or heavy chain CDR3 (CDR-H3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 28, and/or a light chain variable region comprises light chain CDR1 (CDR-L1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 30, light chain CDR2 (CDR-L2) comprising or consisting of the amino acid sequence that consists of glycine (G)-threonine (T)-asparagine (N) (amino acid sequence Gly-Thr-Asn), and/or light chain CDR3 (CDR-L3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 32.
  • CDR-H1 comprising or consisting of the amino acid sequence represented by SEQ
  • examples of the antibody fragment of the present invention include, but are not limited to, an antibody fragment wherein a heavy chain variable region comprises or consists of the amino acid sequence represented by SEQ ID NO: 34 or 38, and/or a light chain variable region comprises or consists of the amino acid sequence represented by SEQ ID NO: 36 or 40.
  • An antibody fragment (peptide) comprising CDR is composed of at least one region of VH or VL CDRs (CDR1-3).
  • An antibody fragment comprising a plurality of CDRs can be bound directly or via an appropriate peptide linker.
  • An antibody fragment comprising CDR can be produced by constructing DNA encoding antibody VH and VL CDRs, inserting the DNA into a prokaryotic expression vector or a eukaryotic expression vector, and then introducing the expression vector into prokaryotes or eukaryotes for expression.
  • a peptide comprising CDR can also be produced by a chemical synthesis method such as a Fmoc method (fluorenylmethyloxycarbonyl method) and a tBoc method (t-butyloxycarbonyl method).
  • DNA encoding VH CDR1-3 include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 13, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 15 and DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 17, respectively.
  • DNA encoding VL CDR1-3 include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 19, DNA comprising or consisting of the nucleotide sequence that consists of thymine (T)-guanine (G)-guanine (G)-guanine (G)-cytosine (C)-adenine (A)-thymine (T)-cytosine (C)-cytosine (C) (also referred to as “nucleotide sequence TGGGCATCC”), and DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 21, respectively.
  • examples of DNA encoding VH CDR1-3 include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 23, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 25 and DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 27, respectively.
  • DNA encoding VL CDR1-3 include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 29, DNA comprising or consisting of the nucleotide sequence that consists of guanine (G)-guanine (G)-thymine (T)-adenine (A)-cytosine (C)-cytosine (C)-adenine (A)-adenine (A)-cytosine (C) (may also be referred to as “nucleotide sequence GGTACCAAC”), and DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 31, respectively.
  • Binding affinity can be determined by the binding constant (KA) and dissociation constant (KD). Affinity equilibrium constant (K) is expressed by the ratio of the KA/KD. Its binding affinity can be detected as follows.
  • Binding constant (KA) and dissociation constant (KD) can be measured using surface plasmon resonance (SPR), and known devices and methods for detecting binding rates in real time and monitoring can be employed (e.g. Biacore®-3000 (GE Healthcare), ProteON XPR36 (Bio-Rad), etc.).
  • the antibody of the present invention can inhibit its target with an IC50 of 1 ⁇ 10 ⁇ 7 mol/L or less (for example, 1 ⁇ 10 ⁇ 7 mol/L or less, 1 ⁇ 10 ⁇ 8 mol/L or less, 1 ⁇ 10 ⁇ 9 mol/L or less, preferably 1 ⁇ 10 ⁇ 10 mol/L or less, more preferably 1 ⁇ 10 ⁇ 11 mol/L or less).
  • the present invention provides an antibody that binds to a site to which the antibody against VEGF of the present invention binds.
  • examples of the antibody against VEGF of the present invention include an antibody that binds to a site, to which a monoclonal antibody against VEGF that binds to VEGF with a dissociation constant of 1 ⁇ 10 ⁇ 11 mol/L or less.
  • a site to which the anti-VEGF antibody of the present invention binds is not limited, as long as it is at least a partial region of VEGF that is an antigen.
  • Examples of a site to which the anti-VEGF antibody of the present invention binds include, at least one region selected from the group consisting of exon 1, 2, 3, 4, 5, 6a, 6b, 7a, 7b, and 8a, and exon 1 to 5 regions are preferred.
  • Persons skilled in the art can specify exon 1 to 5 regions of various VEGFs based on known information such as Genbank.
  • the amino acid sequences of mouse, rat, canine, human VEGF exon 1 to 5 are represented by SEQ ID NO: 51, 52, 53 and 54, respectively.
  • sites e.g., regions and epitopes
  • polypeptides containing them to which the anti-VEGF antibody of the present invention binds, based on the Description and known techniques such as epitope mapping or X-ray structural analysis.
  • an antibody that binds to a site, to which the above monoclonal antibodies bind may be a polyclonal antibody or a monoclonal antibody.
  • the antibody may be a recombinant antibody, such as a chimeric antibody, a humanized antibody, or a caninized antibody.
  • an antibody that binds to a site, to which the antibody against VEGF of the present invention binds competes with the antibody against VEGF of the present invention for binding with VEGF.
  • an antibody competing with the antibody against VEGF of the present invention for binding with VEGF has specificity and/or activity equivalent to that of the antibody of the present invention (Specifically, a monoclonal antibody against VEGF, which binds to VEGF with a dissociation constant of 1 ⁇ 10 ⁇ 11 mol/L or less).
  • a competition test using an antibody is a technique established in the technical field of antibodies as a technique for examining if a set of antibodies bind to the same (or redundant) site (see e.g., Ju-Won Kwak et al., Journal of Immunological Methods 191 (1996) 49-54).
  • the competition test when the binding of the antibody against VEGF of the present invention is competitively inhibited by an anti-VEGF antibody to be tested, the test subject anti-VEGF antibody can be identified to be an antibody that binds to a site, to which the antibody against VEGF of the present invention binds.
  • the test method does not require information about the structure of the relevant site for examining if a set of antibodies bind to the same (or redundant) site.
  • the pharmaceutical composition of the present invention comprises the antibody or a fragment thereof described in the above “3. Antibody against VEGF” as an active ingredient, and is used for a target disease.
  • the pharmaceutical composition of the present invention is used for prevention or treatment of target diseases and is effective for the prevention or the treatment.
  • VEGF-associated diseases including symptoms (conditions)
  • examples of such diseases include solid tumors, cancers including particularly problematic metastatic tumors, and VEGF-mediated eye diseases, and other immune diseases.
  • Tumor vascular structures are known to supply blood, and also function as a vascular niche environment supporting cancer stem cells.
  • the vascular niche environment refers to an environment involving maintenance, proliferation and differentiation of hematopoietic stem cells that are sources of blood and blood vessels, and is considered to be important for cancer stem cell proliferation.
  • cancer cells are characterized by high proliferative ability, unlimited number of cell divisions, and ability to cause invasion and metastasis to peripheral tissues.
  • these partial cancer cells are cells having properties observed in common among stem cells such as embryonic stem cells and somatic stem cells, including self-replicating ability, by which the cells can create cells completely identical thereto, and pluripotency, by which the cells are capable of differentiating into many cell types.
  • the partial cancer cells are considered to be cancer stem cells that function as a source for creating the majority of peripheral cancer cells via differentiation while maintaining cells identical to themselves in the cancer tissue through self-replication.
  • Cancer stem cells are considered to be a major cause of cancer recurrence and cancer metastasis, and thus importance of targeting cancer stem cells in cancer treatment has been indicated. If significant inhibition of cancer stem cell proliferation within tumor tissue becomes possible, a novel treatment capable of killing entire cancer cells effectively can be developed.
  • cancer sternness in the present invention refers to a property of a cell population exerting the properties of cancer stem cells. Specifically, cancer sternness refers to properties of having self-replication and pluripotency peculiar to stem cells, and a property of cells functioning as a source of cancer.
  • examples of cancer include brain tumor, cervical cancer, esophageal cancer, cancer on the tongue, lung cancer, breast cancer, pancreatic cancer, gastric cancer, cancer of small bowel, duodenal cancer, colon cancer, bladder cancer, renal cancer, liver cancer, prostate cancer, uterine cancer, uterine cervix cancer, ovarian cancer, thyroid cancer, gallbladder cancer, pharyngeal cancer, sarcoma, melanoma, leukemia, lymphoma, and multiple myeloma.
  • VEGF-mediated eye disease is VEGF-associated disease that is caused by pathological angiogenesis or vascular hyperpermeability in the eye. That is, the VEGF-mediated eye disease can be treated or prevented by inhibiting binding of VEGF to a VEGF receptor using the anti-VEGF antibody.
  • Such disease examples include age-related macular degeneration (including special types such as polypoidal choroidal vasculopathy and retinal angiomatous proliferation), diabetic retinopathy, diabetic macular edema, neovascular glaucoma, retinal vein occlusion, retinopathy of prematurity, choroidal neovascularization associated with pathological myopia, pterygium, rubeosis, pannus, Stevens-Johnson syndrome, and immunological rejection of transplanted tissue (e.g., corneal tissue) of the eye.
  • age-related macular degeneration including special types such as polypoidal choroidal vasculopathy and retinal angiomatous proliferation
  • diabetic retinopathy diabetic macular edema
  • neovascular glaucoma retinal vein occlusion
  • retinopathy of prematurity retinopathy of prematurity
  • choroidal neovascularization associated with pathological myopia pterygium
  • pathological angiogenesis refers to angiogenesis that takes place, in morbidity or a state inducing morbidity, when new blood vessels grow excessively, insufficiently, or inappropriately (for example, the position or timing is undesirable from a medical viewpoint, or in development) compared with normal physiological angiogenesis (vasculogenesis).
  • the term “treatment”, “treat”, or “treating” refers to contacting (for example, administrating) the antibody or a fragment thereof or the pharmaceutical composition of the present invention (hereafter, may also be referred to as “the pharmaceutical composition of the present invention or the like”) with a subject after the onset of the disease, thereby alleviating the symptoms of the disease, compared to when the subject is not contacted with the pharmaceutical composition of the present invention or the like.
  • the treatment as used herein does not always refer to completely suppressing the symptoms of a disease.
  • onset of a disease refers to the appearance of the symptoms of the disease in the body.
  • prevention refers to contacting (for example, administrating) the pharmaceutical composition of the present invention or the like with a subject before the onset of a disease, thereby alleviating symptoms of the disease after the onset of the disease, compared to when the subject is not contacted with the pharmaceutical composition of the present invention or the like.
  • prevention does not always refer to completely suppressing the onset of the disease.
  • the pharmaceutical composition of the present invention can comprise, in addition to the antibody against VEGF of the present invention, a pharmaceutically acceptable carrier.
  • a pharmaceutically acceptable carrier refers to any carrier (e.g., liposome, lipid microcapsule, and micelle), diluent, excipient, wetting agent, buffering agent, suspending agent, lubricant, adjuvant, emulsifier, disintegrator, absorbent, preservative, surfactant, colorant, flavoring, or sweetener appropriate for the pharmaceutical composition for immune diseases.
  • compositions of the present invention or the like can be formulated into preparations for injection, freeze-dried products, tablets, hard capsules, soft capsules, granules, powders, pills, syrups, suppositories, cataplasm, ointments, cream pharmaceuticals, eye drops, and the like.
  • Liquid preparations such as preparations for injection may be in the form of powder to be prepared before use (for example, freeze-dried powder), which is dissolved in saline or the like before use.
  • the pharmaceutical composition of the present invention or the like can be administered topically or systemically through any means known by persons skilled in the art.
  • the route of administration of the pharmaceutical composition of the present invention can be oral administration and parenteral administration.
  • intratissue administration e.g., subcutaneous administration, intraperitoneal administration, intramuscular administration, and intravenous administration
  • intradermal administration e.g., local administration (e.g., transdermal administration) or transrectal administration
  • the pharmaceutical composition of the present invention can be administered in dosage forms appropriate for these routes of administration.
  • the dosage of the pharmaceutical composition of the present invention or the like can be varied depending on factors such as a subject's age, body weight, health status, gender, and symptoms, and the animal species of a subject, the route of administration, the frequency of administration, and a dosage form, and specific procedures for administration can be determined by persons skilled in the art.
  • the dosage of the antibody of the present invention for treatment of cancer ranges from, for example, 0.1 mg to 100 mg/day, preferably 1 mg to 15 mg/day, and more preferably 2 mg to 12 mg/day per kg body weight of a subject, but the examples are not limited thereto.
  • the frequency of administration the pharmaceutical composition can be administered once to 5 times a day.
  • the dosage of the antibody of the present invention for treatment of VEGF-mediated eye disease ranges from, for example, 0.01 mg to 100 mg/eye, and more preferably, 0.1 mg to 10 mg/eye.
  • the antibody can be administered once a day to once every two months, but the examples are not limited thereto.
  • the timing of administration can be appropriately determined depending on symptoms, and several dosages can be administered simultaneously or separately at intervals.
  • the pharmaceutical composition of the present invention may be administered to a subject before the onset of a disease or after the onset of the disease.
  • the pharmaceutical composition of the present invention can be administered to a mammal as a subject.
  • mammals include mice, rats, hamsters, guinea pigs, rabbits, cats, dogs, goats, pigs, sheep, cattle, horses, monkeys, and humans.
  • a cancer or a VEGF-mediated eye disease can be treated or prevented by administrating to a subject the antibody against VEGF or a fragment thereof or the pharmaceutical composition comprising the same. That is, the present invention provides a method for treating or preventing a cancer or a VEGF-mediated eye disease, comprising a step of administering to a subject a therapeutically effective amount of the antibody of the present invention or a fragment thereof or the pharmaceutical composition comprising the same.
  • the therapeutically effective amount of the antibody of the present invention or a fragment thereof or the pharmaceutical composition comprising the same is varied depending on factors such as a subject's age, body weight, health status, gender, and symptoms, the route of administration, the frequency of administration, and a dosage form.
  • subject includes subjects in need of treatment or prevention of a cancer or a VEGF-mediated eye disease.
  • mammals to be subjected to treatment or prevention as “subject” are as described above.
  • cancer In the method for treating or preventing a cancer or a VEGF-mediated eye disease of the present invention, “cancer”, “VEGF-mediated eye disease”, “treatment” and “prevention” are as described above.
  • the dosage form, the route of administration, the dosage, the timing of administration and the like of the antibody of the present invention or a fragment thereof or the pharmaceutical composition comprising the same are also as described above.
  • the antibody of the present invention inhibits binding of VEGF to a VEGF receptor, and thus can inhibit angiogenesis resulting from the binding.
  • the present invention provides an angiogenesis inhibitor comprising the antibody or a fragment thereof described in the above “3. Antibody against VEGF” as an active ingredient.
  • the angiogenesis inhibitor of the present invention can be used as a reagent or used for treatment of a mammal, and its dosage form, additives, route of administration, administration target, dosage and the like can be appropriately selected according to the description of the above “4. Pharmaceutical composition”.
  • the angiogenesis inhibitor of the present invention may be an inhibitor comprising the antibody of the present invention or a fragment thereof alone.
  • the antibody of the present invention or a fragment thereof can be used in a method for treating or preventing a cancer or a VEGF-mediated eye disease, or the manufacture of a medicament for treatment or prevention of a cancer or a VEGF-mediated eye disease.
  • the present invention provides the anti-VEGF antibody of the present invention or a fragment thereof for use in the method for treating or preventing a cancer or a VEGF-mediated eye disease.
  • the present invention provides the anti-VEGF antibody of the present invention or a fragment thereof for use in the manufacture of a medicament for treatment or prevention of a cancer or a VEGF-mediated eye disease.
  • the present invention provides the anti-VEGF antibody or a fragment thereof for use in the manufacture of an angiogenesis inhibitor.
  • cancer cancer
  • VEGF-mediated eye disease treatment
  • prevention prevention
  • the pharmaceutical composition of the present invention can be used for administration in combination with at least one of other anticancer agents.
  • anticancer agents to be used in the present invention include sorafenib (Nexavar®), sunitinib (Sutent®), bevacizumab (Avastin®), cisplatin (cDDP), carboplatin (Paraplatin®), paclitaxel (Taxol®), docetaxel (Taxotere®), gemcitabine hydrochloride (Gemzar®), gefitinib (Iressa®), erlotinib (Tarceva®), irinotecan hydrochloride (CPT-11), and 5-fluorouracil (5-FU).
  • the term “used in combination” in the present invention refers to simultaneous administration of or separate administration of the pharmaceutical composition of the present invention and at least one of the above anticancer agents.
  • the term “simultaneously” means that administration is performed at the same timing in a single administration schedule, but the times; that is, hours and minutes of administration are not required to be completely the same.
  • the term “separately” means that administration is performed at different timings in a single administration schedule.
  • the dosage form, the route of administration, and the administration target of the pharmaceutical composition or the like and an anticancer agent to be used for combination therapy in the present invention are not particularly limited, and can be appropriately selected according to the description of the above “4.
  • Pharmaceutical composition Moreover, the dosage forms or dosages of agents to be used in combination may differ from each other, and can be appropriately adjusted depending on a combination employed.
  • the dosage can be decreased as appropriate. Therefore, when the pharmaceutical composition of the present invention is combined with another anticancer agent, the following combinations of
  • a subeffective dose of the pharmaceutical composition of the present invention and a subeffective dose of another anticancer agent can be employed.
  • the two can be administered in combination in such an aspect, when the combination can exert pharmacological effects.
  • the monoclonal antibody of the present invention or a fragment thereof can be included in a reagent for detection of VEGF or a kit. That is, the present invention provides a reagent and a kit comprising the monoclonal antibody of the present invention or a fragment thereof.
  • the reagent and the kit of the present invention can be used as a reagent for detecting VEGF or a kit, for example.
  • the monoclonal antibody of the present invention or a fragment thereof may be treated by a method such as freezing for easy handling, and then directly or mixed with a known pharmaceutically acceptable carrier, such as an excipient, an extending agent, a binder, and a lubricant, and a known additive (including a buffering agent, a tonicity agent, a chelating agent, a colorant, a preservative, an aroma chemical, a flavoring agent, a sweetening agent and the like), for example.
  • a known pharmaceutically acceptable carrier such as an excipient, an extending agent, a binder, and a lubricant
  • a known additive including a buffering agent, a tonicity agent, a chelating agent, a colorant, a preservative, an aroma chemical, a flavoring agent, a sweetening agent and the like
  • the kit of the present invention can comprise, in addition to the monoclonal antibody of the present invention or a fragment thereof, a buffer, an enzyme solution, a secondary antibody, a solution for dilution, instructions, and the like.
  • VEGF 165 Human recombinant VEGF 165 (hereafter, may also be referred to as “VEGF”, “rhVEGF 165 ” or “rhVEGF”) expressed by CHO cells (PROSPEC) was used as an antigen.
  • VEGF Human recombinant VEGF 165
  • rhVEGF 165 Human recombinant VEGF 165 expressed by CHO cells (PROSPEC) was used as an antigen.
  • PROSPEC Human recombinant VEGF 165 expressed by CHO cells
  • KLH Keyhole Limpet Hemocyanin
  • VEGF and KLH were mixed so that the molar ratio of VEGF to KLH was 4:1 in PBS ( ⁇ ) (0.01 M sodium-phosphate buffer, 0.138 M NaCl, 0.0027 M KCl, pH 7.4), and then 1% glutaraldehyde was added, and then the mixture was allowed to react at room temperature for 1 hour, thereby cross-linking KLH and rhVEGF 165 .
  • PBS
  • glutaraldehyde 1% glutaraldehyde was added, and then the mixture was allowed to react at room temperature for 1 hour, thereby cross-linking KLH and rhVEGF 165 .
  • the thus prepared protein may also be referred to as “KLH-VEGF” in the followings.
  • rhVEGF or KLH-VEGF and Freund's complete adjuvant were mixed in equal amounts, and then the mixture was administered intraperitoneally to BALB/c mice in an amount of 100 ⁇ l (about 40 ⁇ g/mouse). Subsequently, about 40 ⁇ g of KLH-VEGF or rhVEGF was administered with an incomplete Freund's adjuvant intraperitoneally to mice once every 3 weeks for boosters (additional immunization). Boosters were performed not more than 12 times. Final immune stimulation was performed by administering saline containing about 40 ⁇ g of KLH-VEGF or rhVEGF into the tail vein of each mouse on day 3 before splenectomy.
  • Isolated splenocytes and a mouse myeloma cell line, P3-x63-Ag8U. 1 were mixed at 5:1 in terms of the number of cells, and then cell fusion was performed using 50% polyethylene glycol 3350 (Sigma).
  • Cells were suspended in HAT medium (RPMI1640 medium supplemented with 1/2 ⁇ HT (MP), 1/2 ⁇ HAT (MP), 10% FBS, 50 ng/L mouse IL-6, and 500 mg/mL D-Glucose), dispensed in a 96-well microculture plate and then cultured.
  • HAT medium RPMI1640 medium supplemented with 1/2 ⁇ HT (MP), 1/2 ⁇ HAT (MP), 10% FBS, 50 ng/L mouse IL-6, and 500 mg/mL D-Glucose
  • rhVEGF 165 was diluted with PBS ( ⁇ ), dispensed into a 96-well ELISA plate (Nunc) at 1 ⁇ g/well, allowed to stand overnight at 4° C., and thus bound onto the plate surface. Next, after 3 times of washing with 350 ⁇ L of 0.05% Tween 20-containing PBS ( ⁇ ) (hereafter, denoted as “PBS-T”), 300 ⁇ L of 1% skim milk-containing PBS-T was dispensed into each well, followed by blocking at room temperature for 1 hour.
  • PBS-T Tween 20-containing PBS
  • the culture supernatant of the hybridomas was dispensed into an ELISA plate on which rhVEGF 165 had been immobilized, and then allowed to react for 1 hour at room temperature.
  • 100 ⁇ L of peroxidase (hereafter, denoted as “POD”)-labeled anti-mouse immunoglobulin antibody (BETHYL) diluted 10000-fold was dispensed into each well, and then allowed to react for 1 hour at room temperature.
  • POD peroxidase
  • BETHYL anti-mouse immunoglobulin antibody
  • An anti-VEGF antibody binds to VEGF to block the binding of VEGF to its receptors, VEGFR-1 and/or VEGFR-2, to be able to inhibit signal transduction through mediation of VEGF.
  • KLHa505 and KLHb1501 were separated and purified from the culture supernatants of the two positive clones using Protein G.
  • IgG Fc-VEGFR-1 or IgG Fc-VEGFR2 was immobilized on a 96-well ELISA plate. After blocking with 2% bovine serum albumin, a purified antibody mixed with rhVEGF was added to the plate, followed by reaction at room temperature for 1 hour. A solution was prepared by mixing with rhVEGF, and then washed 3 times with 0.05% TWEEN® 20-containing TBS (TBS: 50 mM Tris-HCl (pH7.4), 500 mM NaCl; hereafter, referred to as “TBS-T”). Thereafter, through color development using rabbit anti-human VEGF polyclonal antibody-HRP, the rhVEGF content was determined.
  • Kd of KLHa505 and Kd of KLHb1501 for binding to VEGF were determined.
  • rhVEGF was immobilized on a CMS chip, serial dilution was performed twice with HBS-EP buffer, and then each antibody was injected at a flow rate of 30 ⁇ L/min.
  • Kd is K off /K on .
  • the dissociation constant for an existing antibody for example, the dissociation constant for Avastin (bevacizumab) is 4.9 nmol/L
  • the dissociation constants for the antibodies of the present invention were each 1/1000 or less that for the existing antibody. Hence, the binding activity of the antibodies that bind to VEGF is significantly high.
  • the antibodies high-affinity anti-VEGF antibodies having extremely high affinity for VEGF were obtained.
  • HUVEC normal human umbilical vein-derived endothelial cells
  • the high-affinity antibodies of the present invention can inhibit blood vessel-derived cells' cell proliferation activity due to VEGF, and can suppress angiogenesis.
  • KLHa505 and KLHb1501 were initiated. Regarding the dosage of KLHa505, administration was performed for 5 mouse per group, and thus (i) model control group (saline alone), (ii) 5 mg/kg KLHa505 group, (iii) 2.5 mg/kg KLHa505 group and (iv) 0.5 mg/kg KLHa505 group were prepared. Similar administration groups were prepared also for KLHb1501.
  • KLHa505 or KLHb1501 dissolved in saline in an amount of 200 ⁇ L per mouse was administered once on day 2 and on day 5 in each week through intraperitoneal injection.
  • 200 ⁇ L of saline was simultaneously administered by the same method.
  • administration was continuously performed for 18 days for KLHa505 and 22 days for KLHb1501.
  • KLHa505 and KLHb1501 were demonstrated to have capability of significantly inhibiting in vivo tumor growth ( FIG. 3 and FIG. 4 ).
  • mRNAs were extracted from hybridomas that produce KLHa505 and KLHb1501, cDNAs were prepared using reverse transcriptase. With the use of these cDNAs as templates, the nucleotide sequences of mouse IgG antibody heavy chain and light chain variable regions were amplified by PCR, and then the nucleotide sequences were analyzed, thereby the amino acid sequences of complementarity determining regions contained in the light chain and heavy chain variable regions were determined.
  • amino acid sequences of CDR1, CDR2 and CDR3 of KLHa505 and KLHb1501 variable region were determined using IMGT/V-QUEST software, version 3.3.0, on the immunoglobulin database “the international ImMunoGeneTics information System®” (IMGT/GENE-DB).
  • the KLHa505 antibody heavy chain variable region gene (nucleotide sequence: SEQ ID NO: 33, amino acid sequence: SEQ ID NO: 34) and light chain variable region gene (nucleotide sequence: SEQ ID NO: 35, amino acid sequence: SEQ ID NO: 36) were cloned. Next, these genes were each ligated in-frame to the nucleotide sequence of the human IgG1 heavy chain constant region gene or light chain ( ⁇ chain) constant region gene.
  • PCR was carried out using a primer having the 5′-terminal nucleotide sequence of the heavy chain variable region, Kozak sequence, and a restriction enzyme Mlu I sequence and an antisense primer having a complementary sequence of the 3′-terminal nucleotide sequence and a restriction enzyme Nhe I sequence.
  • PCR was carried out using a primer having the 5′-terminal nucleotide sequence of the light chain variable region gene and a restriction enzyme BamH I sequence, and an antisense primer having a complementary sequence of the 3′-terminal nucleotide sequence and a restriction enzyme BsiW I sequence.
  • the thus obtained amplification product was treated with restriction enzymes Mlu I and Nhe I or BamH I and BsiW I, and then the resultant was incorporated into the Mlu I-Nhe I site of the human IgG1 heavy chain constant region expression plasmid (pEF6/G1) or the BamH I-BsiW I site of the human Ig light chain ( ⁇ chain) constant region expression plasmid (pEF1/G1k).
  • the human IgG1 heavy chain constant region gene (nucleotide sequence: SEQ ID NO: 41, amino acid sequence: SEQ ID NO: 42) was cloned into the plasmid pEF6/myc-His (Invitrogen).
  • the human Ig light chain ( ⁇ chain) constant region gene (nucleotide sequence: SEQ ID NO: 43, amino acid sequence: SEQ ID NO: 44) was cloned into the plasmid pEF1/myc-His (Invitrogen).
  • the mouse heavy chain variable region and the human heavy chain constant region were linked by a restriction enzyme Nhe I, and the mouse light chain variable region and the human light chain constant region were linked by a restriction enzyme BsiW I sequence.
  • the plasmids pEF6/G1-KLHa505 and pEF1/G1-K-KLHa505 were introduced into 293F cells using a FreeStyleTM 293 Expression System (Thermo Fisher Scientific K.K.), and thus the human IgG1 chimeric KLHa505 antibody (hereafter, may also be referred to as “KLHa505HC antibody”) was transiently expressed.
  • KLHa505HC antibody was purified from a culture supernatant of 293F cells, into which the chimeric gene had been introduced, using Protein G Sepharose 4 Fast Flow (GE Healthcare Japan).
  • a solvent was substituted with D-PBS ( ⁇ ) using an Amicon Ultra-15 centrifugal filter unit (Merck millipore).
  • the concentration of the purified KLHa505HC antibody was determined using Nano drop 1000 (Thermo Fisher Scientific K.K.). Binding of the KLHa505HC antibody to VEGF was evaluated by the method described in the above “Purification of monoclonal antibody (4) ELISA”. As a result, specific binding of the KLHa505HC antibody to VEGF was confirmed.
  • the KLHb1501 antibody heavy chain variable region gene (nucleotide sequence: SEQ ID NO: 37, amino acid sequence: SEQ ID NO: 38) and light chain variable region gene (nucleotide sequence: SEQ ID NO: 39, amino acid sequence: SEQ ID NO: 40) were cloned. Next, these genes were each ligated in-frame to the nucleotide sequence of a human IgG1 heavy chain constant region gene or light chain ( ⁇ chain) constant region gene.
  • PCR was carried out using a primer having the 5′ terminal nucleotide sequence of the heavy chain variable region, Kozak sequence, and a restriction enzyme Xho I sequence, and an antisense primer having the complementary sequence of the 3′ terminal nucleotide sequence and a restriction enzyme Nhe I sequence.
  • PCR was carried out using a primer having the 5′ terminal nucleotide sequence of the light chain variable region gene and a restriction enzyme EcoR I sequence, and an antisense primer having the complementary sequence of the 3′ terminal nucleotide sequence and a restriction enzyme Avr II sequence.
  • the thus obtained amplification products were treated with restriction enzymes Xho I and Nhe I, or EcoR I and Avr II, and then incorporated into the Xho I-Nhe I site of a human IgG1 heavy chain constant region expression plasmid (pFUSE-CHIg-hG1; InvivoGen), or the EcoR I-Avr II site of a human Ig light chain ( ⁇ chain) constant region expression plasmid (pFUSE2ss-CLIg-hl2: InvivoGen).
  • pFUSE-CHIg-hG1 the human IgG1 heavy chain constant region gene (nucleotide sequence: SEQ ID NO: 41, amino acid sequence: SEQ ID NO: 42) was cloned.
  • the human Ig light chain ( ⁇ chain) constant region gene (nucleotide sequence: SEQ ID NO: 43, amino acid sequence: SEQ ID NO: 44) was cloned.
  • the mouse heavy chain variable region and the human heavy chain constant region were linked by the restriction enzyme Nhe I, and the mouse light chain variable region and the human light chain constant region were linked by the restriction enzyme Avr II sequence.
  • Human colon cancer cell line LS174T cells were subcutaneously injected at a rate of 2 ⁇ 10 6 cells per mouse into the right flanks of the 20 immunodeficient mice.
  • 0.9% NaCl control group A
  • KLHb1501HC antibody control group B
  • the KLHb1501HC antibody was administered to the mice of control group B twice a week at 0.5 mg/Kg, 2.5 mg/Kg, or 5 mg/Kg.
  • 0.9% NaCl was administered twice a week to the mice of control group A.
  • group A (0.9% NaCl control) is indicated with ( ⁇ )
  • group B (mice injected with the anti-VEGF antibody) is indicated with ( ⁇ : 0.5 mg/Kg), ( ⁇ : 2.5 mg/Kg), or ( ⁇ : 5.0 mg/Kg).
  • significant decreases in tumor volume were observed in mice injected with the KLHb1501HC antibody.
  • the KLHa505 antibody heavy chain variable region gene (nucleotide sequence: SEQ ID NO: 33, amino acid sequence: SEQ ID NO: 34) and light chain variable region gene (nucleotide sequence: SEQ ID NO: 35, amino acid sequence: SEQ ID NO: 36) were cloned. Next, these genes were each ligated in-frame to the nucleotide sequence of the canine IgGB heavy chain constant region gene or light chain ( ⁇ chain) constant region gene.
  • PCR was carried out using a primer having the 5′-terminal nucleotide sequence of the heavy chain variable region, Kozak sequence, and a restriction enzyme EcoR V sequence, and an antisense primer having a complementary sequence of the 3′-terminal nucleotide sequence and a restriction enzyme Nhe I sequence.
  • PCR was carried out using a primer having the 5′-terminal nucleotide sequence of the light chain variable region gene and a restriction enzyme EcoR I sequence, and an antisense primer having a complementary sequence of the 3′-terminal nucleotide sequence and a restriction enzyme Xho I sequence.
  • the thus obtained amplification product was treated with restriction enzymes Eco V and Nhe I, or EcoR I and Xho I, and then the resultant was incorporated into the EcoR V-Nhe I site of a canine IgGB heavy chain constant region expression plasmid (pFUSE2ss-CHIg-dGB), or the EcoR I-Xho I site of a canine Ig light chain constant region expression plasmid (pFUSE2ss-CHIg-dK).
  • pFUSE2ss-CHIg-dGB the canine IgGB heavy chain constant region gene (nucleotide sequence: SEQ ID NO: 45, amino acid sequence: SEQ ID NO: 46) was cloned into plasmid pFUSE2ss-CLIg-hl2 (InvivoGen).
  • pFUSE2ss-CHIg-dK the canine Ig light chain ( ⁇ chain) constant region gene (nucleotide sequence: SEQ ID NO: 47, amino acid sequence: SEQ ID NO: 48) was cloned into plasmid pFUSE2ss-CLIg-hl2.
  • the mouse heavy chain variable region and the canine heavy chain constant region were linked by the restriction enzyme Nhe I sequence, and the mouse light chain variable region and the canine light chain constant region were linked by the restriction enzyme Xho I sequence.
  • the KLHb1501 antibody heavy chain variable region gene (nucleotide sequence: SEQ ID NO: 37, amino acid sequence: SEQ ID NO: 38) and light chain variable region gene (nucleotide sequence: SEQ ID NO: 39, amino acid sequence: SEQ ID NO: 40) were cloned. Next, these genes were each ligated in-frame to the nucleotide sequence of a canine IgGB heavy chain constant region gene or light chain ( ⁇ chain) constant region gene.
  • PCR was carried out using a primer having the 5′ terminal nucleotide sequence of the heavy chain variable region, Kozak sequence, and a restriction enzyme EcoR V sequence, and an antisense primer having the complementary sequence of the 3′ terminal nucleotide sequence and a restriction enzyme Nhe I sequence.
  • PCR was carried out using a primer having the 5′ terminal nucleotide sequence of the light chain variable region gene and a restriction enzyme EcoR I sequence and an antisense primer having the complementary sequence of the 3′ terminal nucleotide sequence and a restriction enzyme Sca I sequence.
  • the thus obtained amplification products were treated with restriction enzymes Eco V and Nhe I, or EcoR I and Sca I, and then incorporated into the EcoR V-Nhe I site of a canine IgGB heavy chain constant region expression plasmid (pFUSE2ss-CHIg-dGB) or the EcoR I-Sca I site of a canine Ig light chain constant region expression plasmid (pFUSE2ss-CHIg-dK).
  • pFUSE2ss-CHIg-dGB the canine IgGB heavy chain constant region gene (nucleotide sequence: SEQ ID NO: 45, amino acid sequence: SEQ ID NO: 46) was cloned to plasmid pFUSE2ss-CLIg-hl2 (InvivoGen).
  • pFUSE2ss-CHIg-dK the canine Ig light chain ( ⁇ chain) constant region gene (nucleotide sequence: SEQ ID NO: 49, amino acid sequence: SEQ ID NO: 50) was cloned into plasmid pFUSE2ss-CLIg-hl2.
  • the mouse heavy chain variable region and the canine heavy chain constant region were linked by the restriction enzyme Nhe I, and the mouse light chain variable region and the canine light chain constant region were linked by the restriction enzyme Sca I sequence.
  • VEGF165 or canine VEGFA were diluted with TBS, dispensed to a 96-well ELISA plate (Nunc) at 20 ng per well, and then incubated at 37° C. for 1 hour for binding to the plate surface. Next, after 3 times of washing with 300 ⁇ L of 0.02% Tween 20-containing PBS ( ⁇ ) (hereafter, denoted as “PBS-T”), 300 ⁇ L of 3% skim milk-containing PBS ( ⁇ ) was dispensed into each well, followed by blocking at 37° C. for 1 hour.
  • PBS-T Tween 20-containing PBS
  • KLHb1501CC antibody canine-IgGB chimeric KLHb1501 antibody serially diluted from the concentration of 1 ⁇ g/ml was dispensed to an ELISA plate to which VEGF had been immobilized, and then allowed to react at 37° C. for 1 hour.
  • a peroxidase-labeled anti-canine immunoglobulin antibody BETHYL
  • TMB Single Solution was added for color development at room temperature.
  • compositions comprising the canine IgGB chimeric anti-VEGF antibody of the present invention can be used for treatment or prevention of diseases of dogs.
  • Human colon cancer cell line LS174T cells were subcutaneously injected at a rate of 2 ⁇ 10 6 cells per mouse to the right flanks of 20 immunodeficient mice.
  • 0.9% NaCl control group A
  • the KLHb1501CC antibody control group B
  • the KLHb1501CC antibody was administered twice a week to the mice of control group B at 0.5 mg/Kg, 2.5 mg/Kg, or 5 mg/Kg.
  • 0.9% NaCl was administered twice a week to the mice of control group A.
  • KLHb1501CC antibody of the present invention also inhibits (suppresses) in vivo the growth of human tumors.
  • a pharmaceutical composition comprising the canine IgGB chimeric anti-VEGF antibody of the present invention is significantly effective for treatment or prevention of cancer.
  • Canine bone sarcoma cell line D-17 cells were subcutaneously injected at a rate of 1 ⁇ 10 7 cells per mouse to the right flanks of 20 immunodeficient mice. After the mean tumor volume reached 150 mm 3 , 0.9% NaCl (control group A) or the KLHb1501CC antibody (control group B) was intraperitoneally administered. The KLHb1501CC antibody was administered twice a week to the mice of control group B at 0.5 mg/Kg, 2.5 mg/Kg, or 5 mg/Kg. Similarly to the antibody, 0.9% NaCl was administered twice a week to the mice of control group A.
  • KLHb1501CC antibody of the present invention inhibits (suppresses) the growth of tumors of dogs even in vivo.
  • a pharmaceutical composition comprising the canine IgGB chimeric anti-VEGF antibody of the present invention is significantly effective for treatment or prevention of cancer of dogs.
  • anti-VEGF antibodies three anti-VEGF antibodies including KLHa505HC and KLHb1501HC obtained in Examples 7 and 8 were used.
  • VEGF As VEGF, three types of VEGF, (i) VEGF165 containing exon 8a that is the C-terminal region of VEGF, (ii) VEGF121 lacking heparin binding region, and (iii) VEGF165b having an amino acid sequence (exon 8b) differing from the C-terminal region of VEGF165 were used.
  • the binding experiment was specifically conducted as follows.
  • Human VEGF165 (consisting of exon 1, 2, 3, 4, 5, 7 and 8a), human VEGF165b (consisting of exon 1, 2, 3, 4, 5, 7 and 8b) or human VEGF121 (consisting of exon 1, 2, 3, 4, 5 and 8a) was diluted with TBS, dispensed to a 96-well ELISA plate (Nunc) at 20 ng per well, and then incubated at 37° C. for 1 hour, for binding onto the plate surface.
  • TBS 96-well ELISA plate
  • PBS-T 300 ⁇ L of 0.02% Tween 20-containing PBS ( ⁇ ) (hereafter, denoted as “PBS-T”)
  • 300 ⁇ L of 3% skim milk-containing PBS ( ⁇ ) was dispensed to each well, followed by blocking at 37° C. for 1 hour.
  • the KLHa505HC antibody or KLHb1501HC antibody serially diluted from the concentration of 1 ⁇ g/ml was dispensed to an ELISA plate to which VEGF had been immobilized, and then allowed to react at 37° C. for 1 hour.
  • a peroxidase-labeled anti-human immunoglobulin antibody prepared to have a concentration of 100 ng/ml was dispensed at 100 ⁇ L per well, and then allowed to react at 37° C. for 1 hour. After washing similarly, TMB Single Solution was added for color development at room temperature. After the reaction was stopped with 1 N sulfuric acid, absorbance at 450 nm was measured using a plate reader (Molecular Devices).
  • the result demonstrates that the antibody of the present invention binds to exon 1 to 5 regions of VEGF.
  • novel antibodies capable of binding to VEGF with significantly high affinity compared to the prior art can be provided.
  • SEQ ID NO: 13 synthetic DNA
  • SEQ ID NO: 14 synthetic peptide
  • SEQ ID NO: 15 synthetic DNA
  • SEQ ID NO: 16 synthetic peptide
  • SEQ ID NO: 17 synthetic DNA
  • SEQ ID NO: 18 synthetic peptide
  • SEQ ID NO: 19 synthetic DNA
  • SEQ ID NO: 20 synthetic peptide
  • SEQ ID NO: 21 synthetic DNA
  • SEQ ID NO: 22 synthetic peptide
  • SEQ ID NO: 23 synthetic DNA
  • SEQ ID NO: 24 synthetic peptide
  • SEQ ID NO: 25 synthetic DNA
  • SEQ ID NO: 26 synthetic peptide
  • SEQ ID NO: 27 synthetic DNA
  • SEQ ID NO: 28 synthetic peptide
  • SEQ ID NO: 29 synthetic DNA
  • SEQ ID NO: 30 synthetic peptide
  • SEQ ID NO: 31 synthetic DNA
  • SEQ ID NO: 32 synthetic peptide
  • SEQ ID NO: 33 synthetic DNA
  • SEQ ID NO: 34 synthetic peptide
  • SEQ ID NO: 35 synthetic DNA
  • SEQ ID NO: 36 synthetic peptide
  • SEQ ID NO: 37 synthetic DNA
  • SEQ ID NO: 38 synthetic peptide
  • SEQ ID NO: 39 synthetic DNA
  • SEQ ID NO: 40 synthetic peptide
  • SEQ ID NO: 41 synthetic DNA
  • SEQ ID NO: 42 synthetic peptide
  • SEQ ID NO: 43 synthetic DNA
  • SEQ ID NO: 44 synthetic peptide
  • SEQ ID NO: 45 synthetic DNA
  • SEQ ID NO: 46 synthetic peptide
  • SEQ ID NO: 47 synthetic DNA
  • SEQ ID NO: 48 synthetic peptide
  • SEQ ID NO: 49 synthetic DNA
  • SEQ ID NO: 50-54 synthetic peptide

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Immunology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Microbiology (AREA)
  • Oncology (AREA)
  • Vascular Medicine (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

An object of the present invention is to provide an antibody having significantly high affinity for VEGF compared to the prior art. The present invention provides a monoclonal antibody against VEGF, which binds to a vascular endothelial growth factor (VEGF) with a dissociation constant of 1×10−11 mol/L or less.

Description

TECHNICAL FIELD
The present invention relates to a high-affinity anti-VEGF antibody.
BACKGROUND ART Background of the Invention
Vascular endothelial growth factor (VEGF) can induce vasculogenesis (angiogenesis) in vivo, and is a heparin-binding growth factor that is specifically expressed in vascular endothelial cells. Human VEGF protein was purified and identified in 1989. The gene thereof has been cloned and thus the gene sequence has been determined.
VEGF can accelerate vasculogenesis, and all members belonging to the VEGF family bind to receptors (VEGFR) corresponding to respective family molecules existing on cell membrane surfaces and thus to activate cells. As a result of dimerization due to binding of VEGF, the group of these receptors undergoes auto-phosphorylation and is thus activated. VEGFR consists of seven immunoglobulin-like extracellular domains, one transmembrane domain, and one intracellular domain containing a tyrosine kinase region. VEGF-A can bind to VEGF receptor-1 (receptor Flt-1) and VEGF receptor-2 (KDR/Flk-1). Among VEGF receptors, particularly, VEGF receptor-2 mediates almost all known biological functions of VEGF. Regarding VEGF physiological activity and VEGF receptors, Marti et al., (Non Patent Literature 1: Angiogenesis in ischemic disease. Thromb. Haemost. 1999. Supplement 1: 44-52) and Matsumoto et al., (Non Patent Literature 2: VEGF Receptor Signal Transduction. Sci. STKE. 2001. re21) have studied in detail.
In the U.S. and Europe, Avastin® (bevacizumab) that is a recombinant anti-VEGF humanized monoclonal antibody is used for treatment of colorectal cancer, breast cancer, non-small-cell lung cancer, glioma in the central nervous system, and age-related macular degeneration (AMD). The sales of Avastin in 2013 reached US$6,746,000,000, but Avastin does not have high affinity for VEGF (Non Patent Literature 3: Aflibercept as a Treatment for Age-related Macular Degeneration. US Ophthalimic Rev. 2013. 6:58-63). Furthermore, the exclusive production and exclusive form of selling of Avastin force patients who need to use Avastin to pay high medical expenses. Therefore, development of a new anti-VEGF monoclonal antibody is required also from viewpoints of easing the burden of patients and reducing the costs of treatment.
Antibodies having affinity for VEGF higher than that of Avastin have been developed to date, and such antibodies exert tumor suppression superior to Avastin (Patent Literature 1: JP Laid-Open Publication No. 2013-502445).
CITATION LIST Patent Literature
  • Patent Literature 1: JP Laid-Open Publication No. 2013-502445
Non Patent Literature
  • Non Patent Literature 1: Marti et al., Thromb. Haemost. 1999. Supplement 1: 44-52
  • Non Patent Literature 2: Matsumoto et al., VEGF Receptor Signal Transduction. Sci. STKE. 2001. re2l
  • Non Patent Literature 3: US Ophthalimic Rev., 2013. 6:58-63
SUMMARY OF INVENTION Technical Problem
The present invention has been achieved under such circumstances. A technical problem to be solved by the present invention is to provide a novel antibody that inhibits the physiological activity of VEGF by binding to a vascular endothelial growth factor (VEGF) with its high affinity for VEGF compared to the prior art to inhibit binding of VEGF to a VEGF receptor.
Solution to Problem
As a result of intensive studies to solve the problem, the present inventors have prepared an antibody that binds to VEGF with high affinity, have discovered that the antibody inhibits the physiological action of VEGF, and thus have completed the present invention.
That is, the present invention is as follows.
(1) A monoclonal antibody against VEGF that binds to a vascular endothelial growth factor (VEGF) with a dissociation constant of 1×10−11 mol/L or less.
(2) The monoclonal antibody according to (1) above, wherein the monoclonal antibody inhibits binding of a vascular endothelial growth factor (VEGF) to at least one receptor selected from the group consisting of vascular endothelial growth factor receptor-1 (VEGFR1) and vascular endothelial growth factor receptor-2 (VEGFR2).
(3) A monoclonal antibody that binds to a site to which the monoclonal antibody according to (1) or (2) above binds.
(4) The monoclonal antibody according to any one of (1) to (3) above, wherein the monoclonal antibody is a chimeric antibody or a humanized antibody.
(5) The antibody according to any one of (1) to (4) above, comprising CDR-H1 that comprises the amino acid sequence of SEQ ID NO: 14, CDR-H2 that comprises the amino acid sequence of SEQ ID NO: 16, and CDR-H3 that comprises the amino acid sequence of SEQ ID NO: 18.
(6) The antibody according to any one of (1) to (4) above, comprising CDR-L1 that comprises the amino acid sequence of SEQ ID NO: 20, CDR-L2 that comprises the amino acid sequence of Trp-Ala-Ser, and CDR-L3 that comprises the amino acid sequence of SEQ ID NO: 22.
(7) The antibody according to any one of (1) to (4) above, comprising:
CDR-H1 that comprises the amino acid sequence of SEQ ID NO: 14, CDR-112 that comprises the amino acid sequence of SEQ ID NO: 16, and CDR-H3 that comprises the amino acid sequence of SEQ ID NO: 18; and
CDR-L1 that comprises the amino acid sequence of SEQ ID NO: 20, CDR-L2 that comprises the amino acid sequence of Trp-Ala-Ser, and CDR-L3 that comprises the amino acid sequence of SEQ ID NO: 22.
(8) The antibody according to any one of (1) to (4) above, comprising CDR-H1 that comprises the amino acid sequence of SEQ ID NO: 24, CDR-H2 that comprises the amino acid sequence of SEQ ID NO: 26, and CDR-H3 that comprises the amino acid sequence of SEQ ID NO: 28.
(9) The antibody according to any one of (1) to (4) above, comprising CDR-L1 that comprises the amino acid sequence of SEQ ID NO: 30, CDR-L2 that comprises the amino acid sequence of Gly-Thr-Asn, and CDR-L3 that comprises the amino acid sequence of SEQ ID NO: 32.
(10) The antibody according to any one of (1) to (4) above, comprising CDR-H1 that comprises the amino acid sequence of SEQ ID NO: 24, CDR-H2 that comprises the amino acid sequence of SEQ ID NO: 26, and CDR-H3 that comprises the amino acid sequence of SEQ ID NO: 28, and, CDR-L1 that comprises the amino acid sequence of SEQ ID NO: 30, CDR-L2 that comprises the amino acid sequence of Gly-Thr-Asn, and CDR-L3 that comprises the amino acid sequence of SEQ ID NO: 32.
(11) The antibody according to (7) or (10) above, further comprising an amino acid sequence derived from a human IgG1 heavy chain constant region and an amino acid sequence derived from a human IgG1 light chain constant region.
(12) The antibody according to (11) above, wherein the amino acid sequence derived from a human IgG1 heavy chain constant region comprises the amino acid sequence of SEQ ID NO: 42, and the amino acid sequence derived from a human IgG1 light chain constant region comprises the amino acid sequence of SEQ ID NO: 44.
(13) The antibody according to (12) above, comprising:
a heavy chain that comprises the amino acid sequence of SEQ ID NO: 34 or 38, and the amino acid sequence of SEQ ID NO: 42; and
a light chain that comprises the amino acid sequence of SEQ ID NO: 36 or 40, and the amino acid sequence of SEQ ID NO: 44.
(14) The antibody according to (7) or (10) above, further comprising an amino acid sequence derived from a canine IgGB heavy chain constant region and an amino acid sequence derived from a canine Ig light chain (κ chain) constant region or a canine Ig light chain (λ chain) constant region.
(15) The antibody according to (14) above, wherein an amino acid sequence derived from a canine IgGB heavy chain constant region comprises the amino acid sequence of SEQ ID NO: 46, an amino acid sequence derived from a canine Ig light chain (κ chain) constant region comprises the amino acid sequence of SEQ ID NO: 48, and an amino acid sequence derived from a canine Ig light chain (λ chain) constant region comprises the amino acid sequence of SEQ ID NO: 50.
(16) The antibody according to (15) above, comprising:
a heavy chain that comprises the amino acid sequence of SEQ ID NO: 34 or 38 and the amino acid sequence of SEQ ID NO: 46; and
a light chain that comprises the amino acid sequence of SEQ ID NO: 36 or 40 and the amino acid sequence of SEQ ID NO: 48 or 50.
(17) A fragment of the monoclonal antibody according to any one of (1) to (16) above.
(18) The fragment according to (17) above, wherein the fragment is an antigen-binding fragment.
(19) The fragment according to (18) above, wherein the antigen-binding fragment is a single-chain antibody or a double-chain antibody.
(20) A hybridoma that produces the monoclonal antibody according to any one of (1) to (3) above.
(21) A pharmaceutical composition comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
(22) The pharmaceutical composition according to (21) above, for use in treatment or prevention of a VEGF-mediated disease.
(23) The pharmaceutical composition according to (22) above, wherein the VEGF-mediated disease is a cancer or a VEGF-mediated eye disease.
(24) The pharmaceutical composition according to (23) above, wherein the treatment or prevention of the cancer or the VEGF-mediated eye disease is by inhibiting angiogenesis or vascular hyperpermeability.
(25) The pharmaceutical composition according to (24) above, wherein the angiogenesis is pathological angiogenesis.
(26) The pharmaceutical composition according to (23) or (24) above, wherein the cancer is solid cancer or hematologic neoplasm.
(27) The pharmaceutical composition according to (23) or (24) above, wherein the cancer is selected from the group consisting of colorectal cancer, rectal cancer, breast cancer, non-small-cell lung cancer, non-Hodgkin's lymphoma (NHL), renal cell cancer, prostate cancer, liver cancer, pancreas cancer, soft tissue sarcoma, Kaposi's sarcoma, carcinoid tumor, head and neck cancer, melanoma, ovarian cancer, mesothelioma, and multiple myeloma.
(28) The pharmaceutical composition according to (23) or (24) above, wherein the VEGF-mediated eye disease is at least one selected from age-related macular degeneration, diabetic retinopathy, diabetic macular edema, neovascular glaucoma, retinal vein occlusion, retinopathy of prematurity, choroidal neovascularization associated with pathological myopia, pterygium, rubeosis, pannus, Stevens-Johnson syndrome, and an immunological rejection in a transplanted tissue of the eye.
(29) An angiogenesis inhibitor comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
(30) A reagent comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
(31) A kit comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
(32) A method for treating or preventing a cancer or a VEGF-mediated eye disease, comprising a step of administering to a subject a therapeutically effective amount of the antibody or the fragment thereof according to any one of (1) to (19) above.
(33) The antibody or the fragment thereof according to any one of (1) to (19) above, for use in a method for treating or preventing a cancer or a VEGF-mediated eye disease.
(34) The antibody or the fragment thereof according to any one of (1) to (19) above, for use in the manufacture of a medicament for treatment or prevention of a cancer or a VEGF-mediated eye disease.
Advantageous Effects of Invention
According to the present invention, a novel antibody against VEGF that binds with significantly high affinity compared to the prior art to a vascular endothelial growth factor (VEGF) to inhibit its binding to receptor.
BRIEF DESCRIPTION OF DRAWINGS
FIG. 1 shows the results of examining the capability of inhibiting binding of VEGF to VEGFR2 of the antibody of present invention.
FIG. 2 shows the results of examining the inhibiting effect of the antibody of the present invention on cell proliferation.
FIG. 3 shows the results of examining the in vivo inhibiting effect of KLHa505, that is the antibody of the present invention, on tumor growth.
FIG. 4 shows the results of examining the in vivo inhibiting effect of KLHb1501, that is the antibody of the present invention, on tumor growth.
FIG. 5 shows the results of examining the in vivo inhibiting effect of KLHb1501HC, that is the humanized chimeric antibody of the present invention, on tumor growth.
FIG. 6 shows the results of binding of KLHb1501CC, that is a caninized chimeric antibody of the present invention to canine VEGFA.
FIG. 7 shows the results of examining KLHb1501CC, that is the caninized chimeric antibody of the present invention, for its in vivo inhibiting effect on tumor growth in human-derived cancer cells.
FIG. 8 shows the results of examining the in vivo inhibiting effect of KLHb1501CC, that is the caninized chimeric antibody of the present invention, on tumor growth in a canine-derived cancer cells.
FIG. 9 shows the results of examining KLHa505HC, that is the humanized chimeric antibody of the present invention, for the capability of binding to VEGF165, VEGF121 and VEGF165b.
FIG. 10 shows the results of examining KLHb1501HC, that is the humanized chimeric antibody of the present invention, for the capability of binding to VEGF165, VEGF121 and VEGF165b.
DESCRIPTION OF EMBODIMENTS
The present invention will be described in detail as follows. The following embodiments are merely examples for describing the present invention, and are not intended to limit the present invention only to these embodiments. The present invention can be implemented in various modes without departing from the scope of the invention. Moreover, this description includes the contents as disclosed in the specification and drawings of Japanese Patent Application (Japanese Patent Application No. 2016-001277) filed on Jan. 6, 2016, which is priority document of the present application.
1. Summary
Currently, Avastin is known as an anti-VEGF antibody effective for treatment of cancer and age-related macular degeneration, however, Avastin is known to have low affinity for VEGF.
On the other hand, the present inventors have developed an antibody having significantly high affinity for VEGF compared to the prior art, and thus have discovered that the antibody is effective for suppression of angiogenesis and treatment of cancer.
The present invention has been completed based on these findings.
2. Vascular Endothelial Growth Factor (VEGF)
VEGFs are proteins playing an important role in angiogenesis. VEGFs involve cell division and migration, induction of differentiation, vascular hyperpermeability, activation of monocytes and macrophages, and the like through binding to their receptors to cause intracellular signal transduction.
In the present invention, examples of VEGF include VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, PIGF-1, and PIGF-2, and a preferable example thereof is VEGF-A.
VEGF in the present invention may be derived from any mammal. Examples of such a mammal include mice, rats, rabbits, dogs, goats, monkeys and humans, preferably, mice, rats, dogs and humans.
Examples of human VEGF-A include VEGF (VEGF165) consisting of 165 amino acid residues, a subtype thereof; that is, VEGF (VEGF121) consisting of 121 amino acid residues, VEGF (VEGF145) consisting of 145 amino acid residues, VEGF (VEGF183) consisting of 183 amino acid residues, VEGF (VEGF189) consisting of 189 amino acid residues, VEGF (VEGF206) consisting of 206 amino acid residues, VEGF (VEGF165b) differing from the above VEGF165 in the amino acid sequence of the C-terminal region, and naturally-occurring allelic variants thereof and processing variants thereof. In the present invention, as examples of human VEGF-A, VEGF121 and VEGF165 are preferred. VEGF is encoded on chromosome 6p12, and the mRNA is 16,272 bp long. VEGF is consisting of exons 1 to 5, and 6a, 6b, 7a, 7b, 8a and 8b. VEGF165 binds to all of NRP1, VEGFR1 and VEGFR2.
Furthermore, examples of canine VEGF include, but are not limited to, VEGF (VEGF164) consisting of 164 amino acid residues, VEGF (VEGF120) consisting of 120 amino acid residues, VEGF (VEGF144) consisting of 144 amino acid residues, VEGF (VEGF147) consisting of 147 amino acid residues, VEGF (VEGF162) consisting of 162 amino acid residues, VEGF (VEGF182) consisting of 182 amino acid residues, VEGF (VEGF188) consisting of 188 amino acid residues, VEGF (VEGF205) consisting of 205 amino acid residues, VEGF (VEGF164b) differing from the above VEGF164 in the amino acid sequence of the C-terminal region, and naturally occurring allelic variants thereof and processing variants thereof.
In the present invention, the amino acid sequences of mouse, rat, canine and human VEGFs, and VEGF121 and VEGF165 are represented by SEQ ID NOS: 2, 4, 6, 8, 10, and 12, respectively. Moreover, the base (nucleotide) sequences of DNA encoding mouse, rat, canine and human VEGFs, and VEGF121 and VEGF165 are represented by SEQ ID NOS: 1, 3, 5, 7, 9 and 11, respectively. These amino acid sequences and nucleotide sequences are each registered in the GenBank database under given Accession Nos.
Mouse VEGF amino acid sequence: NP_001020421.2 (SEQ ID NO: 2)
Rat VEGF amino acid sequence: NP_114024.2 (SEQ ID NO: 4)
Canine VEGF amino acid sequence: NP_001003175 (SEQ ID NO: 6)
Human VEGF-A amino acid sequence: NP_001020537.2 (SEQ ID NO: 8)
VEGF121 amino acid sequence: ABO26344.1 (SEQ ID NO: 10)
VEGF165 amino acid sequence: AAM03108.1 (SEQ ID NO: 12)
Mouse VEGF-encoding DNA nucleotide sequence: NM_001025250.3 (SEQ ID NO: 1)
Rat VEGF-encoding DNA nucleotide sequence: NM_031836.2 (SEQ ID NO: 3)
Canine VEGF-encoding DNA nucleotide sequence: NM_001003175.2 (SEQ ID NO: 5)
Human VEGF-A-encoding DNA nucleotide sequence: NM_001025366.2 (SEQ ID NO: 7)
VEGF121-encoding DNA nucleotide sequence: EF424789.1 (SEQ ID NO: 9)
VEGF165-encoding DNA nucleotide sequence: AF486837.1 (SEQ ID NO: 11)
VEGFs to be used in the present invention include the following proteins (a) to (c):
(a) a protein comprising the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12;
(b) a protein comprising an amino acid sequence on which one or several amino acids are deleted, substituted or added with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, and having binding activity to a VEGF receptor; and
(c) a protein comprising an amino acid sequence that has 80% or higher homology (identity) with the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, and having binding activity to a VEGF receptor.
In the present invention, examples of “a protein comprising the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12” include a protein consisting of the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12.
Furthermore, examples of “an amino acid sequence on which one or several amino acids are deleted, substituted or added with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12” include:
(i) an amino acid sequence on which 1 to 10 (for example, 1 to 5, preferably 1 to 3, more preferably 1 to 2, and further preferably 1) amino acids are deleted with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12;
(ii) an amino acid sequence on which 1 to 10 (for example, 1 to 5, preferably 1 to 3, more preferably 1 to 2, and further preferably 1) amino acids are substituted with other amino acids with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12;
(iii) an amino acid sequence on which (for example, 1 to 5, preferably 1 to 3, more preferably 1 to 2, and further preferably 1) amino acids are added with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12; and
(iv) an amino acid sequence mutated as a combination of (i) to (iii) above.
In the present invention, “VEGF receptor” is at least one VEGF receptor selected from the group consisting of vascular endothelial growth factor receptor-1 (VEGFR1 (another name: Flt-1)), vascular endothelial growth factor receptor-2 (VEGFR2 (another name: KDR)) and vascular endothelial growth factor receptor-3 (VEGFR3), and is preferably vascular endothelial growth factor receptor-1 (VEGFR1) and/or vascular endothelial growth factor receptor-2 (VEGFR2), and more preferably vascular endothelial growth factor receptor-2 (VEGFR2). Moreover, the term “binding activity to a VEGF receptor” means activity of specifically binding to a VEGF receptor. The presence or the absence of the binding activity can be determined using a known method, such as immunological techniques including immunoprecipitation, Western blotting, EIA (enzyme immunoassay), ELISA (enzyme-linked immunosorbent assay) and the like or pull-down assay. Furthermore, the term “binding activity to a VEGF receptor” means having at least 10% or more, 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, and preferably 90% or more activity, when compared to the activity of the protein consisting of the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, which is set to 100%.
Furthermore, examples of VEGF in the present invention include, in addition to a protein having the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, a protein having an amino acid sequence that has 80% or more homology (identity) with the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, and having binding activity to a VEGF receptor. Examples of such a protein also include a protein having an amino acid sequence that has about 80% or more, 85% or more, 90% or more, 95% or more, 96% or more, 97% or more, 98% or more, or 99% or more homology with the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, and having binding activity to a VEGF receptor (an amino acid sequence substantially equivalent to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12). Homology can be determined using a homology search site on the Internet, for example, by performing a homology search program such as FASTA, BLAST, PSI-BLAST or the like on the DNA Data Bank of Japan (DDBJ). Homology search can also be performed using BLAST on the National Center for Biotechnology Information (NCBI).
Mutagenesis of DNA encoding the relevant protein in order to prepare a protein having the above mutation can be performed using a kit for mutagenesis using site-directed mutagenesis such as Kunkel method, Gapped duplex method or the like, such as QuikChange™ Site-Directed Mutagenesis Kit (Stratagene), GeneTailor™ Site-Directed Mutagenesis System (Invitrogen), TaKaRa Site-Directed Mutagenesis System (Mutan-K, Mutan-Super Express Km and the like: Takara Bio) or the like. Moreover, a method such as a site-directed mutagenesis method described in “Molecular Cloning, A Laboratory Manual (4th edition)” (Cold Spring Harbor Laboratory Press (2012)) can be used.
3. Antibody Against VEGF
In the present invention, the term “antibody against VEGF” (hereafter, may also be referred to as “anti-VEGF antibody”) refers to an antibody that specifically binds to the above VEGF. The anti-VEGF antibody of the present invention binds to VEGF with high affinity compared to the prior art to inhibit binding of VEGF to a VEGF receptor (VEGFR).
Note that, bevacizumab (Avastin®) that is well known as an anti-VEGF antibody is known to have a dissociation constant of 47.9 nmol/L for binding to VEGF.
In the present invention, the term “inhibit binding” does not always means 100% inhibition of the binding of VEGF to the VEGFR. The antibody of the present invention inhibits binding of VEGF to the VEGFR, for example, 50% or more, preferably 60% or more, 70% or more, 80% or more, 90% or more, 95% or more, 96% or more, 97% or more, 98% or more, and 99% or more thereof.
An inhibiting effect on the binding can be evaluated using a known method for a binding inhibition test, such as a method used in Example 2 of the Description.
The antibody of the present invention is a neutralizing antibody that neutralizes VEGF activity through its specific binding to VEGF. In the present invention, the term “specifically bind to” means binding to (reacting with) a target molecule, but substantially not binding (not reacting with) molecules other than the target molecule. Furthermore, in the present invention, the term “neutralize” at least means to inhibit (suppress) the activity of VEGF to bind to VEGFR. Whether or not binding is specific can be confirmed by immunological techniques, such as ELISA, Western blot method or immunohistological staining.
Hereafter, a method for preparing an anti-VEGF antibody is described.
(1) Preparation of Antigen
VEGF is used as an immunogen for preparing the antibody of the present invention.
When VEGF is used as an immunogen, a peptide comprising an amino acid sequence that is a portion of the full length sequence of VEGF can also be used. VEGF to be used as an antigen or an immunogen and methods for introducing mutations are as described in the above “2. VEGF”.
VEGF may be natural VEGF purified from a mouse, rat, dog, or human tissues or cells, for example, or VEGF produced via genetic engineering techniques. For example, a biological sample confirmed to contain VEGF is fractionated into a soluble fraction and an insoluble fraction using various surfactants, such as Triton-X or Sarkosyl. The insoluble fraction is further dissolved in urea, guanidine hydrochloride or the like, and allow to bind to various columns, such as a heparin column or a binding resin, so that VEGF can be obtained. Moreover, VEGF to be used as an antigen can also be synthesized by specifying the amino acid sequence and then using a known protein synthesis method such as a solid phase method or a commercially available protein synthesizer. A synthesized peptide is bound to a carrier protein such as Keyhole Limpet Hemocyanin (KLH) or thyroglobulin and thus the resultant can be used as an immunogen.
(2) Preparation of Polyclonal Antibody
The above-prepared VEGF or a partial peptide alone is administered or the same is administered together with a carrier, a diluent or the like to a non-human mammal, such as a rabbit, a dog, a guinea pig, a mouse, a rat, or a goat for immunization. The dosage of the antigen per animal ranges from 0.1 mg to 10 mg when an adjuvant is used. Examples of the adjuvant include Freund's complete adjuvant (FCA), Freund's incomplete adjuvant (FIA), and an aluminum hydroxide adjuvant. Immunization is performed by mainly intravenous, subcutaneous, intraperitoneal injection, or the like. Furthermore, the immunization interval is not particularly limited, and immunization is performed at intervals of several days to several weeks, and preferably at intervals of 1 to 2 weeks for 2 to 10 times and preferably 3 to 5 times. The immunization interval can be determined by persons skilled in the art considering the resulting antibody titer. Preferably, blood is sampled when subcutaneous immunization is performed 3 to 4 times and then the antibody titer is measured. Antibody titer in serum can be measured by ELISA (enzyme-linked immunosorbent assay), EIA (enzyme immunoassay), radioimmunoassay (RIA) or the like. After confirmation of a sufficient increase in antibody titer, whole blood is collected, and then an antibody can be separated and purified by a generally employed method. Regarding separation and purification, a known method such as an ammonium sulfate salting-out method, ion exchange chromatography, gel filtration chromatography, and affinity chromatography is adequately selected or combined, and then purification can be performed. That is, a serum containing a target antibody is applied to a column to which proteins other than VEGF have been bound, a flow-through fraction is collected, and then a polyclonal antibody having improved specificity to VEGF can be obtained.
(3) Preparation of Monoclonal Antibody
(i) Collection of Antibody-Producing Cells
In a manner similar to that for preparation of a polyclonal antibody, VEGF or a partial peptide alone or the same together with a carrier or a diluent is administered to a non-human mammal for immunization. The dosage of an antigen per animal, the type of an adjuvant to be used, an immunization method, and immunization intervals are similar to those for preparation of a polyclonal antibody. One to 30 days, and preferably 2 to 5 days after the final immunization date, individuals confirmed to have antibody titers are selected, and then antibody-producing cells are collected. Examples of antibody-producing cells include spleen cells, lymph node cells, and peripheral blood cells, and among them spleen cells or lymph node cells are preferred.
(ii) Cell Fusion
To obtain hybridomas, cell fusion of antibody-producing cells and myeloma cells is performed. Cell fusion procedures can be implemented according to a known method such as the method of Kohler et al. As myeloma cells to be fused to antibody-producing cells, generally available established cell lines of an animal such as a mouse can be used. Cell lines that can be preferably used herein have drug selectivity and have a property of being unable to survive in HAT selective medium (containing hypoxanthine, aminopterin, and thymidine) when the cells are in an unfused state, but able to survive only in a state fused to antibody-producing cells. Examples of myeloma cells include mouse myeloma cell lines such as P3-x63-Ag8U.1, SP2/O-Ag14, PAI, P3U1, NSI/1-Ag4-1, and NSO/I, and rat myeloma cell lines such as YB2/0.
The cell fusion of myeloma cells and antibody-producing cells described above is performed by mixing 1×108 to 5×108 antibody-producing cells and 2×107 to 10×107 myeloma cells in animal cell culture medium such as serum-free DMEM and RPMI-1640 medium (the cell ratio of antibody-producing cells to myeloma cells ranges from 10:1 to 1:1), and then performing fusion reaction in the presence of a cell fusion accelerator. As a cell fusion accelerator, polyethylene glycol having an average molecular weight of 1000-6000 daltons or Sendai virus can be used, for example. In addition, antibody-producing cells and myeloma cells can be fused using a commercially available cell fusion device utilizing electrical stimulation (for example, electroporation).
(iii) Hybridoma Selection and Cloning
A target hybridoma is selected from cells after cell fusion treatment. Such a method is performed by appropriately diluting a cell suspension with 10% to 20% fetal calf serum-containing RPMI-1640 medium or the like, placing the resultant on a microtiter plate at about 0.3 cells/well as calculated by a limiting dilution method, adding selective medium such as HAT medium to each well, and then culturing while appropriately exchanging selective media. As a result, cells that grow around 10 days after the start of culture in selective media can be obtained as hybridomas.
Next, hybridomas that have grown are further screened. Hybridoma screening may be performed according to a general method and is not particularly limited. For example, a portion of a culture supernatant contained in wells in which hybridomas have been cultured is collected and then can be screened by enzyme immunoassay, radioimmunoassay or the like. As a specific example, an antigen is adsorbed to a 96-well plate, followed by blocking with calf serum. The culture supernatant of hybridoma cells is reacted with an immobilized antigen at 37° C. for 1 hour, and then reacted with peroxidase-labeled anti-mouse IgG at 37° C. for 1 hour, for color development using orthophenylenediamine as a substrate. The reaction is stopped with acid, and then absorbance at a wavelength of 490 nm is measured, so that screening can be performed. Hybridomas producing a monoclonal antibody found positive as a result of the above measurement method is cloned by a limiting dilution method or the like. Finally, hybridomas that are cells producing the monoclonal antibody that specifically binds to VEGF are established.
(iv) Collection of Monoclonal Antibody
As a method for collecting a monoclonal antibody from the thus established hybridomas, a general cell culture method, an ascites formation method, or the like can be employed. According to a cell culture method, the hybridomas are cultured in animal cell culture medium such as 10% fetal calf serum-containing RPMI-1640 medium, MEM, or serum free medium under general culture conditions (for example, 37° C., 5% CO2 concentration) for 7 to 14 days, and then an antibody is obtained from the culture supernatant. According to an ascites formation method, about 5×106 to 2×107 hybridomas are administered intraperitoneally to an animal of the same species as that of a mammal from which myeloma cells are derived, such as mouse (BALB/c), so that hybridomas are grown in large amounts. One to 2 weeks later, ascites is collected. When the above method for collecting an antibody requires purification of the antibody, purification can be performed by appropriately selecting a known method such as an ammonium sulfate salting-out method, ion exchange chromatography, gel filtration, and affinity chromatography, or using these methods in combination.
Examples of the antibody of the present invention include, but are not limited to, an antibody wherein:
a heavy chain variable region (VH) comprises a heavy chain complementarity determining region (CDR)1 (CDR-H1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 14, heavy chain CDR2 (CDR-112) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 16, and/or heavy chain CDR3 (CDR-113) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 18; and/or
a light chain variable region (VL) comprises light chain CDR1 (CDR-L1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 20, light chain CDR2 (CDR-L2) comprising or consisting of the amino acid sequence that consists of tryptophan (W)-alanine (A)-serine (S) (may also be referred to as “amino acid sequence WAS”, “amino acid sequence Trp-Ala-Ser”), and/or light chain CDR3 (CDR-L3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 22.
In another aspect, examples of the antibody of the present invention include, but are not limited to, an antibody wherein:
a heavy chain variable region comprises heavy chain CDR1 (CDR-H1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 24, heavy chain CDR2 (CDR-H2) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 26 and/or heavy chain CDR3 (CDR-H3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 28; and/or
a light chain variable region comprises light chain CDR1 (CDR-L1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 30, light chain CDR2 (CDR-L2) comprising or consisting of the amino acid sequence that consists of glycine (G)-threonine (T)-asparagine (N) (may also be referred to as “amino acid sequence GTN”, “amino acid sequence Gly-Thr-Asn”) and/or light chain CDR3 (CDR-L3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 32.
In another aspect, examples of the antibody of the present invention include, but are not limited to, an antibody wherein: the amino acid sequence of a heavy chain variable region comprises or consists of the amino acid sequence represented by SEQ ID NO: 34 or 38; and/or the amino acid sequence of a light chain variable region comprises or consists of the amino acid sequence represented by SEQ ID NO: 36 or 40.
(4) Preparation of Recombinant Antibody
A preferred aspect of the antibody of the present invention is a recombinant antibody. Examples of the recombinant antibody include, but are not limited to, a chimeric antibody, a humanized antibody, and a caninized antibody.
A chimeric antibody refers to an antibody prepared by linking immunoglobulin gene fragments of animals of different species. In the present invention, examples of a chimeric antibody include a humanized chimeric antibody, and a caninized chimeric antibody, but the types of animals, from which chimeric antibody variable and constant regions are derived, are not limited. A humanized chimeric antibody is an antibody prepared by linking (joining) a mouse-derived antibody variable region to a human-derived constant region, for example (see Proc. Natl. Acad. Sci. U.S.A. 81, 6851-6855, (1984), for example). A caninized chimeric antibody is an antibody prepared by linking a mouse-derived antibody variable region to a dog-derived constant region, for example. When a chimera is prepared, this can be easily constructed by gene recombination techniques so that an antibody prepared through such ligation can be obtained. Here, examples of a mouse-derived antibody variable region include, but are not limited to, a heavy chain variable region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 34 or 38, and a light chain variable region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 36 or 40.
When a humanized antibody is prepared, a technique referred to as, namely, CDR grafting, can be employed. CDR grafting is a method for preparing a reconstructed variable region, whereby a complementarity determining region (CDR) is grafted from a mouse antibody variable region to a human variable region, so that the framework region (FR) is human-derived and CDR is mouse-derived. Next, such humanized reconstructed human variable region is ligated to a human constant region. Such a method for preparing a humanized antibody is known in the art (see e.g., Nature, 321, 522-525 (1986); J. Mol. Biol., 196, 901-917 (1987); Queen C et al., Proc. Natl. Acad. Sci. USA, 86: 10029-10033 (1989); and Japanese Patent No. 2828340).
Here, examples of the amino acid sequence of mouse-derived CDR, which can be used for the humanized antibody of the present invention include, but are not limited to,
CDR1-3 of a heavy chain variable region (CDR-H1, CDR-H2 and CDR-H3) comprising or consisting of the amino acid sequences represented by SEQ ID NO: 14, 16 and 18, respectively,
CDR1-3 of a light chain variable region (CDR-L1, CDR-L2 and CDR-L3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 20, the amino acid sequence that consists of tryptophan (W)-alanine (A)-serine (S) (amino acid sequence Trp-Ala-Ser), and/or the amino acid sequence represented by SEQ ID NO: 22, respectively.
In another aspect, examples of the amino acid sequences of mouse-derived CDRs that can be used for the humanized antibody of the present invention include, but are not limited to,
CDR1-3 of a heavy chain variable region (CDR-H1, CDR-H2 and CDR-H3) comprising or consisting of the amino acid sequences represented by SEQ ID NO: 24, 26, and 28, respectively,
CDR1-3 of a light chain variable region (CDR-L1, CDR-L2 and CDR-L3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 30, the amino acid sequence that consists of glycine (G)-threonine (T)-asparagine (N) (amino acid sequence Gly-Thr-Asn), and/or the amino acid sequence represented by SEQ ID NO: 32, respectively.
A caninized antibody can also be prepared by a technique similar to the above method for preparing a humanized antibody.
In the present invention, examples of a human heavy chain constant region that can be used for a chimeric antibody and a humanized antibody include, but are not limited to, a human heavy chain constant region comprising an amino acid sequence derived from a human IgG1 heavy chain constant region, and for example, a human heavy chain constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 42, and examples of a human light chain constant region include, but are not limited to, a human light chain constant region comprising an amino acid sequence derived from a human IgG1 light chain constant region, and for example, a human light chain constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 44. Furthermore, examples of DNA encoding a human heavy chain constant region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 41. Examples of DNA encoding a human light chain constant region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 43.
Furthermore, in the present invention, examples of a canine heavy chain constant region that can be used for a chimeric antibody and a caninized antibody include, but are not limited to, a canine heavy chain constant region comprising an amino acid sequence derived from the canine IgGB heavy chain constant region, and for example, a canine heavy chain constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 46. Moreover, examples of a canine light chain constant region that can be used for a chimeric antibody and a caninized antibody include, but are not limited to, a canine light chain constant region comprising an amino acid sequence derived from a canine Ig light chain (κ chain) constant region or an amino acid sequence derived from a canine Ig light chain (λ chain) constant region, and for example, a canine light chain (κ chain) constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 48, or a canine light chain (λ chain) constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 50. Moreover, examples of DNA encoding a canine heavy chain constant region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 45. Examples of DNA encoding a canine light chain (κ chain or λ chain) constant region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 47 or 49.
In the present invention, a chimeric antibody, a humanized antibody, and a caninized antibody can be prepared according to the above-mentioned known method using a hybridoma or DNA, RNA or the like extracted from the hybridoma as a raw material.
Furthermore, the antibody of the present invention in the form of a fusion protein can be prepared according to a known gene recombination technique using antibody variable regions and another protein. The fusion protein can also be prepared by cross-linking a monoclonal antibody and another protein using a cross-linker.
(5) Preparation of Antibody Fragment
A fragment of the antibody against VEGF to be used in the present invention specifically binds to VEGF.
An antibody fragment refers to a polypeptide containing a partial region of the antibody of the present invention. As an antibody fragment, an antigen-binding fragment is preferred. Examples of the antigen-binding fragment include, but are not limited to, single-chain antibodies (scFv (single chain Fv)), sc (Fv)2), double-chain antibodies (Fab, Fab′, diabody (diabody (dibodies), dsFv), and F(ab′)2. The above antibody fragment can be obtained by cleaving the antibody of the present invention with various proteases depending on purposes.
For example, Fab can be obtained by treating an antibody molecule with papain, and F (ab′)2 can be obtained by treating an antibody molecule with pepsin. Moreover, Fab′ can be obtained by cleaving the disulfide bond of the above F(ab′)2 hinge region.
In the case of scFv, cDNA encoding antibody H chain V region and L chain V region is obtained and then DNA encoding scFv is constructed. The DNA is inserted into an expression vector, and then the expression vector is introduced into a host organism for expression, so that scFv can be produced.
In the case of a diabody, cDNA encoding antibody H chain V region and L chain V region is obtained, and then DNA encoding scFv is constructed so that a peptide linker has an amino acid sequence with a length of 8 or less residues. The DNA is inserted into an expression vector, and then the expression vector is introduced into a host organism for expression, so that a diabody can be produced.
In the case of dsFv, cDNA encoding antibody H chain V region and L chain V region is obtained, and then DNA encoding dsFv is constructed. The DNA is inserted into an expression vector, and then the expression vector is introduced into a host organism for expression, so that dsFv can be produced.
In the present invention, examples of the nucleotide sequence of DNA encoding a heavy chain variable region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 33 or 37, and examples of the nucleotide sequence of DNA encoding a light chain variable region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 35 or 39.
Specific examples of the antibody fragment of the present invention include, but are not limited to, an antibody fragment comprising:
a heavy chain variable region (VH) that comprises heavy chain CDR1 (CDR-H1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 14, heavy chain CDR2 (CDR-H2) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 16, and/or heavy chain CDR3 (CDR-H3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 18; and/or a light chain variable region (VL) that comprises light chain CDR1 (CDR-L1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 20, light chain CDR2 (CDR-L2) comprising or consisting of the amino acid sequence that consists of tryptophan (W)-alanine (A)-serine (S) (amino acid sequence Trp-Ala-Ser) and/or light chain CDR3 (CDR-L3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 22.
In another aspect, specific examples of the antibody fragment of the present invention include, but are not limited to, an antibody fragment comprising:
a heavy chain variable region comprises heavy chain CDR1 (CDR-H1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 24, heavy chain CDR2 (CDR-H2) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 26 and/or heavy chain CDR3 (CDR-H3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 28, and/or
a light chain variable region comprises light chain CDR1 (CDR-L1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 30, light chain CDR2 (CDR-L2) comprising or consisting of the amino acid sequence that consists of glycine (G)-threonine (T)-asparagine (N) (amino acid sequence Gly-Thr-Asn), and/or light chain CDR3 (CDR-L3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 32.
Moreover, examples of the antibody fragment of the present invention include, but are not limited to, an antibody fragment wherein a heavy chain variable region comprises or consists of the amino acid sequence represented by SEQ ID NO: 34 or 38, and/or a light chain variable region comprises or consists of the amino acid sequence represented by SEQ ID NO: 36 or 40.
An antibody fragment (peptide) comprising CDR is composed of at least one region of VH or VL CDRs (CDR1-3). An antibody fragment comprising a plurality of CDRs can be bound directly or via an appropriate peptide linker. An antibody fragment comprising CDR can be produced by constructing DNA encoding antibody VH and VL CDRs, inserting the DNA into a prokaryotic expression vector or a eukaryotic expression vector, and then introducing the expression vector into prokaryotes or eukaryotes for expression. Furthermore, a peptide comprising CDR can also be produced by a chemical synthesis method such as a Fmoc method (fluorenylmethyloxycarbonyl method) and a tBoc method (t-butyloxycarbonyl method).
Examples of DNA encoding VH CDR1-3 include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 13, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 15 and DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 17, respectively. Examples of DNA encoding VL CDR1-3 include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 19, DNA comprising or consisting of the nucleotide sequence that consists of thymine (T)-guanine (G)-guanine (G)-guanine (G)-cytosine (C)-adenine (A)-thymine (T)-cytosine (C)-cytosine (C) (also referred to as “nucleotide sequence TGGGCATCC”), and DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 21, respectively.
In another aspect, examples of DNA encoding VH CDR1-3 include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 23, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 25 and DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 27, respectively. Examples of DNA encoding VL CDR1-3 include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 29, DNA comprising or consisting of the nucleotide sequence that consists of guanine (G)-guanine (G)-thymine (T)-adenine (A)-cytosine (C)-cytosine (C)-adenine (A)-adenine (A)-cytosine (C) (may also be referred to as “nucleotide sequence GGTACCAAC”), and DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 31, respectively.
(6) Binding Affinity
Binding affinity can be determined by the binding constant (KA) and dissociation constant (KD). Affinity equilibrium constant (K) is expressed by the ratio of the KA/KD. Its binding affinity can be detected as follows.
Binding constant (KA) and dissociation constant (KD) can be measured using surface plasmon resonance (SPR), and known devices and methods for detecting binding rates in real time and monitoring can be employed (e.g. Biacore®-3000 (GE Healthcare), ProteON XPR36 (Bio-Rad), etc.).
The antibody of the present invention can inhibit its target with an IC50 of 1×10−7 mol/L or less (for example, 1×10−7 mol/L or less, 1×10−8 mol/L or less, 1×10−9 mol/L or less, preferably 1×10−10 mol/L or less, more preferably 1×10−11 mol/L or less).
The present invention provides an antibody that binds to a site to which the antibody against VEGF of the present invention binds. In detail, examples of the antibody against VEGF of the present invention include an antibody that binds to a site, to which a monoclonal antibody against VEGF that binds to VEGF with a dissociation constant of 1×10−11 mol/L or less.
A site to which the anti-VEGF antibody of the present invention binds is not limited, as long as it is at least a partial region of VEGF that is an antigen. Examples of a site to which the anti-VEGF antibody of the present invention binds include, at least one region selected from the group consisting of exon 1, 2, 3, 4, 5, 6a, 6b, 7a, 7b, and 8a, and exon 1 to 5 regions are preferred. Persons skilled in the art can specify exon 1 to 5 regions of various VEGFs based on known information such as Genbank. For example, the amino acid sequences of mouse, rat, canine, human VEGF exon 1 to 5 are represented by SEQ ID NO: 51, 52, 53 and 54, respectively.
Persons skilled in the art can specify sites (e.g., regions and epitopes) or polypeptides containing them, to which the anti-VEGF antibody of the present invention binds, based on the Description and known techniques such as epitope mapping or X-ray structural analysis.
Furthermore, an antibody that binds to a site, to which the above monoclonal antibodies bind, may be a polyclonal antibody or a monoclonal antibody. When such an antibody is a monoclonal antibody, the antibody may be a recombinant antibody, such as a chimeric antibody, a humanized antibody, or a caninized antibody.
An antibody that binds to a site, to which the antibody against VEGF of the present invention binds, competes with the antibody against VEGF of the present invention for binding with VEGF. Persons skilled in the art can understand that an antibody competing with the antibody against VEGF of the present invention for binding with VEGF has specificity and/or activity equivalent to that of the antibody of the present invention (Specifically, a monoclonal antibody against VEGF, which binds to VEGF with a dissociation constant of 1×10−11 mol/L or less).
A competition test using an antibody is a technique established in the technical field of antibodies as a technique for examining if a set of antibodies bind to the same (or redundant) site (see e.g., Ju-Won Kwak et al., Journal of Immunological Methods 191 (1996) 49-54). In the competition test, when the binding of the antibody against VEGF of the present invention is competitively inhibited by an anti-VEGF antibody to be tested, the test subject anti-VEGF antibody can be identified to be an antibody that binds to a site, to which the antibody against VEGF of the present invention binds. Furthermore, the test method does not require information about the structure of the relevant site for examining if a set of antibodies bind to the same (or redundant) site.
That is, persons skilled in the art can obtain an antibody binding to a site, to which the antibody against VEGF of the present invention binds, by conducting a competition test using the antibody against VEGF of the present invention without excessive experimentation.
4. Pharmaceutical Composition
The pharmaceutical composition of the present invention comprises the antibody or a fragment thereof described in the above “3. Antibody against VEGF” as an active ingredient, and is used for a target disease. The pharmaceutical composition of the present invention is used for prevention or treatment of target diseases and is effective for the prevention or the treatment.
Diseases targeted by the pharmaceutical composition of the present invention are not limited, as long as they are VEGF-associated diseases (including symptoms (conditions)), and examples of such diseases include solid tumors, cancers including particularly problematic metastatic tumors, and VEGF-mediated eye diseases, and other immune diseases.
Tumor vascular structures are known to supply blood, and also function as a vascular niche environment supporting cancer stem cells. The vascular niche environment refers to an environment involving maintenance, proliferation and differentiation of hematopoietic stem cells that are sources of blood and blood vessels, and is considered to be important for cancer stem cell proliferation.
Unlike normal cells, cancer cells are characterized by high proliferative ability, unlimited number of cell divisions, and ability to cause invasion and metastasis to peripheral tissues. In recent years, it has become considered that not all cancer cells in a cancer tissue have such properties, and limited partial cells have such properties. That is, these partial cancer cells are cells having properties observed in common among stem cells such as embryonic stem cells and somatic stem cells, including self-replicating ability, by which the cells can create cells completely identical thereto, and pluripotency, by which the cells are capable of differentiating into many cell types. The partial cancer cells are considered to be cancer stem cells that function as a source for creating the majority of peripheral cancer cells via differentiation while maintaining cells identical to themselves in the cancer tissue through self-replication.
Cancer stem cells are considered to be a major cause of cancer recurrence and cancer metastasis, and thus importance of targeting cancer stem cells in cancer treatment has been indicated. If significant inhibition of cancer stem cell proliferation within tumor tissue becomes possible, a novel treatment capable of killing entire cancer cells effectively can be developed.
The term “cancer sternness” in the present invention refers to a property of a cell population exerting the properties of cancer stem cells. Specifically, cancer sternness refers to properties of having self-replication and pluripotency peculiar to stem cells, and a property of cells functioning as a source of cancer.
In the present invention, examples of cancer include brain tumor, cervical cancer, esophageal cancer, cancer on the tongue, lung cancer, breast cancer, pancreatic cancer, gastric cancer, cancer of small bowel, duodenal cancer, colon cancer, bladder cancer, renal cancer, liver cancer, prostate cancer, uterine cancer, uterine cervix cancer, ovarian cancer, thyroid cancer, gallbladder cancer, pharyngeal cancer, sarcoma, melanoma, leukemia, lymphoma, and multiple myeloma.
In the present invention, VEGF-mediated eye disease is VEGF-associated disease that is caused by pathological angiogenesis or vascular hyperpermeability in the eye. That is, the VEGF-mediated eye disease can be treated or prevented by inhibiting binding of VEGF to a VEGF receptor using the anti-VEGF antibody. Examples of such disease include age-related macular degeneration (including special types such as polypoidal choroidal vasculopathy and retinal angiomatous proliferation), diabetic retinopathy, diabetic macular edema, neovascular glaucoma, retinal vein occlusion, retinopathy of prematurity, choroidal neovascularization associated with pathological myopia, pterygium, rubeosis, pannus, Stevens-Johnson syndrome, and immunological rejection of transplanted tissue (e.g., corneal tissue) of the eye.
In the present invention, the term “pathological angiogenesis” refers to angiogenesis that takes place, in morbidity or a state inducing morbidity, when new blood vessels grow excessively, insufficiently, or inappropriately (for example, the position or timing is undesirable from a medical viewpoint, or in development) compared with normal physiological angiogenesis (vasculogenesis).
In the present invention, the term “treatment”, “treat”, or “treating” refers to contacting (for example, administrating) the antibody or a fragment thereof or the pharmaceutical composition of the present invention (hereafter, may also be referred to as “the pharmaceutical composition of the present invention or the like”) with a subject after the onset of the disease, thereby alleviating the symptoms of the disease, compared to when the subject is not contacted with the pharmaceutical composition of the present invention or the like. The treatment as used herein does not always refer to completely suppressing the symptoms of a disease. The term “onset of a disease” refers to the appearance of the symptoms of the disease in the body.
In the present invention, the term “prevention”, “prevent”, or “preventing” refers to contacting (for example, administrating) the pharmaceutical composition of the present invention or the like with a subject before the onset of a disease, thereby alleviating symptoms of the disease after the onset of the disease, compared to when the subject is not contacted with the pharmaceutical composition of the present invention or the like. The term “prevention” does not always refer to completely suppressing the onset of the disease.
The pharmaceutical composition of the present invention can comprise, in addition to the antibody against VEGF of the present invention, a pharmaceutically acceptable carrier. The term “pharmaceutically acceptable carrier” refers to any carrier (e.g., liposome, lipid microcapsule, and micelle), diluent, excipient, wetting agent, buffering agent, suspending agent, lubricant, adjuvant, emulsifier, disintegrator, absorbent, preservative, surfactant, colorant, flavoring, or sweetener appropriate for the pharmaceutical composition for immune diseases.
The pharmaceutical composition of the present invention or the like can be formulated into preparations for injection, freeze-dried products, tablets, hard capsules, soft capsules, granules, powders, pills, syrups, suppositories, cataplasm, ointments, cream pharmaceuticals, eye drops, and the like. Liquid preparations such as preparations for injection may be in the form of powder to be prepared before use (for example, freeze-dried powder), which is dissolved in saline or the like before use.
The pharmaceutical composition of the present invention or the like can be administered topically or systemically through any means known by persons skilled in the art. The route of administration of the pharmaceutical composition of the present invention can be oral administration and parenteral administration. In the case of parenteral administration, intratissue administration (e.g., subcutaneous administration, intraperitoneal administration, intramuscular administration, and intravenous administration), intradermal administration, local administration (e.g., transdermal administration) or transrectal administration can be performed. The pharmaceutical composition of the present invention can be administered in dosage forms appropriate for these routes of administration.
The dosage of the pharmaceutical composition of the present invention or the like can be varied depending on factors such as a subject's age, body weight, health status, gender, and symptoms, and the animal species of a subject, the route of administration, the frequency of administration, and a dosage form, and specific procedures for administration can be determined by persons skilled in the art. The dosage of the antibody of the present invention for treatment of cancer ranges from, for example, 0.1 mg to 100 mg/day, preferably 1 mg to 15 mg/day, and more preferably 2 mg to 12 mg/day per kg body weight of a subject, but the examples are not limited thereto. Regarding the frequency of administration, the pharmaceutical composition can be administered once to 5 times a day. The dosage of the antibody of the present invention for treatment of VEGF-mediated eye disease ranges from, for example, 0.01 mg to 100 mg/eye, and more preferably, 0.1 mg to 10 mg/eye. Regarding the frequency of administration, the antibody can be administered once a day to once every two months, but the examples are not limited thereto.
The timing of administration can be appropriately determined depending on symptoms, and several dosages can be administered simultaneously or separately at intervals. Furthermore, the pharmaceutical composition of the present invention may be administered to a subject before the onset of a disease or after the onset of the disease.
The pharmaceutical composition of the present invention can be administered to a mammal as a subject. Examples of mammals include mice, rats, hamsters, guinea pigs, rabbits, cats, dogs, goats, pigs, sheep, cattle, horses, monkeys, and humans.
5. Method for Treating or Preventing a Cancer or a VEGF-Mediated Eye Disease
According to the present invention, a cancer or a VEGF-mediated eye disease can be treated or prevented by administrating to a subject the antibody against VEGF or a fragment thereof or the pharmaceutical composition comprising the same. That is, the present invention provides a method for treating or preventing a cancer or a VEGF-mediated eye disease, comprising a step of administering to a subject a therapeutically effective amount of the antibody of the present invention or a fragment thereof or the pharmaceutical composition comprising the same. The therapeutically effective amount of the antibody of the present invention or a fragment thereof or the pharmaceutical composition comprising the same is varied depending on factors such as a subject's age, body weight, health status, gender, and symptoms, the route of administration, the frequency of administration, and a dosage form. Persons skilled in the art can easily determine the therapeutically effective amount required for treatment or prevention of a cancer or a VEGF-mediated eye disease. In the present invention, “subject” includes subjects in need of treatment or prevention of a cancer or a VEGF-mediated eye disease. In addition, mammals to be subjected to treatment or prevention as “subject” are as described above.
In the method for treating or preventing a cancer or a VEGF-mediated eye disease of the present invention, “cancer”, “VEGF-mediated eye disease”, “treatment” and “prevention” are as described above. Moreover, the dosage form, the route of administration, the dosage, the timing of administration and the like of the antibody of the present invention or a fragment thereof or the pharmaceutical composition comprising the same are also as described above.
6. Angiogenesis Inhibitor
The antibody of the present invention inhibits binding of VEGF to a VEGF receptor, and thus can inhibit angiogenesis resulting from the binding. Thus, the present invention provides an angiogenesis inhibitor comprising the antibody or a fragment thereof described in the above “3. Antibody against VEGF” as an active ingredient.
The angiogenesis inhibitor of the present invention can be used as a reagent or used for treatment of a mammal, and its dosage form, additives, route of administration, administration target, dosage and the like can be appropriately selected according to the description of the above “4. Pharmaceutical composition”. However, the angiogenesis inhibitor of the present invention may be an inhibitor comprising the antibody of the present invention or a fragment thereof alone.
7. Use of Antibody
The antibody of the present invention or a fragment thereof can be used in a method for treating or preventing a cancer or a VEGF-mediated eye disease, or the manufacture of a medicament for treatment or prevention of a cancer or a VEGF-mediated eye disease. Specifically, the present invention provides the anti-VEGF antibody of the present invention or a fragment thereof for use in the method for treating or preventing a cancer or a VEGF-mediated eye disease. Moreover, the present invention provides the anti-VEGF antibody of the present invention or a fragment thereof for use in the manufacture of a medicament for treatment or prevention of a cancer or a VEGF-mediated eye disease. Furthermore, the present invention provides the anti-VEGF antibody or a fragment thereof for use in the manufacture of an angiogenesis inhibitor.
In these aspects, “cancer”, “VEGF-mediated eye disease”, “treatment” and “prevention” are as described above.
8. Combination Therapy
The pharmaceutical composition of the present invention can be used for administration in combination with at least one of other anticancer agents. Examples of anticancer agents to be used in the present invention include sorafenib (Nexavar®), sunitinib (Sutent®), bevacizumab (Avastin®), cisplatin (cDDP), carboplatin (Paraplatin®), paclitaxel (Taxol®), docetaxel (Taxotere®), gemcitabine hydrochloride (Gemzar®), gefitinib (Iressa®), erlotinib (Tarceva®), irinotecan hydrochloride (CPT-11), and 5-fluorouracil (5-FU).
It can be expected that combined administration of the pharmaceutical composition of the present invention and at least one of anticancer agents exert more advantageous effects than an independent use thereof. Such advantageous effects include an effect on alleviating adverse effects more than conventional therapies while maintaining the therapeutic effects.
The term “used in combination” in the present invention refers to simultaneous administration of or separate administration of the pharmaceutical composition of the present invention and at least one of the above anticancer agents. The term “simultaneously” means that administration is performed at the same timing in a single administration schedule, but the times; that is, hours and minutes of administration are not required to be completely the same. The term “separately” means that administration is performed at different timings in a single administration schedule.
The dosage form, the route of administration, and the administration target of the pharmaceutical composition or the like and an anticancer agent to be used for combination therapy in the present invention are not particularly limited, and can be appropriately selected according to the description of the above “4. Pharmaceutical composition”. Moreover, the dosage forms or dosages of agents to be used in combination may differ from each other, and can be appropriately adjusted depending on a combination employed.
When the pharmaceutical composition of the present invention is used in combination with another anticancer agent, the dosage can be decreased as appropriate. Therefore, when the pharmaceutical composition of the present invention is combined with another anticancer agent, the following combinations of
(i) an effective dose of the pharmaceutical composition of the present invention and an effective dose of another anticancer agent,
(ii) an effective dose of the pharmaceutical composition of the present invention and a subeffective dose of another anticancer agent,
(iii) a subeffective dose of the pharmaceutical composition of the present invention and an effective dose of another anticancer agent, and
(iv) a subeffective dose of the pharmaceutical composition of the present invention and a subeffective dose of another anticancer agent can be employed.
Even in an aspect in which one of or both the pharmaceutical composition and an anticancer agent are used in subeffective doses, the two can be administered in combination in such an aspect, when the combination can exert pharmacological effects.
9. Reagent, Kit
The monoclonal antibody of the present invention or a fragment thereof can be included in a reagent for detection of VEGF or a kit. That is, the present invention provides a reagent and a kit comprising the monoclonal antibody of the present invention or a fragment thereof. The reagent and the kit of the present invention can be used as a reagent for detecting VEGF or a kit, for example.
In the reagent and the kit of the present invention, the monoclonal antibody of the present invention or a fragment thereof may be treated by a method such as freezing for easy handling, and then directly or mixed with a known pharmaceutically acceptable carrier, such as an excipient, an extending agent, a binder, and a lubricant, and a known additive (including a buffering agent, a tonicity agent, a chelating agent, a colorant, a preservative, an aroma chemical, a flavoring agent, a sweetening agent and the like), for example.
The kit of the present invention can comprise, in addition to the monoclonal antibody of the present invention or a fragment thereof, a buffer, an enzyme solution, a secondary antibody, a solution for dilution, instructions, and the like.
Hereafter, the present invention is described in detail by the Examples, but the present invention is not limited to the Examples.
Example 1
Preparation of Monoclonal Antibody
(1) Preparation of Antigen
Human recombinant VEGF165 (hereafter, may also be referred to as “VEGF”, “rhVEGF165” or “rhVEGF”) expressed by CHO cells (PROSPEC) was used as an antigen. For the purpose of suppressing the effect of VEGF on mice, an antigen bound to KLH (Keyhole Limpet Hemocyanin) was prepared. In this case, VEGF and KLH were mixed so that the molar ratio of VEGF to KLH was 4:1 in PBS (−) (0.01 M sodium-phosphate buffer, 0.138 M NaCl, 0.0027 M KCl, pH 7.4), and then 1% glutaraldehyde was added, and then the mixture was allowed to react at room temperature for 1 hour, thereby cross-linking KLH and rhVEGF165. The thus prepared protein may also be referred to as “KLH-VEGF” in the followings.
(2) Immunization
rhVEGF or KLH-VEGF and Freund's complete adjuvant were mixed in equal amounts, and then the mixture was administered intraperitoneally to BALB/c mice in an amount of 100 μl (about 40 μg/mouse). Subsequently, about 40 μg of KLH-VEGF or rhVEGF was administered with an incomplete Freund's adjuvant intraperitoneally to mice once every 3 weeks for boosters (additional immunization). Boosters were performed not more than 12 times. Final immune stimulation was performed by administering saline containing about 40 μg of KLH-VEGF or rhVEGF into the tail vein of each mouse on day 3 before splenectomy.
(3) Cell Fusion
Isolated splenocytes and a mouse myeloma cell line, P3-x63-Ag8U. 1 (DS PHARMA BIOMEDICAL), were mixed at 5:1 in terms of the number of cells, and then cell fusion was performed using 50% polyethylene glycol 3350 (Sigma). Cells were suspended in HAT medium (RPMI1640 medium supplemented with 1/2×HT (MP), 1/2×HAT (MP), 10% FBS, 50 ng/L mouse IL-6, and 500 mg/mL D-Glucose), dispensed in a 96-well microculture plate and then cultured.
(4) ELISA
Culture supernatants of wells in which hybridomas had grown were collected, and then hybridomas producing monoclonal antibodies reactive to rhVEGF165 were selected. rhVEGF165 was diluted with PBS (−), dispensed into a 96-well ELISA plate (Nunc) at 1 μg/well, allowed to stand overnight at 4° C., and thus bound onto the plate surface. Next, after 3 times of washing with 350 μL of 0.05% Tween 20-containing PBS (−) (hereafter, denoted as “PBS-T”), 300 μL of 1% skim milk-containing PBS-T was dispensed into each well, followed by blocking at room temperature for 1 hour. After washing with PBS-T, the culture supernatant of the hybridomas was dispensed into an ELISA plate on which rhVEGF165 had been immobilized, and then allowed to react for 1 hour at room temperature. After washing with PBS-T, 100 μL of peroxidase (hereafter, denoted as “POD”)-labeled anti-mouse immunoglobulin antibody (BETHYL) diluted 10000-fold was dispensed into each well, and then allowed to react for 1 hour at room temperature. After similar washing was performed, a POD substrate that had been prepared to a concentration of 1 mg/mL POD was added, and then the resultant was allowed to develop color at room temperature for 5 minutes. The reaction was stopped with 1.5 N sulfuric acid, and then absorbance at 490 nm was measured using a plate reader (Molecular Devices).
(5) Establishment of Anti-VEGF Monoclonal Antibody
Based on the absorbance of a plate to which no rhVEGF165 had been immobilized, wells each found to have an absorbance three or more times the baseline value were determined to be positive, and then cloning was performed by a limiting dilution method. Cell supernatants of wells containing single colonies were examined for antibody activity by the method of the above (4), isolated, and then cultured, thereby establishing a hybridoma cell line producing a monoclonal antibody reactive to rhVEGF165. From the thus established hybridomas, two positive clones were selected, antibodies produced from these hybridomas were designated as KLHa505 and KLHb1501, respectively.
Example 2
Evaluation of the Capability of Monoclonal Antibodies to Inhibit Binding of VEGF to its Receptor
An anti-VEGF antibody binds to VEGF to block the binding of VEGF to its receptors, VEGFR-1 and/or VEGFR-2, to be able to inhibit signal transduction through mediation of VEGF.
KLHa505 and KLHb1501 were separated and purified from the culture supernatants of the two positive clones using Protein G.
Next, IgG Fc-VEGFR-1 or IgG Fc-VEGFR2 was immobilized on a 96-well ELISA plate. After blocking with 2% bovine serum albumin, a purified antibody mixed with rhVEGF was added to the plate, followed by reaction at room temperature for 1 hour. A solution was prepared by mixing with rhVEGF, and then washed 3 times with 0.05% TWEEN® 20-containing TBS (TBS: 50 mM Tris-HCl (pH7.4), 500 mM NaCl; hereafter, referred to as “TBS-T”). Thereafter, through color development using rabbit anti-human VEGF polyclonal antibody-HRP, the rhVEGF content was determined.
As a result, it was demonstrated that the KLHa505 antibody competitively inhibits binding of VEGF to VEGFR-1 and VEGFR-2, and the KLHb1501 antibody competitively inhibits binding of VEGF to VEGFR-2 (FIG. 1).
That is, it was demonstrated in this Example that the antibodies of the present invention, KLHa505 and KLHb1501, can block VEGF-associated signal transduction.
Example 3
Measurement of Dissociation Constant of KLHa505 and KLHb1501 for Binding to rhVEGF
With the use of BIAcore-3000, Kd of KLHa505 and Kd of KLHb1501 for binding to VEGF were determined. rhVEGF was immobilized on a CMS chip, serial dilution was performed twice with HBS-EP buffer, and then each antibody was injected at a flow rate of 30 μL/min. Kd is Koff/Kon.
As a result, it was demonstrated that the dissociation constant for binding of KLHa505 to rhVEGF was 4.23 pmol/L, and the dissociation constant for binding of KLHb1501 to rhVEGF was 0.60 pmol/L.
When compared with the dissociation constant for an existing antibody (for example, the dissociation constant for Avastin (bevacizumab) is 4.9 nmol/L), the dissociation constants for the antibodies of the present invention were each 1/1000 or less that for the existing antibody. Hence, the binding activity of the antibodies that bind to VEGF is significantly high.
That is, in this Example, the antibodies (high-affinity anti-VEGF antibodies) having extremely high affinity for VEGF were obtained.
Example 4
Examination of the Inhibiting Effect of the Monoclonal Antibodies, KLHa505 and KLHb1501 on HUVEC Proliferation
It was examined if KLHa505 and KLH1501 inhibited VEGF activity exerted to normal human umbilical vein-derived endothelial cells (hereafter, referred to as “HUVEC”). HUVEC was used for the test to such an extent that the passage number did not exceed 8. With 1% fetal calf serum-containing Medium 200, 10000 cells each were seeded on a 96-well cell culture plate, rhVEGF was added at a final concentration of 50 ng/mL and KLHa505 or KLHb1501 was added at a final concentration of 2500 ng/mL each, cells were cultured for 24 hours, and then the numbers of cells were determined.
As a result, compared to positive controls (VEGF and isotype control antibody (“Control IgG” in FIG. 2)), cells with KLHa505 or KLHb1501 were found to exert a significant decrease in the number of cells (FIG. 2).
It was thus demonstrated in this Example that the high-affinity antibodies of the present invention can inhibit blood vessel-derived cells' cell proliferation activity due to VEGF, and can suppress angiogenesis.
Example 5
Examination of the In Vivo Inhibiting Effect of the Monoclonal Antibodies, KLHa505 and KLHb1501, on Cell Proliferation
One lineage of human colon adenocarcinoma LS174T cells (about 1×107 cells) cryopreserved in liquid nitrogen were thawed in a warm bath at 37° C. two weeks before the experiment. Subsequently, to a 100-mm cell dish added with McCoy's 5A medium containing 10% fetal calf serum warmed in advance at 37° C., the thawed cell suspension was added, and then cells were grown to 80% confluency. Thereafter, cells were subcultured at 1:5, followed by 3 times of continuous subculturing. When all cells reached the number of cells required for inoculation, cells were removed from the dish using a 0.25% trypsin-EDTA solution, and then washed with PBS. Saline containing 50% MatriGel® was added to the washed cells to a concentration of 2×107/mL, and then the resultant was inoculated subcutaneously to the abdomen of each Balb/C nude mouse at 100 μL/mouse, specifically at 2×106 cells/mouse.
On the next day of cell inoculation, administration of KLHa505 and KLHb1501 was initiated. Regarding the dosage of KLHa505, administration was performed for 5 mouse per group, and thus (i) model control group (saline alone), (ii) 5 mg/kg KLHa505 group, (iii) 2.5 mg/kg KLHa505 group and (iv) 0.5 mg/kg KLHa505 group were prepared. Similar administration groups were prepared also for KLHb1501.
Regarding the administration method, KLHa505 or KLHb1501 dissolved in saline in an amount of 200 μL per mouse was administered once on day 2 and on day 5 in each week through intraperitoneal injection. To a model control group, 200 μL of saline was simultaneously administered by the same method.
Regarding the administration period, administration was continuously performed for 18 days for KLHa505 and 22 days for KLHb1501. When the antibodies were administered, the maximum diameter “a” and the minimum diameter “b” of a tumor nodule of each nude mouse were measured, and the tumor volume was calculated according to the formula V=0.5×a×b2.
As a result, KLHa505 and KLHb1501 were demonstrated to have capability of significantly inhibiting in vivo tumor growth (FIG. 3 and FIG. 4).
That is, this Example demonstrated that the high-affinity antibodies of the present invention are effective for treatment or prevention of a cancer.
Example 6
Determination of the Nucleotide Sequences and Amino Acid Sequences of Monoclonal Antibody Variable Regions
mRNAs were extracted from hybridomas that produce KLHa505 and KLHb1501, cDNAs were prepared using reverse transcriptase. With the use of these cDNAs as templates, the nucleotide sequences of mouse IgG antibody heavy chain and light chain variable regions were amplified by PCR, and then the nucleotide sequences were analyzed, thereby the amino acid sequences of complementarity determining regions contained in the light chain and heavy chain variable regions were determined.
Furthermore, the amino acid sequences of CDR1, CDR2 and CDR3 of KLHa505 and KLHb1501 variable region were determined using IMGT/V-QUEST software, version 3.3.0, on the immunoglobulin database “the international ImMunoGeneTics information System®” (IMGT/GENE-DB).
The results are each shown in the following Table 1 and Table 2.
TABLE 1
KLHa505
Heavy chain (V-D-J region)
Nucleotide cagatccagttggtgcagtctggacctgagctgaagaagc
sequence ctggagagacagtcaagatctcctgcaaggcttctgggta
taccttcacaaactatggaatgaactgggtgaagcaggct
ccaggaaagggtttaaagtggatgggctggataaacacct
acactggagagccaacatatcttgatgacttcaagggacg
gtttgccttctctttggaaacctctgccagcactgcctac
ttgcagatcaacaacctcaaaaatgaggacacgtctacat
atttctgtgcaagattttcctacggtattacctggttctt
cgatgtctggggcgcagggaccacggtcaccgtctcctca
 (SEQ ID NO: 33)
Peptide QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQA
sequence PGKGLKWMGWINTYTGEPTYLDDFKGRFAFSLETSASTAY
LQINNLKNEDTSTYFCARFSYGITWFFDVWGAGTTVTVSS
(SEQ ID NO: 34)
Light chain (V-J region)
Nucleotide gacattgtgatgtcacagtctccatcctccctggctgtgt
sequence cagcaggagagaaggtcactatgagctgcaaatccagtca
gagtctgctcaacagtagaacccgaaagaactacttggct
tggtaccagcagaaaccagggcagtctcctaaactgctga
tctactgggcatccactagggaatctggggtccctgatcg
cttcacaggcagtggatctgggacagatttcactctcacc
atcagcagtgtgcaggctgaagacctggcagtttattact
gcaagcaatcttataatctgtacacgttcggaggggggac
caagctggaaataaaac (SEQ ID NO: 35)
Peptide DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLA
sequence WYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLT
ISSVQAEDLAVYYCKQSYNLYTFGGGTKLEIK (SEQ ID
NO: 36)
Sequence
Heavy chain
VH-CDR1 GYTFTNYG (SEQ ID NO: 14)
VH-CDR2 INTYTGEP (SEQ ID NO: 16)
VH-CDR3 ARFSYGITWFFDV (SEQ ID NO: 18)
Light chain
VL-CDR1 QSLLNSRTRKNY (SEQ ID NO: 20)
VL-CDR2 WAS
VL-CDR3 KQSYNLYT (SEQ ID NO: 22)
TABLE 2
KLHb1501
Heavy chain (V-D-J region)
Nucleotide gatgtgcagcttcaggagtcgggacctggcctggtgaaac
sequence cttctcagtctctgtccctcacctgcactgtcactggcta
ctcaatcaccagtgattatgcctggacctggatccggcag
tttccaggagacaaactggagtggatgggctacataagct
acagtggtagcactcgctacaacccatctctcaaaagtcg
aatctctatcactcgagacacatccaagaaccagttcttc
ctgcacttgaattctgtgactactgaggacacggccacat
atttctgtgcaagagggggggattactacggtagtcgccc
ctggtttgcttactggggccaagggactctggtcactgtc
tctgcag (SEQ ID NO: 37)
Peptide DVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWTWIR
sequence QFPGDKLEWMGYISYSGSTRYNPSLKSRISITRDTSKNQ
FFLHLNSVTTEDTATYFCARGGDYYGSRPWFAYWGQGTL
VTVSA (SEQ ID NO: 38)
Light chain (V-J region)
Nucleotide caggctgttgtgactcaggaatctgcactcaccacatcac
sequence ctggtgaaacagtcacactcacttgtcgctcaagtactgg
ggctgttacaattagtaactacgccaactgggtccaagaa
aaaccagatcatttattcactggtctaataggtggtacca
acaaccgagctccagatgttcctgccagattctcaggctc
cctgattggagacaaggctgccctcaccatcacaggggca
cagactgaggatgaggcaatatatttctgtgctctctggt
acagcaaccatttggtgttcggtgaaggaaccaaactgac
tgtcctag (SEQ ID NO: 39)
Peptide QAVVTQESALTTSPGETVTLTCRSSTGAVTISNYANWVQE
sequence KPDHLFTGLIGGTNNRAPDVPARFSGSLIGDKAALTITGA
QTEDEAIYFCALWYSNHLVFGEGTKLTVL (SEQ ID  
NO: 40)
Sequence
Heavy chain
VH-CDR1 GYSITSDYA (SEQ ID NO: 24)
VH-CDR2 ISYSGST (SEQ ID NO: 26)
VH-CDR3 ARGGDYYGSRPWFAY (SEQ ID NO: 28)
Light chain
VL-CDR1 TGAVTISNY (SEQ ID NO: 30)
VL-CDR2 GTN
VL-CDR3 ALWYSNHLV (SEQ ID NO: 32)
Example 7
Preparation of Human-IgG1 Chimeric KLHa505 Antibody (KLHa505HC Antibody)
From the hybridoma that produces the KLHa505 antibody, the KLHa505 antibody heavy chain variable region gene (nucleotide sequence: SEQ ID NO: 33, amino acid sequence: SEQ ID NO: 34) and light chain variable region gene (nucleotide sequence: SEQ ID NO: 35, amino acid sequence: SEQ ID NO: 36) were cloned. Next, these genes were each ligated in-frame to the nucleotide sequence of the human IgG1 heavy chain constant region gene or light chain (κ chain) constant region gene. PCR was carried out using a primer having the 5′-terminal nucleotide sequence of the heavy chain variable region, Kozak sequence, and a restriction enzyme Mlu I sequence and an antisense primer having a complementary sequence of the 3′-terminal nucleotide sequence and a restriction enzyme Nhe I sequence. Next, PCR was carried out using a primer having the 5′-terminal nucleotide sequence of the light chain variable region gene and a restriction enzyme BamH I sequence, and an antisense primer having a complementary sequence of the 3′-terminal nucleotide sequence and a restriction enzyme BsiW I sequence. The thus obtained amplification product was treated with restriction enzymes Mlu I and Nhe I or BamH I and BsiW I, and then the resultant was incorporated into the Mlu I-Nhe I site of the human IgG1 heavy chain constant region expression plasmid (pEF6/G1) or the BamH I-BsiW I site of the human Ig light chain (κ chain) constant region expression plasmid (pEF1/G1k). In pEF6/G1, the human IgG1 heavy chain constant region gene (nucleotide sequence: SEQ ID NO: 41, amino acid sequence: SEQ ID NO: 42) was cloned into the plasmid pEF6/myc-His (Invitrogen). In pEF1/G1-k, the human Ig light chain (κ chain) constant region gene (nucleotide sequence: SEQ ID NO: 43, amino acid sequence: SEQ ID NO: 44) was cloned into the plasmid pEF1/myc-His (Invitrogen). The mouse heavy chain variable region and the human heavy chain constant region were linked by a restriction enzyme Nhe I, and the mouse light chain variable region and the human light chain constant region were linked by a restriction enzyme BsiW I sequence.
The plasmids pEF6/G1-KLHa505 and pEF1/G1-K-KLHa505 were introduced into 293F cells using a FreeStyle™ 293 Expression System (Thermo Fisher Scientific K.K.), and thus the human IgG1 chimeric KLHa505 antibody (hereafter, may also be referred to as “KLHa505HC antibody”) was transiently expressed. Next, the KLHa505HC antibody was purified from a culture supernatant of 293F cells, into which the chimeric gene had been introduced, using Protein G Sepharose 4 Fast Flow (GE Healthcare Japan). A solvent was substituted with D-PBS (−) using an Amicon Ultra-15 centrifugal filter unit (Merck millipore). The concentration of the purified KLHa505HC antibody was determined using Nano drop 1000 (Thermo Fisher Scientific K.K.). Binding of the KLHa505HC antibody to VEGF was evaluated by the method described in the above “Purification of monoclonal antibody (4) ELISA”. As a result, specific binding of the KLHa505HC antibody to VEGF was confirmed.
That is, in this Example, the chimeric antibody of the high-affinity anti-VEGF antibody of the present invention was obtained.
Example 8
Preparation of Human-IgG1 Chimeric KLHb1501 Antibody (KLHb1501HC Antibody)
From hybridomas that produce the KLHb1501 antibody, the KLHb1501 antibody heavy chain variable region gene (nucleotide sequence: SEQ ID NO: 37, amino acid sequence: SEQ ID NO: 38) and light chain variable region gene (nucleotide sequence: SEQ ID NO: 39, amino acid sequence: SEQ ID NO: 40) were cloned. Next, these genes were each ligated in-frame to the nucleotide sequence of a human IgG1 heavy chain constant region gene or light chain (λ chain) constant region gene. PCR was carried out using a primer having the 5′ terminal nucleotide sequence of the heavy chain variable region, Kozak sequence, and a restriction enzyme Xho I sequence, and an antisense primer having the complementary sequence of the 3′ terminal nucleotide sequence and a restriction enzyme Nhe I sequence. Next, PCR was carried out using a primer having the 5′ terminal nucleotide sequence of the light chain variable region gene and a restriction enzyme EcoR I sequence, and an antisense primer having the complementary sequence of the 3′ terminal nucleotide sequence and a restriction enzyme Avr II sequence. The thus obtained amplification products were treated with restriction enzymes Xho I and Nhe I, or EcoR I and Avr II, and then incorporated into the Xho I-Nhe I site of a human IgG1 heavy chain constant region expression plasmid (pFUSE-CHIg-hG1; InvivoGen), or the EcoR I-Avr II site of a human Ig light chain (λ chain) constant region expression plasmid (pFUSE2ss-CLIg-hl2: InvivoGen). In pFUSE-CHIg-hG1, the human IgG1 heavy chain constant region gene (nucleotide sequence: SEQ ID NO: 41, amino acid sequence: SEQ ID NO: 42) was cloned. In pFUSE2ss-CLIg-hl2, the human Ig light chain (λ chain) constant region gene (nucleotide sequence: SEQ ID NO: 43, amino acid sequence: SEQ ID NO: 44) was cloned. The mouse heavy chain variable region and the human heavy chain constant region were linked by the restriction enzyme Nhe I, and the mouse light chain variable region and the human light chain constant region were linked by the restriction enzyme Avr II sequence.
Example 9
In Vivo Inhibiting Effect of Human IgG1 Chimeric KLHb1501 Antibody (KLHb1501HC Antibody) on Tumor Growth
Human colon cancer cell line LS174T cells were subcutaneously injected at a rate of 2×106 cells per mouse into the right flanks of the 20 immunodeficient mice. On the next day of injection, 0.9% NaCl (control group A) or KLHb1501HC antibody (control group B) was intraperitoneally administered. The KLHb1501HC antibody was administered to the mice of control group B twice a week at 0.5 mg/Kg, 2.5 mg/Kg, or 5 mg/Kg. Furthermore, similarly to the antibody, 0.9% NaCl was administered twice a week to the mice of control group A. On days 1, 5, 8, 12, 15, 19 and 22 after inoculation of cells, tumor sizes were measured, and then tumor volumes were calculated using the formula: V (mm3)=(d: minor axis)2×(D: major axis)/2. The results are shown in FIG. 5. In FIG. 5, group A (0.9% NaCl control) is indicated with (⋄), group B (mice injected with the anti-VEGF antibody) is indicated with (□: 0.5 mg/Kg), (Δ: 2.5 mg/Kg), or (◯: 5.0 mg/Kg). As shown in FIG. 5, significant decreases in tumor volume were observed in mice injected with the KLHb1501HC antibody. These results demonstrated that the KLHb1501HC antibody; that is an antibody of the present invention, inhibited (suppressed) the tumor growth even in vivo. This demonstrated that a pharmaceutical composition comprising the human IgG1 chimeric anti-VEGF antibody of the present invention is significantly effective for treatment or prevention of cancer.
Example 10
Preparation of Canine-IgGB Chimeric KLHa505 Antibody (KLHa505CC Antibody)
From the hybridoma that produces the KLHa505 antibody, the KLHa505 antibody heavy chain variable region gene (nucleotide sequence: SEQ ID NO: 33, amino acid sequence: SEQ ID NO: 34) and light chain variable region gene (nucleotide sequence: SEQ ID NO: 35, amino acid sequence: SEQ ID NO: 36) were cloned. Next, these genes were each ligated in-frame to the nucleotide sequence of the canine IgGB heavy chain constant region gene or light chain (κ chain) constant region gene. PCR was carried out using a primer having the 5′-terminal nucleotide sequence of the heavy chain variable region, Kozak sequence, and a restriction enzyme EcoR V sequence, and an antisense primer having a complementary sequence of the 3′-terminal nucleotide sequence and a restriction enzyme Nhe I sequence. Next, PCR was carried out using a primer having the 5′-terminal nucleotide sequence of the light chain variable region gene and a restriction enzyme EcoR I sequence, and an antisense primer having a complementary sequence of the 3′-terminal nucleotide sequence and a restriction enzyme Xho I sequence. The thus obtained amplification product was treated with restriction enzymes Eco V and Nhe I, or EcoR I and Xho I, and then the resultant was incorporated into the EcoR V-Nhe I site of a canine IgGB heavy chain constant region expression plasmid (pFUSE2ss-CHIg-dGB), or the EcoR I-Xho I site of a canine Ig light chain constant region expression plasmid (pFUSE2ss-CHIg-dK). In pFUSE2ss-CHIg-dGB, the canine IgGB heavy chain constant region gene (nucleotide sequence: SEQ ID NO: 45, amino acid sequence: SEQ ID NO: 46) was cloned into plasmid pFUSE2ss-CLIg-hl2 (InvivoGen). In pFUSE2ss-CHIg-dK, the canine Ig light chain (κ chain) constant region gene (nucleotide sequence: SEQ ID NO: 47, amino acid sequence: SEQ ID NO: 48) was cloned into plasmid pFUSE2ss-CLIg-hl2. The mouse heavy chain variable region and the canine heavy chain constant region were linked by the restriction enzyme Nhe I sequence, and the mouse light chain variable region and the canine light chain constant region were linked by the restriction enzyme Xho I sequence.
Example 11
Preparation of Canine-IgGB Chimeric KLHb1501 Antibody (KLHb1501CC Antibody)
From hybridomas that produce the KLHb1501 antibody, the KLHb1501 antibody heavy chain variable region gene (nucleotide sequence: SEQ ID NO: 37, amino acid sequence: SEQ ID NO: 38) and light chain variable region gene (nucleotide sequence: SEQ ID NO: 39, amino acid sequence: SEQ ID NO: 40) were cloned. Next, these genes were each ligated in-frame to the nucleotide sequence of a canine IgGB heavy chain constant region gene or light chain (λ chain) constant region gene. PCR was carried out using a primer having the 5′ terminal nucleotide sequence of the heavy chain variable region, Kozak sequence, and a restriction enzyme EcoR V sequence, and an antisense primer having the complementary sequence of the 3′ terminal nucleotide sequence and a restriction enzyme Nhe I sequence. Next, PCR was carried out using a primer having the 5′ terminal nucleotide sequence of the light chain variable region gene and a restriction enzyme EcoR I sequence and an antisense primer having the complementary sequence of the 3′ terminal nucleotide sequence and a restriction enzyme Sca I sequence. The thus obtained amplification products were treated with restriction enzymes Eco V and Nhe I, or EcoR I and Sca I, and then incorporated into the EcoR V-Nhe I site of a canine IgGB heavy chain constant region expression plasmid (pFUSE2ss-CHIg-dGB) or the EcoR I-Sca I site of a canine Ig light chain constant region expression plasmid (pFUSE2ss-CHIg-dK). In pFUSE2ss-CHIg-dGB, the canine IgGB heavy chain constant region gene (nucleotide sequence: SEQ ID NO: 45, amino acid sequence: SEQ ID NO: 46) was cloned to plasmid pFUSE2ss-CLIg-hl2 (InvivoGen). In pFUSE2ss-CHIg-dK, the canine Ig light chain (λ chain) constant region gene (nucleotide sequence: SEQ ID NO: 49, amino acid sequence: SEQ ID NO: 50) was cloned into plasmid pFUSE2ss-CLIg-hl2. The mouse heavy chain variable region and the canine heavy chain constant region were linked by the restriction enzyme Nhe I, and the mouse light chain variable region and the canine light chain constant region were linked by the restriction enzyme Sca I sequence.
Example 12
Cross-Reactivity of Canine-IgGB Chimeric KLHb1501 Antibody (KLHb1501CC Antibody) to Human VEGF165 and Canine VEGFA
Whether or not the thus prepared canine-IgGB chimeric antibody had capability of binding to human VEGF165 and canine VEGFA (VEGF164) was confirmed by ELISA. Human VEGF165 or canine VEGFA were diluted with TBS, dispensed to a 96-well ELISA plate (Nunc) at 20 ng per well, and then incubated at 37° C. for 1 hour for binding to the plate surface. Next, after 3 times of washing with 300 μL of 0.02% Tween 20-containing PBS (−) (hereafter, denoted as “PBS-T”), 300 μL of 3% skim milk-containing PBS (−) was dispensed into each well, followed by blocking at 37° C. for 1 hour. After washing with PBS-T, the canine-IgGB chimeric KLHb1501 antibody (KLHb1501CC antibody) serially diluted from the concentration of 1 μg/ml was dispensed to an ELISA plate to which VEGF had been immobilized, and then allowed to react at 37° C. for 1 hour. After washing with PBS-T, a peroxidase-labeled anti-canine immunoglobulin antibody (BETHYL) prepared to have a concentration of 100 ng/ml was dispensed at 100 μL per well, and then allowed to react at 37° C. for 1 hour. After washing similarly, TMB Single Solution was added for color development at room temperature. After the reaction was stopped with 1 N sulfuric acid, absorbance at 450 nm was measured using a plate reader (Molecular Devices). The results are shown in FIG. 6. It was demonstrated that the KLHb1501CC antibody binds to canine VEGFA with the same degree of affinity as that to human VEGF165.
These results demonstrated that a pharmaceutical composition comprising the canine IgGB chimeric anti-VEGF antibody of the present invention can be used for treatment or prevention of diseases of dogs.
Example 13
In Vivo Inhibiting Effect of Canine IgGB Chimeric KLHb1501 Antibody (KLHb1501CC Antibody) on Tumor Growth in Human Cancer Cell Line
Human colon cancer cell line LS174T cells were subcutaneously injected at a rate of 2×106 cells per mouse to the right flanks of 20 immunodeficient mice. On the next day of injection, 0.9% NaCl (control group A) or the KLHb1501CC antibody (control group B) was administered intraperitoneally. The KLHb1501CC antibody was administered twice a week to the mice of control group B at 0.5 mg/Kg, 2.5 mg/Kg, or 5 mg/Kg. Furthermore, similarly to the antibody, 0.9% NaCl was administered twice a week to the mice of control group A. On days 5, 8, 12, 15, 19 and 22 after inoculation of cells, tumor sizes were measured and tumor volumes were calculated using the formula: V (mm3)=(d: minor axis)2×(D: major axis)/2. The results are shown in FIG. 7. In FIG. 7, group A (0.9% NaCl control) is indicated with (▪), group B (mice injected with the anti-VEGF antibody) is indicated with (●: 0.5 mg/Kg), (▴: 2.5 mg/Kg), or (A: 5.0 mg/Kg). As shown in FIG. 7, significant decreases in tumor volume were observed in mice injected with the KLHb1501CC antibody.
These results demonstrated that the KLHb1501CC antibody of the present invention also inhibits (suppresses) in vivo the growth of human tumors. These results also demonstrated that a pharmaceutical composition comprising the canine IgGB chimeric anti-VEGF antibody of the present invention is significantly effective for treatment or prevention of cancer.
Example 14
In Vivo Inhibiting Effect of Canine IgGB Chimeric KLHb1501 Antibody (KLHb1501CC Antibody) on Tumor Growth in Canine Cancer Cell Line
Canine bone sarcoma cell line D-17 cells were subcutaneously injected at a rate of 1×107 cells per mouse to the right flanks of 20 immunodeficient mice. After the mean tumor volume reached 150 mm3, 0.9% NaCl (control group A) or the KLHb1501CC antibody (control group B) was intraperitoneally administered. The KLHb1501CC antibody was administered twice a week to the mice of control group B at 0.5 mg/Kg, 2.5 mg/Kg, or 5 mg/Kg. Similarly to the antibody, 0.9% NaCl was administered twice a week to the mice of control group A. On days 50, 54, 57, 61, 64, 67, 70, 74, 77 and 81 after inoculation of cells, tumor sizes were measured, and the tumor volumes were calculated using the formula: V (mm3)=(d: minor axis)2×(D: major axis)/2. The results are shown in FIG. 8. In FIG. 8, group A (0.9% NaCl control) is indicated with (▪), and group B (mice injected with the anti-VEGF antibody) is indicated with (●: 0.5 mg/Kg), (▴: 2.5 mg/Kg), or (Δ: 5.0 mg/Kg). As shown in FIG. 8, significant decreases in tumor volume were observed in mice injected with the KLHb1501CC antibody.
These results demonstrated that the KLHb1501CC antibody of the present invention inhibits (suppresses) the growth of tumors of dogs even in vivo. These results also demonstrated that a pharmaceutical composition comprising the canine IgGB chimeric anti-VEGF antibody of the present invention is significantly effective for treatment or prevention of cancer of dogs.
Example 15
Examination of the Antigen Binding Site of the Antibody of the Present Invention
To examine the binding site of the antibody of the present invention in VEGF, a binding experiment based on the ELISA method was conducted as follows.
In this Example, as anti-VEGF antibodies, three anti-VEGF antibodies including KLHa505HC and KLHb1501HC obtained in Examples 7 and 8 were used.
Furthermore, as VEGF, three types of VEGF, (i) VEGF165 containing exon 8a that is the C-terminal region of VEGF, (ii) VEGF121 lacking heparin binding region, and (iii) VEGF165b having an amino acid sequence (exon 8b) differing from the C-terminal region of VEGF165 were used.
The binding experiment was specifically conducted as follows.
Human VEGF165 (consisting of exon 1, 2, 3, 4, 5, 7 and 8a), human VEGF165b (consisting of exon 1, 2, 3, 4, 5, 7 and 8b) or human VEGF121 (consisting of exon 1, 2, 3, 4, 5 and 8a) was diluted with TBS, dispensed to a 96-well ELISA plate (Nunc) at 20 ng per well, and then incubated at 37° C. for 1 hour, for binding onto the plate surface. Next, after 3 times of washing with 300 μL of 0.02% Tween 20-containing PBS (−) (hereafter, denoted as “PBS-T”), 300 μL of 3% skim milk-containing PBS (−) was dispensed to each well, followed by blocking at 37° C. for 1 hour. After washing with PBS-T, the KLHa505HC antibody or KLHb1501HC antibody serially diluted from the concentration of 1 μg/ml was dispensed to an ELISA plate to which VEGF had been immobilized, and then allowed to react at 37° C. for 1 hour. After washing with PBS-T, a peroxidase-labeled anti-human immunoglobulin antibody (BETHYL) prepared to have a concentration of 100 ng/ml was dispensed at 100 μL per well, and then allowed to react at 37° C. for 1 hour. After washing similarly, TMB Single Solution was added for color development at room temperature. After the reaction was stopped with 1 N sulfuric acid, absorbance at 450 nm was measured using a plate reader (Molecular Devices).
As a result, all of the three anti-VEGF antibodies including KLHa505HC and KLHb1501HC that is the anti-VEGF antibody of the present invention were found to bind to all of VEGF165, VEGF121 and VEGF165b above (FIG. 9, 10).
The result demonstrates that the antibody of the present invention binds to exon 1 to 5 regions of VEGF.
INDUSTRIAL APPLICABILITY
According to the present invention, novel antibodies capable of binding to VEGF with significantly high affinity compared to the prior art can be provided.
SEQUENCE LISTING FREE TEXT
SEQ ID NO: 13: synthetic DNA
SEQ ID NO: 14: synthetic peptide
SEQ ID NO: 15: synthetic DNA
SEQ ID NO: 16: synthetic peptide
SEQ ID NO: 17: synthetic DNA
SEQ ID NO: 18: synthetic peptide
SEQ ID NO: 19: synthetic DNA
SEQ ID NO: 20: synthetic peptide
SEQ ID NO: 21: synthetic DNA
SEQ ID NO: 22: synthetic peptide
SEQ ID NO: 23: synthetic DNA
SEQ ID NO: 24: synthetic peptide
SEQ ID NO: 25: synthetic DNA
SEQ ID NO: 26: synthetic peptide
SEQ ID NO: 27: synthetic DNA
SEQ ID NO: 28: synthetic peptide
SEQ ID NO: 29: synthetic DNA
SEQ ID NO: 30: synthetic peptide
SEQ ID NO: 31: synthetic DNA
SEQ ID NO: 32: synthetic peptide
SEQ ID NO: 33: synthetic DNA
SEQ ID NO: 34: synthetic peptide
SEQ ID NO: 35: synthetic DNA
SEQ ID NO: 36: synthetic peptide
SEQ ID NO: 37: synthetic DNA
SEQ ID NO: 38: synthetic peptide
SEQ ID NO: 39: synthetic DNA
SEQ ID NO: 40: synthetic peptide
SEQ ID NO: 41: synthetic DNA
SEQ ID NO: 42: synthetic peptide
SEQ ID NO: 43: synthetic DNA
SEQ ID NO: 44: synthetic peptide
SEQ ID NO: 45: synthetic DNA
SEQ ID NO: 46: synthetic peptide
SEQ ID NO: 47: synthetic DNA
SEQ ID NO: 48: synthetic peptide
SEQ ID NO: 49: synthetic DNA
SEQ ID NO: 50-54: synthetic peptide

Claims (21)

The invention claimed is:
1. A monoclonal antibody against VEGF, or an antigen-binding fragment thereof, that binds to a vascular endothelial growth factor (VEGF), comprising:
CDR-H1 that comprises the amino acid sequence of SEQ ID NO: 24, CDR-H2 that comprises the amino acid sequence of SEQ ID NO: 26, and CDR-H3 that comprises the amino acid sequence of SEQ ID NO: 28; and CDR-L1 that comprises the amino acid sequence of SEQ ID NO: 30, CDR-L2 that comprises the amino acid sequence of Gly-Thr-Asn, and CDR-L3 that comprises the amino acid sequence of SEQ ID NO: 32.
2. The monoclonal antibody, or the antigen-binding fragment thereof, according to claim 1, wherein the monoclonal antibody inhibits binding of a vascular endothelial growth factor (VEGF) to at least one receptor selected from the group consisting of vascular endothelial growth factor receptor-1 (VEGFR1) and vascular endothelial growth factor receptor-2 (VEGFR2).
3. The monoclonal antibody, or the antigen-binding fragment thereof, according to claim 1, wherein the monoclonal antibody is a chimeric antibody, a humanized antibody, or a caninized antibody.
4. The antibody, or the antigen-binding fragment thereof, according to claim 1, further comprising a heavy chain constant region comprising an amino acid sequence derived from a human IgG1 heavy chain constant region and a light chain constant region comprising an amino acid sequence derived from a human IgG1 light chain constant region.
5. The antibody, or the antigen-binding fragment thereof, according to claim 4, wherein the amino acid sequence derived from a human IgG1 heavy chain constant region comprises the amino acid sequence of SEQ ID NO: 42, and the amino acid sequence derived from a human IgG1 light chain constant region comprises the amino acid sequence of SEQ ID NO: 44.
6. The antibody, or the antigen-binding fragment thereof, according to claim 5, comprising:
a heavy chain that comprises the amino acid sequence of SEQ ID NO: 38, and the amino acid sequence of SEQ ID NO: 42; and
a light chain that comprises the amino acid sequence of SEQ ID NO: 40, and the amino acid sequence of SEQ ID NO: 44.
7. The antibody, or the antigen-binding fragment thereof, according to claim 1, further comprising a heavy chain constant region comprising an amino acid sequence derived from a canine IgGB heavy chain constant region and a light chain constant region comprising an amino acid sequence derived from a canine Ig light chain (κ chain) constant region or a canine Ig light chain (λ chain) constant region.
8. The antibody, or the antigen-binding fragment thereof, according to claim 7, wherein an amino acid sequence derived from a canine IgGB heavy chain constant region comprises the amino acid sequence of SEQ ID NO: 46, an amino acid sequence derived from a canine Ig light chain (κ chain) constant region comprises the amino acid sequence of SEQ ID NO: 48, and an amino acid sequence derived from a canine Ig light chain (λ chain) constant region comprises the amino acid sequence of SEQ ID NO: 50.
9. The antibody, or the antigen-binding fragment thereof, according to claim 8, comprising:
a heavy chain that comprises the amino acid sequence of SEQ ID NO: 38 and the amino acid sequence of SEQ ID NO: 46; and
a light chain that comprises the amino acid sequence of SEQ ID NO: 40 and the amino acid sequence of SEQ ID NO: 48 or 50.
10. The antigen-binding fragment according to claim 1, wherein the antigen-binding fragment is a single-chain antibody or a double-chain antibody.
11. A hybridoma that produces the monoclonal antibody according to claim 1.
12. A pharmaceutical composition comprising the monoclonal antibody, or the antigen-binging fragment thereof, according to claim 1; and a pharmaceutically acceptable carrier.
13. A kit comprising the monoclonal antibody, or the antigen-binding fragment thereof, according to claim 1; and a buffer, an enzyme solution, a secondary antibody, a solution for dilution, and/or instructions.
14. A method for treating a VEGF-mediated cancer or a VEGF-mediated eye disease in a subject in need thereof, comprising a step of administering a therapeutically effective amount of the antibody, or the antigen-binding fragment thereof, according to claim 1 to the subject.
15. The method according to claim 14, wherein the therapeutically effective amount inhibits angiogenesis or vascular hyperpermeability.
16. The method according to claim 15, wherein the angiogenesis is pathological angiogenesis.
17. The method according to claim 14, wherein the cancer is a solid cancer.
18. The method according to claim 14, wherein the cancer is selected from the group consisting of colorectal cancer, rectal cancer, breast cancer, non-small-cell lung cancer, non-Hodgkin's lymphoma (NHL), renal cell cancer, prostate cancer, liver cancer, pancreas cancer, soft tissue sarcoma, Kaposi's sarcoma, carcinoid tumor, head and neck cancer, melanoma, ovarian cancer, and mesothelioma.
19. The method according to claim 14, wherein the VEGF-mediated eye disease is at least one selected from age-related macular degeneration, diabetic retinopathy, diabetic macular edema, neovascular glaucoma, retinal vein occlusion, retinopathy of prematurity, choroidal neovascularization associated with pathological myopia, pterygium, rubeosis, pannus, Stevens-Johnson syndrome, and an immunological rejection in a transplanted tissue of the eye.
20. The monoclonal antibody, or an antigen-binding fragment thereof, of claim 1, comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain comprising the amino acid sequence of SEQ ID NO: 40.
21. The monoclonal antibody, or an antigen-binding fragment thereof, of claim 20, wherein the antibody, or antigen-binding fragment thereof, binds to the vascular endothelial growth factor (VEGF) with a dissociation constant of 1×10−11 mol/L or less.
US16/067,931 2016-01-06 2017-01-05 High-affinity anti-VEGF antibody Active 2037-06-23 US11007259B2 (en)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
JP2016001277 2016-01-06
JPJP2016-001277 2016-01-06
JP2016-001277 2016-01-25
PCT/JP2017/000101 WO2017119435A1 (en) 2016-01-06 2017-01-05 High-affinity anti-vegf antibody

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/JP2017/000101 A-371-Of-International WO2017119435A1 (en) 2016-01-06 2017-01-05 High-affinity anti-vegf antibody

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/229,271 Continuation US11872271B2 (en) 2016-01-06 2021-04-13 High-affinity anti-VEGF antibody KLHa505

Publications (2)

Publication Number Publication Date
US20200165330A1 US20200165330A1 (en) 2020-05-28
US11007259B2 true US11007259B2 (en) 2021-05-18

Family

ID=59273696

Family Applications (2)

Application Number Title Priority Date Filing Date
US16/067,931 Active 2037-06-23 US11007259B2 (en) 2016-01-06 2017-01-05 High-affinity anti-VEGF antibody
US17/229,271 Active 2037-02-05 US11872271B2 (en) 2016-01-06 2021-04-13 High-affinity anti-VEGF antibody KLHa505

Family Applications After (1)

Application Number Title Priority Date Filing Date
US17/229,271 Active 2037-02-05 US11872271B2 (en) 2016-01-06 2021-04-13 High-affinity anti-VEGF antibody KLHa505

Country Status (6)

Country Link
US (2) US11007259B2 (en)
EP (1) EP3401331B1 (en)
JP (2) JP6910963B2 (en)
KR (1) KR102293755B1 (en)
CN (1) CN108699141B (en)
WO (1) WO2017119435A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
USD1116103S1 (en) 2019-06-05 2026-03-03 Regeneron Pharmaceuticals, Inc. Dose delivery device
USD1120314S1 (en) 2022-11-30 2026-03-24 Regeneron Pharmaceuticals, Inc. Dose delivery device

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9840553B2 (en) 2014-06-28 2017-12-12 Kodiak Sciences Inc. Dual PDGF/VEGF antagonists
KR20250057128A (en) 2015-12-30 2025-04-28 코디악 사이언시스 인코포레이티드 Antibodies and conjugates thereof
EP3758737A4 (en) 2018-03-02 2022-10-12 Kodiak Sciences Inc. ANTI-IL-6 ANTIBODIES AND RELATED FUSION CONSTRUCTS AND CONJUGATES
CN110031616B (en) * 2019-04-03 2020-07-28 浙江众意生物科技有限公司 Detection kit for auxiliary diagnosis of diseases
JP2022534406A (en) * 2019-05-27 2022-07-29 ザ ユニヴァーシティ オブ ブリティッシュ コロンビア Conformation-Specific Epitopes of Tau, Antibodies Against Them, and Related Methods
CA3147921C (en) 2019-07-19 2023-02-21 Sinocelltech Ltd. Humanized anti-vegf monoclonal antibody
ES3050609T3 (en) * 2019-07-19 2025-12-22 Sinocelltech Ltd Humanized anti-vegf fab antibody fragment and use thereof
CA3157509A1 (en) 2019-10-10 2021-04-15 Kodiak Sciences Inc. Methods of treating an eye disorder
CN110845605B (en) * 2019-12-23 2023-04-14 长春工业大学 A kind of genetically engineered antibody against canine parvovirus and its application
WO2023206134A1 (en) * 2022-04-27 2023-11-02 Beijing Sightnovo Medical Technology Co., Ltd Compositions and methods for eye diseases
CN117820474A (en) * 2023-04-25 2024-04-05 南京贝思奥生物科技有限公司 Drugs for improving ocular angiogenesis-related diseases and their applications

Citations (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0419858A1 (en) 1989-08-25 1991-04-03 Juridical Foundation The Chemo-Sero-Therapeutic Research Institute Dog-mouse heterohybridoma and gene fragment coding for constant region of canine immunoglobulins
US20020119153A1 (en) 1999-04-28 2002-08-29 Board Of Regents,The University Of Texas System Antibody conjugate formulations for selectively inhibiting VEGF
US20050106667A1 (en) 2003-08-01 2005-05-19 Genentech, Inc Binding polypeptides with restricted diversity sequences
WO2007047626A1 (en) 2005-10-14 2007-04-26 Alcon, Inc. Combination treatment with anecortave acetate and bevacizumab or ranibizumab for pathologic ocular angiogenesis
US20080213268A1 (en) 2005-11-08 2008-09-04 Watts Ryan J Neuropilin antagonists
US20100061988A1 (en) 2008-09-04 2010-03-11 Hansen Genevieve Monoclonal antibodies
US20100111967A1 (en) 2008-10-08 2010-05-06 Monika Baehner Bispecific anti-vegf/anti-ang-2 antibodies
US20100150919A1 (en) 2007-05-17 2010-06-17 Appleton Brent A Crystal structures of neuropilin fragments and neuropilin-antibody complexes
JP2011500086A (en) 2007-10-22 2011-01-06 シェーリング コーポレイション Fully human anti-VEGF antibodies and methods of use
JP2011525359A (en) 2008-06-25 2011-09-22 エスバテック、アン アルコン バイオメディカル リサーチ ユニット、エルエルシー Stable and soluble antibody that inhibits VEGF
US20120231011A1 (en) 2009-08-28 2012-09-13 Apexigen Inc. Anti-vegf monoclonal antibody and pharmaceutical composition comprising said antibody
US20140170137A1 (en) 2011-05-06 2014-06-19 Nvip Pty Ltd Therapeutic canine immunoglobulins and methods of using same
JP2014516026A (en) 2011-05-06 2014-07-07 エヌヴィーアイピー プロプライエタリー リミテッド Therapeutic canine immunoglobulin and method of using the same
WO2014193191A1 (en) 2013-05-31 2014-12-04 동아쏘시오홀딩스 주식회사 Anti-vegf antibody, and pharmaceutical composition for preventing, diagnosing or treating cancer or angiogenesis-related diseases, containing same
US20150315270A1 (en) 2014-05-01 2015-11-05 Alberto BALDI Anti-human vegf antibodies with unusually strong binding afinity to human vegf-a and cross reactivity to human vegf-b
WO2016205427A2 (en) 2015-06-15 2016-12-22 Abbvie Inc. Binding proteins against vegf, pdgf, and/or their receptors

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2004261899A1 (en) 2003-08-01 2005-02-10 Norimasa Nakamura Scaffold-free self-organized 3D synthetic tissue

Patent Citations (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0419858A1 (en) 1989-08-25 1991-04-03 Juridical Foundation The Chemo-Sero-Therapeutic Research Institute Dog-mouse heterohybridoma and gene fragment coding for constant region of canine immunoglobulins
US20020119153A1 (en) 1999-04-28 2002-08-29 Board Of Regents,The University Of Texas System Antibody conjugate formulations for selectively inhibiting VEGF
JP2002543093A (en) 1999-04-28 2002-12-17 ボード オブ リージェンツ, ザ ユニバーシティ オブ テキサス システム Compositions and methods for treating cancer by selective inhibition of VEGF
US20050106667A1 (en) 2003-08-01 2005-05-19 Genentech, Inc Binding polypeptides with restricted diversity sequences
JP2007526756A (en) 2003-08-01 2007-09-20 ジェネンテック・インコーポレーテッド Anti-VEGF antibody
WO2007047626A1 (en) 2005-10-14 2007-04-26 Alcon, Inc. Combination treatment with anecortave acetate and bevacizumab or ranibizumab for pathologic ocular angiogenesis
US20080213268A1 (en) 2005-11-08 2008-09-04 Watts Ryan J Neuropilin antagonists
JP2011256183A (en) 2005-11-08 2011-12-22 Genentech Inc Neuropilin antagonist
US20100150919A1 (en) 2007-05-17 2010-06-17 Appleton Brent A Crystal structures of neuropilin fragments and neuropilin-antibody complexes
JP2010530359A (en) 2007-05-17 2010-09-09 ジェネンテック, インコーポレイテッド Crystal structures of neuropilin fragments and neuropilin-antibody complexes
JP2011500086A (en) 2007-10-22 2011-01-06 シェーリング コーポレイション Fully human anti-VEGF antibodies and methods of use
US20110097340A1 (en) 2007-10-22 2011-04-28 Sumant Ramachandra Fully human anti-vegf antibodies and methods of using
US20120014958A1 (en) 2008-06-25 2012-01-19 Esbatech, An Alcon Biomedical Research Unit Llc Stable and soluble antibodies inhibiting vegf
JP2011525359A (en) 2008-06-25 2011-09-22 エスバテック、アン アルコン バイオメディカル リサーチ ユニット、エルエルシー Stable and soluble antibody that inhibits VEGF
US20100061988A1 (en) 2008-09-04 2010-03-11 Hansen Genevieve Monoclonal antibodies
US20100111967A1 (en) 2008-10-08 2010-05-06 Monika Baehner Bispecific anti-vegf/anti-ang-2 antibodies
JP2012504943A (en) 2008-10-08 2012-03-01 エフ.ホフマン−ラ ロシュ アーゲー Bispecific anti-VEGF / anti-ANG-2 antibody
US20120231011A1 (en) 2009-08-28 2012-09-13 Apexigen Inc. Anti-vegf monoclonal antibody and pharmaceutical composition comprising said antibody
JP2013502445A (en) 2009-08-28 2013-01-24 チャンスー シムサー ファーマシューティカル アールアンドディー カンパニー リミテッド Anti-VEGF monoclonal antibody and pharmaceutical composition containing the antibody
US20140170137A1 (en) 2011-05-06 2014-06-19 Nvip Pty Ltd Therapeutic canine immunoglobulins and methods of using same
JP2014516026A (en) 2011-05-06 2014-07-07 エヌヴィーアイピー プロプライエタリー リミテッド Therapeutic canine immunoglobulin and method of using the same
WO2014193191A1 (en) 2013-05-31 2014-12-04 동아쏘시오홀딩스 주식회사 Anti-vegf antibody, and pharmaceutical composition for preventing, diagnosing or treating cancer or angiogenesis-related diseases, containing same
EP3006465A1 (en) 2013-05-31 2016-04-13 Dong-A Socio Holdings Co., Ltd. Anti-vegf antibody, and pharmaceutical composition for preventing, diagnosing or treating cancer or angiogenesis-related diseases, containing same
US20160122426A1 (en) 2013-05-31 2016-05-05 Dong-A Socio Holdings Co., Ltd. Anti-vegf antibody, and pharmaceutical composition for preventing, diagnosing or treating cancer or angiogenesis-related diseases, containing same
US20150315270A1 (en) 2014-05-01 2015-11-05 Alberto BALDI Anti-human vegf antibodies with unusually strong binding afinity to human vegf-a and cross reactivity to human vegf-b
WO2015166112A1 (en) 2014-05-01 2015-11-05 Consejo Nacional De Investigaciones Científicas Y Técnicas (Conicet) Anti-human vegf antibodies with unusually strong binding afinity to human vegf-a and cross reactivity to human vegf-b
WO2016205427A2 (en) 2015-06-15 2016-12-22 Abbvie Inc. Binding proteins against vegf, pdgf, and/or their receptors
US20170015742A1 (en) 2015-06-15 2017-01-19 Abbvie Inc. Binding proteins against vegf, pdgf, and/or their receptors

Non-Patent Citations (24)

* Cited by examiner, † Cited by third party
Title
Beck et al., "A Vascular niche and a VEGF-Nrpl loop regulate the initiation and stemness of skin tumours", Nature, vol. 478, Oct. 20, 2011, pp. 399-403 (7 pages).
Carmeliet et al., "Common Mechanisms of nerve and blood vessel wiring," Nature, vol. 436, No. 14, Jul. 2005, pp. 193-200 (8 pages).
Doi et al., "S7-5 Clinical Applications of Molecular Target Inhibitors Through VEGF/VEGFR ( Focusing on Antibody Medicine", The 45th Congress of Japan Society for Cancer Therapy, vol. 42, No. 2, Sep. 20, 2007, pp. 249 with abstract.
Extended European Search Report dated Aug. 13, 2019 for European Application No. 17735972.6; European Patent Office, Munich, Germany; Ulbrecht, Matthias; pp. 2-9 (10 pages total).
Extended European Search Report dated Aug. 19, 2019 for European Application No. 17735971.8; European Patent Office, Munich, Germany; Chapman, Rob; pp. 2-8 (10 pages total).
Ferrara et al., "The Biology of Vascular Endothelial Growth Factor," Endocrine Reviews, vol. 18, No. 1, Feb. 1997, pp. 4-25 (22 pages).
Graziani et al, "Neuropilin-1 as therapeutic target for malignant melanoma", Frontiers in Oncology, vol. 5, Article 125, Jun. 2015, pp. 1-9 (9 pages).
Harper et al., "VEGF-A Splicing: the key to anti-angiogenic therapeutics", Nat Rev Cancer. Author Manuscript, vol. 8, No. 11, Nov. 2008, pp. 880-887 (17 pages).
Heskamp et al., "Bevacizumab reduces tumor targeting of antiepidermal growth factor and anti-insulin growth factor 1 receptor antibodies", Int. J. Cancer, vol. 133, 2013, pp. 307-314 (8 pages).
Jones et al., "Separating genetic and hemodynamic defects in neuropilin 1 knockout embryos", Development, vol. 135, 2008, pp. 2479-2488 (10 pages).
Keyt et al., "Identification of Vascular Endothelial Growth Factor Determinants for Binding KDR and FLT-1 Receptors", The Journal of Biological Chemistry, vol. 271, No. 10, 1996, pp. 5638-5646 (10 pages).
Khadidja-Tehami et al., "Production of polyclonal anti VEGF antibodies and establishment of sELISA system for detection of serum VEGF level in tumor patients", Journal of Chemical and Pharmaceutical Research, vol. 7, No. 6, 2015, pp. 672-679 (8 pages).
Marti et al., "Angioenesis in Ischemic Disease" Thromb Haemost, vol. 82, 1999, pp. 44-52 ( 9 pages).
Matsumoto et al., "VEGF Receptor Signal Transduction", Science's stke, URL: www.stke.org/cgi/content/full/OC_sigtrans;2001/112/re21, 2011, pp. 1-17 (17 pages).
Pan et al., "Blocking Neuropilin-1 Funtion Has an Additve Effect with Anti-VEGF to Inhibit Tumor Growth" Cancer Cell, vol. 11, Jan. 2007, pp. 53-67 ( 15 pages).
Parker et al., "Structural Basis for Selective Vascular Endothelial Growth Factor-A (VEGF-A) Binding to Neuropilin-1", The Journal of Biological Chemistry, vol. 287, No. 14, Mar. 30, 2012, pp. 11082-11089 (8 pages).
Schlaeppi et al, "Characterization of a new potent, in vivo neutralizing monoclonal antibody to human vascular endothelial growth factor", J. Cancer Res Clin Oncol, vol. 125, 1999, pp. 336-342 ( 7 pages).
Sela-Culang et al. Fron. Immunol. 4(302): 1-13, 2013. *
Soker et al., "Neuropilin-1 is Expressed by Endothelial and Tumor Cells as an Isoform-Specifc Receptor and Vascular Endothelial Growth Factor", Cell, vol. 92, Mar. 20, 1998, pp. 735-745 (11 pages).
Stewart, "Aflibercept as a Treatment for Age-Related Macular Degeneration", US Opthalimic Rev. vol. 6, 2013, pp. 58-63 ( 6 pages).
Sullivan et al, "r84, a Novel Therapeutic Antibody against Mouse and Human VEGF with Potent Anti-Tumor Activity and Limited Toxicity Induction" Plos One, vol. 5, Issue 8, Aug. 2010, pp. 1-13 (13 pages).
Translated International Search Report dated Apr. 11, 2017 for International Application No. PCT/JP2017/000101; Japan Patent Office; Tokyo, Japan; pp. 1-2 (3 pages total).
Tugues et al, "Vascular endothelial growth factors and receptors: Anti-angiogenic therapy in the treatment of cancer", Molecular Aspects of Medicine. vol. 32, 2011, pp. 88-111 (24 pages).
Yu et al, "A Humanized Anti-VEGF Rabbit Monoclonal Antibody Inhibits Angiogenesis and Blocks Tumor Growth in Xenograft Models", PloS ONE, vol. 5, Issue 2, Feb. 2010, pp. 1-12 (12 pages).

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
USD1116103S1 (en) 2019-06-05 2026-03-03 Regeneron Pharmaceuticals, Inc. Dose delivery device
USD1120314S1 (en) 2022-11-30 2026-03-24 Regeneron Pharmaceuticals, Inc. Dose delivery device

Also Published As

Publication number Publication date
JP2021169475A (en) 2021-10-28
US20210228700A1 (en) 2021-07-29
JP6910963B2 (en) 2021-07-28
JPWO2017119435A1 (en) 2018-10-25
US20200165330A1 (en) 2020-05-28
CN108699141B (en) 2022-06-17
CN108699141A (en) 2018-10-23
KR102293755B1 (en) 2021-08-24
US11872271B2 (en) 2024-01-16
WO2017119435A1 (en) 2017-07-13
JP7273110B2 (en) 2023-05-12
EP3401331B1 (en) 2022-04-06
EP3401331A4 (en) 2019-09-11
EP3401331A1 (en) 2018-11-14
KR20180132038A (en) 2018-12-11

Similar Documents

Publication Publication Date Title
US11872271B2 (en) High-affinity anti-VEGF antibody KLHa505
US11008387B2 (en) Antibody inhibiting binding of VEGF to NRP1
JP2024125370A (en) Claudin 18.2 binding moieties and uses thereof
JP5667067B2 (en) Anti-TGF beta receptor II antibody
JP2012508170A5 (en)
KR20220082007A (en) Antibodies to poliovirus receptor (PVR) and uses thereof
TW202317639A (en) Anti-human CD3 antibody and use thereof
WO2023235703A1 (en) Therapeutic methods using ilt-binding agents
CN110343178B (en) Anti-human LAG-3 monoclonal antibody and application thereof
WO2023236991A1 (en) Trispecific antibody targeting her2, pd-l1 and vegf
CA3229250A1 (en) Anti-vegf a and vegf c bispecific antibodies and use thereof
JP2023519620A (en) Antigen-binding polypeptide that binds to CD47 and uses
RU2809746C2 (en) Humanized anti-vegf monoclonal antibody
WO2024078558A1 (en) Anti-cd100 antibody and use thereof
HK40073145B (en) Antibodies against the poliovirus receptor (pvr) and uses thereof
HK40080952A (en) Antigen-binding polypeptide binding to cd47, and use thereof
HK1261619B (en) Antibody inhibiting binding between vegf and nrp1
HK1261618B (en) High-affinity anti-vegf antibody
HK1261618A1 (en) High-affinity anti-vegf antibody
HK1261619A1 (en) Antibody inhibiting binding between vegf and nrp1

Legal Events

Date Code Title Description
FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

AS Assignment

Owner name: SANTEN PHARMACEUTICAL CO., LTD., JAPAN

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:MURAKAMI, YASUFUMI;MUKOUBATA, SHIGEKI;AKIYAMA, HIROTADA;AND OTHERS;SIGNING DATES FROM 20180808 TO 20180824;REEL/FRAME:046898/0941

Owner name: ORDER-MADE MEDICAL RESEARCH INC., JAPAN

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:MURAKAMI, YASUFUMI;MUKOUBATA, SHIGEKI;AKIYAMA, HIROTADA;AND OTHERS;SIGNING DATES FROM 20180808 TO 20180824;REEL/FRAME:046898/0941

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED

STCF Information on status: patent grant

Free format text: PATENTED CASE

MAFP Maintenance fee payment

Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1551); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

Year of fee payment: 4