US10894082B2 - Anti-S100A8 for treating leukemia - Google Patents

Anti-S100A8 for treating leukemia Download PDF

Info

Publication number
US10894082B2
US10894082B2 US15/759,362 US201615759362A US10894082B2 US 10894082 B2 US10894082 B2 US 10894082B2 US 201615759362 A US201615759362 A US 201615759362A US 10894082 B2 US10894082 B2 US 10894082B2
Authority
US
United States
Prior art keywords
antibody
leukemia
seq
human
cells
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Expired - Fee Related, expires
Application number
US15/759,362
Other versions
US20180256710A1 (en
Inventor
Philippe Tessier
Malika LAOUEDJ
Frédéric BARABE
Natalie Pagé
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Universite Laval
Original Assignee
Universite Laval
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Universite Laval filed Critical Universite Laval
Priority to US15/759,362 priority Critical patent/US10894082B2/en
Assigned to UNIVERSITé LAVAL reassignment UNIVERSITé LAVAL ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: LAOUEDJ, Malika, BARABE, FREDERIC, TESSIER, PHILIPPE, PAGE, NATALIE
Publication of US20180256710A1 publication Critical patent/US20180256710A1/en
Application granted granted Critical
Publication of US10894082B2 publication Critical patent/US10894082B2/en
Expired - Fee Related legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/335Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/35Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom
    • A61K31/351Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom not condensed with another ring
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/513Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim having oxo groups directly attached to the heterocyclic ring, e.g. cytosine

Definitions

  • the present description relates to an anti-S1008 protein for treating leukemia.
  • Acute leukemias are the result of a series of genetic and epigenetic events occurring in a stem or progenitor hematopoietic cell, giving rise to a clonal expansion of progenitors with an impaired capacity to differentiate.
  • the past 20 years have been very fruitful in the identification of recurrent genetic lesions in acute leukemia. Improvement in leukemia-free survival has been mostly due to better risk stratification which allows for adjustment of treatment intensity and also to allogenic hematopoietic stem cell transplantation.
  • drugs used in acute myeloid treatment (AML) are basically the same today as they were 25-30 years ago and prognosis remains poor.
  • the 5-year survival rate is as low as 55% for children with AML and even worse for adults (30-40%) and elderly (>65 yo) ( ⁇ 15%). Therefore, novel and innovative approaches need to be explored in order to improve leukemia-free survival of acute leukemia patients.
  • the anti-S100A8 is an antibody.
  • the anti-S100A8 specifically binds to a portion of S100A8 protein.
  • the anti-S100A8 specifically binds to a S100A8/S100A8 homodimer or a S100A8/S100A9 heterodimer.
  • the S100A8 protein is a human S100A8.
  • human S100A8 comprises the amino acid sequence depicted in SEQ ID NO: 1.
  • the anti-S100A8 is monoclonal or polyclonal antibody.
  • the anti-S100A8 is a mouse antibody, a goat antibody, a human antibody or a rabbit antibody.
  • the anti-S100A8 is a humanized antibody.
  • the anti-S100A8 antibody comprises an epitope binding fragment selected from the group consisting of: Fv, F(ab′), or F(ab′)2.
  • the anti-S100A8 antibody comprises a heavy chain variable region encoded by the nucleotide sequence set forth in SEQ ID NO: 3.
  • the anti-S100A8 antibody comprises a heavy chain variable region consisting of SEQ ID NO: 4.
  • the anti-S100A8 antibody comprises a light chain variable region encoded by the nucleotide sequence set forth in SEQ ID NO: 5.
  • the anti-S100A8 antibody comprises a light chain variable region consisting of SEQ ID NO: 6.
  • the anti-S100A8 is formulated for an injection.
  • the anti-S100A8 is formulated for an administration with a chemotherapeutic agent.
  • the chemotherapeutic agent is at least one of daunorubicin, doxorubicin and cytarabine.
  • the anti-S100A8 is formulated for a simultaneous or separate administration with the chemotherapeutic agent.
  • the anti-S100A8 is formulated for an administration after a chemotherapeutic treatment to a subject.
  • composition comprising the anti-S100A8 as described herein and a carrier.
  • composition described herein is for the treatment of leukemia.
  • the leukemia is acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML) and chronic myelomonocytic leukemia (CMML).
  • ALL acute lymphoblastic leukemia
  • AML acute myeloid leukemia
  • CLL chronic lymphocytic leukemia
  • CML chronic myeloid leukemia
  • CMML chronic myelomonocytic leukemia
  • composition described herein is for stimulating cell differentiation.
  • composition described herein is for inhibiting cell proliferation.
  • composition described herein is for the treatment of acute myeloid leukemia (AML).
  • AML acute myeloid leukemia
  • It is also provided a method of treating leukemia in a subject comprising the step of administering the anti-S100A8 or the composition described herein to the subject.
  • It is also provided a method of stimulating cell differentiation in a subject comprising the step of administering the anti-S100A8 or the composition described herein to the subject.
  • It is also provided a method for inhibiting cell proliferation in a subject comprising the step of administering the anti-S100A8 or the composition described herein to the subject.
  • It is also provided a method of stimulating cell differentiation ex vivo comprising the step of administering the anti-S100A8 or the composition described herein to the subject.
  • a method for inhibiting cell proliferation ex vivo comprising a step of administering the anti-S100A8 or the composition described herein to the subject.
  • the subject is a mammal.
  • the subject is a mouse or a human.
  • composition described herein further comprises a S100A9 peptide or a peptidomimetic thereof.
  • the anti-S100A8 encompassed herein is formulated for an administration with an S100A9 peptide.
  • the S100A9 peptide is human S100A9 protein.
  • the peptide comprises the amino acid sequence set forth in SEQ ID NO: 7.
  • the peptide has at least 60%, at least 70% or at least 80%, at least 90% identical, or at least about 95% identity with SEQ ID NO: 7.
  • the peptide consists of the amino acid sequence set forth in SEQ ID NO: 7.
  • FIG. 1 illustrates the secretion of S100A8/A9 in the serum of mice with primary leukemia, wherein primary leukemia were generated by injecting mouse hematopoietic stem/progenitor cells transfected with a retrovirus expressing GFP, as well as the genes HOXA9 and MEIS1 or the fusion gene MLL-ENL, the S100A8/A9 concentrations measured by ELISA in serum (data are the mean ⁇ sem of 3 independent measurements).
  • FIG. 2 illustrates the level of S100A8, S100A9, and S100A8/A9 secreted in the serum of mice with primary leukemia, wherein primary leukemia were generated by injecting mouse hematopoietic stem/progenitor cells transfected with a retrovirus expressing GFP, as well as the genes HOXA9 and MEIS1, secondary leukemia then induced by injecting 100,000 bone marrow cells from a leukemic mouse to controlled mice, and the S100A8/A9 concentrations measured by ELISA in serum (data are the mean ⁇ sem of 3 independent measurements).
  • FIG. 3 illustrates the correlation between the secretion of S100A8/A9 and the presence of leukemia cells in the peripheral blood, wherein primary leukemia were generated by injecting mouse hematopoietic stem/progenitor cells transfected with a retrovirus expressing GFP, as well as the genes HOXA9 and MEIS1, secondary leukemia then induced by injecting 100,000 bone marrow cells from a leukemic mouse to na ⁇ ve mice, and the number of leukemic cells in the blood was determined by flow cytometry, S100A8/A9 concentrations measured by ELISA in serum (data are the mean ⁇ sem of 3 independent measurements).
  • FIG. 4 illustrates that an anti-S100A8 antibody in accordance to one embodiment prolong survival of secondary mice injected with HOXA9-MEIS1 leukemia, wherein 100,000 bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected 3 times a week from day 3 till day 35 in sub-lethally irradiated secondary mice with rabbit anti-S100A8 pAbs or non-specific rabbit IgGs (150 ⁇ g/injection), rat anti-S100A9 mAb or isotype control Ab (rat IgG1) or PBS (control) (6 mice per group).
  • FIG. 5 illustrates that an anti-S100A8 antibody in accordance to one embodiment reduces weight loss of secondary mice injected with HOXA9-MEIS1 leukemia, wherein 100,000 bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected 3 times a week from day 3 till day 35 in sub-lethally irradiated secondary mice with rabbit anti-S100A8 pAbs or non-specific rabbit IgGs (150 ⁇ g/injection) (6 mice per group).
  • FIG. 6 illustrates that an anti-S100A8 antibody in accordance to one embodiment delays the appearance of leukemic cells in the peripheral blood, wherein 100,000 bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected 3 times a week from day 3 till day 35 in sub-lethally irradiated secondary mice with rabbit anti-S100A8 pAbs or non-specific rabbit IgGs (150 ⁇ g/injection) (6 mice per group), the number of leukemia cells determined by flow cytometry.
  • FIG. 7 illustrates that an anti-S100A8 antibody in accordance to one embodiment increases differentiation of AML blast cells, wherein 100,000 bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected 3 times a week from day 3 till day 35 in sub-lethally irradiated secondary mice with rabbit anti-S100A8 pAbs or non-specific rabbit IgGs (150 ⁇ g/injection) (6 mice per group), and wherein moribund mice were sacrificed, peripheral blood, spleen, and bone marrow were harvested and the cells were analyzed by flow cytometry for the expression of differentiation markers (CD11b and Gr1) (data are from one mouse representative of 3 others).
  • differentiation markers CD11b and Gr1
  • FIG. 8 illustrates that an anti-S100A8 antibody in accordance to one embodiment inhibits proliferation of AML blast cells, wherein 100,000 bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected 3 times a week from day 3 till day 35 in sub-lethally irradiated secondary mice with rabbit anti-S100A8 pAbs or non-specific rabbit IgGs (150 ⁇ g/injection) (6 mice per group), wherein moribund mice were sacrificed and bone marrow were harvested, and cell cycle was analyzed by propidium iodide staining (data are the mean of 3 experiments).
  • FIG. 9 illustrates the increased differentiation of AML cells in anti-S100A8-treated mice, wherein 100,000 bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected 3 times a week from day 3 till day 35 in sub-lethally irradiated secondary mice with rabbit anti-S100A8 pAbs or non-specific rabbit IgGs (150 ⁇ g/injection) (6 mice per group), wherein moribund mice were sacrificed, peripheral blood and bone marrow were harvested, the cells were then stained with Wright-Giemsa to reveal cellular morphology (data are from one mouse representative of 3 others).
  • FIG. 10 illustrates that an anti-S100A8 antibody in accordance to one embodiment promotes the differentiation and growth arrest of human leukemia cells, wherein human cord blood cells expressing the fusion gene MLL-AF9 were stimulated with anti-S100A8 mAb 1F8 (20 ⁇ g/ml) or an isotype control Ab for 72 h, showing in (A) the cells labelled with anti-CD14 and examined by flow cytometry; and in (B) cell cycle analyzed by propidium iodide staining.
  • FIG. 11 illustrates that an anti-S100A8 antibody in combination with a S100A9 peptide in accordance to one embodiment prolong survival of secondary mice injected with HOXA9-MEIS1 leukemia, wherein bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected in sub-lethally irradiated secondary mice with anti-S100A8, S100A9 peptide or a combination thereof.
  • anti-S100A8 being an antibody for treating or preventing leukemia.
  • Leukemia encompassed herein can be acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL) chronic myeloid leukemia (CML) and/or chronic myelomonocytic leukemia (CMML).
  • ALL acute lymphoblastic leukemia
  • AML acute myeloid leukemia
  • CLL chronic lymphocytic leukemia
  • CML chronic myeloid leukemia
  • CML chronic myeloid leukemia
  • CMML chronic myelomonocytic leukemia
  • the S100 protein family comprises 22 members of small (10 to 14 kDa) acidic calcium-binding proteins named as S100A1, S100A2, and so on, according to the time of their discovery and on the chromosome on which they are found. These intracellular proteins are involved in the control of protein phosphorylation, enzymatic activities, Ca 2+ homeostasis, and intermediate filaments polymerisation. S100A8, S100A9 and S100A12 belong to a subset called myeloid related proteins (MRPs) because they are predominantly expressed in neutrophils (30% of cytoplasmic protein) and monocytes, which derive from myeloid precursors.
  • MRPs myeloid related proteins
  • S100A8 and S100A9 are arranged as noncovalently bonded homodimers.
  • S100A8 and S100A9 form a noncovalent heterodimer called S100A8/A9 or calprotectin, presumed to be involved in the cellular control of calcium concentrations.
  • S100A8 and S100A9 are arranged as non-covalently bonded homodimers.
  • S100A8 and S100A9 also form a noncovalent heterodimer called S100A8/A9 or calprotectin in presence of calcium, and this heterodimer is presumed to be involved in the cellular control of calcium concentrations.
  • calprotectin binds to lipids and activates NADPH oxidase inside neutrophils, at least in part by transferring arachidonic acid to NADPH oxidase.
  • S100A8 and S100A9 are presumed to bind to RAGE, the scavenger receptor (CD36) or the Toll-like receptor 4 (TLR4).
  • Human peptide sequence of S100A8 consists of:
  • Humanization can be necessary when the process of developing a specific antibody involves generation in a non-human immune system (such as that in mice).
  • Antibody humanization methods are designed to produce a molecule with minimal immunogenicity when applied to humans, while retaining the specificity and affinity of the parental non-human antibody.
  • the protein sequences of antibodies produced in this way are partially distinct from homologous antibodies occurring naturally in humans, and are therefore potentially immunogenic when administered to human patients.
  • Humanized antibodies encompassed herein can be produced via enrichment technologies such as phage display or immunization of transgenic mice bearing the antibody human gene repertoire have provided powerful means to generate human antibodies.
  • the antibody described herein specifically binds to an epitope on S100A8.
  • the antibody comprises an epitope binding fragment that is selected from: Fv and/or F(ab′) and/or F(ab′)2.
  • the antibody comprises an epitope-binding single chain antibody.
  • the antibody encompassed herein comprises a heavy chain variable region encoded by nucleotide sequence:
  • the antibody comprises a heavy chain variable region consisting of:
  • the antibody encompassed herein comprises a light chain variable region encoded by nucleotide sequence:
  • the antibody comprises a light chain variable region consisting of:
  • compositions comprise a therapeutically effective amount of the antibody, and a physiologically or a pharmaceutically acceptable carrier or excipient.
  • a suitable physiological or pharmaceutical carrier includes but is not limited to saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof.
  • the formulation should suit the mode of administration.
  • An antibody as defined herein, acting as inhibitor or antagonist of S100A8 protein, can be administered alone or in combination with other antibodies directed toward other complementary targets, including but not limited to, other S100 polynucleotides or polypeptides.
  • the antibodies encompassed herein may be advantageously utilized in combination with other monoclonal or chimeric antibodies, with cytokines, or with S100 proteins.
  • the antibodies may be administered alone or in combination with other types of treatments.
  • the antibody described herein can be administered in combination, simultaneously or separately, with for example a chemotherapeutic agent, such as daunorubicin (Cerubidine), doxorubicin (Adriamycin), and cytarabine.
  • a chemotherapeutic agent such as daunorubicin (Cerubidine), doxorubicin (Adriamycin), and cytarabine.
  • a chemotherapeutic agent such as daunorubicin (Cerubidine), doxorubicin (Adriamycin), and cytarabine.
  • a chemotherapeutic agent such as daunorubicin (Cerubidine), doxorubicin (Adriamycin), and cy
  • a method for treating leukemia comprising the step of administering to a subject in need thereof an effective amount of the antibody as defined herein or the composition as defined herein.
  • the Cancer Genome Atlas (TCGA) Research Network performed whole genome/whole exome sequencing on 200 adult AML cases along with RNA, microRNA and DNA-methylation analysis.
  • S100A8 and S100A9 were amongst the top 5 discriminatory genes for one important sub-group mainly composed of myelomonocytic and monocytic AML, with high RPKM levels (Cancer Genome Atlas Research, N., 2013, The New England journal of medicine, 368: 2059-2074).
  • High concentrations of S100A8 and S100A9 proteins are found in the serum of patients with acute and chronic myeloid leukemia (Ivanov et al., 1996, Immunology letters, 49: 7-13), and these concentrations correlate with growth-stimulating activity in these sera.
  • S100A8 has been identified as a predictor of poor survival in de novo AML patients (Nicolas et al., 2011, Leukemia: official journal of the Leukemia Society of America, Leukemia Research Fund, U.K, 25: 57-65).
  • S100A8/A9 constitutive over-expression of S100A8/A9 is also associated with resistance to prednisone treatment in MLL-rearranged B-ALL, and forced expression of S100A8/A9 in MLL-rearranged B-ALL cells transform prednisone-sensitive into prednisone insensitive cells in vitro (Spijkers-Hagelstein et al., 2012, Leukemia: official journal of the Leukemia Society of America, Leukemia Research Fund, U.K, 26: 1255-1265).
  • S100A8 and S100A9 proteins were measured using two well-characterized myeloid leukemia models induced by overexpression of Hoxa9 and the cofactor Meis1 or expression of the oncogene MLL-ENL in hematopoietic progenitors and stem cells (HPSC) transplanted into lethally irradiated recipient.
  • HPSC hematopoietic progenitors and stem cells
  • S100A8/A9 Elevated concentrations of S100A8/A9 were found in bone marrow and spleen supernatants of AML recipient, indicating that extracellular fluids are also enriched in those proteins. S100A8/A9 concentration gradually increased as leukemia progressed and strongly correlated to regress of leukemic cells from the bone marrow to the blood (see FIG. 3 ).
  • H9M driven AML secondary recipients were treated i.p with 10 mg/kg of either pAb anti-S100A8 or with mAb anti-S100A9. These antibodies interact with both homodimeric S100A8/A8 or S100A9/A9 respectively, and heterodimeric S100A8/A9. Injection of anti-S100A8 led to a marked delay in leukemia progression and significantly extended survival compared to control immunoglobulins ( FIG. 4 ). This was associated with reduced weight loss and improvement of the behavior of leukemic mice in anti-S100A8-treated mice ( FIG. 5 ).
  • S100A8 promotes AML pathogenesis by interfering with myeloid cell differentiation.
  • the anti-S100A8 antibody encompassed herein can be administered with a S100A9 peptide in order to significantly increase the delay in leukemia progression and extended survival compared to control immunoglobulins or compared to administration of the anti-S100A8 antibody or S100A9 peptide alone.
  • S100A9 also known as calgranulin B and myeloid related protein-14 (MRP-14), is a calcium- and zinc-binding protein that belongs to the S100 protein family.
  • S100A9 is highly expressed by the myeloid cell lineage and is found in the extracellular milieu during inflammatory conditions. S100A9 forms heterodimers with S100A8, another member of the S100 family. However, S100A9 may also form monomers which execute specific functions.
  • Human S100A9 has a molecular mass of about 13 kDa and is composed of 114 amino acid residues.
  • Human S100A9 (SEQ ID NO: 7) 10 20 30 40 MTCKMSQLER NIETIINTFH QYSVKLGHPD TLNQGEFKEL 50 60 70 80 VRKDLQNFLK KENKNEKVIE HIMEDLDTNA DKQLSFEEFI 90 100 110 MLMARLTWAS HEKMHEGDEG PGHHHKPGLG EGTP
  • composition comprising an anti-S100A8 antibody and a S100A9 peptide.
  • composition comprising an anti-S100A8 antibody comprising a heavy chain variable region encoded by the nucleotide sequence set forth in SEQ ID NO: 3 or 4, a light chain variable region encoded by the nucleotide sequence set forth in SEQ ID NO: 5 or 6, and a S100A9 peptide comprising the amino acid sequence set forth in SEQ ID NO: 7 for treating leukemia.
  • injection of anti-S100A8 protects from AML by promoting the differentiation of leukemia cells, resulting in reduced proliferation.
  • mice Primary leukemia recipient C57BL/6 mice were irradiated (7 Gy), then injected i.v. 24 h later with 4 ⁇ 10 5 infected bone marrow cells (expressing Hoxa9, Meis1 and Egfp). Mice were followed every day for signs of leukemia. Peripheral blood was harvested every week to quantify the number of leukemia cells (expressing GFP) by flow cytometry. Moribund mice were sacrificed and the peripheral blood and bone marrow were harvested.
  • Secondary leukemia were induced by injecting 2 ⁇ 10 5 bone marrow cells from primary leukemia mice into sublethally irradiated (4Gy) recipient.
  • Leukemic cells isolated from bone marrow of primary leukemia mice were injected into sublethally irradiated (4Gy) recipient C57BL/6 mice.
  • the presence of AML cells (EGFP+) in peripheral blood was evaluated by flow cytometry 14 days later.
  • Mice were injected i.p three times per week with 100 ⁇ g purified rabbit IgG anti-S100A8 starting on day 3. Mice exhibiting signs of ill health were sacrificed and peripheral blood and bone marrow were harvested for histology and flow cytometry analyses.
  • Human cord blood cells transfected with the fusion gene MLL-AF9 were cultivated in IMDM supplemented with 15% fetal calf serum, IL-6 and stem cell factor.
  • the cells were plated 96 well microtiter plates (200 000 cells/well), then stimulated with 20 ⁇ g/ml of mAb 1F8 anti-S100A8, or PBS. After 72 h, cells were collected and immunophenotyping was performed by flow cytometry following staining with anti-CD14. Cell cycle was analyzed by propidium iodide staining.
  • Leukemic cells isolated from bone marrow of primary leukemia mice were injected into sublethally irradiated (4Gy) recipient C57BL/6 mice.
  • the presence of AML cells (EGFP+) in peripheral blood was evaluated by flow cytometry 14 days later.
  • Mice were injected i.p three times per week with 100 ⁇ g purified rabbit IgG anti-S100A8, 20 ⁇ g of recombinant mouse S100A9 protein, or a combination of anti-S100A8 and S100A9 protein starting on day 3.
  • Mice exhibiting signs of ill health were sacrificed and peripheral blood and bone marrow were harvested for histology and flow cytometry analyses.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Endocrinology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • Hematology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The present description relates to an anti-S1008 protein for treating leukemia. More specifically, is disclosed anti-S100A8 antibody that specifically binds to a portion of S100A8 protein and/or a S100A8/S100A9 heterodimer for treating leukemia.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS
This application is a U.S. National Phase of International Application No. PCT/CA2016/051078, filed on Sep. 13, 2016 and claiming priority from U.S. provisional patent applications 62/218,000 filed Sep. 14, 2015, and 62/259,738 filed Nov. 25, 2015 and this application claims priority to and the benefit of the above-identified applications, each of which are incorporated by reference herewith in their entirety.
TECHNICAL FIELD
The present description relates to an anti-S1008 protein for treating leukemia.
BACKGROUND ART
Acute leukemias are the result of a series of genetic and epigenetic events occurring in a stem or progenitor hematopoietic cell, giving rise to a clonal expansion of progenitors with an impaired capacity to differentiate. The past 20 years have been very fruitful in the identification of recurrent genetic lesions in acute leukemia. Improvement in leukemia-free survival has been mostly due to better risk stratification which allows for adjustment of treatment intensity and also to allogenic hematopoietic stem cell transplantation. However, drugs used in acute myeloid treatment (AML) are basically the same today as they were 25-30 years ago and prognosis remains poor. The 5-year survival rate is as low as 55% for children with AML and even worse for adults (30-40%) and elderly (>65 yo) (<15%). Therefore, novel and innovative approaches need to be explored in order to improve leukemia-free survival of acute leukemia patients.
There is thus still a need to be provided with a composition or methodology for treating leukemia.
SUMMARY
In accordance with the present invention there is now provided an anti-S100A8 for treating leukemia.
In an embodiment, the anti-S100A8 is an antibody.
In another embodiment, the anti-S100A8 specifically binds to a portion of S100A8 protein.
In a further embodiment, the anti-S100A8 specifically binds to a S100A8/S100A8 homodimer or a S100A8/S100A9 heterodimer.
In an additional embodiment, the S100A8 protein is a human S100A8.
In another embodiment, the human S100A8 comprises the amino acid sequence depicted in SEQ ID NO: 1.
In a further embodiment, the anti-S100A8 is monoclonal or polyclonal antibody.
In an embodiment, the anti-S100A8 is a mouse antibody, a goat antibody, a human antibody or a rabbit antibody.
In another embodiment, the anti-S100A8 is a humanized antibody.
In an embodiment, the anti-S100A8 antibody comprises an epitope binding fragment selected from the group consisting of: Fv, F(ab′), or F(ab′)2.
In another embodiment, the anti-S100A8 antibody comprises a heavy chain variable region encoded by the nucleotide sequence set forth in SEQ ID NO: 3.
In a supplemental embodiment, the anti-S100A8 antibody comprises a heavy chain variable region consisting of SEQ ID NO: 4.
In another embodiment, the anti-S100A8 antibody comprises a light chain variable region encoded by the nucleotide sequence set forth in SEQ ID NO: 5.
In another embodiment, the anti-S100A8 antibody comprises a light chain variable region consisting of SEQ ID NO: 6.
In another embodiment, the anti-S100A8 is formulated for an injection.
In another embodiment, the anti-S100A8 is formulated for an administration with a chemotherapeutic agent.
In an embodiment, the chemotherapeutic agent is at least one of daunorubicin, doxorubicin and cytarabine.
In another embodiment, the anti-S100A8 is formulated for a simultaneous or separate administration with the chemotherapeutic agent.
In a further embodiment, the anti-S100A8 is formulated for an administration after a chemotherapeutic treatment to a subject.
It is also provided herein a composition comprising the anti-S100A8 as described herein and a carrier.
In an embodiment, the composition described herein is for the treatment of leukemia.
In an embodiment, the leukemia is acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML) and chronic myelomonocytic leukemia (CMML).
In an embodiment, the composition described herein is for stimulating cell differentiation.
In an embodiment, the composition described herein is for inhibiting cell proliferation.
In an embodiment, the composition described herein is for the treatment of acute myeloid leukemia (AML).
It is also provided a method of treating leukemia in a subject comprising the step of administering the anti-S100A8 or the composition described herein to the subject.
It is also provided a method of stimulating cell differentiation in a subject comprising the step of administering the anti-S100A8 or the composition described herein to the subject.
It is also provided a method for inhibiting cell proliferation in a subject comprising the step of administering the anti-S100A8 or the composition described herein to the subject.
It is also provided a method of stimulating cell differentiation ex vivo comprising the step of administering the anti-S100A8 or the composition described herein to the subject.
It is further provided a method for inhibiting cell proliferation ex vivo comprising a step of administering the anti-S100A8 or the composition described herein to the subject.
It is additionally provided the use of the anti-S100A8 or the composition described herein for treating leukemia in a subject.
It is also provided the use of the anti-S100A8 or the composition described herein in the manufacture of a medicament for treating leukemia in a subject.
It is also provided the use of the anti-S100A8 or the composition described herein for stimulating cell differentiation.
It is also provided the use of the anti-S100A8 or the composition described herein for inhibiting cell proliferation.
In an embodiment, the subject is a mammal.
In another embodiment, the subject is a mouse or a human.
In an embodiment, the composition described herein further comprises a S100A9 peptide or a peptidomimetic thereof.
In another embodiment, the anti-S100A8 encompassed herein is formulated for an administration with an S100A9 peptide.
In another embodiment, the S100A9 peptide is human S100A9 protein.
In a further embodiment, wherein the peptide comprises the amino acid sequence set forth in SEQ ID NO: 7.
In an additional embodiment, the peptide has at least 60%, at least 70% or at least 80%, at least 90% identical, or at least about 95% identity with SEQ ID NO: 7.
In another embodiment, the peptide consists of the amino acid sequence set forth in SEQ ID NO: 7.
BRIEF DESCRIPTION OF THE DRAWINGS
Reference will now be made to the accompanying drawings.
FIG. 1 illustrates the secretion of S100A8/A9 in the serum of mice with primary leukemia, wherein primary leukemia were generated by injecting mouse hematopoietic stem/progenitor cells transfected with a retrovirus expressing GFP, as well as the genes HOXA9 and MEIS1 or the fusion gene MLL-ENL, the S100A8/A9 concentrations measured by ELISA in serum (data are the mean±sem of 3 independent measurements).
FIG. 2 illustrates the level of S100A8, S100A9, and S100A8/A9 secreted in the serum of mice with primary leukemia, wherein primary leukemia were generated by injecting mouse hematopoietic stem/progenitor cells transfected with a retrovirus expressing GFP, as well as the genes HOXA9 and MEIS1, secondary leukemia then induced by injecting 100,000 bone marrow cells from a leukemic mouse to controlled mice, and the S100A8/A9 concentrations measured by ELISA in serum (data are the mean±sem of 3 independent measurements).
FIG. 3 illustrates the correlation between the secretion of S100A8/A9 and the presence of leukemia cells in the peripheral blood, wherein primary leukemia were generated by injecting mouse hematopoietic stem/progenitor cells transfected with a retrovirus expressing GFP, as well as the genes HOXA9 and MEIS1, secondary leukemia then induced by injecting 100,000 bone marrow cells from a leukemic mouse to naïve mice, and the number of leukemic cells in the blood was determined by flow cytometry, S100A8/A9 concentrations measured by ELISA in serum (data are the mean±sem of 3 independent measurements).
FIG. 4 illustrates that an anti-S100A8 antibody in accordance to one embodiment prolong survival of secondary mice injected with HOXA9-MEIS1 leukemia, wherein 100,000 bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected 3 times a week from day 3 till day 35 in sub-lethally irradiated secondary mice with rabbit anti-S100A8 pAbs or non-specific rabbit IgGs (150 μg/injection), rat anti-S100A9 mAb or isotype control Ab (rat IgG1) or PBS (control) (6 mice per group).
FIG. 5 illustrates that an anti-S100A8 antibody in accordance to one embodiment reduces weight loss of secondary mice injected with HOXA9-MEIS1 leukemia, wherein 100,000 bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected 3 times a week from day 3 till day 35 in sub-lethally irradiated secondary mice with rabbit anti-S100A8 pAbs or non-specific rabbit IgGs (150 μg/injection) (6 mice per group).
FIG. 6 illustrates that an anti-S100A8 antibody in accordance to one embodiment delays the appearance of leukemic cells in the peripheral blood, wherein 100,000 bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected 3 times a week from day 3 till day 35 in sub-lethally irradiated secondary mice with rabbit anti-S100A8 pAbs or non-specific rabbit IgGs (150 μg/injection) (6 mice per group), the number of leukemia cells determined by flow cytometry.
FIG. 7 illustrates that an anti-S100A8 antibody in accordance to one embodiment increases differentiation of AML blast cells, wherein 100,000 bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected 3 times a week from day 3 till day 35 in sub-lethally irradiated secondary mice with rabbit anti-S100A8 pAbs or non-specific rabbit IgGs (150 μg/injection) (6 mice per group), and wherein moribund mice were sacrificed, peripheral blood, spleen, and bone marrow were harvested and the cells were analyzed by flow cytometry for the expression of differentiation markers (CD11b and Gr1) (data are from one mouse representative of 3 others).
FIG. 8 illustrates that an anti-S100A8 antibody in accordance to one embodiment inhibits proliferation of AML blast cells, wherein 100,000 bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected 3 times a week from day 3 till day 35 in sub-lethally irradiated secondary mice with rabbit anti-S100A8 pAbs or non-specific rabbit IgGs (150 μg/injection) (6 mice per group), wherein moribund mice were sacrificed and bone marrow were harvested, and cell cycle was analyzed by propidium iodide staining (data are the mean of 3 experiments).
FIG. 9 illustrates the increased differentiation of AML cells in anti-S100A8-treated mice, wherein 100,000 bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected 3 times a week from day 3 till day 35 in sub-lethally irradiated secondary mice with rabbit anti-S100A8 pAbs or non-specific rabbit IgGs (150 μg/injection) (6 mice per group), wherein moribund mice were sacrificed, peripheral blood and bone marrow were harvested, the cells were then stained with Wright-Giemsa to reveal cellular morphology (data are from one mouse representative of 3 others).
FIG. 10 illustrates that an anti-S100A8 antibody in accordance to one embodiment promotes the differentiation and growth arrest of human leukemia cells, wherein human cord blood cells expressing the fusion gene MLL-AF9 were stimulated with anti-S100A8 mAb 1F8 (20 μg/ml) or an isotype control Ab for 72 h, showing in (A) the cells labelled with anti-CD14 and examined by flow cytometry; and in (B) cell cycle analyzed by propidium iodide staining.
FIG. 11 illustrates that an anti-S100A8 antibody in combination with a S100A9 peptide in accordance to one embodiment prolong survival of secondary mice injected with HOXA9-MEIS1 leukemia, wherein bone marrow cells from a HOXA9-MEIS1 primary leukemic mouse were injected in sub-lethally irradiated secondary mice with anti-S100A8, S100A9 peptide or a combination thereof.
DETAILED DESCRIPTION
It is provided an anti-S100A8 for treating or preventing leukemia.
Accordingly, it is described herein the use of anti-S100A8 being an antibody for treating or preventing leukemia.
Leukemia encompassed herein can be acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL) chronic myeloid leukemia (CML) and/or chronic myelomonocytic leukemia (CMML).
The S100 protein family comprises 22 members of small (10 to 14 kDa) acidic calcium-binding proteins named as S100A1, S100A2, and so on, according to the time of their discovery and on the chromosome on which they are found. These intracellular proteins are involved in the control of protein phosphorylation, enzymatic activities, Ca2+ homeostasis, and intermediate filaments polymerisation. S100A8, S100A9 and S100A12 belong to a subset called myeloid related proteins (MRPs) because they are predominantly expressed in neutrophils (30% of cytoplasmic protein) and monocytes, which derive from myeloid precursors.
S100A8 and S100A9 are arranged as noncovalently bonded homodimers. In addition, in the presence of calcium, S100A8 and S100A9 form a noncovalent heterodimer called S100A8/A9 or calprotectin, presumed to be involved in the cellular control of calcium concentrations.
S100A8 and S100A9 are arranged as non-covalently bonded homodimers. S100A8 and S100A9 also form a noncovalent heterodimer called S100A8/A9 or calprotectin in presence of calcium, and this heterodimer is presumed to be involved in the cellular control of calcium concentrations. Inside the cells, calprotectin binds to lipids and activates NADPH oxidase inside neutrophils, at least in part by transferring arachidonic acid to NADPH oxidase. S100A8 and S100A9 are presumed to bind to RAGE, the scavenger receptor (CD36) or the Toll-like receptor 4 (TLR4).
Human peptide sequence of S100A8 consists of:
(SEQ ID NO: 1)
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKG
ADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE.
Accordingly it is disclosed humanized antibodies and antibodies from non-human species against S100A8, and particularly human S100A8, whose protein sequences can be modified to increase their similarity to antibody variants produced naturally in humans. Humanization can be necessary when the process of developing a specific antibody involves generation in a non-human immune system (such as that in mice). Antibody humanization methods are designed to produce a molecule with minimal immunogenicity when applied to humans, while retaining the specificity and affinity of the parental non-human antibody. The protein sequences of antibodies produced in this way are partially distinct from homologous antibodies occurring naturally in humans, and are therefore potentially immunogenic when administered to human patients.
Humanized antibodies encompassed herein can be produced via enrichment technologies such as phage display or immunization of transgenic mice bearing the antibody human gene repertoire have provided powerful means to generate human antibodies.
More particularly, the antibody described herein specifically binds to an epitope on S100A8.
In a particular embodiment, the antibody comprises an epitope binding fragment that is selected from: Fv and/or F(ab′) and/or F(ab′)2. In particular, the antibody comprises an epitope-binding single chain antibody.
Particularly, the antibody encompassed herein comprises a heavy chain variable region encoded by nucleotide sequence:
(SEQ ID NO: 3)
GGATCCCAGGTTCAGCTGCAGCAGTCAGGGGCAGAGCTTGTGAAGCCAGG
GGCCTCAGTCAAGTTGTCCTGCACAGCTTCTGGCTTCAACATTAAAGACA
CCTATTTGCACTGGGTGAAGCAGAGGCCTGAGCAGGGCCTGGAGTGGGTT
GGAAGGATTGATCCTGCGAATGGTGATACTAAATATGACCCGAAGTTCCA
GGCCAAGGCCACTATAACAGCTGACACAACCTCCAACACAGCCTACGTGC
ACCTCAACAGCCTGACATCTGAGGACACTGCCGTCTATTTCTGTACTGGG
GGATGGCAGATGGGGGGCCGGTACTTCGATGTCTGGGGCGCAGGGACAAC
GGTCACCGTCTCCTCAGCCAAAACGACACCCCCATCTGTCTATGGTGGCG
GTGGTTCT.
In a particular embodiment, the antibody comprises a heavy chain variable region consisting of:
(SEQ ID NO: 4)
GSQVQLQQSGAELVKPGASVKLSCTASGFNIKDTYLHWVKQRPEQGLEW
VGRIDPANGDTKYDPKFQAKATITADTTSNTAYVHLNSLTSEDTAVYFC
TGGWQMGGRYFDVWGAGTTVTVSSAKTTPPSVYGGGGS.
Particularly, the antibody encompassed herein comprises a light chain variable region encoded by nucleotide sequence:
(SEQ ID NO: 5)
GATGTTGTGATGACCCAGTCTCCTGCTTCCTTAGCTGTATCTCTGGGGC
AGAGGGCCACCATCTCATACAGGGCCAGCAAAAGTGTCAGTACATCTGG
CTATAGTTATATGCACTGGAACCAACAGAAACCAGGACAGCCACCCAGA
CTCCTCATCTATCTTGTATCCAACCTAGAATCTGGGGTCCCTGCCAGGT
TCAGTGGCAGTGGGTCTGGGACAGACTTCACCCTCAACATCCATCCTGT
GGAGGAGGAGGATGCTGCAACCTATTACTGTCAGCACATTAGGGAGCTT
ACACGTTCGGAGGGGGGACCAAGCTGGAAATAA.
In a particular embodiment, the antibody comprises a light chain variable region consisting of:
(SEQ ID NO: 6)
DVVMTQSPASLAVSLGQRATISYRASKSVSTSGYSYMHWNQQKPGQPPR
LLIYLVSNLESGVPARFSGSGSGTDFTLNIHPVEEEDAATYYCQHIREL
TRSEGGPSWK.
The anti-S100 Ab described herein may be employed in admixture with a suitable physiological or pharmaceutical carrier. Such compositions comprise a therapeutically effective amount of the antibody, and a physiologically or a pharmaceutically acceptable carrier or excipient. Such a carrier includes but is not limited to saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof. The formulation should suit the mode of administration.
An antibody as defined herein, acting as inhibitor or antagonist of S100A8 protein, can be administered alone or in combination with other antibodies directed toward other complementary targets, including but not limited to, other S100 polynucleotides or polypeptides.
The antibodies encompassed herein may be advantageously utilized in combination with other monoclonal or chimeric antibodies, with cytokines, or with S100 proteins. The antibodies may be administered alone or in combination with other types of treatments. For example, the antibody described herein can be administered in combination, simultaneously or separately, with for example a chemotherapeutic agent, such as daunorubicin (Cerubidine), doxorubicin (Adriamycin), and cytarabine. Generally, administration of products of a species origin or species reactivity (in the case of antibodies) that is the same species as that of the patient is preferred. Thus, in a preferred embodiment, human antibodies, fragments, derivatives, or analogs are administered to a human or animal patient for therapy or prophylaxis.
It is preferred to use high affinity and/or potent in vivo inhibiting and/or neutralizing antibodies against S100 polypeptides or polynucleotides encompassed herein, fragments or regions thereof, for therapy of disorders related to S100 polynucleotides or polypeptides, including fragments thereof. Such antibodies, fragments, or regions, will preferably have an affinity for S100 polypeptide encompassed herein.
Particularly, there is provided a method for treating leukemia comprising the step of administering to a subject in need thereof an effective amount of the antibody as defined herein or the composition as defined herein.
The Cancer Genome Atlas (TCGA) Research Network performed whole genome/whole exome sequencing on 200 adult AML cases along with RNA, microRNA and DNA-methylation analysis. S100A8 and S100A9 were amongst the top 5 discriminatory genes for one important sub-group mainly composed of myelomonocytic and monocytic AML, with high RPKM levels (Cancer Genome Atlas Research, N., 2013, The New England journal of medicine, 368: 2059-2074). High concentrations of S100A8 and S100A9 proteins are found in the serum of patients with acute and chronic myeloid leukemia (Ivanov et al., 1996, Immunology letters, 49: 7-13), and these concentrations correlate with growth-stimulating activity in these sera. In addition, S100A8 has been identified as a predictor of poor survival in de novo AML patients (Nicolas et al., 2011, Leukemia: official journal of the Leukemia Society of America, Leukemia Research Fund, U.K, 25: 57-65). Constitutive over-expression of S100A8/A9 is also associated with resistance to prednisone treatment in MLL-rearranged B-ALL, and forced expression of S100A8/A9 in MLL-rearranged B-ALL cells transform prednisone-sensitive into prednisone insensitive cells in vitro (Spijkers-Hagelstein et al., 2012, Leukemia: official journal of the Leukemia Society of America, Leukemia Research Fund, U.K, 26: 1255-1265).
To address the possible involvement of S100A8 and S100A9 proteins in AML, their expression was measured using two well-characterized myeloid leukemia models induced by overexpression of Hoxa9 and the cofactor Meis1 or expression of the oncogene MLL-ENL in hematopoietic progenitors and stem cells (HPSC) transplanted into lethally irradiated recipient. As in AML patients, it was observed a substantial increase of S100A8/A9 concentration in plasma of primary recipient mice expressing Hoxa9 and Meis1 (H9M) and MLL-ENL (5.0 μg/mL±1.0 μg/mL and 3.8 μg/mL±0.5 μg/mL, respectively) compared to control mice (0.5 μg/mL±0.08 μg/mL) (see FIG. 1). S100A8/A9 levels in plasma of H9M secondary recipient was also increased by an approximatively tenfold. Although the heterodimeric form was predominant, both homodimeric S100A8 and S100A9 were observed in plasma of AML mice (see FIG. 2). Elevated concentrations of S100A8/A9 were found in bone marrow and spleen supernatants of AML recipient, indicating that extracellular fluids are also enriched in those proteins. S100A8/A9 concentration gradually increased as leukemia progressed and strongly correlated to regress of leukemic cells from the bone marrow to the blood (see FIG. 3).
To investigate the roles of S100A8 and S100A9 in leukemia progression, H9M driven AML secondary recipients were treated i.p with 10 mg/kg of either pAb anti-S100A8 or with mAb anti-S100A9. These antibodies interact with both homodimeric S100A8/A8 or S100A9/A9 respectively, and heterodimeric S100A8/A9. Injection of anti-S100A8 led to a marked delay in leukemia progression and significantly extended survival compared to control immunoglobulins (FIG. 4). This was associated with reduced weight loss and improvement of the behavior of leukemic mice in anti-S100A8-treated mice (FIG. 5). The percentage of leukemic cells in peripheral blood of anti-S100A8 treated mice and S100A8/A9 concentrations were also significantly reduced (FIG. 6). In contrast, no difference was observed between control IgG and anti-S100A9-treated mice in terms of plasma S100A8/A9 levels, leukemic cells in blood or overall survival (FIG. 4). Analysis of anti-S100A8 treated mice revealed an increase of mature myeloid cell marker CD11b and Gr1 expression (FIG. 7), cells in G0/G1 cell cycle phases (FIG. 8) and cytological modifications characteristic of granulocytic cells (FIG. 9) whereas no changes were observed in anti-S100A9 suggesting enhancement of AML cell differentiation and that the anti-S100A8 had induced myeloid differentiation. Accordingly, S100A8 promotes AML pathogenesis by interfering with myeloid cell differentiation.
To confirm the effect of the anti-S100A8, human cord blood cells transfected with the fusion gene MLL-AF9 were stimulated with anti-S100A8 for 72 h. Cell differentiation was examined using expression of CD14 as a marker of cell differentiation. Anti-S100A8 mAb 1F8 doubled the number of cells expressing of CD14 (FIG. 10A), suggesting a stimulation of cell differentiation. In addition, anti-S100A8 mAb 1F8 increased the number of cells in G0/G1 and S phases (FIG. 10B), indicating an inhibition of proliferation of the cells.
As shown in FIG. 11, the anti-S100A8 antibody encompassed herein can be administered with a S100A9 peptide in order to significantly increase the delay in leukemia progression and extended survival compared to control immunoglobulins or compared to administration of the anti-S100A8 antibody or S100A9 peptide alone.
S100A9, also known as calgranulin B and myeloid related protein-14 (MRP-14), is a calcium- and zinc-binding protein that belongs to the S100 protein family. S100A9 is highly expressed by the myeloid cell lineage and is found in the extracellular milieu during inflammatory conditions. S100A9 forms heterodimers with S100A8, another member of the S100 family. However, S100A9 may also form monomers which execute specific functions. Human S100A9 has a molecular mass of about 13 kDa and is composed of 114 amino acid residues.
Human S100A9
(SEQ ID NO: 7)
        10         20         30         40         
MTCKMSQLER NIETIINTFH QYSVKLGHPD TLNQGEFKEL
        50         60         70         80
VRKDLQNFLK KENKNEKVIE HIMEDLDTNA DKQLSFEEFI
        90        100        110
MLMARLTWAS HEKMHEGDEG PGHHHKPGLG EGTP
Accordingly, it is disclosed a composition comprising an anti-S100A8 antibody and a S100A9 peptide.
More particularly, it is disclosed a composition comprising an anti-S100A8 antibody comprising a heavy chain variable region encoded by the nucleotide sequence set forth in SEQ ID NO: 3 or 4, a light chain variable region encoded by the nucleotide sequence set forth in SEQ ID NO: 5 or 6, and a S100A9 peptide comprising the amino acid sequence set forth in SEQ ID NO: 7 for treating leukemia.
Accordingly, injection of anti-S100A8 protects from AML by promoting the differentiation of leukemia cells, resulting in reduced proliferation.
The present disclosure will be more readily understood by referring to the following examples which are given to illustrate embodiments rather than to limit its scope.
Example I Bone Marrow Progenitor Cell Transduction and Transplantation Procedure
Bone marrow cells isolated from 5-fluorouracyl-treated C57BL/6 mice (8-12 week old female) were cultivated 2 days in DMEM with 15% fetal calf serum with 10 ng/ml IL-3, 10 ng/ml IL-6 and 100 ng/ml stem cell factor to promote cell cycle entry. Bone marrow cells were then co-cultured with irradiated GP+E86 cells transfected with MSCV-hoxa9-ires-meis1 hpgk-EGFP (virus producing cells) in presence of 5 μg/ml of polybrene for 2 days.
Primary leukemia recipient C57BL/6 mice were irradiated (7 Gy), then injected i.v. 24 h later with 4×105 infected bone marrow cells (expressing Hoxa9, Meis1 and Egfp). Mice were followed every day for signs of leukemia. Peripheral blood was harvested every week to quantify the number of leukemia cells (expressing GFP) by flow cytometry. Moribund mice were sacrificed and the peripheral blood and bone marrow were harvested.
Secondary leukemia were induced by injecting 2×105 bone marrow cells from primary leukemia mice into sublethally irradiated (4Gy) recipient.
Example II Anti-S100A8 Antibody Treatment
Leukemic cells isolated from bone marrow of primary leukemia mice were injected into sublethally irradiated (4Gy) recipient C57BL/6 mice. The presence of AML cells (EGFP+) in peripheral blood was evaluated by flow cytometry 14 days later. Mice were injected i.p three times per week with 100 μg purified rabbit IgG anti-S100A8 starting on day 3. Mice exhibiting signs of ill health were sacrificed and peripheral blood and bone marrow were harvested for histology and flow cytometry analyses.
Example III Stimulation MLL-AF9
Human cord blood cells transfected with the fusion gene MLL-AF9 were cultivated in IMDM supplemented with 15% fetal calf serum, IL-6 and stem cell factor. The cells were plated 96 well microtiter plates (200 000 cells/well), then stimulated with 20 μg/ml of mAb 1F8 anti-S100A8, or PBS. After 72 h, cells were collected and immunophenotyping was performed by flow cytometry following staining with anti-CD14. Cell cycle was analyzed by propidium iodide staining.
Example IV Combination of Anti-S100A8 and S100A9 Peptide
Leukemic cells isolated from bone marrow of primary leukemia mice were injected into sublethally irradiated (4Gy) recipient C57BL/6 mice. The presence of AML cells (EGFP+) in peripheral blood was evaluated by flow cytometry 14 days later. Mice were injected i.p three times per week with 100 μg purified rabbit IgG anti-S100A8, 20 μg of recombinant mouse S100A9 protein, or a combination of anti-S100A8 and S100A9 protein starting on day 3. Mice exhibiting signs of ill health were sacrificed and peripheral blood and bone marrow were harvested for histology and flow cytometry analyses.
While the disclosure has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations following, including such departures from the present disclosure as come within known or customary practice within the art to which the disclosure pertains and as may be applied to the essential features hereinbefore set forth, and as follows in the scope of the appended claims.

Claims (14)

What is claimed is:
1. An anti-S100A8 antibody, wherein said anti-S100A8 antibody comprises a heavy chain variable region encoded by the nucleotide sequence set forth in SEQ ID NO: 3 or a heavy chain variable region consisting of SEQ ID NO: 4, and said anti-S100A8 antibody comprises a light chain variable region encoded by the nucleotide sequence set forth in SEQ ID NO: 5 or a light chain variable region consisting of SEQ ID NO: 6.
2. The anti-S100A8 antibody of claim 1, wherein said anti-S100A8 specifically binds to a S100A8/S100A8 homodimer or a S100A8/S100A9 heterodimer.
3. The anti-S100A8 antibody of claim 2, wherein the anti-S100A8 specifically binds to S100A8 protein is a human S100A8.
4. The anti-S100A8 antibody of claim 3, wherein the human S100A8 comprises the amino acid sequence depicted in SEQ ID NO: 1.
5. The anti-S100A8 antibody of claim 1, wherein said anti-S100A8 is monoclonal or polyclonal antibody.
6. The anti-S100A8 antibody of claim 1, wherein said anti-S100A8 is a mouse antibody, a goat antibody, a human antibody or a rabbit antibody.
7. The anti-S100A8 antibody of claim 1, wherein said anti-S100A8 is a humanized antibody.
8. The anti-S100A8 antibody claim 1, formulated for an administration with a chemotherapeutic agent.
9. The anti-S100A8 antibody of claim 8, wherein the chemotherapeutic agent is at least one of daunorubicin, doxorubicin and cytarabine.
10. A composition comprising the anti-S100A8 antibody claim 1 and a carrier.
11. The composition of claim 10, further comprising a S100A9 peptide or a peptidomimetic thereof.
12. The composition of claim 11, wherein the S100A9 peptide is human S100A9 protein.
13. A method of treating leukemia, stimulating cell differentiation, and/or for inhibiting cell proliferation in a subject comprising the step of administering the anti-S100A8 antibody claim 1 to said subject.
14. The method of claim 13, wherein said leukemia is acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML) and chronic myelomonocytic leukemia (CMML).
US15/759,362 2015-09-14 2016-09-13 Anti-S100A8 for treating leukemia Expired - Fee Related US10894082B2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/759,362 US10894082B2 (en) 2015-09-14 2016-09-13 Anti-S100A8 for treating leukemia

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201562218000P 2015-09-14 2015-09-14
US201562259738P 2015-11-25 2015-11-25
PCT/CA2016/051078 WO2017045070A1 (en) 2015-09-14 2016-09-13 Anti-s100a8 for treating leukemia
US15/759,362 US10894082B2 (en) 2015-09-14 2016-09-13 Anti-S100A8 for treating leukemia

Publications (2)

Publication Number Publication Date
US20180256710A1 US20180256710A1 (en) 2018-09-13
US10894082B2 true US10894082B2 (en) 2021-01-19

Family

ID=58287955

Family Applications (1)

Application Number Title Priority Date Filing Date
US15/759,362 Expired - Fee Related US10894082B2 (en) 2015-09-14 2016-09-13 Anti-S100A8 for treating leukemia

Country Status (8)

Country Link
US (1) US10894082B2 (en)
EP (1) EP3349793B1 (en)
JP (1) JP6750018B2 (en)
CN (1) CN108367068B (en)
CA (1) CA2998410A1 (en)
EA (1) EA038980B1 (en)
HK (1) HK1250649A1 (en)
WO (1) WO2017045070A1 (en)

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP6912800B2 (en) * 2017-03-24 2021-08-04 学校法人金沢医科大学 Hematopoietic tumor therapeutic agent and screening method
WO2019010566A1 (en) * 2017-07-10 2019-01-17 UNIVERSITé LAVAL Anti-s100a8/a9 for inhibiting immunosuppressive activity of mdscs cells
US11858984B2 (en) 2018-04-27 2024-01-02 National University Corporation Okayama University Anti-S100A8/A9 antibody and use thereof
WO2020051460A1 (en) * 2018-09-07 2020-03-12 Sanford Burnham Prebys Medical Discovery Institute Methods of diagnosis and treatment of inflammatory bowel disease
US20230144545A1 (en) * 2019-10-30 2023-05-11 National University Corporation Okayama University Prophylactic and/or therapeutic agent for inflammatory pulmonary disease
KR20230152032A (en) 2021-02-03 2023-11-02 모차르트 쎄라퓨틱스 인코포레이티드 Binding agents and how to use them
WO2023076876A1 (en) 2021-10-26 2023-05-04 Mozart Therapeutics, Inc. Modulation of immune responses to viral vectors
KR20260029504A (en) * 2023-05-22 2026-03-04 앨버트 아인슈타인 컬리지 오브 메디신 Antibodies targeting S100 protein and uses thereof

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004004770A1 (en) 2002-07-05 2004-01-15 Universite Laval Chemotactic factor inhibitor for modulating inflammatory reactions
WO2006005186A1 (en) 2004-07-13 2006-01-19 UNIVERSITé LAVAL S100 protein inhibitors for treating leukemia
US20100316655A1 (en) * 2008-02-11 2010-12-16 Hall Matthew D Compounds with mdr1-inverse activity

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP5814549B2 (en) * 2008-04-30 2015-11-17 株式会社ジェノミックス Drugs for promoting functional regeneration of damaged tissues
US20100021472A1 (en) * 2008-07-25 2010-01-28 Geetha Srikrishna Methods for diagnosing and treating cancer
EP2892922A2 (en) * 2012-09-10 2015-07-15 Westfälische Wilhelms-Universität Münster Methods and compounds for preventing, treating and diagnosing an inflammatory condition

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004004770A1 (en) 2002-07-05 2004-01-15 Universite Laval Chemotactic factor inhibitor for modulating inflammatory reactions
WO2006005186A1 (en) 2004-07-13 2006-01-19 UNIVERSITé LAVAL S100 protein inhibitors for treating leukemia
US20070231317A1 (en) * 2004-07-13 2007-10-04 Universite Laval S100 Protein Inhibitors for Treating Leukemia
US20100316655A1 (en) * 2008-02-11 2010-12-16 Hall Matthew D Compounds with mdr1-inverse activity

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
Barabe et al., "Myeloid-related protein S100A9 induces cellular differentiation in acute myeloid leukemia through TLR2 and TLR4 receptors". Blood, Dec. 2015, vol. 126, No. 23, pp. 3858.
Laouedj et al. "S100A9 induces differentiation of acute myeloid leukemia cells through TLR4", Blood, 2017, vol. 129, No. 14.
Spijkers-Hagelstein, et al., "Elevated S100A8/S100A9 espression causes glucocorticoid resistance in MLL-rearranged infant acute lymphoblastic leukemia". Leukemia, Jun. 2012, vol. 26, No. 6, pp. 1255-1265.
Yang L. et al., "S100A8-targeting siRNA enhances arsenic trioxide-induced myeloid leukemia cell death by down-regulating autophagy". Int. J. Mol. Med., Jan. 2012, vol. 29, No. 1, pp. 65-72.
Yang M. et al., "S100A8 contirbutes to drug resistance by promoting autophagy in leukemia cells". PLoS one, May 2014, vol. 9, No. 5.

Also Published As

Publication number Publication date
EP3349793A4 (en) 2019-05-01
JP6750018B2 (en) 2020-09-02
EA038980B1 (en) 2021-11-17
HK1250649A1 (en) 2019-01-11
JP2018527410A (en) 2018-09-20
WO2017045070A1 (en) 2017-03-23
CA2998410A1 (en) 2017-03-23
EP3349793A1 (en) 2018-07-25
EA201890739A1 (en) 2018-09-28
CN108367068A (en) 2018-08-03
EP3349793B1 (en) 2021-08-11
US20180256710A1 (en) 2018-09-13
CN108367068B (en) 2021-08-03

Similar Documents

Publication Publication Date Title
EP3349793B1 (en) Anti-s100a8 for treating leukemia
JP7138735B2 (en) Antibodies and vaccines for use in treating ROR1 cancer and inhibiting metastasis
RU2603742C2 (en) Pharmaceutical composition for treatment and/or prevention of cancer
ES2526079T3 (en) Anti-ILT7 antibody
BR112019014694A2 (en) anti-cd47 antibodies and their uses
US12552873B2 (en) Anti-PSGL-1 compositions and methods for modulating myeloid cell inflammatory phenotypes and uses thereof
JP6649941B2 (en) Anticancer / metastasis inhibitor using FSTL1 and combination thereof
UA120753C2 (en) Anti-cd3 antibodies and methods of use
KR20220031738A (en) Use of anti-fam19a5 antibodies for treating cancers
US20230348603A1 (en) Anti-vsig4 compositions and methods for modulating myeloid cell inflammatory phenotypes and uses thereof
CN113015751A (en) Fusion protein and application thereof
CN110117329A (en) Fused polypeptide and application thereof comprising chemotactic factor (CF) and binding partners
KR20250067121A (en) CNX antigen-binding molecule
JP2022023216A (en) Composition for preventing or treating skin diseases containing substance that specifically binds to peptide derived from vimentin
US20260116986A1 (en) Epo receptor agonists and antagonists
MX2011000117A (en) Pharmaceutical composition for treatment and prevention of cancer.
US20220363752A1 (en) Anti-lrrc25 compositions and methods for modulating myeloid cell inflammatory phenotypes and uses thereof
WO2005084708A1 (en) Medicinal composition containing cxcr3 inhibitor
US20240117034A1 (en) GARP Protein Antibody and Use Thereof
KR20240101664A (en) Multispecific binding moiety comprising PD-1 and TGF-BRII binding domains
KR20230079074A (en) Immunoglobulin E antibody compositions and methods of use
US20240352121A1 (en) Lair-1 agonistic antibodies and methods of use thereof
TW202033553A (en) Antibody, kit comprising the same, and uses thereof
TW202535920A (en) Chimeric antigen receptor against programmed death ligand 1 (pd-l1) and application thereof
WO2026073314A1 (en) Activating epha2 antigen-binding agents and uses thereof

Legal Events

Date Code Title Description
FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

AS Assignment

Owner name: UNIVERSITE LAVAL, CANADA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:TESSIER, PHILIPPE;LAOUEDJ, MALIKA;BARABE, FREDERIC;AND OTHERS;SIGNING DATES FROM 20180403 TO 20180423;REEL/FRAME:045776/0455

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE AFTER FINAL ACTION FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED

STCF Information on status: patent grant

Free format text: PATENTED CASE

FEPP Fee payment procedure

Free format text: MAINTENANCE FEE REMINDER MAILED (ORIGINAL EVENT CODE: REM.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

LAPS Lapse for failure to pay maintenance fees

Free format text: PATENT EXPIRED FOR FAILURE TO PAY MAINTENANCE FEES (ORIGINAL EVENT CODE: EXP.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

STCH Information on status: patent discontinuation

Free format text: PATENT EXPIRED DUE TO NONPAYMENT OF MAINTENANCE FEES UNDER 37 CFR 1.362

FP Lapsed due to failure to pay maintenance fee

Effective date: 20250119