US11007259B2 - High-affinity anti-VEGF antibody - Google Patents
High-affinity anti-VEGF antibody Download PDFInfo
- Publication number
- US11007259B2 US11007259B2 US16/067,931 US201716067931A US11007259B2 US 11007259 B2 US11007259 B2 US 11007259B2 US 201716067931 A US201716067931 A US 201716067931A US 11007259 B2 US11007259 B2 US 11007259B2
- Authority
- US
- United States
- Prior art keywords
- amino acid
- antibody
- acid sequence
- seq
- vegf
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active, expires
Links
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims abstract description 190
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 claims abstract description 179
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims abstract description 18
- 238000010494 dissociation reaction Methods 0.000 claims abstract description 14
- 230000005593 dissociations Effects 0.000 claims abstract description 14
- 230000027455 binding Effects 0.000 claims description 82
- 206010028980 Neoplasm Diseases 0.000 claims description 75
- 238000000034 method Methods 0.000 claims description 65
- 201000011510 cancer Diseases 0.000 claims description 58
- 241000282465 Canis Species 0.000 claims description 57
- 239000012634 fragment Substances 0.000 claims description 50
- 239000008194 pharmaceutical composition Substances 0.000 claims description 49
- 241000282414 Homo sapiens Species 0.000 claims description 47
- 239000000427 antigen Substances 0.000 claims description 32
- 108091007433 antigens Proteins 0.000 claims description 32
- 102000036639 antigens Human genes 0.000 claims description 32
- 210000004408 hybridoma Anatomy 0.000 claims description 29
- 230000001404 mediated effect Effects 0.000 claims description 27
- 208000030533 eye disease Diseases 0.000 claims description 24
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 claims description 18
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 claims description 17
- 230000033115 angiogenesis Effects 0.000 claims description 12
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 claims description 11
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 claims description 11
- 239000000243 solution Substances 0.000 claims description 9
- 210000001519 tissue Anatomy 0.000 claims description 9
- 208000002780 macular degeneration Diseases 0.000 claims description 8
- 102000005962 receptors Human genes 0.000 claims description 8
- 108020003175 receptors Proteins 0.000 claims description 8
- 206010064930 age-related macular degeneration Diseases 0.000 claims description 7
- 230000002792 vascular Effects 0.000 claims description 7
- 206010009944 Colon cancer Diseases 0.000 claims description 6
- FKESCSGWBPUTPN-FOHZUACHSA-N Gly-Thr-Asn Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(O)=O FKESCSGWBPUTPN-FOHZUACHSA-N 0.000 claims description 6
- 230000001900 immune effect Effects 0.000 claims description 6
- 102000004190 Enzymes Human genes 0.000 claims description 5
- 108090000790 Enzymes Proteins 0.000 claims description 5
- 108010067988 prolactin-binding protein Proteins 0.000 claims description 5
- 206010006187 Breast cancer Diseases 0.000 claims description 4
- 208000026310 Breast neoplasm Diseases 0.000 claims description 4
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 claims description 4
- 208000034038 Pathologic Neovascularization Diseases 0.000 claims description 4
- 239000003937 drug carrier Substances 0.000 claims description 4
- 208000005590 Choroidal Neovascularization Diseases 0.000 claims description 3
- 206010060823 Choroidal neovascularisation Diseases 0.000 claims description 3
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 3
- 206010012688 Diabetic retinal oedema Diseases 0.000 claims description 3
- 206010012689 Diabetic retinopathy Diseases 0.000 claims description 3
- 208000010412 Glaucoma Diseases 0.000 claims description 3
- 206010033128 Ovarian cancer Diseases 0.000 claims description 3
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 3
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 3
- 241001111421 Pannus Species 0.000 claims description 3
- 206010060862 Prostate cancer Diseases 0.000 claims description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 3
- 201000002154 Pterygium Diseases 0.000 claims description 3
- 206010038933 Retinopathy of prematurity Diseases 0.000 claims description 3
- 206010039491 Sarcoma Diseases 0.000 claims description 3
- 206010042033 Stevens-Johnson syndrome Diseases 0.000 claims description 3
- 231100000168 Stevens-Johnson syndrome Toxicity 0.000 claims description 3
- 239000000872 buffer Substances 0.000 claims description 3
- 208000001309 degenerative myopia Diseases 0.000 claims description 3
- 230000004340 degenerative myopia Effects 0.000 claims description 3
- 201000011190 diabetic macular edema Diseases 0.000 claims description 3
- 201000007270 liver cancer Diseases 0.000 claims description 3
- 208000014018 liver neoplasm Diseases 0.000 claims description 3
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 3
- 201000001441 melanoma Diseases 0.000 claims description 3
- 201000003142 neovascular glaucoma Diseases 0.000 claims description 3
- 208000002154 non-small cell lung carcinoma Diseases 0.000 claims description 3
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 3
- 208000004644 retinal vein occlusion Diseases 0.000 claims description 3
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 claims description 3
- 206010007275 Carcinoid tumour Diseases 0.000 claims description 2
- 208000007766 Kaposi sarcoma Diseases 0.000 claims description 2
- 206010027406 Mesothelioma Diseases 0.000 claims description 2
- 208000015634 Rectal Neoplasms Diseases 0.000 claims description 2
- 208000006265 Renal cell carcinoma Diseases 0.000 claims description 2
- 208000021712 Soft tissue sarcoma Diseases 0.000 claims description 2
- 208000002458 carcinoid tumor Diseases 0.000 claims description 2
- 238000010790 dilution Methods 0.000 claims description 2
- 239000012895 dilution Substances 0.000 claims description 2
- 201000010536 head and neck cancer Diseases 0.000 claims description 2
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 2
- 206010038038 rectal cancer Diseases 0.000 claims description 2
- 201000001275 rectum cancer Diseases 0.000 claims description 2
- 208000015347 renal cell adenocarcinoma Diseases 0.000 claims description 2
- 239000007787 solid Substances 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 30
- 102000009524 Vascular Endothelial Growth Factor A Human genes 0.000 description 175
- 150000001413 amino acids Chemical group 0.000 description 170
- 210000004027 cell Anatomy 0.000 description 77
- 239000002773 nucleotide Substances 0.000 description 69
- 125000003729 nucleotide group Chemical group 0.000 description 69
- 108020004414 DNA Proteins 0.000 description 65
- 108090000623 proteins and genes Proteins 0.000 description 56
- 108090000765 processed proteins & peptides Proteins 0.000 description 33
- 241000699666 Mus <mouse, genus> Species 0.000 description 31
- 238000011282 treatment Methods 0.000 description 30
- 108091008146 restriction endonucleases Proteins 0.000 description 28
- 101000808011 Homo sapiens Vascular endothelial growth factor A Proteins 0.000 description 23
- 241000699670 Mus sp. Species 0.000 description 20
- 201000010099 disease Diseases 0.000 description 20
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 20
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 19
- 102000004169 proteins and genes Human genes 0.000 description 19
- 102000058223 human VEGFA Human genes 0.000 description 18
- 230000002265 prevention Effects 0.000 description 18
- 108091008605 VEGF receptors Proteins 0.000 description 17
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 17
- 238000002965 ELISA Methods 0.000 description 16
- 230000002401 inhibitory effect Effects 0.000 description 16
- 238000002360 preparation method Methods 0.000 description 16
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 15
- 230000000694 effects Effects 0.000 description 15
- 125000000539 amino acid group Chemical group 0.000 description 14
- 238000001727 in vivo Methods 0.000 description 14
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 13
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 13
- 206010035226 Plasma cell myeloma Diseases 0.000 description 13
- 101000702488 Rattus norvegicus High affinity cationic amino acid transporter 1 Proteins 0.000 description 13
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 12
- 229940120638 avastin Drugs 0.000 description 12
- 238000002649 immunization Methods 0.000 description 12
- 230000003053 immunization Effects 0.000 description 12
- 238000005406 washing Methods 0.000 description 12
- 239000002246 antineoplastic agent Substances 0.000 description 11
- 201000000050 myeloid neoplasm Diseases 0.000 description 11
- 230000004614 tumor growth Effects 0.000 description 11
- 241000700159 Rattus Species 0.000 description 10
- 210000000628 antibody-producing cell Anatomy 0.000 description 10
- 230000007910 cell fusion Effects 0.000 description 10
- 241000282472 Canis lupus familiaris Species 0.000 description 9
- 239000002671 adjuvant Substances 0.000 description 9
- 239000013604 expression vector Substances 0.000 description 9
- 210000000130 stem cell Anatomy 0.000 description 9
- 230000000692 anti-sense effect Effects 0.000 description 8
- 239000003153 chemical reaction reagent Substances 0.000 description 8
- 230000000295 complement effect Effects 0.000 description 8
- 239000013613 expression plasmid Substances 0.000 description 8
- 239000011780 sodium chloride Substances 0.000 description 8
- 208000024891 symptom Diseases 0.000 description 8
- 241000124008 Mammalia Species 0.000 description 7
- 241001465754 Metazoa Species 0.000 description 7
- 239000012228 culture supernatant Substances 0.000 description 7
- 239000002552 dosage form Substances 0.000 description 7
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 7
- 230000036961 partial effect Effects 0.000 description 7
- 239000013612 plasmid Substances 0.000 description 7
- VEEGZPWAAPPXRB-BJMVGYQFSA-N (3e)-3-(1h-imidazol-5-ylmethylidene)-1h-indol-2-one Chemical compound O=C1NC2=CC=CC=C2\C1=C/C1=CN=CN1 VEEGZPWAAPPXRB-BJMVGYQFSA-N 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 6
- 238000002835 absorbance Methods 0.000 description 6
- 229940024606 amino acid Drugs 0.000 description 6
- 239000004037 angiogenesis inhibitor Substances 0.000 description 6
- 229940121369 angiogenesis inhibitor Drugs 0.000 description 6
- 238000006243 chemical reaction Methods 0.000 description 6
- 229940104302 cytosine Drugs 0.000 description 6
- 238000011161 development Methods 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 5
- AVYVKJMBNLPWRX-WFBYXXMGSA-N Trp-Ala-Ser Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O)=CNC2=C1 AVYVKJMBNLPWRX-WFBYXXMGSA-N 0.000 description 5
- 102100039037 Vascular endothelial growth factor A Human genes 0.000 description 5
- 230000000903 blocking effect Effects 0.000 description 5
- 230000004663 cell proliferation Effects 0.000 description 5
- 239000003814 drug Substances 0.000 description 5
- 230000014509 gene expression Effects 0.000 description 5
- 238000011081 inoculation Methods 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- -1 particularly Proteins 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 238000002741 site-directed mutagenesis Methods 0.000 description 5
- 101100244725 Caenorhabditis elegans pef-1 gene Proteins 0.000 description 4
- 108060003951 Immunoglobulin Proteins 0.000 description 4
- 101100370002 Mus musculus Tnfsf14 gene Proteins 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 241000283973 Oryctolagus cuniculus Species 0.000 description 4
- 239000012980 RPMI-1640 medium Substances 0.000 description 4
- 229960000643 adenine Drugs 0.000 description 4
- 230000003321 amplification Effects 0.000 description 4
- 229960000397 bevacizumab Drugs 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 210000004899 c-terminal region Anatomy 0.000 description 4
- 208000029742 colonic neoplasm Diseases 0.000 description 4
- 230000007423 decrease Effects 0.000 description 4
- 229940088598 enzyme Drugs 0.000 description 4
- 239000012894 fetal calf serum Substances 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 102000018358 immunoglobulin Human genes 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 238000003199 nucleic acid amplification method Methods 0.000 description 4
- 102000013415 peroxidase activity proteins Human genes 0.000 description 4
- 108040007629 peroxidase activity proteins Proteins 0.000 description 4
- 239000006152 selective media Substances 0.000 description 4
- 230000019491 signal transduction Effects 0.000 description 4
- BJHCYTJNPVGSBZ-YXSASFKJSA-N 1-[4-[6-amino-5-[(Z)-methoxyiminomethyl]pyrimidin-4-yl]oxy-2-chlorophenyl]-3-ethylurea Chemical compound CCNC(=O)Nc1ccc(Oc2ncnc(N)c2\C=N/OC)cc1Cl BJHCYTJNPVGSBZ-YXSASFKJSA-N 0.000 description 3
- 206010003445 Ascites Diseases 0.000 description 3
- 241000283707 Capra Species 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- 239000004473 Threonine Substances 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- 229960001230 asparagine Drugs 0.000 description 3
- 210000004204 blood vessel Anatomy 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 238000003113 dilution method Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 238000003127 radioimmunoassay Methods 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 235000020183 skimmed milk Nutrition 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 229940113082 thymine Drugs 0.000 description 3
- 230000004862 vasculogenesis Effects 0.000 description 3
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 108020004635 Complementary DNA Proteins 0.000 description 2
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 2
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 2
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 208000034578 Multiple myelomas Diseases 0.000 description 2
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 101100372762 Rattus norvegicus Flt1 gene Proteins 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- 101710120037 Toxin CcdB Proteins 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 108010053100 Vascular Endothelial Growth Factor Receptor-3 Proteins 0.000 description 2
- 102100033179 Vascular endothelial growth factor receptor 3 Human genes 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 2
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 2
- 235000011130 ammonium sulphate Nutrition 0.000 description 2
- 210000004102 animal cell Anatomy 0.000 description 2
- DVQHYTBCTGYNNN-UHFFFAOYSA-N azane;cyclobutane-1,1-dicarboxylic acid;platinum Chemical compound N.N.[Pt].OC(=O)C1(C(O)=O)CCC1 DVQHYTBCTGYNNN-UHFFFAOYSA-N 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 239000006172 buffering agent Substances 0.000 description 2
- 239000006143 cell culture medium Substances 0.000 description 2
- 230000032823 cell division Effects 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 201000010881 cervical cancer Diseases 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 239000003086 colorant Substances 0.000 description 2
- 238000002648 combination therapy Methods 0.000 description 2
- 238000004132 cross linking Methods 0.000 description 2
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 2
- 229960002949 fluorouracil Drugs 0.000 description 2
- 235000003599 food sweetener Nutrition 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 2
- 238000001641 gel filtration chromatography Methods 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- 230000003862 health status Effects 0.000 description 2
- 229960002897 heparin Drugs 0.000 description 2
- 229920000669 heparin Polymers 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 208000026278 immune system disease Diseases 0.000 description 2
- 239000007928 intraperitoneal injection Substances 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 238000004255 ion exchange chromatography Methods 0.000 description 2
- GURKHSYORGJETM-WAQYZQTGSA-N irinotecan hydrochloride (anhydrous) Chemical compound Cl.C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 GURKHSYORGJETM-WAQYZQTGSA-N 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- 210000001165 lymph node Anatomy 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 230000001766 physiological effect Effects 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000002335 preservative effect Effects 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 238000005215 recombination Methods 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 238000005185 salting out Methods 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 210000004989 spleen cell Anatomy 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 239000013589 supplement Substances 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 239000003765 sweetening agent Substances 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- GEYOCULIXLDCMW-UHFFFAOYSA-N 1,2-phenylenediamine Chemical compound NC1=CC=CC=C1N GEYOCULIXLDCMW-UHFFFAOYSA-N 0.000 description 1
- QAPSNMNOIOSXSQ-YNEHKIRRSA-N 1-[(2r,4s,5r)-4-[tert-butyl(dimethyl)silyl]oxy-5-(hydroxymethyl)oxolan-2-yl]-5-methylpyrimidine-2,4-dione Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O[Si](C)(C)C(C)(C)C)C1 QAPSNMNOIOSXSQ-YNEHKIRRSA-N 0.000 description 1
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 238000011729 BALB/c nude mouse Methods 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 101100381481 Caenorhabditis elegans baz-2 gene Proteins 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 239000004971 Cross linker Substances 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 206010061825 Duodenal neoplasm Diseases 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 1
- 102100031000 Hepatoma-derived growth factor Human genes 0.000 description 1
- 101001083798 Homo sapiens Hepatoma-derived growth factor Proteins 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 238000012218 Kunkel's method Methods 0.000 description 1
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 241000711408 Murine respirovirus Species 0.000 description 1
- 101001076414 Mus musculus Interleukin-6 Proteins 0.000 description 1
- 101000808007 Mus musculus Vascular endothelial growth factor A Proteins 0.000 description 1
- 108090000772 Neuropilin-1 Proteins 0.000 description 1
- 102000004207 Neuropilin-1 Human genes 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 208000009565 Pharyngeal Neoplasms Diseases 0.000 description 1
- 206010034811 Pharyngeal cancer Diseases 0.000 description 1
- 102100040681 Platelet-derived growth factor C Human genes 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 206010063381 Polypoidal choroidal vasculopathy Diseases 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 101000808006 Rattus norvegicus Vascular endothelial growth factor A Proteins 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 206010054184 Small intestine carcinoma Diseases 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 102000009843 Thyroglobulin Human genes 0.000 description 1
- 108010034949 Thyroglobulin Proteins 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 108010073925 Vascular Endothelial Growth Factor B Proteins 0.000 description 1
- 108010073923 Vascular Endothelial Growth Factor C Proteins 0.000 description 1
- 108010073919 Vascular Endothelial Growth Factor D Proteins 0.000 description 1
- 102000016549 Vascular Endothelial Growth Factor Receptor-2 Human genes 0.000 description 1
- 102100038217 Vascular endothelial growth factor B Human genes 0.000 description 1
- 102100038232 Vascular endothelial growth factor C Human genes 0.000 description 1
- 102100038234 Vascular endothelial growth factor D Human genes 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 108010081667 aflibercept Proteins 0.000 description 1
- 229960002833 aflibercept Drugs 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 230000035578 autophosphorylation Effects 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 206010006007 bone sarcoma Diseases 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000012292 cell migration Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 201000010897 colon adenocarcinoma Diseases 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 238000011443 conventional therapy Methods 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 201000000312 duodenum cancer Diseases 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 229960001433 erlotinib Drugs 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 125000005519 fluorenylmethyloxycarbonyl group Chemical group 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 229960002584 gefitinib Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229960005144 gemcitabine hydrochloride Drugs 0.000 description 1
- 229940020967 gemzar Drugs 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 229960000789 guanidine hydrochloride Drugs 0.000 description 1
- PJJJBBJSCAKJQF-UHFFFAOYSA-N guanidinium chloride Chemical compound [Cl-].NC(N)=[NH2+] PJJJBBJSCAKJQF-UHFFFAOYSA-N 0.000 description 1
- 239000007902 hard capsule Substances 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 230000002998 immunogenetic effect Effects 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 230000031146 intracellular signal transduction Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 229940084651 iressa Drugs 0.000 description 1
- 229960000779 irinotecan hydrochloride Drugs 0.000 description 1
- 208000023589 ischemic disease Diseases 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 108010082117 matrigel Proteins 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 238000000691 measurement method Methods 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 239000007758 minimum essential medium Substances 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- LBWFXVZLPYTWQI-IPOVEDGCSA-N n-[2-(diethylamino)ethyl]-5-[(z)-(5-fluoro-2-oxo-1h-indol-3-ylidene)methyl]-2,4-dimethyl-1h-pyrrole-3-carboxamide;(2s)-2-hydroxybutanedioic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O.CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C LBWFXVZLPYTWQI-IPOVEDGCSA-N 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 229940080607 nexavar Drugs 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 238000011580 nude mouse model Methods 0.000 description 1
- 229920002113 octoxynol Polymers 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 229940127084 other anti-cancer agent Drugs 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 210000004976 peripheral blood cell Anatomy 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 108010017992 platelet-derived growth factor C Proteins 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229940050929 polyethylene glycol 3350 Drugs 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 238000010379 pull-down assay Methods 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 229940016590 sarkosyl Drugs 0.000 description 1
- 108700004121 sarkosyl Proteins 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- KSAVQLQVUXSOCR-UHFFFAOYSA-M sodium lauroyl sarcosinate Chemical compound [Na+].CCCCCCCCCCCC(=O)N(C)CC([O-])=O KSAVQLQVUXSOCR-UHFFFAOYSA-M 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- 239000007901 soft capsule Substances 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 210000001988 somatic stem cell Anatomy 0.000 description 1
- 229960003787 sorafenib Drugs 0.000 description 1
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 description 1
- 238000010911 splenectomy Methods 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 229960001796 sunitinib Drugs 0.000 description 1
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 229940034785 sutent Drugs 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 229940120982 tarceva Drugs 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- RCINICONZNJXQF-XAZOAEDWSA-N taxol® Chemical compound O([C@@H]1[C@@]2(CC(C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3(C21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-XAZOAEDWSA-N 0.000 description 1
- 229940063683 taxotere Drugs 0.000 description 1
- 238000010998 test method Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 229960002175 thyroglobulin Drugs 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 239000012929 tonicity agent Substances 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 230000005760 tumorsuppression Effects 0.000 description 1
- 210000003606 umbilical vein Anatomy 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 210000003556 vascular endothelial cell Anatomy 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/00113—Growth factors
- A61K39/001135—Vascular endothelial growth factor [VEGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to a high-affinity anti-VEGF antibody.
- VEGF Vascular endothelial growth factor
- angiogenesis vasculogenesis
- Human VEGF protein was purified and identified in 1989. The gene thereof has been cloned and thus the gene sequence has been determined.
- VEGF can accelerate vasculogenesis, and all members belonging to the VEGF family bind to receptors (VEGFR) corresponding to respective family molecules existing on cell membrane surfaces and thus to activate cells. As a result of dimerization due to binding of VEGF, the group of these receptors undergoes auto-phosphorylation and is thus activated.
- VEGFR consists of seven immunoglobulin-like extracellular domains, one transmembrane domain, and one intracellular domain containing a tyrosine kinase region.
- VEGF-A can bind to VEGF receptor-1 (receptor Flt-1) and VEGF receptor-2 (KDR/Flk-1).
- Non Patent Literature 1 Angiogenesis in ischemic disease. Thromb. Haemost. 1999. Supplement 1: 44-52
- Non Patent Literature 2 VEGF Receptor Signal Transduction. Sci. STKE. 2001. re21
- Avastin® (bevacizumab) that is a recombinant anti-VEGF humanized monoclonal antibody is used for treatment of colorectal cancer, breast cancer, non-small-cell lung cancer, glioma in the central nervous system, and age-related macular degeneration (AMD).
- Avastin does not have high affinity for VEGF (Non Patent Literature 3: Aflibercept as a Treatment for Age-related Macular Degeneration. US Ophthalimic Rev. 2013. 6:58-63).
- the exclusive production and exclusive form of selling of Avastin force patients who need to use Avastin to pay high medical expenses. Therefore, development of a new anti-VEGF monoclonal antibody is required also from viewpoints of easing the burden of patients and reducing the costs of treatment.
- Patent Literature 1 JP Laid-Open Publication No. 2013-502445.
- a technical problem to be solved by the present invention is to provide a novel antibody that inhibits the physiological activity of VEGF by binding to a vascular endothelial growth factor (VEGF) with its high affinity for VEGF compared to the prior art to inhibit binding of VEGF to a VEGF receptor.
- VEGF vascular endothelial growth factor
- the present inventors have prepared an antibody that binds to VEGF with high affinity, have discovered that the antibody inhibits the physiological action of VEGF, and thus have completed the present invention.
- the present invention is as follows.
- a monoclonal antibody against VEGF that binds to a vascular endothelial growth factor (VEGF) with a dissociation constant of 1 ⁇ 10 ⁇ 11 mol/L or less.
- VEGF vascular endothelial growth factor
- VEGF vascular endothelial growth factor
- VFGFR1 vascular endothelial growth factor receptor-1
- VGFR2 vascular endothelial growth factor receptor-2
- the antibody according to any one of (1) to (4) above comprising: CDR-H1 that comprises the amino acid sequence of SEQ ID NO: 14, CDR-112 that comprises the amino acid sequence of SEQ ID NO: 16, and CDR-H3 that comprises the amino acid sequence of SEQ ID NO: 18; and CDR-L1 that comprises the amino acid sequence of SEQ ID NO: 20, CDR-L2 that comprises the amino acid sequence of Trp-Ala-Ser, and CDR-L3 that comprises the amino acid sequence of SEQ ID NO: 22.
- the antibody according to any one of (1) to (4) above comprising CDR-H1 that comprises the amino acid sequence of SEQ ID NO: 24, CDR-H2 that comprises the amino acid sequence of SEQ ID NO: 26, and CDR-H3 that comprises the amino acid sequence of SEQ ID NO: 28.
- the antibody according to any one of (1) to (4) above comprising CDR-L1 that comprises the amino acid sequence of SEQ ID NO: 30, CDR-L2 that comprises the amino acid sequence of Gly-Thr-Asn, and CDR-L3 that comprises the amino acid sequence of SEQ ID NO: 32.
- an amino acid sequence derived from a canine IgGB heavy chain constant region comprises the amino acid sequence of SEQ ID NO: 46
- an amino acid sequence derived from a canine Ig light chain ( ⁇ chain) constant region comprises the amino acid sequence of SEQ ID NO: 48
- an amino acid sequence derived from a canine Ig light chain ( ⁇ chain) constant region comprises the amino acid sequence of SEQ ID NO: 50.
- the antibody according to (15) above comprising: a heavy chain that comprises the amino acid sequence of SEQ ID NO: 34 or 38 and the amino acid sequence of SEQ ID NO: 46; and a light chain that comprises the amino acid sequence of SEQ ID NO: 36 or 40 and the amino acid sequence of SEQ ID NO: 48 or 50.
- (17) A fragment of the monoclonal antibody according to any one of (1) to (16) above.
- (18) The fragment according to (17) above, wherein the fragment is an antigen-binding fragment.
- the antigen-binding fragment is a single-chain antibody or a double-chain antibody.
- (20) A hybridoma that produces the monoclonal antibody according to any one of (1) to (3) above.
- a pharmaceutical composition comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
- (22) The pharmaceutical composition according to (21) above, for use in treatment or prevention of a VEGF-mediated disease.
- the pharmaceutical composition according to (22) above, wherein the VEGF-mediated disease is a cancer or a VEGF-mediated eye disease.
- the pharmaceutical composition according to (23) above, wherein the treatment or prevention of the cancer or the VEGF-mediated eye disease is by inhibiting angiogenesis or vascular hyperpermeability.
- the pharmaceutical composition according to (24) above, wherein the angiogenesis is pathological angiogenesis.
- (26) The pharmaceutical composition according to (23) or (24) above, wherein the cancer is solid cancer or hematologic neoplasm.
- cancer selected from the group consisting of colorectal cancer, rectal cancer, breast cancer, non-small-cell lung cancer, non-Hodgkin's lymphoma (NHL), renal cell cancer, prostate cancer, liver cancer, pancreas cancer, soft tissue sarcoma, Kaposi's sarcoma, carcinoid tumor, head and neck cancer, melanoma, ovarian cancer, mesothelioma, and multiple myeloma.
- the cancer is selected from the group consisting of colorectal cancer, rectal cancer, breast cancer, non-small-cell lung cancer, non-Hodgkin's lymphoma (NHL), renal cell cancer, prostate cancer, liver cancer, pancreas cancer, soft tissue sarcoma, Kaposi's sarcoma, carcinoid tumor, head and neck cancer, melanoma, ovarian cancer, mesothelioma, and multiple myeloma.
- VEGF-mediated eye disease is at least one selected from age-related macular degeneration, diabetic retinopathy, diabetic macular edema, neovascular glaucoma, retinal vein occlusion, retinopathy of prematurity, choroidal neovascularization associated with pathological myopia, pterygium, rubeosis, pannus, Stevens-Johnson syndrome, and an immunological rejection in a transplanted tissue of the eye.
- An angiogenesis inhibitor comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
- a reagent comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
- a kit comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
- a method for treating or preventing a cancer or a VEGF-mediated eye disease comprising a step of administering to a subject a therapeutically effective amount of the antibody or the fragment thereof according to any one of (1) to (19) above.
- the antibody or the fragment thereof according to any one of (1) to (19) above for use in a method for treating or preventing a cancer or a VEGF-mediated eye disease.
- the antibody or the fragment thereof according to any one of (1) to (19) above for use in the manufacture of a medicament for treatment or prevention of a cancer or a VEGF-mediated eye disease.
- VEGF vascular endothelial growth factor
- FIG. 1 shows the results of examining the capability of inhibiting binding of VEGF to VEGFR2 of the antibody of present invention.
- FIG. 2 shows the results of examining the inhibiting effect of the antibody of the present invention on cell proliferation.
- FIG. 3 shows the results of examining the in vivo inhibiting effect of KLHa505, that is the antibody of the present invention, on tumor growth.
- FIG. 4 shows the results of examining the in vivo inhibiting effect of KLHb1501, that is the antibody of the present invention, on tumor growth.
- FIG. 5 shows the results of examining the in vivo inhibiting effect of KLHb1501HC, that is the humanized chimeric antibody of the present invention, on tumor growth.
- FIG. 6 shows the results of binding of KLHb1501CC, that is a caninized chimeric antibody of the present invention to canine VEGFA.
- FIG. 7 shows the results of examining KLHb1501CC, that is the caninized chimeric antibody of the present invention, for its in vivo inhibiting effect on tumor growth in human-derived cancer cells.
- FIG. 8 shows the results of examining the in vivo inhibiting effect of KLHb1501CC, that is the caninized chimeric antibody of the present invention, on tumor growth in a canine-derived cancer cells.
- FIG. 9 shows the results of examining KLHa505HC, that is the humanized chimeric antibody of the present invention, for the capability of binding to VEGF165, VEGF121 and VEGF165b.
- FIG. 10 shows the results of examining KLHb1501HC, that is the humanized chimeric antibody of the present invention, for the capability of binding to VEGF165, VEGF121 and VEGF165b.
- Avastin is known as an anti-VEGF antibody effective for treatment of cancer and age-related macular degeneration, however, Avastin is known to have low affinity for VEGF.
- the present inventors have developed an antibody having significantly high affinity for VEGF compared to the prior art, and thus have discovered that the antibody is effective for suppression of angiogenesis and treatment of cancer.
- the present invention has been completed based on these findings.
- VEGF Vascular Endothelial Growth Factor
- VEGFs are proteins playing an important role in angiogenesis. VEGFs involve cell division and migration, induction of differentiation, vascular hyperpermeability, activation of monocytes and macrophages, and the like through binding to their receptors to cause intracellular signal transduction.
- examples of VEGF include VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, PIGF-1, and PIGF-2, and a preferable example thereof is VEGF-A.
- VEGF in the present invention may be derived from any mammal.
- Examples of such a mammal include mice, rats, rabbits, dogs, goats, monkeys and humans, preferably, mice, rats, dogs and humans.
- VEGF-A examples include VEGF (VEGF 165 ) consisting of 165 amino acid residues, a subtype thereof; that is, VEGF (VEGF 121 ) consisting of 121 amino acid residues, VEGF (VEGF 145 ) consisting of 145 amino acid residues, VEGF (VEGF 183 ) consisting of 183 amino acid residues, VEGF (VEGF 189 ) consisting of 189 amino acid residues, VEGF (VEGF 206 ) consisting of 206 amino acid residues, VEGF (VEGF 165b ) differing from the above VEGF 165 in the amino acid sequence of the C-terminal region, and naturally-occurring allelic variants thereof and processing variants thereof.
- VEGF 121 and VEGF 165 are preferred.
- VEGF is encoded on chromosome 6p12, and the mRNA is 16,272 bp long.
- VEGF is consisting of exons 1 to 5, and 6a, 6b, 7a, 7b, 8a and 8b.
- VEGF 165 binds to all of NRP1, VEGFR1 and VEGFR2.
- examples of canine VEGF include, but are not limited to, VEGF (VEGF 164 ) consisting of 164 amino acid residues, VEGF (VEGF 120 ) consisting of 120 amino acid residues, VEGF (VEGF 144 ) consisting of 144 amino acid residues, VEGF (VEGF 147 ) consisting of 147 amino acid residues, VEGF (VEGF 162 ) consisting of 162 amino acid residues, VEGF (VEGF 182 ) consisting of 182 amino acid residues, VEGF (VEGF 188 ) consisting of 188 amino acid residues, VEGF (VEGF 205 ) consisting of 205 amino acid residues, VEGF (VEGF 164b ) differing from the above VEGF 164 in the amino acid sequence of the C-terminal region, and naturally occurring allelic variants thereof and processing variants thereof.
- amino acid sequences of mouse, rat, canine and human VEGFs, and VEGF 121 and VEGF 165 are represented by SEQ ID NOS: 2, 4, 6, 8, 10, and 12, respectively.
- base (nucleotide) sequences of DNA encoding mouse, rat, canine and human VEGFs, and VEGF 121 and VEGF 165 are represented by SEQ ID NOS: 1, 3, 5, 7, 9 and 11, respectively.
- Rat VEGF amino acid sequence NP_114024.2 (SEQ ID NO: 4)
- Canine VEGF amino acid sequence NP_001003175 (SEQ ID NO: 6)
- Human VEGF-A amino acid sequence NP_001020537.2 (SEQ ID NO: 8)
- VEGF 121 amino acid sequence ABO26344.1 (SEQ ID NO: 10)
- VEGF 165 amino acid sequence AAM03108.1 (SEQ ID NO: 12)
- Rat VEGF-encoding DNA nucleotide sequence NM_031836.2 (SEQ ID NO: 3)
- Canine VEGF-encoding DNA nucleotide sequence NM_001003175.2 (SEQ ID NO: 5)
- Human VEGF-A-encoding DNA nucleotide sequence NM_001025366.2 (SEQ ID NO: 7)
- VEGF 121 -encoding DNA nucleotide sequence: EF424789.1 (SEQ ID NO: 9)
- VEGFs to be used in the present invention include the following proteins (a) to (c):
- a protein comprising an amino acid sequence on which one or several amino acids are deleted, substituted or added with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, and having binding activity to a VEGF receptor; and (c) a protein comprising an amino acid sequence that has 80% or higher homology (identity) with the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, and having binding activity to a VEGF receptor.
- examples of “a protein comprising the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12” include a protein consisting of the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12.
- amino acid sequence on which one or several amino acids are deleted, substituted or added with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12 include:
- amino acid sequence on which 1 to 10 (for example, 1 to 5, preferably 1 to 3, more preferably 1 to 2, and further preferably 1) amino acids are deleted with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12;
- amino acid sequence on which 1 to 10 (for example, 1 to 5, preferably 1 to 3, more preferably 1 to 2, and further preferably 1) amino acids are substituted with other amino acids with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12; (iii) an amino acid sequence on which (for example, 1 to 5, preferably 1 to 3, more preferably 1 to 2, and further preferably 1) amino acids are added with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12; and (iv) an amino acid sequence mutated as a combination of (i) to (iii) above.
- VEGF receptor is at least one VEGF receptor selected from the group consisting of vascular endothelial growth factor receptor-1 (VEGFR1 (another name: Flt-1)), vascular endothelial growth factor receptor-2 (VEGFR2 (another name: KDR)) and vascular endothelial growth factor receptor-3 (VEGFR3), and is preferably vascular endothelial growth factor receptor-1 (VEGFR1) and/or vascular endothelial growth factor receptor-2 (VEGFR2), and more preferably vascular endothelial growth factor receptor-2 (VEGFR2).
- binding activity to a VEGF receptor means activity of specifically binding to a VEGF receptor.
- binding activity to a VEGF receptor means having at least 10% or more, 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, and preferably 90% or more activity, when compared to the activity of the protein consisting of the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, which is set to 100%.
- examples of VEGF in the present invention include, in addition to a protein having the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, a protein having an amino acid sequence that has 80% or more homology (identity) with the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, and having binding activity to a VEGF receptor.
- Examples of such a protein also include a protein having an amino acid sequence that has about 80% or more, 85% or more, 90% or more, 95% or more, 96% or more, 97% or more, 98% or more, or 99% or more homology with the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, and having binding activity to a VEGF receptor (an amino acid sequence substantially equivalent to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12).
- Homology can be determined using a homology search site on the Internet, for example, by performing a homology search program such as FASTA, BLAST, PSI-BLAST or the like on the DNA Data Bank of Japan (DDBJ). Homology search can also be performed using BLAST on the National Center for Biotechnology Information (NCBI).
- NCBI National Center for Biotechnology Information
- Mutagenesis of DNA encoding the relevant protein in order to prepare a protein having the above mutation can be performed using a kit for mutagenesis using site-directed mutagenesis such as Kunkel method, Gapped duplex method or the like, such as QuikChangeTM Site-Directed Mutagenesis Kit (Stratagene), GeneTailorTM Site-Directed Mutagenesis System (Invitrogen), TaKaRa Site-Directed Mutagenesis System (Mutan-K, Mutan-Super Express Km and the like: Takara Bio) or the like.
- a method such as a site-directed mutagenesis method described in “Molecular Cloning, A Laboratory Manual (4th edition)” (Cold Spring Harbor Laboratory Press (2012)) can be used.
- anti-VEGF antibody refers to an antibody that specifically binds to the above VEGF.
- the anti-VEGF antibody of the present invention binds to VEGF with high affinity compared to the prior art to inhibit binding of VEGF to a VEGF receptor (VEGFR).
- bevacizumab (Avastin®) that is well known as an anti-VEGF antibody is known to have a dissociation constant of 47.9 nmol/L for binding to VEGF.
- the term “inhibit binding” does not always means 100% inhibition of the binding of VEGF to the VEGFR.
- the antibody of the present invention inhibits binding of VEGF to the VEGFR, for example, 50% or more, preferably 60% or more, 70% or more, 80% or more, 90% or more, 95% or more, 96% or more, 97% or more, 98% or more, and 99% or more thereof.
- An inhibiting effect on the binding can be evaluated using a known method for a binding inhibition test, such as a method used in Example 2 of the Description.
- the antibody of the present invention is a neutralizing antibody that neutralizes VEGF activity through its specific binding to VEGF.
- the term “specifically bind to” means binding to (reacting with) a target molecule, but substantially not binding (not reacting with) molecules other than the target molecule.
- the term “neutralize” at least means to inhibit (suppress) the activity of VEGF to bind to VEGFR. Whether or not binding is specific can be confirmed by immunological techniques, such as ELISA, Western blot method or immunohistological staining.
- VEGF is used as an immunogen for preparing the antibody of the present invention.
- VEGF When VEGF is used as an immunogen, a peptide comprising an amino acid sequence that is a portion of the full length sequence of VEGF can also be used. VEGF to be used as an antigen or an immunogen and methods for introducing mutations are as described in the above “2. VEGF”.
- VEGF may be natural VEGF purified from a mouse, rat, dog, or human tissues or cells, for example, or VEGF produced via genetic engineering techniques.
- a biological sample confirmed to contain VEGF is fractionated into a soluble fraction and an insoluble fraction using various surfactants, such as Triton-X or Sarkosyl.
- the insoluble fraction is further dissolved in urea, guanidine hydrochloride or the like, and allow to bind to various columns, such as a heparin column or a binding resin, so that VEGF can be obtained.
- VEGF to be used as an antigen can also be synthesized by specifying the amino acid sequence and then using a known protein synthesis method such as a solid phase method or a commercially available protein synthesizer.
- a synthesized peptide is bound to a carrier protein such as Keyhole Limpet Hemocyanin (KLH) or thyroglobulin and thus the resultant can be used as an immunogen.
- KLH Keyhole Limpet Hemocyanin
- thyroglobulin thyroglobulin
- the above-prepared VEGF or a partial peptide alone is administered or the same is administered together with a carrier, a diluent or the like to a non-human mammal, such as a rabbit, a dog, a guinea pig, a mouse, a rat, or a goat for immunization.
- a carrier such as a rabbit, a dog, a guinea pig, a mouse, a rat, or a goat for immunization.
- the dosage of the antigen per animal ranges from 0.1 mg to 10 mg when an adjuvant is used.
- the adjuvant include Freund's complete adjuvant (FCA), Freund's incomplete adjuvant (FIA), and an aluminum hydroxide adjuvant. Immunization is performed by mainly intravenous, subcutaneous, intraperitoneal injection, or the like.
- the immunization interval is not particularly limited, and immunization is performed at intervals of several days to several weeks, and preferably at intervals of 1 to 2 weeks for 2 to 10 times and preferably 3 to 5 times.
- the immunization interval can be determined by persons skilled in the art considering the resulting antibody titer.
- blood is sampled when subcutaneous immunization is performed 3 to 4 times and then the antibody titer is measured.
- Antibody titer in serum can be measured by ELISA (enzyme-linked immunosorbent assay), EIA (enzyme immunoassay), radioimmunoassay (RIA) or the like.
- an antibody can be separated and purified by a generally employed method.
- separation and purification a known method such as an ammonium sulfate salting-out method, ion exchange chromatography, gel filtration chromatography, and affinity chromatography is adequately selected or combined, and then purification can be performed. That is, a serum containing a target antibody is applied to a column to which proteins other than VEGF have been bound, a flow-through fraction is collected, and then a polyclonal antibody having improved specificity to VEGF can be obtained.
- VEGF or a partial peptide alone or the same together with a carrier or a diluent is administered to a non-human mammal for immunization.
- the dosage of an antigen per animal, the type of an adjuvant to be used, an immunization method, and immunization intervals are similar to those for preparation of a polyclonal antibody.
- One to 30 days, and preferably 2 to 5 days after the final immunization date individuals confirmed to have antibody titers are selected, and then antibody-producing cells are collected. Examples of antibody-producing cells include spleen cells, lymph node cells, and peripheral blood cells, and among them spleen cells or lymph node cells are preferred.
- cell fusion of antibody-producing cells and myeloma cells is performed.
- Cell fusion procedures can be implemented according to a known method such as the method of Kohler et al.
- myeloma cells to be fused to antibody-producing cells generally available established cell lines of an animal such as a mouse can be used.
- Cell lines that can be preferably used herein have drug selectivity and have a property of being unable to survive in HAT selective medium (containing hypoxanthine, aminopterin, and thymidine) when the cells are in an unfused state, but able to survive only in a state fused to antibody-producing cells.
- HAT selective medium containing hypoxanthine, aminopterin, and thymidine
- myeloma cells examples include mouse myeloma cell lines such as P3-x63-Ag8U.1, SP2/O-Ag14, PAI, P3U1, NSI/1-Ag4-1, and NSO/I, and rat myeloma cell lines such as YB2/0.
- the cell fusion of myeloma cells and antibody-producing cells described above is performed by mixing 1 ⁇ 10 8 to 5 ⁇ 10 8 antibody-producing cells and 2 ⁇ 10 7 to 10 ⁇ 10 7 myeloma cells in animal cell culture medium such as serum-free DMEM and RPMI-1640 medium (the cell ratio of antibody-producing cells to myeloma cells ranges from 10:1 to 1:1), and then performing fusion reaction in the presence of a cell fusion accelerator.
- a cell fusion accelerator polyethylene glycol having an average molecular weight of 1000-6000 daltons or Sendai virus can be used, for example.
- antibody-producing cells and myeloma cells can be fused using a commercially available cell fusion device utilizing electrical stimulation (for example, electroporation).
- a target hybridoma is selected from cells after cell fusion treatment.
- Such a method is performed by appropriately diluting a cell suspension with 10% to 20% fetal calf serum-containing RPMI-1640 medium or the like, placing the resultant on a microtiter plate at about 0.3 cells/well as calculated by a limiting dilution method, adding selective medium such as HAT medium to each well, and then culturing while appropriately exchanging selective media.
- selective medium such as HAT medium
- Hybridoma screening may be performed according to a general method and is not particularly limited. For example, a portion of a culture supernatant contained in wells in which hybridomas have been cultured is collected and then can be screened by enzyme immunoassay, radioimmunoassay or the like. As a specific example, an antigen is adsorbed to a 96-well plate, followed by blocking with calf serum. The culture supernatant of hybridoma cells is reacted with an immobilized antigen at 37° C. for 1 hour, and then reacted with peroxidase-labeled anti-mouse IgG at 37° C.
- Hybridomas producing a monoclonal antibody found positive as a result of the above measurement method is cloned by a limiting dilution method or the like. Finally, hybridomas that are cells producing the monoclonal antibody that specifically binds to VEGF are established.
- the hybridomas are cultured in animal cell culture medium such as 10% fetal calf serum-containing RPMI-1640 medium, MEM, or serum free medium under general culture conditions (for example, 37° C., 5% CO 2 concentration) for 7 to 14 days, and then an antibody is obtained from the culture supernatant.
- animal cell culture medium such as 10% fetal calf serum-containing RPMI-1640 medium, MEM, or serum free medium under general culture conditions (for example, 37° C., 5% CO 2 concentration) for 7 to 14 days, and then an antibody is obtained from the culture supernatant.
- an ascites formation method about 5 ⁇ 10 6 to 2 ⁇ 10 7 hybridomas are administered intraperitoneally to an animal of the same species as that of a mammal from which myeloma cells are derived, such as mouse (BALB/c), so that hybridomas are grown in large amounts.
- a mammal from which myeloma cells are derived such as mouse (BALB/c)
- ascites is collected.
- purification can be performed by appropriately selecting a known method such as an ammonium sulfate salting-out method, ion exchange chromatography, gel filtration, and affinity chromatography, or using these methods in combination.
- Examples of the antibody of the present invention include, but are not limited to, an antibody wherein:
- a heavy chain variable region comprises a heavy chain complementarity determining region (CDR)1 (CDR-H1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 14, heavy chain CDR2 (CDR-112) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 16, and/or heavy chain CDR3 (CDR-113) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 18; and/or a light chain variable region (VL) comprises light chain CDR1 (CDR-L1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 20, light chain CDR2 (CDR-L2) comprising or consisting of the amino acid sequence that consists of tryptophan (W)-alanine (A)-serine (S) (may also be referred to as “amino acid sequence WAS”, “amino acid sequence Trp-Ala-Ser”), and/or light chain CDR3 (CDR-L3) comprising or consisting of the amino acid
- examples of the antibody of the present invention include, but are not limited to, an antibody wherein:
- a heavy chain variable region comprises heavy chain CDR1 (CDR-H1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 24, heavy chain CDR2 (CDR-H2) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 26 and/or heavy chain CDR3 (CDR-H3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 28; and/or a light chain variable region comprises light chain CDR1 (CDR-L1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 30, light chain CDR2 (CDR-L2) comprising or consisting of the amino acid sequence that consists of glycine (G)-threonine (T)-asparagine (N) (may also be referred to as “amino acid sequence GTN”, “amino acid sequence Gly-Thr-Asn”) and/or light chain CDR3 (CDR-L3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 32.
- examples of the antibody of the present invention include, but are not limited to, an antibody wherein: the amino acid sequence of a heavy chain variable region comprises or consists of the amino acid sequence represented by SEQ ID NO: 34 or 38; and/or the amino acid sequence of a light chain variable region comprises or consists of the amino acid sequence represented by SEQ ID NO: 36 or 40.
- a preferred aspect of the antibody of the present invention is a recombinant antibody.
- the recombinant antibody include, but are not limited to, a chimeric antibody, a humanized antibody, and a caninized antibody.
- a chimeric antibody refers to an antibody prepared by linking immunoglobulin gene fragments of animals of different species.
- examples of a chimeric antibody include a humanized chimeric antibody, and a caninized chimeric antibody, but the types of animals, from which chimeric antibody variable and constant regions are derived, are not limited.
- a humanized chimeric antibody is an antibody prepared by linking (joining) a mouse-derived antibody variable region to a human-derived constant region, for example (see Proc. Natl. Acad. Sci. U.S.A. 81, 6851-6855, (1984), for example).
- a caninized chimeric antibody is an antibody prepared by linking a mouse-derived antibody variable region to a dog-derived constant region, for example.
- mice-derived antibody variable region include, but are not limited to, a heavy chain variable region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 34 or 38, and a light chain variable region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 36 or 40.
- CDR grafting is a method for preparing a reconstructed variable region, whereby a complementarity determining region (CDR) is grafted from a mouse antibody variable region to a human variable region, so that the framework region (FR) is human-derived and CDR is mouse-derived.
- CDR complementarity determining region
- FR framework region
- CDR mouse-derived
- Such humanized reconstructed human variable region is ligated to a human constant region.
- Such a method for preparing a humanized antibody is known in the art (see e.g., Nature, 321, 522-525 (1986); J. Mol. Biol., 196, 901-917 (1987); Queen C et al., Proc. Natl. Acad. Sci. USA, 86: 10029-10033 (1989); and Japanese Patent No. 2828340).
- CDR1-3 of a heavy chain variable region (CDR-H1, CDR-H2 and CDR-H3) comprising or consisting of the amino acid sequences represented by SEQ ID NO: 14, 16 and 18, respectively,
- CDR1-3 of a light chain variable region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 20, the amino acid sequence that consists of tryptophan (W)-alanine (A)-serine (S) (amino acid sequence Trp-Ala-Ser), and/or the amino acid sequence represented by SEQ ID NO: 22, respectively.
- amino acid sequences of mouse-derived CDRs that can be used for the humanized antibody of the present invention include, but are not limited to,
- CDR1-3 of a heavy chain variable region (CDR-H1, CDR-H2 and CDR-H3) comprising or consisting of the amino acid sequences represented by SEQ ID NO: 24, 26, and 28, respectively,
- CDR1-3 of a light chain variable region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 30, the amino acid sequence that consists of glycine (G)-threonine (T)-asparagine (N) (amino acid sequence Gly-Thr-Asn), and/or the amino acid sequence represented by SEQ ID NO: 32, respectively.
- a caninized antibody can also be prepared by a technique similar to the above method for preparing a humanized antibody.
- examples of a human heavy chain constant region that can be used for a chimeric antibody and a humanized antibody include, but are not limited to, a human heavy chain constant region comprising an amino acid sequence derived from a human IgG1 heavy chain constant region, and for example, a human heavy chain constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 42
- examples of a human light chain constant region include, but are not limited to, a human light chain constant region comprising an amino acid sequence derived from a human IgG1 light chain constant region, and for example, a human light chain constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 44.
- examples of DNA encoding a human heavy chain constant region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 41.
- examples of DNA encoding a human light chain constant region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 43.
- examples of a canine heavy chain constant region that can be used for a chimeric antibody and a caninized antibody include, but are not limited to, a canine heavy chain constant region comprising an amino acid sequence derived from the canine IgGB heavy chain constant region, and for example, a canine heavy chain constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 46.
- examples of a canine light chain constant region that can be used for a chimeric antibody and a caninized antibody include, but are not limited to, a canine light chain constant region comprising an amino acid sequence derived from a canine Ig light chain ( ⁇ chain) constant region or an amino acid sequence derived from a canine Ig light chain ( ⁇ chain) constant region, and for example, a canine light chain ( ⁇ chain) constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 48, or a canine light chain ( ⁇ chain) constant region comprising or consisting of the amino acid sequence represented by SEQ ID NO: 50.
- examples of DNA encoding a canine heavy chain constant region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 45.
- examples of DNA encoding a canine light chain ( ⁇ chain or ⁇ chain) constant region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 47 or 49.
- a chimeric antibody, a humanized antibody, and a caninized antibody can be prepared according to the above-mentioned known method using a hybridoma or DNA, RNA or the like extracted from the hybridoma as a raw material.
- the antibody of the present invention in the form of a fusion protein can be prepared according to a known gene recombination technique using antibody variable regions and another protein.
- the fusion protein can also be prepared by cross-linking a monoclonal antibody and another protein using a cross-linker.
- a fragment of the antibody against VEGF to be used in the present invention specifically binds to VEGF.
- An antibody fragment refers to a polypeptide containing a partial region of the antibody of the present invention.
- an antigen-binding fragment is preferred.
- the antigen-binding fragment include, but are not limited to, single-chain antibodies (scFv (single chain Fv)), sc (Fv) 2 ), double-chain antibodies (Fab, Fab′, diabody (diabody (dibodies), dsFv), and F(ab′) 2 .
- the above antibody fragment can be obtained by cleaving the antibody of the present invention with various proteases depending on purposes.
- Fab can be obtained by treating an antibody molecule with papain, and F (ab′) 2 can be obtained by treating an antibody molecule with pepsin. Moreover, Fab′ can be obtained by cleaving the disulfide bond of the above F(ab′) 2 hinge region.
- scFv cDNA encoding antibody H chain V region and L chain V region is obtained and then DNA encoding scFv is constructed.
- the DNA is inserted into an expression vector, and then the expression vector is introduced into a host organism for expression, so that scFv can be produced.
- a diabody In the case of a diabody, cDNA encoding antibody H chain V region and L chain V region is obtained, and then DNA encoding scFv is constructed so that a peptide linker has an amino acid sequence with a length of 8 or less residues.
- the DNA is inserted into an expression vector, and then the expression vector is introduced into a host organism for expression, so that a diabody can be produced.
- dsFv cDNA encoding antibody H chain V region and L chain V region is obtained, and then DNA encoding dsFv is constructed.
- the DNA is inserted into an expression vector, and then the expression vector is introduced into a host organism for expression, so that dsFv can be produced.
- examples of the nucleotide sequence of DNA encoding a heavy chain variable region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 33 or 37
- examples of the nucleotide sequence of DNA encoding a light chain variable region include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 35 or 39.
- antibody fragment of the present invention include, but are not limited to, an antibody fragment comprising:
- VH heavy chain variable region
- CDR-H1 heavy chain CDR1
- CDR-H2 heavy chain CDR2
- CDR-H3 heavy chain CDR3
- VL light chain variable region
- antibody fragment of the present invention include, but are not limited to, an antibody fragment comprising:
- a heavy chain variable region comprises heavy chain CDR1 (CDR-H1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 24, heavy chain CDR2 (CDR-H2) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 26 and/or heavy chain CDR3 (CDR-H3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 28, and/or a light chain variable region comprises light chain CDR1 (CDR-L1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 30, light chain CDR2 (CDR-L2) comprising or consisting of the amino acid sequence that consists of glycine (G)-threonine (T)-asparagine (N) (amino acid sequence Gly-Thr-Asn), and/or light chain CDR3 (CDR-L3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 32.
- CDR-H1 comprising or consisting of the amino acid sequence represented by SEQ
- examples of the antibody fragment of the present invention include, but are not limited to, an antibody fragment wherein a heavy chain variable region comprises or consists of the amino acid sequence represented by SEQ ID NO: 34 or 38, and/or a light chain variable region comprises or consists of the amino acid sequence represented by SEQ ID NO: 36 or 40.
- An antibody fragment (peptide) comprising CDR is composed of at least one region of VH or VL CDRs (CDR1-3).
- An antibody fragment comprising a plurality of CDRs can be bound directly or via an appropriate peptide linker.
- An antibody fragment comprising CDR can be produced by constructing DNA encoding antibody VH and VL CDRs, inserting the DNA into a prokaryotic expression vector or a eukaryotic expression vector, and then introducing the expression vector into prokaryotes or eukaryotes for expression.
- a peptide comprising CDR can also be produced by a chemical synthesis method such as a Fmoc method (fluorenylmethyloxycarbonyl method) and a tBoc method (t-butyloxycarbonyl method).
- DNA encoding VH CDR1-3 include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 13, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 15 and DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 17, respectively.
- DNA encoding VL CDR1-3 include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 19, DNA comprising or consisting of the nucleotide sequence that consists of thymine (T)-guanine (G)-guanine (G)-guanine (G)-cytosine (C)-adenine (A)-thymine (T)-cytosine (C)-cytosine (C) (also referred to as “nucleotide sequence TGGGCATCC”), and DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 21, respectively.
- examples of DNA encoding VH CDR1-3 include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 23, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 25 and DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 27, respectively.
- DNA encoding VL CDR1-3 include, but are not limited to, DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 29, DNA comprising or consisting of the nucleotide sequence that consists of guanine (G)-guanine (G)-thymine (T)-adenine (A)-cytosine (C)-cytosine (C)-adenine (A)-adenine (A)-cytosine (C) (may also be referred to as “nucleotide sequence GGTACCAAC”), and DNA comprising or consisting of the nucleotide sequence represented by SEQ ID NO: 31, respectively.
- Binding affinity can be determined by the binding constant (KA) and dissociation constant (KD). Affinity equilibrium constant (K) is expressed by the ratio of the KA/KD. Its binding affinity can be detected as follows.
- Binding constant (KA) and dissociation constant (KD) can be measured using surface plasmon resonance (SPR), and known devices and methods for detecting binding rates in real time and monitoring can be employed (e.g. Biacore®-3000 (GE Healthcare), ProteON XPR36 (Bio-Rad), etc.).
- the antibody of the present invention can inhibit its target with an IC50 of 1 ⁇ 10 ⁇ 7 mol/L or less (for example, 1 ⁇ 10 ⁇ 7 mol/L or less, 1 ⁇ 10 ⁇ 8 mol/L or less, 1 ⁇ 10 ⁇ 9 mol/L or less, preferably 1 ⁇ 10 ⁇ 10 mol/L or less, more preferably 1 ⁇ 10 ⁇ 11 mol/L or less).
- the present invention provides an antibody that binds to a site to which the antibody against VEGF of the present invention binds.
- examples of the antibody against VEGF of the present invention include an antibody that binds to a site, to which a monoclonal antibody against VEGF that binds to VEGF with a dissociation constant of 1 ⁇ 10 ⁇ 11 mol/L or less.
- a site to which the anti-VEGF antibody of the present invention binds is not limited, as long as it is at least a partial region of VEGF that is an antigen.
- Examples of a site to which the anti-VEGF antibody of the present invention binds include, at least one region selected from the group consisting of exon 1, 2, 3, 4, 5, 6a, 6b, 7a, 7b, and 8a, and exon 1 to 5 regions are preferred.
- Persons skilled in the art can specify exon 1 to 5 regions of various VEGFs based on known information such as Genbank.
- the amino acid sequences of mouse, rat, canine, human VEGF exon 1 to 5 are represented by SEQ ID NO: 51, 52, 53 and 54, respectively.
- sites e.g., regions and epitopes
- polypeptides containing them to which the anti-VEGF antibody of the present invention binds, based on the Description and known techniques such as epitope mapping or X-ray structural analysis.
- an antibody that binds to a site, to which the above monoclonal antibodies bind may be a polyclonal antibody or a monoclonal antibody.
- the antibody may be a recombinant antibody, such as a chimeric antibody, a humanized antibody, or a caninized antibody.
- an antibody that binds to a site, to which the antibody against VEGF of the present invention binds competes with the antibody against VEGF of the present invention for binding with VEGF.
- an antibody competing with the antibody against VEGF of the present invention for binding with VEGF has specificity and/or activity equivalent to that of the antibody of the present invention (Specifically, a monoclonal antibody against VEGF, which binds to VEGF with a dissociation constant of 1 ⁇ 10 ⁇ 11 mol/L or less).
- a competition test using an antibody is a technique established in the technical field of antibodies as a technique for examining if a set of antibodies bind to the same (or redundant) site (see e.g., Ju-Won Kwak et al., Journal of Immunological Methods 191 (1996) 49-54).
- the competition test when the binding of the antibody against VEGF of the present invention is competitively inhibited by an anti-VEGF antibody to be tested, the test subject anti-VEGF antibody can be identified to be an antibody that binds to a site, to which the antibody against VEGF of the present invention binds.
- the test method does not require information about the structure of the relevant site for examining if a set of antibodies bind to the same (or redundant) site.
- the pharmaceutical composition of the present invention comprises the antibody or a fragment thereof described in the above “3. Antibody against VEGF” as an active ingredient, and is used for a target disease.
- the pharmaceutical composition of the present invention is used for prevention or treatment of target diseases and is effective for the prevention or the treatment.
- VEGF-associated diseases including symptoms (conditions)
- examples of such diseases include solid tumors, cancers including particularly problematic metastatic tumors, and VEGF-mediated eye diseases, and other immune diseases.
- Tumor vascular structures are known to supply blood, and also function as a vascular niche environment supporting cancer stem cells.
- the vascular niche environment refers to an environment involving maintenance, proliferation and differentiation of hematopoietic stem cells that are sources of blood and blood vessels, and is considered to be important for cancer stem cell proliferation.
- cancer cells are characterized by high proliferative ability, unlimited number of cell divisions, and ability to cause invasion and metastasis to peripheral tissues.
- these partial cancer cells are cells having properties observed in common among stem cells such as embryonic stem cells and somatic stem cells, including self-replicating ability, by which the cells can create cells completely identical thereto, and pluripotency, by which the cells are capable of differentiating into many cell types.
- the partial cancer cells are considered to be cancer stem cells that function as a source for creating the majority of peripheral cancer cells via differentiation while maintaining cells identical to themselves in the cancer tissue through self-replication.
- Cancer stem cells are considered to be a major cause of cancer recurrence and cancer metastasis, and thus importance of targeting cancer stem cells in cancer treatment has been indicated. If significant inhibition of cancer stem cell proliferation within tumor tissue becomes possible, a novel treatment capable of killing entire cancer cells effectively can be developed.
- cancer sternness in the present invention refers to a property of a cell population exerting the properties of cancer stem cells. Specifically, cancer sternness refers to properties of having self-replication and pluripotency peculiar to stem cells, and a property of cells functioning as a source of cancer.
- examples of cancer include brain tumor, cervical cancer, esophageal cancer, cancer on the tongue, lung cancer, breast cancer, pancreatic cancer, gastric cancer, cancer of small bowel, duodenal cancer, colon cancer, bladder cancer, renal cancer, liver cancer, prostate cancer, uterine cancer, uterine cervix cancer, ovarian cancer, thyroid cancer, gallbladder cancer, pharyngeal cancer, sarcoma, melanoma, leukemia, lymphoma, and multiple myeloma.
- VEGF-mediated eye disease is VEGF-associated disease that is caused by pathological angiogenesis or vascular hyperpermeability in the eye. That is, the VEGF-mediated eye disease can be treated or prevented by inhibiting binding of VEGF to a VEGF receptor using the anti-VEGF antibody.
- Such disease examples include age-related macular degeneration (including special types such as polypoidal choroidal vasculopathy and retinal angiomatous proliferation), diabetic retinopathy, diabetic macular edema, neovascular glaucoma, retinal vein occlusion, retinopathy of prematurity, choroidal neovascularization associated with pathological myopia, pterygium, rubeosis, pannus, Stevens-Johnson syndrome, and immunological rejection of transplanted tissue (e.g., corneal tissue) of the eye.
- age-related macular degeneration including special types such as polypoidal choroidal vasculopathy and retinal angiomatous proliferation
- diabetic retinopathy diabetic macular edema
- neovascular glaucoma retinal vein occlusion
- retinopathy of prematurity retinopathy of prematurity
- choroidal neovascularization associated with pathological myopia pterygium
- pathological angiogenesis refers to angiogenesis that takes place, in morbidity or a state inducing morbidity, when new blood vessels grow excessively, insufficiently, or inappropriately (for example, the position or timing is undesirable from a medical viewpoint, or in development) compared with normal physiological angiogenesis (vasculogenesis).
- the term “treatment”, “treat”, or “treating” refers to contacting (for example, administrating) the antibody or a fragment thereof or the pharmaceutical composition of the present invention (hereafter, may also be referred to as “the pharmaceutical composition of the present invention or the like”) with a subject after the onset of the disease, thereby alleviating the symptoms of the disease, compared to when the subject is not contacted with the pharmaceutical composition of the present invention or the like.
- the treatment as used herein does not always refer to completely suppressing the symptoms of a disease.
- onset of a disease refers to the appearance of the symptoms of the disease in the body.
- prevention refers to contacting (for example, administrating) the pharmaceutical composition of the present invention or the like with a subject before the onset of a disease, thereby alleviating symptoms of the disease after the onset of the disease, compared to when the subject is not contacted with the pharmaceutical composition of the present invention or the like.
- prevention does not always refer to completely suppressing the onset of the disease.
- the pharmaceutical composition of the present invention can comprise, in addition to the antibody against VEGF of the present invention, a pharmaceutically acceptable carrier.
- a pharmaceutically acceptable carrier refers to any carrier (e.g., liposome, lipid microcapsule, and micelle), diluent, excipient, wetting agent, buffering agent, suspending agent, lubricant, adjuvant, emulsifier, disintegrator, absorbent, preservative, surfactant, colorant, flavoring, or sweetener appropriate for the pharmaceutical composition for immune diseases.
- compositions of the present invention or the like can be formulated into preparations for injection, freeze-dried products, tablets, hard capsules, soft capsules, granules, powders, pills, syrups, suppositories, cataplasm, ointments, cream pharmaceuticals, eye drops, and the like.
- Liquid preparations such as preparations for injection may be in the form of powder to be prepared before use (for example, freeze-dried powder), which is dissolved in saline or the like before use.
- the pharmaceutical composition of the present invention or the like can be administered topically or systemically through any means known by persons skilled in the art.
- the route of administration of the pharmaceutical composition of the present invention can be oral administration and parenteral administration.
- intratissue administration e.g., subcutaneous administration, intraperitoneal administration, intramuscular administration, and intravenous administration
- intradermal administration e.g., local administration (e.g., transdermal administration) or transrectal administration
- the pharmaceutical composition of the present invention can be administered in dosage forms appropriate for these routes of administration.
- the dosage of the pharmaceutical composition of the present invention or the like can be varied depending on factors such as a subject's age, body weight, health status, gender, and symptoms, and the animal species of a subject, the route of administration, the frequency of administration, and a dosage form, and specific procedures for administration can be determined by persons skilled in the art.
- the dosage of the antibody of the present invention for treatment of cancer ranges from, for example, 0.1 mg to 100 mg/day, preferably 1 mg to 15 mg/day, and more preferably 2 mg to 12 mg/day per kg body weight of a subject, but the examples are not limited thereto.
- the frequency of administration the pharmaceutical composition can be administered once to 5 times a day.
- the dosage of the antibody of the present invention for treatment of VEGF-mediated eye disease ranges from, for example, 0.01 mg to 100 mg/eye, and more preferably, 0.1 mg to 10 mg/eye.
- the antibody can be administered once a day to once every two months, but the examples are not limited thereto.
- the timing of administration can be appropriately determined depending on symptoms, and several dosages can be administered simultaneously or separately at intervals.
- the pharmaceutical composition of the present invention may be administered to a subject before the onset of a disease or after the onset of the disease.
- the pharmaceutical composition of the present invention can be administered to a mammal as a subject.
- mammals include mice, rats, hamsters, guinea pigs, rabbits, cats, dogs, goats, pigs, sheep, cattle, horses, monkeys, and humans.
- a cancer or a VEGF-mediated eye disease can be treated or prevented by administrating to a subject the antibody against VEGF or a fragment thereof or the pharmaceutical composition comprising the same. That is, the present invention provides a method for treating or preventing a cancer or a VEGF-mediated eye disease, comprising a step of administering to a subject a therapeutically effective amount of the antibody of the present invention or a fragment thereof or the pharmaceutical composition comprising the same.
- the therapeutically effective amount of the antibody of the present invention or a fragment thereof or the pharmaceutical composition comprising the same is varied depending on factors such as a subject's age, body weight, health status, gender, and symptoms, the route of administration, the frequency of administration, and a dosage form.
- subject includes subjects in need of treatment or prevention of a cancer or a VEGF-mediated eye disease.
- mammals to be subjected to treatment or prevention as “subject” are as described above.
- cancer In the method for treating or preventing a cancer or a VEGF-mediated eye disease of the present invention, “cancer”, “VEGF-mediated eye disease”, “treatment” and “prevention” are as described above.
- the dosage form, the route of administration, the dosage, the timing of administration and the like of the antibody of the present invention or a fragment thereof or the pharmaceutical composition comprising the same are also as described above.
- the antibody of the present invention inhibits binding of VEGF to a VEGF receptor, and thus can inhibit angiogenesis resulting from the binding.
- the present invention provides an angiogenesis inhibitor comprising the antibody or a fragment thereof described in the above “3. Antibody against VEGF” as an active ingredient.
- the angiogenesis inhibitor of the present invention can be used as a reagent or used for treatment of a mammal, and its dosage form, additives, route of administration, administration target, dosage and the like can be appropriately selected according to the description of the above “4. Pharmaceutical composition”.
- the angiogenesis inhibitor of the present invention may be an inhibitor comprising the antibody of the present invention or a fragment thereof alone.
- the antibody of the present invention or a fragment thereof can be used in a method for treating or preventing a cancer or a VEGF-mediated eye disease, or the manufacture of a medicament for treatment or prevention of a cancer or a VEGF-mediated eye disease.
- the present invention provides the anti-VEGF antibody of the present invention or a fragment thereof for use in the method for treating or preventing a cancer or a VEGF-mediated eye disease.
- the present invention provides the anti-VEGF antibody of the present invention or a fragment thereof for use in the manufacture of a medicament for treatment or prevention of a cancer or a VEGF-mediated eye disease.
- the present invention provides the anti-VEGF antibody or a fragment thereof for use in the manufacture of an angiogenesis inhibitor.
- cancer cancer
- VEGF-mediated eye disease treatment
- prevention prevention
- the pharmaceutical composition of the present invention can be used for administration in combination with at least one of other anticancer agents.
- anticancer agents to be used in the present invention include sorafenib (Nexavar®), sunitinib (Sutent®), bevacizumab (Avastin®), cisplatin (cDDP), carboplatin (Paraplatin®), paclitaxel (Taxol®), docetaxel (Taxotere®), gemcitabine hydrochloride (Gemzar®), gefitinib (Iressa®), erlotinib (Tarceva®), irinotecan hydrochloride (CPT-11), and 5-fluorouracil (5-FU).
- the term “used in combination” in the present invention refers to simultaneous administration of or separate administration of the pharmaceutical composition of the present invention and at least one of the above anticancer agents.
- the term “simultaneously” means that administration is performed at the same timing in a single administration schedule, but the times; that is, hours and minutes of administration are not required to be completely the same.
- the term “separately” means that administration is performed at different timings in a single administration schedule.
- the dosage form, the route of administration, and the administration target of the pharmaceutical composition or the like and an anticancer agent to be used for combination therapy in the present invention are not particularly limited, and can be appropriately selected according to the description of the above “4.
- Pharmaceutical composition Moreover, the dosage forms or dosages of agents to be used in combination may differ from each other, and can be appropriately adjusted depending on a combination employed.
- the dosage can be decreased as appropriate. Therefore, when the pharmaceutical composition of the present invention is combined with another anticancer agent, the following combinations of
- a subeffective dose of the pharmaceutical composition of the present invention and a subeffective dose of another anticancer agent can be employed.
- the two can be administered in combination in such an aspect, when the combination can exert pharmacological effects.
- the monoclonal antibody of the present invention or a fragment thereof can be included in a reagent for detection of VEGF or a kit. That is, the present invention provides a reagent and a kit comprising the monoclonal antibody of the present invention or a fragment thereof.
- the reagent and the kit of the present invention can be used as a reagent for detecting VEGF or a kit, for example.
- the monoclonal antibody of the present invention or a fragment thereof may be treated by a method such as freezing for easy handling, and then directly or mixed with a known pharmaceutically acceptable carrier, such as an excipient, an extending agent, a binder, and a lubricant, and a known additive (including a buffering agent, a tonicity agent, a chelating agent, a colorant, a preservative, an aroma chemical, a flavoring agent, a sweetening agent and the like), for example.
- a known pharmaceutically acceptable carrier such as an excipient, an extending agent, a binder, and a lubricant
- a known additive including a buffering agent, a tonicity agent, a chelating agent, a colorant, a preservative, an aroma chemical, a flavoring agent, a sweetening agent and the like
- the kit of the present invention can comprise, in addition to the monoclonal antibody of the present invention or a fragment thereof, a buffer, an enzyme solution, a secondary antibody, a solution for dilution, instructions, and the like.
- VEGF 165 Human recombinant VEGF 165 (hereafter, may also be referred to as “VEGF”, “rhVEGF 165 ” or “rhVEGF”) expressed by CHO cells (PROSPEC) was used as an antigen.
- VEGF Human recombinant VEGF 165
- rhVEGF 165 Human recombinant VEGF 165 expressed by CHO cells (PROSPEC) was used as an antigen.
- PROSPEC Human recombinant VEGF 165 expressed by CHO cells
- KLH Keyhole Limpet Hemocyanin
- VEGF and KLH were mixed so that the molar ratio of VEGF to KLH was 4:1 in PBS ( ⁇ ) (0.01 M sodium-phosphate buffer, 0.138 M NaCl, 0.0027 M KCl, pH 7.4), and then 1% glutaraldehyde was added, and then the mixture was allowed to react at room temperature for 1 hour, thereby cross-linking KLH and rhVEGF 165 .
- PBS ⁇
- glutaraldehyde 1% glutaraldehyde was added, and then the mixture was allowed to react at room temperature for 1 hour, thereby cross-linking KLH and rhVEGF 165 .
- the thus prepared protein may also be referred to as “KLH-VEGF” in the followings.
- rhVEGF or KLH-VEGF and Freund's complete adjuvant were mixed in equal amounts, and then the mixture was administered intraperitoneally to BALB/c mice in an amount of 100 ⁇ l (about 40 ⁇ g/mouse). Subsequently, about 40 ⁇ g of KLH-VEGF or rhVEGF was administered with an incomplete Freund's adjuvant intraperitoneally to mice once every 3 weeks for boosters (additional immunization). Boosters were performed not more than 12 times. Final immune stimulation was performed by administering saline containing about 40 ⁇ g of KLH-VEGF or rhVEGF into the tail vein of each mouse on day 3 before splenectomy.
- Isolated splenocytes and a mouse myeloma cell line, P3-x63-Ag8U. 1 were mixed at 5:1 in terms of the number of cells, and then cell fusion was performed using 50% polyethylene glycol 3350 (Sigma).
- Cells were suspended in HAT medium (RPMI1640 medium supplemented with 1/2 ⁇ HT (MP), 1/2 ⁇ HAT (MP), 10% FBS, 50 ng/L mouse IL-6, and 500 mg/mL D-Glucose), dispensed in a 96-well microculture plate and then cultured.
- HAT medium RPMI1640 medium supplemented with 1/2 ⁇ HT (MP), 1/2 ⁇ HAT (MP), 10% FBS, 50 ng/L mouse IL-6, and 500 mg/mL D-Glucose
- rhVEGF 165 was diluted with PBS ( ⁇ ), dispensed into a 96-well ELISA plate (Nunc) at 1 ⁇ g/well, allowed to stand overnight at 4° C., and thus bound onto the plate surface. Next, after 3 times of washing with 350 ⁇ L of 0.05% Tween 20-containing PBS ( ⁇ ) (hereafter, denoted as “PBS-T”), 300 ⁇ L of 1% skim milk-containing PBS-T was dispensed into each well, followed by blocking at room temperature for 1 hour.
- PBS-T Tween 20-containing PBS
- the culture supernatant of the hybridomas was dispensed into an ELISA plate on which rhVEGF 165 had been immobilized, and then allowed to react for 1 hour at room temperature.
- 100 ⁇ L of peroxidase (hereafter, denoted as “POD”)-labeled anti-mouse immunoglobulin antibody (BETHYL) diluted 10000-fold was dispensed into each well, and then allowed to react for 1 hour at room temperature.
- POD peroxidase
- BETHYL anti-mouse immunoglobulin antibody
- An anti-VEGF antibody binds to VEGF to block the binding of VEGF to its receptors, VEGFR-1 and/or VEGFR-2, to be able to inhibit signal transduction through mediation of VEGF.
- KLHa505 and KLHb1501 were separated and purified from the culture supernatants of the two positive clones using Protein G.
- IgG Fc-VEGFR-1 or IgG Fc-VEGFR2 was immobilized on a 96-well ELISA plate. After blocking with 2% bovine serum albumin, a purified antibody mixed with rhVEGF was added to the plate, followed by reaction at room temperature for 1 hour. A solution was prepared by mixing with rhVEGF, and then washed 3 times with 0.05% TWEEN® 20-containing TBS (TBS: 50 mM Tris-HCl (pH7.4), 500 mM NaCl; hereafter, referred to as “TBS-T”). Thereafter, through color development using rabbit anti-human VEGF polyclonal antibody-HRP, the rhVEGF content was determined.
- Kd of KLHa505 and Kd of KLHb1501 for binding to VEGF were determined.
- rhVEGF was immobilized on a CMS chip, serial dilution was performed twice with HBS-EP buffer, and then each antibody was injected at a flow rate of 30 ⁇ L/min.
- Kd is K off /K on .
- the dissociation constant for an existing antibody for example, the dissociation constant for Avastin (bevacizumab) is 4.9 nmol/L
- the dissociation constants for the antibodies of the present invention were each 1/1000 or less that for the existing antibody. Hence, the binding activity of the antibodies that bind to VEGF is significantly high.
- the antibodies high-affinity anti-VEGF antibodies having extremely high affinity for VEGF were obtained.
- HUVEC normal human umbilical vein-derived endothelial cells
- the high-affinity antibodies of the present invention can inhibit blood vessel-derived cells' cell proliferation activity due to VEGF, and can suppress angiogenesis.
- KLHa505 and KLHb1501 were initiated. Regarding the dosage of KLHa505, administration was performed for 5 mouse per group, and thus (i) model control group (saline alone), (ii) 5 mg/kg KLHa505 group, (iii) 2.5 mg/kg KLHa505 group and (iv) 0.5 mg/kg KLHa505 group were prepared. Similar administration groups were prepared also for KLHb1501.
- KLHa505 or KLHb1501 dissolved in saline in an amount of 200 ⁇ L per mouse was administered once on day 2 and on day 5 in each week through intraperitoneal injection.
- 200 ⁇ L of saline was simultaneously administered by the same method.
- administration was continuously performed for 18 days for KLHa505 and 22 days for KLHb1501.
- KLHa505 and KLHb1501 were demonstrated to have capability of significantly inhibiting in vivo tumor growth ( FIG. 3 and FIG. 4 ).
- mRNAs were extracted from hybridomas that produce KLHa505 and KLHb1501, cDNAs were prepared using reverse transcriptase. With the use of these cDNAs as templates, the nucleotide sequences of mouse IgG antibody heavy chain and light chain variable regions were amplified by PCR, and then the nucleotide sequences were analyzed, thereby the amino acid sequences of complementarity determining regions contained in the light chain and heavy chain variable regions were determined.
- amino acid sequences of CDR1, CDR2 and CDR3 of KLHa505 and KLHb1501 variable region were determined using IMGT/V-QUEST software, version 3.3.0, on the immunoglobulin database “the international ImMunoGeneTics information System®” (IMGT/GENE-DB).
- the KLHa505 antibody heavy chain variable region gene (nucleotide sequence: SEQ ID NO: 33, amino acid sequence: SEQ ID NO: 34) and light chain variable region gene (nucleotide sequence: SEQ ID NO: 35, amino acid sequence: SEQ ID NO: 36) were cloned. Next, these genes were each ligated in-frame to the nucleotide sequence of the human IgG1 heavy chain constant region gene or light chain ( ⁇ chain) constant region gene.
- PCR was carried out using a primer having the 5′-terminal nucleotide sequence of the heavy chain variable region, Kozak sequence, and a restriction enzyme Mlu I sequence and an antisense primer having a complementary sequence of the 3′-terminal nucleotide sequence and a restriction enzyme Nhe I sequence.
- PCR was carried out using a primer having the 5′-terminal nucleotide sequence of the light chain variable region gene and a restriction enzyme BamH I sequence, and an antisense primer having a complementary sequence of the 3′-terminal nucleotide sequence and a restriction enzyme BsiW I sequence.
- the thus obtained amplification product was treated with restriction enzymes Mlu I and Nhe I or BamH I and BsiW I, and then the resultant was incorporated into the Mlu I-Nhe I site of the human IgG1 heavy chain constant region expression plasmid (pEF6/G1) or the BamH I-BsiW I site of the human Ig light chain ( ⁇ chain) constant region expression plasmid (pEF1/G1k).
- the human IgG1 heavy chain constant region gene (nucleotide sequence: SEQ ID NO: 41, amino acid sequence: SEQ ID NO: 42) was cloned into the plasmid pEF6/myc-His (Invitrogen).
- the human Ig light chain ( ⁇ chain) constant region gene (nucleotide sequence: SEQ ID NO: 43, amino acid sequence: SEQ ID NO: 44) was cloned into the plasmid pEF1/myc-His (Invitrogen).
- the mouse heavy chain variable region and the human heavy chain constant region were linked by a restriction enzyme Nhe I, and the mouse light chain variable region and the human light chain constant region were linked by a restriction enzyme BsiW I sequence.
- the plasmids pEF6/G1-KLHa505 and pEF1/G1-K-KLHa505 were introduced into 293F cells using a FreeStyleTM 293 Expression System (Thermo Fisher Scientific K.K.), and thus the human IgG1 chimeric KLHa505 antibody (hereafter, may also be referred to as “KLHa505HC antibody”) was transiently expressed.
- KLHa505HC antibody was purified from a culture supernatant of 293F cells, into which the chimeric gene had been introduced, using Protein G Sepharose 4 Fast Flow (GE Healthcare Japan).
- a solvent was substituted with D-PBS ( ⁇ ) using an Amicon Ultra-15 centrifugal filter unit (Merck millipore).
- the concentration of the purified KLHa505HC antibody was determined using Nano drop 1000 (Thermo Fisher Scientific K.K.). Binding of the KLHa505HC antibody to VEGF was evaluated by the method described in the above “Purification of monoclonal antibody (4) ELISA”. As a result, specific binding of the KLHa505HC antibody to VEGF was confirmed.
- the KLHb1501 antibody heavy chain variable region gene (nucleotide sequence: SEQ ID NO: 37, amino acid sequence: SEQ ID NO: 38) and light chain variable region gene (nucleotide sequence: SEQ ID NO: 39, amino acid sequence: SEQ ID NO: 40) were cloned. Next, these genes were each ligated in-frame to the nucleotide sequence of a human IgG1 heavy chain constant region gene or light chain ( ⁇ chain) constant region gene.
- PCR was carried out using a primer having the 5′ terminal nucleotide sequence of the heavy chain variable region, Kozak sequence, and a restriction enzyme Xho I sequence, and an antisense primer having the complementary sequence of the 3′ terminal nucleotide sequence and a restriction enzyme Nhe I sequence.
- PCR was carried out using a primer having the 5′ terminal nucleotide sequence of the light chain variable region gene and a restriction enzyme EcoR I sequence, and an antisense primer having the complementary sequence of the 3′ terminal nucleotide sequence and a restriction enzyme Avr II sequence.
- the thus obtained amplification products were treated with restriction enzymes Xho I and Nhe I, or EcoR I and Avr II, and then incorporated into the Xho I-Nhe I site of a human IgG1 heavy chain constant region expression plasmid (pFUSE-CHIg-hG1; InvivoGen), or the EcoR I-Avr II site of a human Ig light chain ( ⁇ chain) constant region expression plasmid (pFUSE2ss-CLIg-hl2: InvivoGen).
- pFUSE-CHIg-hG1 the human IgG1 heavy chain constant region gene (nucleotide sequence: SEQ ID NO: 41, amino acid sequence: SEQ ID NO: 42) was cloned.
- the human Ig light chain ( ⁇ chain) constant region gene (nucleotide sequence: SEQ ID NO: 43, amino acid sequence: SEQ ID NO: 44) was cloned.
- the mouse heavy chain variable region and the human heavy chain constant region were linked by the restriction enzyme Nhe I, and the mouse light chain variable region and the human light chain constant region were linked by the restriction enzyme Avr II sequence.
- Human colon cancer cell line LS174T cells were subcutaneously injected at a rate of 2 ⁇ 10 6 cells per mouse into the right flanks of the 20 immunodeficient mice.
- 0.9% NaCl control group A
- KLHb1501HC antibody control group B
- the KLHb1501HC antibody was administered to the mice of control group B twice a week at 0.5 mg/Kg, 2.5 mg/Kg, or 5 mg/Kg.
- 0.9% NaCl was administered twice a week to the mice of control group A.
- group A (0.9% NaCl control) is indicated with ( ⁇ )
- group B (mice injected with the anti-VEGF antibody) is indicated with ( ⁇ : 0.5 mg/Kg), ( ⁇ : 2.5 mg/Kg), or ( ⁇ : 5.0 mg/Kg).
- significant decreases in tumor volume were observed in mice injected with the KLHb1501HC antibody.
- the KLHa505 antibody heavy chain variable region gene (nucleotide sequence: SEQ ID NO: 33, amino acid sequence: SEQ ID NO: 34) and light chain variable region gene (nucleotide sequence: SEQ ID NO: 35, amino acid sequence: SEQ ID NO: 36) were cloned. Next, these genes were each ligated in-frame to the nucleotide sequence of the canine IgGB heavy chain constant region gene or light chain ( ⁇ chain) constant region gene.
- PCR was carried out using a primer having the 5′-terminal nucleotide sequence of the heavy chain variable region, Kozak sequence, and a restriction enzyme EcoR V sequence, and an antisense primer having a complementary sequence of the 3′-terminal nucleotide sequence and a restriction enzyme Nhe I sequence.
- PCR was carried out using a primer having the 5′-terminal nucleotide sequence of the light chain variable region gene and a restriction enzyme EcoR I sequence, and an antisense primer having a complementary sequence of the 3′-terminal nucleotide sequence and a restriction enzyme Xho I sequence.
- the thus obtained amplification product was treated with restriction enzymes Eco V and Nhe I, or EcoR I and Xho I, and then the resultant was incorporated into the EcoR V-Nhe I site of a canine IgGB heavy chain constant region expression plasmid (pFUSE2ss-CHIg-dGB), or the EcoR I-Xho I site of a canine Ig light chain constant region expression plasmid (pFUSE2ss-CHIg-dK).
- pFUSE2ss-CHIg-dGB the canine IgGB heavy chain constant region gene (nucleotide sequence: SEQ ID NO: 45, amino acid sequence: SEQ ID NO: 46) was cloned into plasmid pFUSE2ss-CLIg-hl2 (InvivoGen).
- pFUSE2ss-CHIg-dK the canine Ig light chain ( ⁇ chain) constant region gene (nucleotide sequence: SEQ ID NO: 47, amino acid sequence: SEQ ID NO: 48) was cloned into plasmid pFUSE2ss-CLIg-hl2.
- the mouse heavy chain variable region and the canine heavy chain constant region were linked by the restriction enzyme Nhe I sequence, and the mouse light chain variable region and the canine light chain constant region were linked by the restriction enzyme Xho I sequence.
- the KLHb1501 antibody heavy chain variable region gene (nucleotide sequence: SEQ ID NO: 37, amino acid sequence: SEQ ID NO: 38) and light chain variable region gene (nucleotide sequence: SEQ ID NO: 39, amino acid sequence: SEQ ID NO: 40) were cloned. Next, these genes were each ligated in-frame to the nucleotide sequence of a canine IgGB heavy chain constant region gene or light chain ( ⁇ chain) constant region gene.
- PCR was carried out using a primer having the 5′ terminal nucleotide sequence of the heavy chain variable region, Kozak sequence, and a restriction enzyme EcoR V sequence, and an antisense primer having the complementary sequence of the 3′ terminal nucleotide sequence and a restriction enzyme Nhe I sequence.
- PCR was carried out using a primer having the 5′ terminal nucleotide sequence of the light chain variable region gene and a restriction enzyme EcoR I sequence and an antisense primer having the complementary sequence of the 3′ terminal nucleotide sequence and a restriction enzyme Sca I sequence.
- the thus obtained amplification products were treated with restriction enzymes Eco V and Nhe I, or EcoR I and Sca I, and then incorporated into the EcoR V-Nhe I site of a canine IgGB heavy chain constant region expression plasmid (pFUSE2ss-CHIg-dGB) or the EcoR I-Sca I site of a canine Ig light chain constant region expression plasmid (pFUSE2ss-CHIg-dK).
- pFUSE2ss-CHIg-dGB the canine IgGB heavy chain constant region gene (nucleotide sequence: SEQ ID NO: 45, amino acid sequence: SEQ ID NO: 46) was cloned to plasmid pFUSE2ss-CLIg-hl2 (InvivoGen).
- pFUSE2ss-CHIg-dK the canine Ig light chain ( ⁇ chain) constant region gene (nucleotide sequence: SEQ ID NO: 49, amino acid sequence: SEQ ID NO: 50) was cloned into plasmid pFUSE2ss-CLIg-hl2.
- the mouse heavy chain variable region and the canine heavy chain constant region were linked by the restriction enzyme Nhe I, and the mouse light chain variable region and the canine light chain constant region were linked by the restriction enzyme Sca I sequence.
- VEGF165 or canine VEGFA were diluted with TBS, dispensed to a 96-well ELISA plate (Nunc) at 20 ng per well, and then incubated at 37° C. for 1 hour for binding to the plate surface. Next, after 3 times of washing with 300 ⁇ L of 0.02% Tween 20-containing PBS ( ⁇ ) (hereafter, denoted as “PBS-T”), 300 ⁇ L of 3% skim milk-containing PBS ( ⁇ ) was dispensed into each well, followed by blocking at 37° C. for 1 hour.
- PBS-T Tween 20-containing PBS
- KLHb1501CC antibody canine-IgGB chimeric KLHb1501 antibody serially diluted from the concentration of 1 ⁇ g/ml was dispensed to an ELISA plate to which VEGF had been immobilized, and then allowed to react at 37° C. for 1 hour.
- a peroxidase-labeled anti-canine immunoglobulin antibody BETHYL
- TMB Single Solution was added for color development at room temperature.
- compositions comprising the canine IgGB chimeric anti-VEGF antibody of the present invention can be used for treatment or prevention of diseases of dogs.
- Human colon cancer cell line LS174T cells were subcutaneously injected at a rate of 2 ⁇ 10 6 cells per mouse to the right flanks of 20 immunodeficient mice.
- 0.9% NaCl control group A
- the KLHb1501CC antibody control group B
- the KLHb1501CC antibody was administered twice a week to the mice of control group B at 0.5 mg/Kg, 2.5 mg/Kg, or 5 mg/Kg.
- 0.9% NaCl was administered twice a week to the mice of control group A.
- KLHb1501CC antibody of the present invention also inhibits (suppresses) in vivo the growth of human tumors.
- a pharmaceutical composition comprising the canine IgGB chimeric anti-VEGF antibody of the present invention is significantly effective for treatment or prevention of cancer.
- Canine bone sarcoma cell line D-17 cells were subcutaneously injected at a rate of 1 ⁇ 10 7 cells per mouse to the right flanks of 20 immunodeficient mice. After the mean tumor volume reached 150 mm 3 , 0.9% NaCl (control group A) or the KLHb1501CC antibody (control group B) was intraperitoneally administered. The KLHb1501CC antibody was administered twice a week to the mice of control group B at 0.5 mg/Kg, 2.5 mg/Kg, or 5 mg/Kg. Similarly to the antibody, 0.9% NaCl was administered twice a week to the mice of control group A.
- KLHb1501CC antibody of the present invention inhibits (suppresses) the growth of tumors of dogs even in vivo.
- a pharmaceutical composition comprising the canine IgGB chimeric anti-VEGF antibody of the present invention is significantly effective for treatment or prevention of cancer of dogs.
- anti-VEGF antibodies three anti-VEGF antibodies including KLHa505HC and KLHb1501HC obtained in Examples 7 and 8 were used.
- VEGF As VEGF, three types of VEGF, (i) VEGF165 containing exon 8a that is the C-terminal region of VEGF, (ii) VEGF121 lacking heparin binding region, and (iii) VEGF165b having an amino acid sequence (exon 8b) differing from the C-terminal region of VEGF165 were used.
- the binding experiment was specifically conducted as follows.
- Human VEGF165 (consisting of exon 1, 2, 3, 4, 5, 7 and 8a), human VEGF165b (consisting of exon 1, 2, 3, 4, 5, 7 and 8b) or human VEGF121 (consisting of exon 1, 2, 3, 4, 5 and 8a) was diluted with TBS, dispensed to a 96-well ELISA plate (Nunc) at 20 ng per well, and then incubated at 37° C. for 1 hour, for binding onto the plate surface.
- TBS 96-well ELISA plate
- PBS-T 300 ⁇ L of 0.02% Tween 20-containing PBS ( ⁇ ) (hereafter, denoted as “PBS-T”)
- 300 ⁇ L of 3% skim milk-containing PBS ( ⁇ ) was dispensed to each well, followed by blocking at 37° C. for 1 hour.
- the KLHa505HC antibody or KLHb1501HC antibody serially diluted from the concentration of 1 ⁇ g/ml was dispensed to an ELISA plate to which VEGF had been immobilized, and then allowed to react at 37° C. for 1 hour.
- a peroxidase-labeled anti-human immunoglobulin antibody prepared to have a concentration of 100 ng/ml was dispensed at 100 ⁇ L per well, and then allowed to react at 37° C. for 1 hour. After washing similarly, TMB Single Solution was added for color development at room temperature. After the reaction was stopped with 1 N sulfuric acid, absorbance at 450 nm was measured using a plate reader (Molecular Devices).
- the result demonstrates that the antibody of the present invention binds to exon 1 to 5 regions of VEGF.
- novel antibodies capable of binding to VEGF with significantly high affinity compared to the prior art can be provided.
- SEQ ID NO: 13 synthetic DNA
- SEQ ID NO: 14 synthetic peptide
- SEQ ID NO: 15 synthetic DNA
- SEQ ID NO: 16 synthetic peptide
- SEQ ID NO: 17 synthetic DNA
- SEQ ID NO: 18 synthetic peptide
- SEQ ID NO: 19 synthetic DNA
- SEQ ID NO: 20 synthetic peptide
- SEQ ID NO: 21 synthetic DNA
- SEQ ID NO: 22 synthetic peptide
- SEQ ID NO: 23 synthetic DNA
- SEQ ID NO: 24 synthetic peptide
- SEQ ID NO: 25 synthetic DNA
- SEQ ID NO: 26 synthetic peptide
- SEQ ID NO: 27 synthetic DNA
- SEQ ID NO: 28 synthetic peptide
- SEQ ID NO: 29 synthetic DNA
- SEQ ID NO: 30 synthetic peptide
- SEQ ID NO: 31 synthetic DNA
- SEQ ID NO: 32 synthetic peptide
- SEQ ID NO: 33 synthetic DNA
- SEQ ID NO: 34 synthetic peptide
- SEQ ID NO: 35 synthetic DNA
- SEQ ID NO: 36 synthetic peptide
- SEQ ID NO: 37 synthetic DNA
- SEQ ID NO: 38 synthetic peptide
- SEQ ID NO: 39 synthetic DNA
- SEQ ID NO: 40 synthetic peptide
- SEQ ID NO: 41 synthetic DNA
- SEQ ID NO: 42 synthetic peptide
- SEQ ID NO: 43 synthetic DNA
- SEQ ID NO: 44 synthetic peptide
- SEQ ID NO: 45 synthetic DNA
- SEQ ID NO: 46 synthetic peptide
- SEQ ID NO: 47 synthetic DNA
- SEQ ID NO: 48 synthetic peptide
- SEQ ID NO: 49 synthetic DNA
- SEQ ID NO: 50-54 synthetic peptide
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Vascular Medicine (AREA)
- Oncology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
Description
- Patent Literature 1: JP Laid-Open Publication No. 2013-502445
- Non Patent Literature 1: Marti et al., Thromb. Haemost. 1999. Supplement 1: 44-52
- Non Patent Literature 2: Matsumoto et al., VEGF Receptor Signal Transduction. Sci. STKE. 2001. re2l
- Non Patent Literature 3: US Ophthalimic Rev., 2013. 6:58-63
(3) A monoclonal antibody that binds to a site to which the monoclonal antibody according to (1) or (2) above binds.
(4) The monoclonal antibody according to any one of (1) to (3) above, wherein the monoclonal antibody is a chimeric antibody or a humanized antibody.
(5) The antibody according to any one of (1) to (4) above, comprising CDR-H1 that comprises the amino acid sequence of SEQ ID NO: 14, CDR-H2 that comprises the amino acid sequence of SEQ ID NO: 16, and CDR-H3 that comprises the amino acid sequence of SEQ ID NO: 18.
(6) The antibody according to any one of (1) to (4) above, comprising CDR-L1 that comprises the amino acid sequence of SEQ ID NO: 20, CDR-L2 that comprises the amino acid sequence of Trp-Ala-Ser, and CDR-L3 that comprises the amino acid sequence of SEQ ID NO: 22.
(7) The antibody according to any one of (1) to (4) above, comprising:
CDR-H1 that comprises the amino acid sequence of SEQ ID NO: 14, CDR-112 that comprises the amino acid sequence of SEQ ID NO: 16, and CDR-H3 that comprises the amino acid sequence of SEQ ID NO: 18; and
CDR-L1 that comprises the amino acid sequence of SEQ ID NO: 20, CDR-L2 that comprises the amino acid sequence of Trp-Ala-Ser, and CDR-L3 that comprises the amino acid sequence of SEQ ID NO: 22.
(8) The antibody according to any one of (1) to (4) above, comprising CDR-H1 that comprises the amino acid sequence of SEQ ID NO: 24, CDR-H2 that comprises the amino acid sequence of SEQ ID NO: 26, and CDR-H3 that comprises the amino acid sequence of SEQ ID NO: 28.
(9) The antibody according to any one of (1) to (4) above, comprising CDR-L1 that comprises the amino acid sequence of SEQ ID NO: 30, CDR-L2 that comprises the amino acid sequence of Gly-Thr-Asn, and CDR-L3 that comprises the amino acid sequence of SEQ ID NO: 32.
(10) The antibody according to any one of (1) to (4) above, comprising CDR-H1 that comprises the amino acid sequence of SEQ ID NO: 24, CDR-H2 that comprises the amino acid sequence of SEQ ID NO: 26, and CDR-H3 that comprises the amino acid sequence of SEQ ID NO: 28, and, CDR-L1 that comprises the amino acid sequence of SEQ ID NO: 30, CDR-L2 that comprises the amino acid sequence of Gly-Thr-Asn, and CDR-L3 that comprises the amino acid sequence of SEQ ID NO: 32.
(11) The antibody according to (7) or (10) above, further comprising an amino acid sequence derived from a human IgG1 heavy chain constant region and an amino acid sequence derived from a human IgG1 light chain constant region.
(12) The antibody according to (11) above, wherein the amino acid sequence derived from a human IgG1 heavy chain constant region comprises the amino acid sequence of SEQ ID NO: 42, and the amino acid sequence derived from a human IgG1 light chain constant region comprises the amino acid sequence of SEQ ID NO: 44.
(13) The antibody according to (12) above, comprising:
a heavy chain that comprises the amino acid sequence of SEQ ID NO: 34 or 38, and the amino acid sequence of SEQ ID NO: 42; and
a light chain that comprises the amino acid sequence of SEQ ID NO: 36 or 40, and the amino acid sequence of SEQ ID NO: 44.
(14) The antibody according to (7) or (10) above, further comprising an amino acid sequence derived from a canine IgGB heavy chain constant region and an amino acid sequence derived from a canine Ig light chain (κ chain) constant region or a canine Ig light chain (λ chain) constant region.
(15) The antibody according to (14) above, wherein an amino acid sequence derived from a canine IgGB heavy chain constant region comprises the amino acid sequence of SEQ ID NO: 46, an amino acid sequence derived from a canine Ig light chain (κ chain) constant region comprises the amino acid sequence of SEQ ID NO: 48, and an amino acid sequence derived from a canine Ig light chain (λ chain) constant region comprises the amino acid sequence of SEQ ID NO: 50.
(16) The antibody according to (15) above, comprising:
a heavy chain that comprises the amino acid sequence of SEQ ID NO: 34 or 38 and the amino acid sequence of SEQ ID NO: 46; and
a light chain that comprises the amino acid sequence of SEQ ID NO: 36 or 40 and the amino acid sequence of SEQ ID NO: 48 or 50.
(17) A fragment of the monoclonal antibody according to any one of (1) to (16) above.
(18) The fragment according to (17) above, wherein the fragment is an antigen-binding fragment.
(19) The fragment according to (18) above, wherein the antigen-binding fragment is a single-chain antibody or a double-chain antibody.
(20) A hybridoma that produces the monoclonal antibody according to any one of (1) to (3) above.
(21) A pharmaceutical composition comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
(22) The pharmaceutical composition according to (21) above, for use in treatment or prevention of a VEGF-mediated disease.
(23) The pharmaceutical composition according to (22) above, wherein the VEGF-mediated disease is a cancer or a VEGF-mediated eye disease.
(24) The pharmaceutical composition according to (23) above, wherein the treatment or prevention of the cancer or the VEGF-mediated eye disease is by inhibiting angiogenesis or vascular hyperpermeability.
(25) The pharmaceutical composition according to (24) above, wherein the angiogenesis is pathological angiogenesis.
(26) The pharmaceutical composition according to (23) or (24) above, wherein the cancer is solid cancer or hematologic neoplasm.
(27) The pharmaceutical composition according to (23) or (24) above, wherein the cancer is selected from the group consisting of colorectal cancer, rectal cancer, breast cancer, non-small-cell lung cancer, non-Hodgkin's lymphoma (NHL), renal cell cancer, prostate cancer, liver cancer, pancreas cancer, soft tissue sarcoma, Kaposi's sarcoma, carcinoid tumor, head and neck cancer, melanoma, ovarian cancer, mesothelioma, and multiple myeloma.
(28) The pharmaceutical composition according to (23) or (24) above, wherein the VEGF-mediated eye disease is at least one selected from age-related macular degeneration, diabetic retinopathy, diabetic macular edema, neovascular glaucoma, retinal vein occlusion, retinopathy of prematurity, choroidal neovascularization associated with pathological myopia, pterygium, rubeosis, pannus, Stevens-Johnson syndrome, and an immunological rejection in a transplanted tissue of the eye.
(29) An angiogenesis inhibitor comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
(30) A reagent comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
(31) A kit comprising the monoclonal antibody or the fragment thereof according to any one of (1) to (19) above.
(32) A method for treating or preventing a cancer or a VEGF-mediated eye disease, comprising a step of administering to a subject a therapeutically effective amount of the antibody or the fragment thereof according to any one of (1) to (19) above.
(33) The antibody or the fragment thereof according to any one of (1) to (19) above, for use in a method for treating or preventing a cancer or a VEGF-mediated eye disease.
(34) The antibody or the fragment thereof according to any one of (1) to (19) above, for use in the manufacture of a medicament for treatment or prevention of a cancer or a VEGF-mediated eye disease.
(c) a protein comprising an amino acid sequence that has 80% or higher homology (identity) with the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12, and having binding activity to a VEGF receptor.
(iii) an amino acid sequence on which (for example, 1 to 5, preferably 1 to 3, more preferably 1 to 2, and further preferably 1) amino acids are added with respect to the amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10 or 12; and
(iv) an amino acid sequence mutated as a combination of (i) to (iii) above.
a light chain variable region (VL) comprises light chain CDR1 (CDR-L1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 20, light chain CDR2 (CDR-L2) comprising or consisting of the amino acid sequence that consists of tryptophan (W)-alanine (A)-serine (S) (may also be referred to as “amino acid sequence WAS”, “amino acid sequence Trp-Ala-Ser”), and/or light chain CDR3 (CDR-L3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 22.
a light chain variable region comprises light chain CDR1 (CDR-L1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 30, light chain CDR2 (CDR-L2) comprising or consisting of the amino acid sequence that consists of glycine (G)-threonine (T)-asparagine (N) (may also be referred to as “amino acid sequence GTN”, “amino acid sequence Gly-Thr-Asn”) and/or light chain CDR3 (CDR-L3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 32.
a light chain variable region comprises light chain CDR1 (CDR-L1) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 30, light chain CDR2 (CDR-L2) comprising or consisting of the amino acid sequence that consists of glycine (G)-threonine (T)-asparagine (N) (amino acid sequence Gly-Thr-Asn), and/or light chain CDR3 (CDR-L3) comprising or consisting of the amino acid sequence represented by SEQ ID NO: 32.
| TABLE 1 |
| KLHa505 |
| Heavy chain (V-D-J region) |
| Nucleotide | cagatccagttggtgcagtctggacctgagctgaagaagc |
| sequence | ctggagagacagtcaagatctcctgcaaggcttctgggta |
| taccttcacaaactatggaatgaactgggtgaagcaggct | |
| ccaggaaagggtttaaagtggatgggctggataaacacct | |
| acactggagagccaacatatcttgatgacttcaagggacg | |
| gtttgccttctctttggaaacctctgccagcactgcctac | |
| ttgcagatcaacaacctcaaaaatgaggacacgtctacat | |
| atttctgtgcaagattttcctacggtattacctggttctt | |
| cgatgtctggggcgcagggaccacggtcaccgtctcctca | |
| (SEQ ID NO: 33) | |
| Peptide | QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQA |
| sequence | PGKGLKWMGWINTYTGEPTYLDDFKGRFAFSLETSASTAY |
| LQINNLKNEDTSTYFCARFSYGITWFFDVWGAGTTVTVSS | |
| (SEQ ID NO: 34) | |
| Light chain (V-J region) |
| Nucleotide | gacattgtgatgtcacagtctccatcctccctggctgtgt |
| sequence | cagcaggagagaaggtcactatgagctgcaaatccagtca |
| gagtctgctcaacagtagaacccgaaagaactacttggct | |
| tggtaccagcagaaaccagggcagtctcctaaactgctga | |
| tctactgggcatccactagggaatctggggtccctgatcg | |
| cttcacaggcagtggatctgggacagatttcactctcacc | |
| atcagcagtgtgcaggctgaagacctggcagtttattact | |
| gcaagcaatcttataatctgtacacgttcggaggggggac | |
| caagctggaaataaaac (SEQ ID NO: 35) | |
| Peptide | DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLA |
| sequence | WYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLT |
| ISSVQAEDLAVYYCKQSYNLYTFGGGTKLEIK (SEQ ID | |
| NO: 36) | |
| Sequence |
| Heavy chain |
| VH-CDR1 | GYTFTNYG (SEQ ID NO: 14) |
| VH-CDR2 | INTYTGEP (SEQ ID NO: 16) |
| VH-CDR3 | ARFSYGITWFFDV (SEQ ID NO: 18) |
| Light chain |
| VL-CDR1 | QSLLNSRTRKNY (SEQ ID NO: 20) |
| VL-CDR2 | WAS |
| VL-CDR3 | KQSYNLYT (SEQ ID NO: 22) |
| TABLE 2 |
| KLHb1501 |
| Heavy chain (V-D-J region) |
| Nucleotide | gatgtgcagcttcaggagtcgggacctggcctggtgaaac |
| sequence | cttctcagtctctgtccctcacctgcactgtcactggcta |
| ctcaatcaccagtgattatgcctggacctggatccggcag | |
| tttccaggagacaaactggagtggatgggctacataagct | |
| acagtggtagcactcgctacaacccatctctcaaaagtcg | |
| aatctctatcactcgagacacatccaagaaccagttcttc | |
| ctgcacttgaattctgtgactactgaggacacggccacat | |
| atttctgtgcaagagggggggattactacggtagtcgccc | |
| ctggtttgcttactggggccaagggactctggtcactgtc | |
| tctgcag (SEQ ID NO: 37) | |
| Peptide | DVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWTWIR |
| sequence | QFPGDKLEWMGYISYSGSTRYNPSLKSRISITRDTSKNQ |
| FFLHLNSVTTEDTATYFCARGGDYYGSRPWFAYWGQGTL | |
| VTVSA (SEQ ID NO: 38) | |
| Light chain (V-J region) |
| Nucleotide | caggctgttgtgactcaggaatctgcactcaccacatcac |
| sequence | ctggtgaaacagtcacactcacttgtcgctcaagtactgg |
| ggctgttacaattagtaactacgccaactgggtccaagaa | |
| aaaccagatcatttattcactggtctaataggtggtacca | |
| acaaccgagctccagatgttcctgccagattctcaggctc | |
| cctgattggagacaaggctgccctcaccatcacaggggca | |
| cagactgaggatgaggcaatatatttctgtgctctctggt | |
| acagcaaccatttggtgttcggtgaaggaaccaaactgac | |
| tgtcctag (SEQ ID NO: 39) | |
| Peptide | QAVVTQESALTTSPGETVTLTCRSSTGAVTISNYANWVQE |
| sequence | KPDHLFTGLIGGTNNRAPDVPARFSGSLIGDKAALTITGA |
| QTEDEAIYFCALWYSNHLVFGEGTKLTVL (SEQ ID | |
| NO: 40) | |
| Sequence |
| Heavy chain |
| VH-CDR1 | GYSITSDYA (SEQ ID NO: 24) |
| VH-CDR2 | ISYSGST (SEQ ID NO: 26) |
| VH-CDR3 | ARGGDYYGSRPWFAY (SEQ ID NO: 28) |
| Light chain |
| VL-CDR1 | TGAVTISNY (SEQ ID NO: 30) |
| VL-CDR2 | GTN |
| VL-CDR3 | ALWYSNHLV (SEQ ID NO: 32) |
Claims (21)
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2016-001277 | 2016-01-06 | ||
| JP2016001277 | 2016-01-06 | ||
| JPJP2016-001277 | 2016-01-06 | ||
| PCT/JP2017/000101 WO2017119435A1 (en) | 2016-01-06 | 2017-01-05 | High-affinity anti-vegf antibody |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/JP2017/000101 A-371-Of-International WO2017119435A1 (en) | 2016-01-06 | 2017-01-05 | High-affinity anti-vegf antibody |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/229,271 Continuation US11872271B2 (en) | 2016-01-06 | 2021-04-13 | High-affinity anti-VEGF antibody KLHa505 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20200165330A1 US20200165330A1 (en) | 2020-05-28 |
| US11007259B2 true US11007259B2 (en) | 2021-05-18 |
Family
ID=59273696
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/067,931 Active 2037-06-23 US11007259B2 (en) | 2016-01-06 | 2017-01-05 | High-affinity anti-VEGF antibody |
| US17/229,271 Active 2037-02-05 US11872271B2 (en) | 2016-01-06 | 2021-04-13 | High-affinity anti-VEGF antibody KLHa505 |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/229,271 Active 2037-02-05 US11872271B2 (en) | 2016-01-06 | 2021-04-13 | High-affinity anti-VEGF antibody KLHa505 |
Country Status (6)
| Country | Link |
|---|---|
| US (2) | US11007259B2 (en) |
| EP (1) | EP3401331B1 (en) |
| JP (2) | JP6910963B2 (en) |
| KR (1) | KR102293755B1 (en) |
| CN (1) | CN108699141B (en) |
| WO (1) | WO2017119435A1 (en) |
Families Citing this family (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9840553B2 (en) | 2014-06-28 | 2017-12-12 | Kodiak Sciences Inc. | Dual PDGF/VEGF antagonists |
| NZ783685A (en) | 2015-12-30 | 2025-09-26 | Kodiak Sciences Inc | Antibodies and conjugates thereof |
| SG11202008242XA (en) | 2018-03-02 | 2020-09-29 | Kodiak Sciences Inc | Il-6 antibodies and fusion constructs and conjugates thereof |
| CN110031616B (en) * | 2019-04-03 | 2020-07-28 | 浙江众意生物科技有限公司 | Detection kit for auxiliary diagnosis of diseases |
| WO2020237375A1 (en) * | 2019-05-27 | 2020-12-03 | The University Of British Columbia | Conformation-specific epitopes in tau, antibodies thereto and methods related thereof |
| AU2020316498B2 (en) * | 2019-07-19 | 2024-02-29 | Sinocelltech Ltd. | Humanized anti-VEGF monoclonal antibody |
| AU2020316495B2 (en) * | 2019-07-19 | 2024-07-04 | Sinocelltech Ltd | Humanized anti-VEGF Fab antibody fragment and use thereof |
| AU2020364071A1 (en) | 2019-10-10 | 2022-05-26 | Kodiak Sciences Inc. | Methods of treating an eye disorder |
| CN110845605B (en) * | 2019-12-23 | 2023-04-14 | 长春工业大学 | A kind of genetically engineered antibody against canine parvovirus and its application |
| WO2023206134A1 (en) * | 2022-04-27 | 2023-11-02 | Beijing Sightnovo Medical Technology Co., Ltd | Compositions and methods for eye diseases |
| CN117820474A (en) * | 2023-04-25 | 2024-04-05 | 南京贝思奥生物科技有限公司 | Medicine for improving eye angiogenesis related diseases and application thereof |
Citations (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0419858A1 (en) | 1989-08-25 | 1991-04-03 | Juridical Foundation The Chemo-Sero-Therapeutic Research Institute | Dog-mouse heterohybridoma and gene fragment coding for constant region of canine immunoglobulins |
| US20020119153A1 (en) | 1999-04-28 | 2002-08-29 | Board Of Regents,The University Of Texas System | Antibody conjugate formulations for selectively inhibiting VEGF |
| US20050106667A1 (en) | 2003-08-01 | 2005-05-19 | Genentech, Inc | Binding polypeptides with restricted diversity sequences |
| WO2007047626A1 (en) | 2005-10-14 | 2007-04-26 | Alcon, Inc. | Combination treatment with anecortave acetate and bevacizumab or ranibizumab for pathologic ocular angiogenesis |
| US20080213268A1 (en) | 2005-11-08 | 2008-09-04 | Watts Ryan J | Neuropilin antagonists |
| US20100061988A1 (en) | 2008-09-04 | 2010-03-11 | Hansen Genevieve | Monoclonal antibodies |
| US20100111967A1 (en) | 2008-10-08 | 2010-05-06 | Monika Baehner | Bispecific anti-vegf/anti-ang-2 antibodies |
| US20100150919A1 (en) | 2007-05-17 | 2010-06-17 | Appleton Brent A | Crystal structures of neuropilin fragments and neuropilin-antibody complexes |
| JP2011500086A (en) | 2007-10-22 | 2011-01-06 | シェーリング コーポレイション | Fully human anti-VEGF antibodies and methods of use |
| JP2011525359A (en) | 2008-06-25 | 2011-09-22 | エスバテック、アン アルコン バイオメディカル リサーチ ユニット、エルエルシー | Stable and soluble antibody that inhibits VEGF |
| US20120231011A1 (en) | 2009-08-28 | 2012-09-13 | Apexigen Inc. | Anti-vegf monoclonal antibody and pharmaceutical composition comprising said antibody |
| US20140170137A1 (en) | 2011-05-06 | 2014-06-19 | Nvip Pty Ltd | Therapeutic canine immunoglobulins and methods of using same |
| JP2014516026A (en) | 2011-05-06 | 2014-07-07 | エヌヴィーアイピー プロプライエタリー リミテッド | Therapeutic canine immunoglobulin and method of using the same |
| WO2014193191A1 (en) | 2013-05-31 | 2014-12-04 | 동아쏘시오홀딩스 주식회사 | Anti-vegf antibody, and pharmaceutical composition for preventing, diagnosing or treating cancer or angiogenesis-related diseases, containing same |
| WO2015166112A1 (en) | 2014-05-01 | 2015-11-05 | Consejo Nacional De Investigaciones Científicas Y Técnicas (Conicet) | Anti-human vegf antibodies with unusually strong binding afinity to human vegf-a and cross reactivity to human vegf-b |
| WO2016205427A2 (en) | 2015-06-15 | 2016-12-22 | Abbvie Inc. | Binding proteins against vegf, pdgf, and/or their receptors |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1651756B1 (en) | 2003-08-01 | 2010-11-24 | Two Cells Co., Ltd | Scaffold-free self-organized 3d synthetic tissue |
-
2017
- 2017-01-05 US US16/067,931 patent/US11007259B2/en active Active
- 2017-01-05 KR KR1020187022197A patent/KR102293755B1/en active Active
- 2017-01-05 JP JP2017560400A patent/JP6910963B2/en active Active
- 2017-01-05 WO PCT/JP2017/000101 patent/WO2017119435A1/en not_active Ceased
- 2017-01-05 EP EP17735972.6A patent/EP3401331B1/en active Active
- 2017-01-05 CN CN201780005863.XA patent/CN108699141B/en active Active
-
2021
- 2021-04-13 US US17/229,271 patent/US11872271B2/en active Active
- 2021-07-07 JP JP2021112701A patent/JP7273110B2/en active Active
Patent Citations (28)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0419858A1 (en) | 1989-08-25 | 1991-04-03 | Juridical Foundation The Chemo-Sero-Therapeutic Research Institute | Dog-mouse heterohybridoma and gene fragment coding for constant region of canine immunoglobulins |
| US20020119153A1 (en) | 1999-04-28 | 2002-08-29 | Board Of Regents,The University Of Texas System | Antibody conjugate formulations for selectively inhibiting VEGF |
| JP2002543093A (en) | 1999-04-28 | 2002-12-17 | ボード オブ リージェンツ, ザ ユニバーシティ オブ テキサス システム | Compositions and methods for treating cancer by selective inhibition of VEGF |
| US20050106667A1 (en) | 2003-08-01 | 2005-05-19 | Genentech, Inc | Binding polypeptides with restricted diversity sequences |
| JP2007526756A (en) | 2003-08-01 | 2007-09-20 | ジェネンテック・インコーポレーテッド | Anti-VEGF antibody |
| WO2007047626A1 (en) | 2005-10-14 | 2007-04-26 | Alcon, Inc. | Combination treatment with anecortave acetate and bevacizumab or ranibizumab for pathologic ocular angiogenesis |
| US20080213268A1 (en) | 2005-11-08 | 2008-09-04 | Watts Ryan J | Neuropilin antagonists |
| JP2011256183A (en) | 2005-11-08 | 2011-12-22 | Genentech Inc | Neuropilin antagonist |
| US20100150919A1 (en) | 2007-05-17 | 2010-06-17 | Appleton Brent A | Crystal structures of neuropilin fragments and neuropilin-antibody complexes |
| JP2010530359A (en) | 2007-05-17 | 2010-09-09 | ジェネンテック, インコーポレイテッド | Crystal structures of neuropilin fragments and neuropilin-antibody complexes |
| JP2011500086A (en) | 2007-10-22 | 2011-01-06 | シェーリング コーポレイション | Fully human anti-VEGF antibodies and methods of use |
| US20110097340A1 (en) | 2007-10-22 | 2011-04-28 | Sumant Ramachandra | Fully human anti-vegf antibodies and methods of using |
| US20120014958A1 (en) | 2008-06-25 | 2012-01-19 | Esbatech, An Alcon Biomedical Research Unit Llc | Stable and soluble antibodies inhibiting vegf |
| JP2011525359A (en) | 2008-06-25 | 2011-09-22 | エスバテック、アン アルコン バイオメディカル リサーチ ユニット、エルエルシー | Stable and soluble antibody that inhibits VEGF |
| US20100061988A1 (en) | 2008-09-04 | 2010-03-11 | Hansen Genevieve | Monoclonal antibodies |
| US20100111967A1 (en) | 2008-10-08 | 2010-05-06 | Monika Baehner | Bispecific anti-vegf/anti-ang-2 antibodies |
| JP2012504943A (en) | 2008-10-08 | 2012-03-01 | エフ.ホフマン−ラ ロシュ アーゲー | Bispecific anti-VEGF / anti-ANG-2 antibody |
| US20120231011A1 (en) | 2009-08-28 | 2012-09-13 | Apexigen Inc. | Anti-vegf monoclonal antibody and pharmaceutical composition comprising said antibody |
| JP2013502445A (en) | 2009-08-28 | 2013-01-24 | チャンスー シムサー ファーマシューティカル アールアンドディー カンパニー リミテッド | Anti-VEGF monoclonal antibody and pharmaceutical composition containing the antibody |
| US20140170137A1 (en) | 2011-05-06 | 2014-06-19 | Nvip Pty Ltd | Therapeutic canine immunoglobulins and methods of using same |
| JP2014516026A (en) | 2011-05-06 | 2014-07-07 | エヌヴィーアイピー プロプライエタリー リミテッド | Therapeutic canine immunoglobulin and method of using the same |
| WO2014193191A1 (en) | 2013-05-31 | 2014-12-04 | 동아쏘시오홀딩스 주식회사 | Anti-vegf antibody, and pharmaceutical composition for preventing, diagnosing or treating cancer or angiogenesis-related diseases, containing same |
| EP3006465A1 (en) | 2013-05-31 | 2016-04-13 | Dong-A Socio Holdings Co., Ltd. | Anti-vegf antibody, and pharmaceutical composition for preventing, diagnosing or treating cancer or angiogenesis-related diseases, containing same |
| US20160122426A1 (en) | 2013-05-31 | 2016-05-05 | Dong-A Socio Holdings Co., Ltd. | Anti-vegf antibody, and pharmaceutical composition for preventing, diagnosing or treating cancer or angiogenesis-related diseases, containing same |
| WO2015166112A1 (en) | 2014-05-01 | 2015-11-05 | Consejo Nacional De Investigaciones Científicas Y Técnicas (Conicet) | Anti-human vegf antibodies with unusually strong binding afinity to human vegf-a and cross reactivity to human vegf-b |
| US20150315270A1 (en) | 2014-05-01 | 2015-11-05 | Alberto BALDI | Anti-human vegf antibodies with unusually strong binding afinity to human vegf-a and cross reactivity to human vegf-b |
| WO2016205427A2 (en) | 2015-06-15 | 2016-12-22 | Abbvie Inc. | Binding proteins against vegf, pdgf, and/or their receptors |
| US20170015742A1 (en) | 2015-06-15 | 2017-01-19 | Abbvie Inc. | Binding proteins against vegf, pdgf, and/or their receptors |
Non-Patent Citations (24)
| Title |
|---|
| Beck et al., "A Vascular niche and a VEGF-Nrpl loop regulate the initiation and stemness of skin tumours", Nature, vol. 478, Oct. 20, 2011, pp. 399-403 (7 pages). |
| Carmeliet et al., "Common Mechanisms of nerve and blood vessel wiring," Nature, vol. 436, No. 14, Jul. 2005, pp. 193-200 (8 pages). |
| Doi et al., "S7-5 Clinical Applications of Molecular Target Inhibitors Through VEGF/VEGFR ( Focusing on Antibody Medicine", The 45th Congress of Japan Society for Cancer Therapy, vol. 42, No. 2, Sep. 20, 2007, pp. 249 with abstract. |
| Extended European Search Report dated Aug. 13, 2019 for European Application No. 17735972.6; European Patent Office, Munich, Germany; Ulbrecht, Matthias; pp. 2-9 (10 pages total). |
| Extended European Search Report dated Aug. 19, 2019 for European Application No. 17735971.8; European Patent Office, Munich, Germany; Chapman, Rob; pp. 2-8 (10 pages total). |
| Ferrara et al., "The Biology of Vascular Endothelial Growth Factor," Endocrine Reviews, vol. 18, No. 1, Feb. 1997, pp. 4-25 (22 pages). |
| Graziani et al, "Neuropilin-1 as therapeutic target for malignant melanoma", Frontiers in Oncology, vol. 5, Article 125, Jun. 2015, pp. 1-9 (9 pages). |
| Harper et al., "VEGF-A Splicing: the key to anti-angiogenic therapeutics", Nat Rev Cancer. Author Manuscript, vol. 8, No. 11, Nov. 2008, pp. 880-887 (17 pages). |
| Heskamp et al., "Bevacizumab reduces tumor targeting of antiepidermal growth factor and anti-insulin growth factor 1 receptor antibodies", Int. J. Cancer, vol. 133, 2013, pp. 307-314 (8 pages). |
| Jones et al., "Separating genetic and hemodynamic defects in neuropilin 1 knockout embryos", Development, vol. 135, 2008, pp. 2479-2488 (10 pages). |
| Keyt et al., "Identification of Vascular Endothelial Growth Factor Determinants for Binding KDR and FLT-1 Receptors", The Journal of Biological Chemistry, vol. 271, No. 10, 1996, pp. 5638-5646 (10 pages). |
| Khadidja-Tehami et al., "Production of polyclonal anti VEGF antibodies and establishment of sELISA system for detection of serum VEGF level in tumor patients", Journal of Chemical and Pharmaceutical Research, vol. 7, No. 6, 2015, pp. 672-679 (8 pages). |
| Marti et al., "Angioenesis in Ischemic Disease" Thromb Haemost, vol. 82, 1999, pp. 44-52 ( 9 pages). |
| Matsumoto et al., "VEGF Receptor Signal Transduction", Science's stke, URL: www.stke.org/cgi/content/full/OC_sigtrans;2001/112/re21, 2011, pp. 1-17 (17 pages). |
| Pan et al., "Blocking Neuropilin-1 Funtion Has an Additve Effect with Anti-VEGF to Inhibit Tumor Growth" Cancer Cell, vol. 11, Jan. 2007, pp. 53-67 ( 15 pages). |
| Parker et al., "Structural Basis for Selective Vascular Endothelial Growth Factor-A (VEGF-A) Binding to Neuropilin-1", The Journal of Biological Chemistry, vol. 287, No. 14, Mar. 30, 2012, pp. 11082-11089 (8 pages). |
| Schlaeppi et al, "Characterization of a new potent, in vivo neutralizing monoclonal antibody to human vascular endothelial growth factor", J. Cancer Res Clin Oncol, vol. 125, 1999, pp. 336-342 ( 7 pages). |
| Sela-Culang et al. Fron. Immunol. 4(302): 1-13, 2013. * |
| Soker et al., "Neuropilin-1 is Expressed by Endothelial and Tumor Cells as an Isoform-Specifc Receptor and Vascular Endothelial Growth Factor", Cell, vol. 92, Mar. 20, 1998, pp. 735-745 (11 pages). |
| Stewart, "Aflibercept as a Treatment for Age-Related Macular Degeneration", US Opthalimic Rev. vol. 6, 2013, pp. 58-63 ( 6 pages). |
| Sullivan et al, "r84, a Novel Therapeutic Antibody against Mouse and Human VEGF with Potent Anti-Tumor Activity and Limited Toxicity Induction" Plos One, vol. 5, Issue 8, Aug. 2010, pp. 1-13 (13 pages). |
| Translated International Search Report dated Apr. 11, 2017 for International Application No. PCT/JP2017/000101; Japan Patent Office; Tokyo, Japan; pp. 1-2 (3 pages total). |
| Tugues et al, "Vascular endothelial growth factors and receptors: Anti-angiogenic therapy in the treatment of cancer", Molecular Aspects of Medicine. vol. 32, 2011, pp. 88-111 (24 pages). |
| Yu et al, "A Humanized Anti-VEGF Rabbit Monoclonal Antibody Inhibits Angiogenesis and Blocks Tumor Growth in Xenograft Models", PloS ONE, vol. 5, Issue 2, Feb. 2010, pp. 1-12 (12 pages). |
Also Published As
| Publication number | Publication date |
|---|---|
| JP6910963B2 (en) | 2021-07-28 |
| US20210228700A1 (en) | 2021-07-29 |
| EP3401331A1 (en) | 2018-11-14 |
| US20200165330A1 (en) | 2020-05-28 |
| WO2017119435A1 (en) | 2017-07-13 |
| CN108699141B (en) | 2022-06-17 |
| KR20180132038A (en) | 2018-12-11 |
| JPWO2017119435A1 (en) | 2018-10-25 |
| CN108699141A (en) | 2018-10-23 |
| JP7273110B2 (en) | 2023-05-12 |
| EP3401331A4 (en) | 2019-09-11 |
| KR102293755B1 (en) | 2021-08-24 |
| US11872271B2 (en) | 2024-01-16 |
| EP3401331B1 (en) | 2022-04-06 |
| JP2021169475A (en) | 2021-10-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11872271B2 (en) | High-affinity anti-VEGF antibody KLHa505 | |
| US11008387B2 (en) | Antibody inhibiting binding of VEGF to NRP1 | |
| JP2024125370A (en) | Claudin 18.2 binding moieties and uses thereof | |
| JP5667067B2 (en) | Anti-TGF beta receptor II antibody | |
| JP2012508170A5 (en) | ||
| TW202317639A (en) | Anti-human CD3 antibody and use thereof | |
| KR20220082007A (en) | Antibodies to poliovirus receptor (PVR) and uses thereof | |
| CN110343178B (en) | Anti-human LAG-3 monoclonal antibody and application thereof | |
| WO2023236991A1 (en) | Trispecific antibody targeting her2, pd-l1 and vegf | |
| CA3229250A1 (en) | Anti-vegf a and vegf c bispecific antibodies and use thereof | |
| JP2023519620A (en) | Antigen-binding polypeptide that binds to CD47 and uses | |
| WO2023235703A1 (en) | Therapeutic methods using ilt-binding agents | |
| RU2809746C2 (en) | Humanized anti-vegf monoclonal antibody | |
| WO2024078558A1 (en) | Anti-cd100 antibody and use thereof | |
| HK40073145B (en) | Antibodies against the poliovirus receptor (pvr) and uses thereof | |
| HK40080952A (en) | Antigen-binding polypeptide binding to cd47, and use thereof | |
| HK1261619B (en) | Antibody inhibiting binding between vegf and nrp1 | |
| HK1261618A1 (en) | High-affinity anti-vegf antibody | |
| HK1261618B (en) | High-affinity anti-vegf antibody | |
| HK1261619A1 (en) | Antibody inhibiting binding between vegf and nrp1 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
| AS | Assignment |
Owner name: SANTEN PHARMACEUTICAL CO., LTD., JAPAN Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:MURAKAMI, YASUFUMI;MUKOUBATA, SHIGEKI;AKIYAMA, HIROTADA;AND OTHERS;SIGNING DATES FROM 20180808 TO 20180824;REEL/FRAME:046898/0941 Owner name: ORDER-MADE MEDICAL RESEARCH INC., JAPAN Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:MURAKAMI, YASUFUMI;MUKOUBATA, SHIGEKI;AKIYAMA, HIROTADA;AND OTHERS;SIGNING DATES FROM 20180808 TO 20180824;REEL/FRAME:046898/0941 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED |
|
| STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
| MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1551); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY Year of fee payment: 4 |