CROSS-REFERENCE TO RELATED APPLICATION
This present application is a divisional application of U.S. application Ser. No. 14/494,661, filed Sep. 24, 2014, which itself claims priority under 35 U.S.C. § 119(e) to U.S. Provisional Ser. No. 61/882,116, which was filed on Sep. 25, 2013, the entirety of which is hereby incorporated by reference.
FIELD OF THE INVENTION
The present invention is related to silencing specific eukaryotic translation initiation factors in plants to produce a plant resistant to viruses such as Potyviruses, Luteoviruses, and Furoviruses. More specifically, the plant would be resistant to viruses such as Wheat streak mosaic virus, Triticum mosaic virus, Soil bourne mosaic virus, or Barley yellow dwarf virus.
BACKGROUND OF INVENTION
Fire, et al. (U.S. Pat. No. 6,506,559) discloses a process of introducing RNA into a living cell to inhibit gene expression of a target gene in that cell. The RNA has a region with double-stranded structure. Inhibition is sequence-specific in that the nucleotide sequences of the duplex region of the RNA and of a portion of the target gene are identical. Specifically, Fire, et al. (U.S. Pat. No. 6,506,559) discloses a method to inhibit expression of a target gene in a cell, the method comprising introduction of a double stranded ribonucleic acid into the cell in an amount sufficient to inhibit expression of the target gene, wherein the RNA is a double-stranded molecule with a first ribonucleic acid strand consisting essentially of a ribonucleotide sequence which corresponds to a nucleotide sequence of the target gene and a second ribonucleic acid strand consisting essentially of a ribonucleotide sequence which is complementary to the nucleotide sequence of the target gene. Furthermore, the first and the second ribonucleotide strands are separately complementary strands that hybridize to each other to form the said double-stranded construct, and the double-stranded construct inhibits expression of the target gene.
To utilize RNA interference as a method to regulate gene expression for control, a specific essential gene needs to be targeted. Coordinated gene expression requires factors involved in transcription and translation. Translation initiation coordinates activities of several eukaryotic initiation factors (eIF) or proteins which are classically defined by their cytoplasmic location and ability to regulate the initiation phase of protein synthesis. One of these factors, the eIF4F complex involves the expression of two proteins EIF(iso)4E-2 and EIF4G.
Disclosed in Caranta et al. (U.S. Pat. No. 7,919,677) is a method to obtain Potyvirus resistant plants having mutations in an eIF4E translation factor region. Additionally, disclosed in Jahn et al. (U.S. Pat. No. 7,772,462) is silencing of translation initiation factor eIF4E from Capsicum annuum imparted virus resistance to transgenic plants. Given the interest and showing of viral resistance to poyviruses related to eIF4 region, there is a need in the art to determine whether targeting eIF(iso)4E-2 or eIF4G via RNA interference induces viral resistance in vial susceptible plants.
BRIEF DESCRIPTION OF THE DRAWINGS
The present invention together with the above and other objects and advantages may best be understood from the following detailed description of the embodiment of the invention illustrated in the drawings, wherein:
FIG. 1A and FIG. 1B depicts a vector map for a CP fragment cloned into pANDA mini vector by means of homologous recombination via LR clonase.
BRIEF DESCRIPTION OF THE SEQUENCES
The invention can be more fully understood from the following detailed description and the accompanying sequence descriptions, which form a part of this application.
| SEQ. ID. NO: 1: |
| ATGGCAGAGGTCGAAGCTGCGCTCCCGGTGGCGGCGACAGAGACCCCGGA |
| |
| GGTCGCCGCCGAGGGCGACGCGGGTGCGGCCGAGGCGAAGGGGCCGCACA |
| |
| AGCTGCAGCGGCAGTGGACCTTCTGGTACGACATCCAGACCAAGCCCAAG |
| |
| CCCGGCGCCGCCTGGGGCACCTCGCTCAAAAAGGGCTACACCTTCGACAC |
| |
| CGTCGAAGAGTTCTGGTGCTTGTATGATCAGATTTTCCGTCCGAGTAAGC |
| |
| TGGTAGGAAGTGCTGATTTTCATTTATTCAAGGCTGGGGTAGAACCAAAG |
| |
| TGGGAAGATCCAGAGTGCGCAAATGGAGGCAAATGGACTGTGATATCTAG |
| |
| CAGGAAGACCAATCTTGATACCATGTGGCTTGAAACGTGTATGGCTCTGA |
| |
| TTGGAGAGCAGTTCGATGAAAGCCAGGAAATTTGTGGTGTTGTTGCTAGT |
| |
| GTCCGCCAGAGACAGGATAAGCTTTCATTATGGACTAAGACTGCCAGTAA |
| |
| CGAAGCTGTTCAGGTGGACATTGGCAAGAAATGGAAGGAGGTTATTGACT |
| |
| ACAATGATAAGATGGTCTACAGCTTCCACGATGACTCAAGAAGTCAGAAA |
| |
| CCAAGCAGAGGTGGACGATACACCGTCTAA corresponds to the |
| |
| cDNA of eIF(iso)4E-2. |
| |
| SEQ. ID. NO: 2: |
| MAEVEAALPVAATETPEVAAEGDAGAAEAKGPHKLQRQWTFWYDIQTKPK |
| |
| PGAAWGTSLKKGYTFDTVEEFWCLYDQIFRPSKLVGSADFHLFKAGVEPK |
| |
| WEDPECANGGKWTVISSRKTNLDTMWLETCMALIGEQFDESQEICGVVAS |
| |
| VRQRQDKLSLWTKTASNEAVQVDIGKKWKEVIDYNDKMVYSFHDDSRSQK |
| |
| PSRGGRYTV corresponds to the amino acid sequence |
| |
| encoded by SEQ. ID. NO: 1. |
| |
| SEQ. ID. NO: 3: |
| ATGGGGCATCAAGGACAAACCATGATGTATCCGTCTGTTGCTCATCCAAT |
| |
| CCCTCCTCAACTGGGCAATGTTAATTTGAACATGGCTTCACAGTATCCTC |
| |
| AGCAACAGCAGAATAAGCTTGTTGCTCCTCGAAAGAGCAGTAATATCAAA |
| |
| ATTACTGATCCAAACACTAACAAAGAAGTGGTTCTTGGGCGGCCTTCACC |
| |
| TAATGTAGCAGTACAACCGCAGCAAGTCAGTGGTGTTGCAACTCAGCCTA |
| |
| TGGTTTACTATACTAATCCACAGCAGACCTCGTATAACCAGTCAGGCACG |
| |
| TATTACTCCGGCACTGCTGGTGTTGTTCCCACTGGATCACAGGGCAGGTT |
| |
| TGGTTATCCTGCCACTCAAGCTGGTCAATCAATTCCTTTCATGAACCCTT |
| |
| CTATGTCAAATACTGTTCCTGCCAGCCACAAGGACAACATAGCTGGGCCT |
| |
| GCACCATCTGGTCAGTCCCAACTCATAGGCAAACCACAAGGTGGGTTGCA |
| |
| CATGGAGAAACCTGTTCCCTCGGTCAAGATAAGTATGCCTGCAGGTAGAT |
| |
| CAGACGCTTCTAAATTCGGGTCGCTGACCATGCGGTACAACATCGACAAA |
| |
| AGGATAATGAAGTTATTTCTGGTGCTATGGTTTCGAATAAACCAGTTAGT |
| |
| GAGAAGGAGAGCAAGGCACCATCTATCCCAGAGAAGCACTCCAAGGAAAG |
| |
| TAAAGCACCATCTGCCGTGGAGAAGCATCCCACTGCGGTGACTCAACCTT |
| |
| TACCGATTCAAGCTGCAAAGCCAGAAACTGATGCAGCGACTGCAAATTCA |
| |
| CCCTCATTCTTGACCGGAGCTGATGAAAAGAAAGAATCCCTTCCAATGAC |
| |
| TGATTCACTTAAGGATAACAAGAAAAATGCAACTAGAAATGACACAAAGA |
| |
| ATTTGCCGCAACAACCTCAGTCTGCTTCCCCTGCCGAAGAGTTGAAGGGG |
| |
| CAAACTTCTGTGAAGCTTGGTGATGATGTGGTTGGTCACATGGAAACCAA |
| |
| GAGCTTCGATAGTGAAAAGGTGGATTTAACCAGCAAGGTTTCAGGCTTAA |
| |
| CATCAGCAACATCTGAAAGTAGTATTTCTCCTATTCTTGGTAAAAGTGAA |
| |
| GCTGACAGCACATCAGTAGATGCTGCTGATGTTCCTGCCATGGTAATCAG |
| |
| CTCTGCAAAATTGTCCTCTGCGAGCACTGGGGAGCCCCAAGCAGTAGAAA |
| |
| GCTTAGGTGTTGCTGCTGTTAAATCTAAGGAGATTGAAATAACTCACCAA |
| |
| ATTTCACCTGAATCTAGTGATGGCAAAATTATGTCTGATTCTACTGAAAA |
| |
| TGAATCACATGACTTCACGGTGGACTTGGCTGAGCAGGCATCATTGGCAA |
| |
| CTTCAAAGCCTGGTAATTCAGATGCAACATCTTTTGTAACTGACCCGCAA |
| |
| GAGCTACCCAAGGAGTGCACAACATCTGTACCGGAGGACCACAGTTTGAT |
| |
| GAATACATCACATAATAAGGATACCCAAACTTTATCAGCTTCTGTGGATG |
| |
| CCAGCGATGTGTCTGAGGTCAATTCTGGAACCTCATCAGAGTCTACCAGC |
| |
| CAAAGTACCAACGATAAAGATATCAGAAGTAGCATTCAGGAAACTGGATT |
| |
| AGCTGTTTCTGGTATTACTCCTGGCATGTTGCCTGTGAATCATTCAGTTG |
| |
| CATCTGAGGGGCAAGTCAAACATGCAGATGGAGCGAAGGATGAGTCTAGT |
| |
| ACTGAGCAATCAAGTGCCGTACCAACAGGTTCTGTTAGACCCTTATCAAG |
| |
| GGAAAAACCTACTGCAGAGCTTGCCCGAACAAAGTCTACAGCTGGGAGAA |
| |
| AGAAGAAACGGAAGGAAATGCTTTCAAAAGCTGATGCTGCTGGGAGCTCA |
| |
| GATCTGTACAATGCATACAAAGGACCACAAGAACAGTCTGAGAGTGTTGC |
| |
| CACATCAGACGGTGCTGATAGTTCTTCAACAGTCGACGGGACACATGTGC |
| |
| TGCCTGAGGAATCAGAAAGGGAGGTGATGTGTGAGGACGATGGAAAGAAA |
| |
| AAAGTTGAGCCGGATGATTGGGAAGATGCAGCAGACATGTCTACTCCAAA |
| |
| GCTGCAAAGTTCGGACTCTGGAAACCAGGCTAGTGCAGTTCAATTGCCAG |
| |
| ATTCTGATATGACTGAAGCTAATGGCCGAAAGAAATATTCTCGTGATTTT |
| |
| CTTCTAACTTTTGCACATCAGTATTCTAGTCTTCCTGTTGGCATCCGGAT |
| |
| GGATACTGTCACTAGTACGCTATTCAAAGATTTGGCAGGAAAATCCTATG |
| |
| TTATTGATCGGGAACCTCACCCAAGTTCTGCAAGGGGATCTGATAGACCA |
| |
| ACATCTCGCGGTGATCGCCGTGGTCCTGCTATGGATGATGATAAGTGGTT |
| |
| AAAATCAGGTGTTCCTTACAGTCCTAACCGTGATGCCCACATGGACTTGA |
| |
| CAAACGGCCCAGCAATTAATTACCGTGGCGGCCCAGGAGGCGCTCATGGT |
| |
| GTTCTGAGGAATCCACGTGGTGCACTCCTTGTGGGACCACAATCCAATGC |
| |
| TCCTCAAGTACCCCGCAGTGGCTCTGATGCAGATAGATGGCAGCAAAAGG |
| |
| GTCTGATCCCATCTCCTGTTACACCCATGCAAGTAATGCACAAAGCCGAG |
| |
| AAAAAGTATGTTGTCGGCAAAGTTTCTGATGAGGAGCAGGCAAAGCAGAG |
| |
| GCAGCTGAAAGCCATTCTGAATAAACTGACCCCACAAAACTTTGACAAGC |
| |
| TTTTTGAACAAGTGAAAGAGGTGAACATTGACAATGTATCAACTCTTACT |
| |
| GGGGTGATTTCACAGATATTTGACAAAGCTTTGATGGAACCAACTTTCTG |
| |
| TGAAATGTATGCCAACTTCTGTTCCCATTTGGCTGGTGCCCTGCCAGACT |
| |
| TTAGTGAGGACAATGAAAAGATTACATTCAAGAGACTGCTATTGAACAAG |
| |
| TGCCAAGAGGAGTTTGAGAGGGGAGAAAGAGAAGAAGCTGAAGCAGATAA |
| |
| AACGGAGGAGGAAGGTGAGATTAAGCAAACGAAAGAGGAAAGGGAAGAAA |
| |
| AGAGAGTTAAAGCTCGAAGGCGCATGCTGGGTAATATTAGATTGATTGGA |
| |
| GAATTGTACAAAAAGAGGATGTTGACAGAGCGCATCATGCATGAATGCAT |
| |
| CAAAAAATTGTTGGGAAATTATCAGAATCCAGATGAGGAGAACATTGAAG |
| |
| CACTATGCAAATTGATGAGTACAATTGGAGAGATGATAGATCATCCCAAG |
| |
| GCTAAGGAACATATGGATGCNTATTTTGATAGAATGCGCAACCTGTCGAC |
| |
| CAGTCAACTGATATCTTCCCGTGTTAGATTCCTGCTCAGAGATTCAATCG |
| |
| ATCTCAGGAAGAACAAATGGCAGCAAAGGCGTAAAGTGGATGGCCCCAAG |
| |
| AAGATTGATGAGGTTCACAGGGATGCAGCTCAGGAAAGACATGCTCAATC |
| |
| GAGTAGGTCTCGTGGTCCAGTCGTTAGTTCTCTTCCAAGAAGAGGGGCAC |
| |
| CCTCTATGGATTACGGCTCCCGTGGCTCAGCAGCACCATTGGTATCTCCA |
| |
| GGTCCTCAGCAACGAGGGCGTGGATTTGGTAATCAAGATATTCGGTATGA |
| |
| GCAGGAAAGGCATCAGTTTGATAGAACTGTTCCCCTTCCCCAGCGTTCTG |
| |
| TAAAGGACGAAGCTATCACTCTTGGACCACAAGGTGGCCTAGCTAGGGGT |
| |
| ATGTCTTTAAGAGGGCAGCCACCGGTATCAAATTCTGAACTTCCTAGTGT |
| |
| TGTTGACCAGCGCAGGATTGTATCTGGTCCTAATGGGTACAATTCTGTGC |
| |
| CTTCAACAACAAGAGAAGACACTAGCTCTAGAATTCCAGATCGATTTTCT |
| |
| GGGAGAATAGCACCTGCTGCACAATCTGCTAGTTCTTCACACAGACCTGC |
| |
| CAGCCAGGAGGGTCGTTCAGGAAATAAATCATACTCTGAGGAGGAATTGA |
| |
| GAGAGAAATCTATTGCAACCATCCGGGAATATTATAGTGCGAAAGATGAA |
| |
| AAGGAAGTTGCATTGTGTATTGAGGAGTTGAATGCTCCGAGCTTCTATCC |
| |
| TTCTCTTGTATCACTTTGGGTAAATGATTCCTTTGAGAGGAAAGATATGG |
| |
| AAAGAGAGTTGTTGGCAAAGCTCTTTGTCGGGCTTTACAATGGTGGATAT |
| |
| AATTTATTGAGCAAGCCTCAGCTCATTGAGGGGCTTTCATCCGTTCTTGC |
| |
| TTCATTGGAGGATGCTCTAAGTGATTCTCCAAGAGCGGCAGAGTATCTTG |
| |
| GACGTCTTCTTGCAAGGTTTGTGGTGGAGAAGATACTGGTTTTGCAAGAC |
| |
| GTAGGTAAATTGATTGAAGAAGGCGGAGAGGAGCCTGGACACCTTGTGCA |
| |
| GGAAGGCATCGCAGCTGATGTCCTTGGCGCAGTCTTGGAGTGGATCAGAA |
| |
| CAGAAAAGGGGGATTCCTTCTTGAAGGAGGCCAAGACAAGCTCCAATCTC |
| |
| AAGTTGGAGGATTTCAGACCGCAGCATCTTAAGAGGTCAAAGTTGGATGC |
| |
| CTTCATGTTGACTTAA corresponds to the cDNA of eIF4G. |
| |
| SEQ. ID. NO: 4: |
| MGHQGQTMMYPSVAHPIPPQLGNVNLNMASQYPQQQQNKLVAPRKSSNIK |
| |
| ITDPNTNKEVVLGRPSPNVAVQPQQVSGVATQPMVYYTNPQQTSYNQSGT |
| |
| YYSGTAGVVPTGSQGRFGYPATQAGQSIPFMNPSMSNTVPASHKDNIAGP |
| |
| APSGQSQLIGKPQGGLHMEKPVPSVKISMPAGRSDASKFGVADHAVQHRQ |
| |
| KDNEVISGAMVSNKPVSEKESKAPSIPEKHSKESKAPSAVEKHPTAVTQP |
| |
| LPIQAAKPETDAATANSPSFLTGADEKKESLPMTDSLKDNKKNATRNDTK |
| |
| NLPQQPQSASPAEELKGQTSVKLGDDVVGHMETKSFDSEKVDLTSKVSGL |
| |
| TSATSESSISPILGKSEADSTSVDAADVPAMVISSAKLSSASTGEPQAVE |
| |
| SLGVAAVKSKEIEITHQISPESSDGKIMSDSTENESHDFTVDLAEQASLA |
| |
| TSKPGNSDATSFVTDPQELPKECTTSVPEDHSLMNTSHNKDTQTLSASVD |
| |
| ASDVSEVNSGTSSESTSQSTNDKDIRSSIQETGLAVSGITPGMLPVNHSV |
| |
| ASEGQVKHADGAKDESSTEQSSAVPTGSVRPLSREKPTAELARTKSTAGR |
| |
| KKKRKEMLSKADAAGSSDLYNAYKGPQEQSESVATSDGADSSSTVDGTHV |
| |
| LPEESEREVMCEDDGKKKVEPDDWEDAADMSTPKLQSSDSGNQASAVQLP |
| |
| DSDMTEANGRKKYSRDFLLTFAHQYSSLPVGIRMDTVTSTLFKDLAGKSY |
| |
| VIDREPHPSSARGSDRPTSRGDRRGPAMDDDKWLKSGVPYSPNRDAHMDL |
| |
| TNGPAINYRGGPGGAHGVLRNPRGALLVGPQSNAPQVPRSGSDADRWQQK |
| |
| GLIPSPVTPMQVMHKAEKKYVVGKVSDEEQAKQRQLKAILNKLTPQNFDK |
| |
| LFEQVKEVNIDNVSTLTGVISQIFDKALMEPTFCEMYANFCSHLAGALPD |
| |
| FSEDNEKITFKRLLLNKCQEEFERGEREEAEADKTEEEGEIKQTKEEREE |
| |
| KRVKARRRMLGNIRLIGELYKKRMLTERIMHECIKKLLGNYQNPDEENIE |
| |
| ALCKLMSTIGEMIDHPKAKEHMDAYFDRMRNLSTSQLISSRVRFLLRDSI |
| |
| DLRKNKWQQRRKVDGPKKIDEVHRDAAQERHAQSSRSRGPVVSSLPRRGA |
| |
| PSMDYGSRGSAAPLVSPGPQQRGRGFGNQDIRYEQERHQFDRTVPLPQRS |
| |
| VKDEAITLGPQGGLARGMSLRGQPPVSNSELPSVVDQRRIVSGPNGYNSV |
| |
| PSTTREDTSSRlPDRFSGRIAPAAQSASSSHRPASQEGRSGNKSYSEEEL |
| |
| REKSIATIREYYSAKDEKEVALCIEELNAPSFYPSLVSLWVNDSFERKDM |
| |
| ERELLAKLFVGLYNGGYNLLSKPQLIEGLSSVLASLEDALSDSPRAAEYL |
| |
| GRLLARFVVEKILVLQDVGKLIEEGGEEPGHLVQEGIAADVLGAVLEWIR |
| |
| TEKGDSFLKEAKTSSNLKLEDFRPQHLKRSKLDAFMLT |
| |
| corresponds to the amino acid sequence encoded by |
| |
| SEQ ID NO: 3. |
| |
| SEQ. ID. NO: 5: |
| CACCCGCAAATGGAGGCAAATGGACTGT is a forward primer |
| used to amplify a fragment of eIF(iso)4E-2. |
| |
| SEQ. ID. NO: 6: |
| TCCACCTCTGCTTGGTTTCTGACT is a reverse primer used |
| to amplify a fragment of eIF(iso)4E-2. |
| |
| SEQ. ID. NO: 7: |
| CACCTCAGCAGCACCATTGGTATCTCCA is a forward primer |
| used to amplify a fragment of eIF4G. |
| |
| SEQ. ID. NO: 8 |
| GCTCGGAGCATTCAACTCCTCAA is a reverse primer used |
| to amplify a fragment of eIF4G. |
DETAILED DESCRIPTION OF THE INVENTION
Disclosed herein is a method of producing a plant germplasm having resistance to RNA viruses, the method comprises introducing into a parental plant germplasm a chimeric DNA molecule comprising (i) a plant expressible promoter, (ii) a region which encodes dsRNA for eIF(iso)4E-2 or eIF4G which is capable of inhibiting RNA viral replication (iii) plant translation termination signal, b) transforming said parental plant germplasm, c) generating a plant germplasm from the parental plant germplasm comprising the chimeric DNA molecule; and d) selecting plant germplasm obtained from step (c) and identifying germplasm having immunity to viral RNA replication. In one embodiment of the invention, also disclosed is a transgenic plant produced by the method disclosed herein. In another embodiment of the invention, disclosed is a transgenic plant produced by the method disclosed where the plant is resistant to RNA plant viruses selected from the group consisting of Potyviruses, Luteoviruses, and Furoviruses. In yet another embodiment of the invention, disclosed is a transgenic plant produced by the method wherein the plant is resistant to Wheat streak mosaic virus. In yet another embodiment of the invention, disclosed is a transgenic plant produced by the method herein where the plant is resistant to Triticum mosaic virus. In yet another embodiment of the invention, disclosed is a transgenic plant produced by the method herein where the plant is resistant to Soil bourne mosaic virus. In another embodiment of the invention, disclosed is a transgenic plant produced by the method herein where the plant is resistant to Barley yellow dwarf virus.
In another embodiment of invention, the expression of transgenes and resistance phenotype remains stable in multiple generations of the progeny in the transgenic plant produced by the method herein. In another embodiment of the invention, the seed of a transgenic plant produced by the method herein.
In various embodiments of the invention, the method for transforming plant germplasm can be accomplish through a process selected from the group consisting of a biolistic particle delivery system, microprojectile bombardment, viral infection, Agrobacterium-mediated transformation, and electroporation.
In another embodiment of the invention, the method for producing a plant germplasm having resistance to RNA viruses is due to inhibited expression of an eIF(iso)4E-2 gene encoding a protein comprising SEQ. ID. NO: 2. In yet another embodiment of the invention, the method for producing a plant germplasm having resistance to RNA viruses is due to inhibited expression of an eIF4G gene encoding a protein comprising SEQ. ID. NO: 4. In another embodiment of the invention, disclosed is a transgenic plant having resistance to RNA viruses where said transgenic plant comprises a chimeric DNA molecule which encodes a double stranded RNA molecule for eIF(iso)4E-2 or eIF4G.
Disclosed herein is a nucleic acid construct comprising a nucleotide sequence of SEQ. ID. NO: 1 or an antisense sequence corresponding to SEQ. ID. NO: 1, wherein the construct is operably linked to a promoter that drives expression in a plant cell. Also disclosed is a vector comprising of the nucleic acid SEQ. ID. NO: 1. In an embodiment of the invention is a transgenic plant having stably incorporated in its genome the nucleotide sequence of SEQ. ID. NO:1.
Disclosed herein is a nucleic acid construct comprising of the nucleotide sequence of SEQ. ID. NO: 3 or an antisense sequence corresponding to SEQ. ID. NO: 3, wherein the construct is operably linked to a promoter that drives expression in a plant cell. Also disclosed is a vector comprising the nucleic acid SEQ. ID. NO: 3. In an embodiment of the invention is a transgenic plant having stably incorporated in its genome the nucleotide sequence of SEQ. ID. NO:3.
Disclosed herein is a non-transgenic plant comprising an eIF(iso)4E-2 allele in its genome, whereby the eIF(iso)4E-2 allele is an allele which encodes a protein comprising the amino acid sequence of SEQ. ID. NO: 1, characterized in that said eIF(iso)4E-2 allele comprises one or more mutations in its nucleotide sequence and whereby as a result of said one or more mutations the plant comprising said mutant allele in its genome has significant resistance to RNA viruses compared to a plant comprising a wild type eIF(iso)4E-2 allele in its genome. In an embodiment of the invention, disclosed is a non-transgenic plant produced by the method disclosed where the plant is resistant to RNA plant viruses selected from the group consisting of Potyviruses, Luteoviruses, and Furoviruses. In yet another embodiment of the invention, disclosed is a non-transgenic plant produced by the method wherein the plant is resistant to Wheat streak mosaic virus. In yet another embodiment of the invention, disclosed is a non-transgenic plant produced by the method herein where the plant is resistant to Triticum mosaic virus. In yet another embodiment of the invention, disclosed is a non-transgenic plant produced by the method herein where the plant is resistant to Soil bourne mosaic virus. In another embodiment of the invention, disclosed is a non-transgenic plant produced by the method herein where the plant is resistant to Barley yellow dwarf virus. In another embodiment of the invention, the seed of a non-transgenic plant produced by the method herein.
Disclosed is a non-transgenic plant comprising of an eIF4G allele in its genome, whereby the eIF4G allele is an allele which encodes a protein comprising the amino acid sequence of SEQ. ID. NO: 4, characterized in that said eIF4G allele comprises one or more mutations in its nucleotide sequence and whereby as a result of said one or more mutations the plant comprising said mutant allele in its genome has significant resistance to RNA viruses compared to a plant comprising a wild type eIF4G allele in its genome.
Definitions
To assist in the understanding of the invention, the following terms, as used herein, are defined below.
As used in the specification and claims, the singular form “a”, “an” and “the” include plural references unless the context clearly dictates otherwise. For example, the term “a cell” includes a plurality of cells, including mixtures thereof.
The term “gene” refers to a DNA sequence involved in producing a polypeptide or precursor thereof. The polypeptide can be encoded by a full-length coding sequence or by any portion of the coding sequence, such as exon sequences. In one embodiment of the invention, the gene target is eIF(iso)4E-2 and eIF4G.
As used herein, the term “isolated” includes a material removed from its original environment, e.g., the natural environment if it is naturally occurring. For example, a naturally occurring polypeptide present in a living organism is not isolated, but the same polynucleotide or polypeptide, separated from some or all of the coexisting materials in the natural system, is isolated. Such polypeptide can be expressed by a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of its natural environment. As used herein, an isolated material or composition can also be a “purified” composition, i.e., it does not require absolute purity; rather, it is intended as a relative definition.
The term “oligonucleotide” refers to a molecule comprising a plurality of deoxyribonucleotides or ribonucleotides. Oligonucleotide may be generated in any manner, including chemical synthesis, DNA replication, reverse transcription, polymerase chain reaction, or a combination thereof. The present invention embodies utilizing the oligonucleotide in the form of dsRNA as means of interfering with a critical developmental or reproductive process that leads to control. Inasmuch as mononucleotides are synthesized to construct oligonucleotides in a manner such that the 5′ phosphate of one mononucleotide pentose ring is attached to the 3′ oxygen of its neighbor in one direction via a phosphodiester linkage, an end of an oligonucleotide is referred to as the “5′ end” if its 5′ phosphate is not linked to the 3′ oxygen of a mononucleotide pentose ring and as the “3′ end” if its 3′ oxygen is not linked to a 5′ phosphate of a subsequent mononucleotide pentose ring. As used herein, a nucleic acid sequence, even if internal to a larger oligonucleotide, also may be said to have 5′ and 3′ ends.
When two different, non-overlapping oligonucleotides anneal to different regions of the same linear complementary nucleic acid sequence, and the 3′ end of one oligonucleotide points towards the 5′ end of the other, the former may be called the “upstream” oligonucleotide and the latter the “downstream” oligonucleotide.
The term “primer” refers to an oligonucleotide, which is capable of acting as a point of initiation of synthesis when placed under conditions in which primer extension is initiated. An oligonucleotide “primer” may occur naturally, as in a purified restriction digest or may be produced synthetically.
A primer is selected to be “substantially complementary” to a strand of specific sequence of the template. A primer must be sufficiently complementary to hybridize with a template strand for primer elongation to occur. A primer sequence need not reflect the exact sequence of the template. For example, a non-complementary nucleotide fragment may be attached to the 5′ end of the primer, with the remainder of the primer sequence being substantially complementary to the strand. Non-complementary bases or longer sequences can be interspersed into the primer, provided that the primer sequence is sufficiently complementary with the sequence of the template to hybridize and thereby form a template primer complex for synthesis of the extension product of the primer.
The term “double stranded RNA” or “dsRNA” refers to two substantially complementary strands of ribonucleic acid. “Identity,” as used herein, is the relationship between two or more polynucleotide sequences, as determined by comparing the sequences. Identity also means the degree of sequence relatedness between polynucleotide sequences, as determined by the match between strings of such sequences. Identity can be readily calculated (see, e.g, Computation Molecular Biology, Lesk, A. M., eds., Oxford University Press, New York (1998), and Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York (1993), both of which are incorporated by reference herein). While there exist a number of methods to measure identity between two polynucleotide sequences, the term is well known to skilled artisans (see, e.g., Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press (1987); and Sequence Analysis Primer, Gribskov., M. and Devereux, J., eds., M Stockton Press, New York (1991)). Methods commonly employed to determine identity between sequences include, for example, those disclosed in Carillo, H., and Lipman, D., SIAM J. Applied Math. (1988) 48:1073. “Substantially identical” as used herein, means there is a very high degree of homology (preferably 100% sequence identity) between the inhibitory dsRNA and the corresponding part of the target gene. However, dsRNA having greater than 90% or 95% sequence identity may be used in the present invention, and thus sequence variations that might be expected due to genetic mutation, strain polymorphism, or evolutionary divergence can be tolerated. Although 100% identity is preferred, the dsRNA may contain single or multiple base pair random mismatches between the RNA and the target gene, provided that the mismatches occur at a distance of at least three nucleotides from the fusion site.
As used herein, “target gene” refers to a section of a DNA strand of a double-stranded DNA that is complementary to a section of a DNA strand, including all transcribed regions, that serves as a matrix for transcription. The target gene is therefore usually the sense strand.
The protein EIF(iso)4E-2 is also identified as eukaryotic translation initiation factor 4E-2, eIF-4E-2, eIF4E-2, eIF-(iso)4F, and eIF-(iso)4F p28 subunit.
The protein EIF4G is also identified as eukaryotic translation initiation factor 4G.
The term “complementary RNA strand” refers to the strand of the dsRNA, which is complementary to an mRNA transcript that is formed during expression of the target gene, or its processing products. “dsRNA” refers to a ribonucleic acid molecule having a duplex structure comprising two complementary and anti-parallel nucleic acid strands. Not all nucleotides of a dsRNA must exhibit Watson-Crick base pairs. The maximum number of base pairs is the number of nucleotides in the shortest strand of the dsRNA.
As used herein, the term “recombinant DNA construct” refer to any agent such as a plasmid, cosmid, virus, BAC (bacterial artificial chromosome), autonomously replicating sequence, phage, or linear or circular single-stranded or double-stranded DNA or RNA nucleotide sequence, derived from any source, capable of genomic integration or autonomous replication, comprising a DNA molecule in which one or more DNA sequences have been linked in a functionally operative manner using well-known recombinant DNA techniques.
A nucleic acid sequence can be inserted into a vector by a variety of procedures. In general, the sequence is ligated to the desired position in a vector following digestion of the insert and the vector with appropriate restriction endonucleases. Alternatively, blunt ends in both the insert and the vector may be ligated. A variety of cloning techniques are known in the art, e.g., as described in Sambrook, J. et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Press, Plainview, N.Y, (1989) and Ausubel, F. M. et al., Current Protocols in Molecular Biology, John Wiley & Sons, New York, N.Y. (1989). Such procedures and others are deemed to be within the scope of those skilled in the art.
The vector can be in the form of a plasmid, a viral particle, or a phage. Preferably, as disclosed herein the vector is a bacterial vector. Other vectors include chromosomal, non-chromosomal and synthetic DNA sequences, pET-30a and derivatives of pET-30; bacterial plasmids, phage DNA, baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, viral DNA such as vaccinia, adenovirus, fowl pox virus, and pseudorabies. A variety of cloning and expression vectors for use with prokaryotic and eukaryotic hosts are described by, e.g., Sambrook, T. et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Plainview, N.Y, (1989).
“Small interfering RNA” or “siRNA” refers to a short double-strand of ribonucleic acid, approximately 18 to 30 nucleotides in length. The term “RNA interference” or “RNAi” refers to a cellular mechanism for the destruction of targeted ribonucleic acid molecules. Under endogenous conditions, RNAi mechanism operates when dsRNA is cleaved to siRNA via an enzyme, DICER. The siRNA is processed to a single strand of anti-sense ribonucleic acid and coupled with a protein complex named RISC. The antisense RNA then targets a complementary gene construct, such as messenger RNA that is cleaved by ribonuclease. While the examples infra discloses constructing dsRNA constructs via enzymatic techniques with the enzyme RNA polymerase, it is contemplated that siRNA can be constructed via RNA oligonucleotide synthesis such as those disclosed in Scaringe, S., Methods Enzymol., 2000, Vol. 317:3 and incorporated herein by reference.
As used herein, “knock-down” is defined as the act of binding an oligonucleotide with a complementary nucleotide sequence of a gene as such that the expression of the gene or mRNA transcript decreases. In an embodiment, knock-down of a eIF(iso)4E-2 and eIF4G gene in a transgenic plant confers resistance against viral RNA for said transgenic plant.
dsRNA containing a nucleotide sequence complementary to a portion of the eukaryotic translation initiation factor gene, preferably eIF(iso)4E-2 and eIF4G. As disclosed herein, 100% sequence identity between the RNA and the target gene is not required to practice the present invention. Thus, the invention has the advantage of being able to tolerate sequence variations that might be expected due to genetic mutation, strain polymorphism, or evolutionary divergence. RNA sequences with insertions, deletions, and single point mutations relative to the target sequence may also be effective for plant resistance to RNA viruses. Thus, sequence identity may be optimized by sequence comparison and alignment algorithms known in the art. Thus, the determination of percent identity between any two sequences can be accomplished using a mathematical algorithm. Non-limiting examples of such mathematical algorithms are the algorithm of Myers and Miller (1988. CABIOS 4: 11-17), the local homology algorithm of Smith et al. (1981. Adv. Appl. Math. 2: 482); the homology alignment algorithm of Needleman and Wunsch (1970. J. Mol. Biol. 48: 443-453); the search-for-similarity-method of Pearson and Lipman (1988. Proc. Natl. Acad. Sci. 85: 2444-2448; the algorithm of Karlin and Altschul (1990. Proc. Natl. Acad. Sci. USA 87: 2264), modified as in Karlin and Altschul (1993. Proc. Natl. Acad. Sci. USA 90: 5873-5877).
Computer implementations of these mathematical algorithms can be utilized for comparison of sequences to determine sequence identity. Such implementations include, but are not limited to: CLUSTAL in the PC/Gene program (available from Intelligenetics, Mountain View, Calif.); the ALIGN program (Version 2.0) and GAP, BESTFIT, BLAST, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Version 8 (available from Genetics Computer Group (GCG), 575 Science Drive, Madison, Wis., USA), MacVector and Assembler Version 12.7 (Macvector. 1939 High House Road, Cary, N.C. USA 27519. Alignments using these programs can be performed using the default parameters.
Greater than 90% sequence identity, or even 100% sequence identity, between the inhibitory RNA and the portion of the eukaryotic translation initiation factor target gene is preferred. Alternatively, the duplex region of the RNA may be defined functionally as a nucleotide sequence that is capable of hybridizing with a portion of the target gene transcript under stringent conditions (e.g., 400 mM NaCl, 40 mM PIPES pH 6.4, 1 mM EDTA, 60° C. hybridization for 12-16 hours; followed by washing). The length of the substantially identical double-stranded nucleotide sequences may be at least about 18, 19, 21, 25, 50, 100, 200, 300, 400, 491, 500, or 510 bases. In a preferred embodiment, the length of the constructed double-stranded nucleotide sequence is approximately from about 18 to about 510 nucleotides in length.
The dsRNA construct disclosed herein may optionally comprise a single stranded overhang at either or both ends. The double-stranded structure may be formed by a single self-complementary RNA strand (i.e. forming a hairpin loop) or two complementary RNA strands. RNA duplex formation may be initiated either inside or outside the cell. When the dsRNA of the invention forms a hairpin loop, it may optionally comprise an intron, as set forth in U.S. 2003/0180945A1 or a nucleotide spacer, which is a stretch of sequence between the complementary RNA strands to stabilize the hairpin transgene in cells. Methods for making various dsRNA molecules are set forth, for example, in WO 99/53050 and in U.S. Pat. No. 6,506,559. The RNA may be introduced in an amount that allows delivery of at least one copy per cell. Expression of higher doses of double-stranded construct may yield more effective RNA viral plant resistance.
While the examples provided wherein describe dsRNA constructs targeting eukaryotic initiation factor genes eIF(iso)4E-2 and eIF4G, (GenBank Accession Nos. Q03389 and EF190330), it is contemplated that when read in conjunction with the teaching disclosed herein, the construction of other dsRNA constructs targeting other eukaryotic initiation factor complex members which in turn reduce or eliminate viral reproduction and replication are disclosed herein.
Additionally it is contemplated that the disclosure herein would teach the transfer of a nucleic acid fragment into the genome of a host organism, resulting in genetically stable inheritance, particularly in a plant. Host organisms containing the transformed nucleic acid fragments are referred to as “transgenic” organisms. Examples of methods of plant transformation include Agrobacterium-mediated transformation (De Blaere et al. 1987. Meth. Enzymol. 143: 277) and biolistic particle delivery or “gene gun” transformation technology (Klein et al. 1987. Nature (London) 327: 70-73; U.S. Pat. No. 4,945,050, incorporated herein by reference). Thus, isolated polynucleotides of the present invention can be incorporated into recombinant constructs, typically DNA constructs, capable of introduction into and replication in a host cell. Such a construct can be a vector that includes a replication system and sequences that are capable of transcription and translation of a polypeptide-encoding sequence in a given host cell. A number of vectors suitable for stable transformation of plant cells or for the establishment of transgenic plants have been described in, e.g., Pouwels et al. 1985. Supp. 1987. Cloning Vectors: A Laboratory Manual; Weissbach and Weissbach. 1989. Methods for Plant Molecular Biology, Academic Press, New York; and Flevin et al. 1990. Plant Molecular Biology Manual, Kluwer Academic Publishers, Boston. Typically, plant expression vectors include, for example, one or more cloned plant genes under the transcriptional control of 5′ and 3′ regulatory sequences and a dominant selectable marker. Such plant expression vectors also can contain a promoter regulatory region (e.g., a regulatory region controlling inducible or constitutive, environmentally- or developmentally-regulated, or cell- or tissue-specific expression), a transcription initiation start site, a ribosome binding site, an RNA processing signal, a transcription termination site, and/or a polyadenylation signal.
It is to be understood that as used herein the term “transgenic” includes any cell, cell line, callus, tissue, plant part, or plant the genotype of which has been altered by the presence of a heterologous nucleic acid including those transgenics initially so altered as well as those created by sexual crosses or asexual propagation from the initial transgenic. The term “transgenic” as used herein does not encompass the alteration of the genome (chromosomal or extra-chromosomal) by conventional plant breeding methods or by naturally occurring events such as random cross-fertilization, non-recombinant viral infection, non-recombinant bacterial transformation, non-recombinant transposition, or spontaneous mutation.
The teachings disclosed herein also teach generating a non-transgenic wheat plant having the genes for eIF(iso)4E-2 or eIF4G silenced through the use of chemical mutagens such as ethyl methanesulfonate (EMS), radiation based mutagenesis such as fast neutron, or site directed mutagenesis, and targeted editing such as zinc finger nucleases, TALEN, or CRISPR technologies. An example would be to expose wheat seeds to 0.6% EMS. M0 seeds would be grown to maturity and allowed to self pollinate. Plants would be screened at the M2 generation for mutations in the eIF(iso)4E-2. DNA from lines would be pooled and TILLING would be used to identify mutant lines. Lines would be screened for resistance to WSMV and TriMV. Resistant lines would be used as germplasm for crop improvement. A second approach would be to use targeted mutations to alter the binding site of an initiation factor that binds to a binding protein to prevent interactions with viral proteins, thus preventing virus replication.
In an embodiment of the invention, targeted cleavage events can be used, for example, to induce targeted mutagenesis, induce targeted deletions of cellular DNA sequences, and facilitate targeted recombination and integration at a predetermined chromosomal ppTAC or ppeTAC locus. Techniques of nucleotide editing can be found for example, Urnov et al. (2010) Nature 435(7042):646-51; United States Patent Publications 20030232410; 20050208489; 20050026157; 20050064474; 20060188987; 20090263900; 20090117617; 20100047805; 20110207221; 20110301073; 2011089775; 20110239315; 20110145940; and International Publication WO 2007/014275, the disclosures of which are incorporated by reference in their entireties for all purposes. Cleavage can occur through the use of specific nucleases such as engineered zinc finger nucleases (ZFN), transcription-activator like effector nucleases (TALENs), or using the CRISPR/Cas system with an engineered crRNA/tracr RNA (‘single guide RNA’) to guide specific cleavage. U.S. Patent Publication No. 20080182332 describes the use of non-canonical zinc finger nucleases (ZFNs) for targeted modification of plant genomes; U.S. Patent Publication No. 20090205083 describes ZFN-mediated targeted modification of a plant EPSPS locus; U.S. Patent Publication No. 20100199389 describes targeted modification of a plant Zp15 locus and U.S. Patent Publication No. 20110167521 describes targeted modification of plant genes involved in fatty acid biosynthesis. In addition, Moehle et al. (2007) Proc. Natl. Acad, Sci. USA 104(9):3055-3060 describes using designed ZFNs for targeted gene addition at a specified locus. U.S. Patent Publication 20110041195 describes methods of making homozygous diploid organisms.
As used herein, the term “plant” includes reference to whole plants, plant organs (e.g., leaves, stems, roots, etc.), seeds, plant cells, and progeny of same. Parts of transgenic plants are to be understood within the scope of the invention to comprise, for example, plant cells, protoplasts, tissues, callus, embryos as well as flowers, stems, fruits, leaves, roots originating in transgenic plants or their progeny previously transformed with a DNA molecule of the invention and therefore consisting at least in part of transgenic cells, are also an object of the present invention.
Example 1: Cloning of eIF(iso)4E-2 (SEQ. ID. NO: 2)
A search term of “eIF4F” was used to identify a partial cDNA sequence from the TIGR wheat EST database (http:\jcvi.org\wheat\ wheat gene index term TC383303). That sequence was used in a BLASTX search to find the full length Triticum aestivum L. EIF(iso)4E-2 amino acid sequence in GenBank (Accession number Q03389). The nucleotide sequence of Q03389 was used to design the primers used to clone a portion of eIF(iso)4E-2. Forward CACCCGCAAATGGAGGCAAATGGACTGT (SEQ. ID. NO: 5) and Reverse TCCACCTCTGCTTGGTTTCTGACT (SEQ. ID. NO: 6) primers were used to amplify a 298 fragment of eIF(iso)4E-2 from cDNA from the cultivar Bobwhite corresponding to nucleotides 318-615.
CACC was added to the 5′ end of the forward primer for directional cloning of the PCR fragment into the entry vector pENTER-D/TOPO (Life Technologies) which carries two recombination sites, attL1 and attL2. The CP fragment was independently cloned into pANDA mini vector (Miki and Shimamoto, 2003; FIG. 1A, FIG. 1B) by means of homologous recombination via LR clonase (Invitrogen, Carlsbad, Calif.).
Example 2: Generation of Silenced eIF(iso)4E-2 Transgenic Wheat Conferring Resistance to Viruses
The construct was bombarded in five independent biolistic experiments using approximately 900 independent wheat embryos. Embryogenic calli was transferred into glufosinate selection and regeneration cycles, where morphological differentiation occurred normally. One hundred and nineteen plants were generated under glufosinate selection, and transferred to soil. Plants were tested for glufosinate resistance and 15 herbicide resistant plants were identified. PCR analyses of these plants identified three with the hairpin construct. Lines were self fertilized and tested in the T3 generation. The majority of the lines derived from single seed descent that contained the gene of interest (GOI) and were expressing were resistant to Wheat streak mosaic virus (WSMV) and Triticum Mosaic Virus (TriMV) both individually and during co-infection (Table 1). Seed from the T2 generation were bulked for testing with Soilbourne mosaic virus (SbWMV). Soil infected with SbWMV was collected and used to grow plants. Most plants that had the GOI and were expressing the GOI were found to be resistant to the virus (Table 2). Bulked T2 seed was also used for testing resistance to Barley yellow dwarf virus (BYDV). A viruliferous aphid colony containing three strains of BYDV, -SGV, -MAV and PAV were used. Ten viruliferous aphids were placed individually on each plant and allowed time to infect. Aphids were then destroyed. Plants were allowed to recover. Most plants that contained the GOI and were expressing were found to be resistant (Table 3).
| TABLE 1 |
| |
| Transgenic wheat plant expressing silenced eIF(iso)4E-2 co-infected |
| with WSMV and TriMV. Transgenic plants were T3 generation derived |
| by single seed selection. Transgenic Bobwhite controls were lines |
| expressing only the bar gene for biolophos resistance. |
| |
Total |
GOI + and |
Resistant |
Resistant |
| T3 eIF4(iso)4E-2 |
Plants |
Expressing |
to WSMV |
to TriMV |
| |
| 1550A |
50 |
47 |
45 |
45 |
| 1822A |
53 |
45 |
40 |
40 |
| 1814A |
54 |
52 |
43 |
43 |
| Transgenic Bobwhite |
24 |
0 |
0 |
0 |
| w/o GOI |
| |
| TABLE 2 |
| |
| Transgenic wheat plant expressing silenced eIF(iso)4E-2 infected |
| with SbWMV. Transgenic plants were T3 generation bulk derived |
| T2 progeny. Transgenic Bobwhite controls were lines expressing |
| only the bar gene for biolophos resistance. |
| |
Total |
GOI + and |
Resistant |
| T3 eIF4(iso)4E-2 |
Plants |
Expressing |
to SbWMV |
| |
| 1550A |
75 |
32 |
26 |
| 1822A |
70 |
28 |
24 |
| 1814A |
73 |
30 |
24 |
| Transgenic Bobwhite |
17 |
0 |
0 |
| w/o GOI |
| |
| TABLE 3 |
| |
| Transgenic wheat plant expressing silenced eIF(iso)4E-2 infected |
| with BYDV. Transgenic plants were T3 generation bulk derived |
| T2 progeny. Transgenic Bobwhite controls were lines expressing |
| only the bar gene for biolophos resistance. |
| |
|
Total |
GOI + and |
Resistant |
| |
T3 eIF4(iso)4E-2 |
Plants |
Expressing |
to BYDV |
| |
|
| |
1550A |
16 |
3 |
3 |
| |
1822A |
10 |
7 |
6 |
| |
1814A |
9 |
6 |
6 |
| |
Transgenic Bobwhite |
2 |
0 |
0 |
| |
w/o GOI |
| |
|
Example 3: Cloning of eIF4G (SEQ: ID. NO. 4)
A search of “Triticum aestivum eIF4G” was used to identify the wheat eIF4G cDNA (EF190330) sequence from GenBank and used to design primers used to clone a portion of wheat eIF4G. The primers used were Forward CACCTCAGCAGCACCATTGGTATCTCCA (SEQ. ID. NO: 7) and Reverse GCTCGGAGCATTCAACTCCTCAA (SEQ. ID. NO: 8). The primers amplified a fragment of a 517 bp from regions 3479-3993 of the eIF4G sequence (EF190330). The fragment was amplified from cDNA from the cultivar Bobwhite.
CACC was added to the 5′ end of the forward primer for directional cloning of the PCR fragment into the entry vector pENTER-D/TOPO (Life Technologies) which carries two recombination sites, attL1 and attL2. The CP fragment was independently cloned into pANDA mini vector (Miki and Shimamoto, 2003; FIG. 1A, 1B) by means of homologous recombination via LR clonase (Invitrogen, Carlsbad, Calif.).
Example 4: Generation of Silenced eIF4G Transgenic Wheat Conferring Resistance to Viruses
A fragment of 517 bp from the host eukaryotic translation initiation factor G (GenBank Accession # EF190330.1) was cloned in pANDA mini and co-bombarded with pAHC20 in five independent biolistic experiments using approximately 900 wheat embryos. Embryogenic calli was transferred onto glufosinate selection. Seventy-two plants were generated under glufosinate selection and transferred to soil. PCR analyses confirmed the presence of the eIF4G hairpin construct in three lines of the bar-positive plants. Lines were self fertilized through the T3 generation. At the T3 generation, plants were inoculated with either WSMV or Triticum mosaic virus (TriMV) at the 2-3 leaf stage. Fourteen days later, plants were inoculated again to insure infection. Twenty-one days after the second inoculation, plants were scored for viral symptoms and compared to the nontransformed Bobwhite susceptible control. Leaf samples were also taken and used for ELISA to determine the presence of viral antigen. The majority of the lines that contained the gene of interest (GOI) were resistant to WSMV and TriMV both individually and during co-infection (Table 4). Seed from the T2 generation were bulked for testing with Soilbourne mosaic virus (SbWMV). Soil infected with SbWMV was collected and used to grow plants. Most plants that had the GOI and were expressing the GOI were found to be resistant to the virus (Table 5). Bulked T2 seed was also used for testing resistance to Barley yellow dwarf virus (BYDV). A viruliferous aphid colony containing three strains of BYDV, -SGV, -MAV and PAV were used. Ten viruliferous aphids were placed individually on each plant and allowed time to infect. Aphids were then destroyed. Plants were allowed to recover. Most plants that contained the GOI and were expressing were found to be resistant (Table 6). These results indicate the eIF4G hairpin construct provides resistance to the two potyviruses, the luteovirus and the furovirus.
| TABLE 4 |
| |
| Transgenic wheat plant expressing silenced eIF4G co-infected with |
| WSMV and TriMV. Transgenic plants were T3 generation derived by |
| single seed selection. Transgenic Bobwhite controls were lines |
| expressing only the bar gene for biolophos resistance. |
| |
Total |
GOI + and |
Resistant |
Resistant |
| T3 eIF4G |
Plants |
Expressing |
to WSMV |
to TriMV |
| |
| 1673A |
50 |
47 |
47 |
47 |
| 1742A |
51 |
48 |
48 |
48 |
| 1755A |
50 |
48 |
48 |
48 |
| 1830A |
46 |
52 |
42 |
42 |
| Transgenic Bobwhite |
24 |
0 |
0 |
0 |
| w/o GOI |
| |
| TABLE 5 |
| |
| Transgenic wheat plant expressing silenced eIF4G infected |
| with SbWMV. Transgenic plants were T3 generation bulk derived |
| T2 progeny. Transgenic Bobwhite controls were lines expressing |
| only the bar gene for biolophos resistance. |
| |
Total |
GOI + and |
Resistant |
| T3 eIF4G |
Plants |
Expressing |
to SbWMV |
| |
| 1673A |
10 |
6 |
6 |
| 1742A |
29 |
19 |
15 |
| 1755A |
20 |
12 |
9 |
| 1830A |
12 |
7 |
7 |
| Transgenic Bobwhite |
11 |
0 |
0 |
| w/o GOI |
| |
| TABLE 6 |
| |
| Transgenic wheat plant expressing silenced eIF4G infected |
| with BYDV. Transgenic plants were T3 generation bulk derived |
| T2 progeny. Transgenic Bobwhite controls were lines expressing |
| only the bar gene for biolophos resistance. |
| |
|
Total |
GOI + and |
Resistant |
| |
T3 eIF4G |
Plants |
Expressing |
to BYDV |
| |
|
| |
1673A |
10 |
4 |
3 |
| |
1742A |
5 |
1 |
1 |
| |
1755A |
7 |
2 |
2 |
| |
1830A |
5 |
3 |
3 |
| |
Transgenic Bobwhite |
7 |
0 |
0 |
| |
w/o GOI |
| |
|
While the invention has been described with reference to details of the illustrated embodiment, these details are not intended to limit the scope of the invention as defined in the appended claims. All cited references and published patent applications cited in this application are incorporated herein by reference. The embodiment of the invention in which exclusive property or privilege is claimed is defined as follows: