US10588951B2 - Compound comprising an autoantigenic peptide and a carrier with a MHC binding motif - Google Patents

Compound comprising an autoantigenic peptide and a carrier with a MHC binding motif Download PDF

Info

Publication number
US10588951B2
US10588951B2 US14/658,962 US201514658962A US10588951B2 US 10588951 B2 US10588951 B2 US 10588951B2 US 201514658962 A US201514658962 A US 201514658962A US 10588951 B2 US10588951 B2 US 10588951B2
Authority
US
United States
Prior art keywords
peptide
mhc class
molecule
carrier
dra
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active, expires
Application number
US14/658,962
Other versions
US20150231216A1 (en
Inventor
Rikard Holmdahl
Jan Kihlberg
Balik Dzhambazov
Mikael Vestberg
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Fraunhofer Gesellschaft zur Foerderung der Angewandten Forschung eV
Original Assignee
Fraunhofer Gesellschaft zur Foerderung der Angewandten Forschung eV
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Fraunhofer Gesellschaft zur Foerderung der Angewandten Forschung eV filed Critical Fraunhofer Gesellschaft zur Foerderung der Angewandten Forschung eV
Priority to US14/658,962 priority Critical patent/US10588951B2/en
Publication of US20150231216A1 publication Critical patent/US20150231216A1/en
Priority to US16/685,424 priority patent/US12115214B2/en
Application granted granted Critical
Publication of US10588951B2 publication Critical patent/US10588951B2/en
Active legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0008Antigens related to auto-immune diseases; Preparations to induce self-tolerance
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/6425Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the peptide or protein in the drug conjugate being a receptor, e.g. CD4, a cell surface antigen, i.e. not a peptide ligand targeting the antigen, or a cell surface determinant, i.e. a part of the surface of a cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6843Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4713Autoimmune diseases, e.g. Insulin-dependent diabetes mellitus, multiple sclerosis, rheumathoid arthritis, systemic lupus erythematosus; Autoantigens
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/605MHC molecules or ligands thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6056Antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Rheumatology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Rehabilitation Therapy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

The invention relates a compound comprising (a) a peptide and (b) a carrier, wherein said peptide having at least the motif X-X-X-X-X-X-X, wherein at least one amino acid residue X is glycosylated, said peptide being linked to the peptide binding protein and said carrier comprises at least a MHC binding motif being linked to said peptide as well as pharmaceutical compositions comprising said compound and the use of said compound or pharmaceutical composition for the treatment of a disease, such as an inflammatory joint disease. The subject matter of the application is exemplified with peptides derived from type II collagen such as peptides having at least the sequence AGFKGEA, or IAGFKGEQPKG, or the peptide AAAKAAA. Preferably a hydroxylysine in the peptides are glycosylated.

Description

FIELD OF INVENTION
The invention relates a compound comprising (a) a peptide and (b) a carrier, wherein said peptide having at least the motif X-X-X-X-X-X-X, wherein at least one amino acid residue X is glycosylated, said peptide being linked to the peptide binding protein and said carrier comprises at least a MHC binding motif being linked to said peptide as well as pharmaceutical compositions comprising said compound and the use of said compound or pharmaceutical composition for the treatment of a disease, such as an inflammatory joint disease.
BACKGROUND OF INVENTION
There is an increasing population of humans suffering from different kinds of inflammatory joint diseases. Diseases, which sometimes are impossible to cure, where the treatment is lifelong and where the symptoms often become worse during the years. So far the focus of the treatment has been on trying to find compounds, which reduce the symptoms but not cure the disease or make the disease decline.
One example of such a disease is rheumatoid arthritis (RA), which is characterized by chronic inflammation of the articular synovial tissues initiated by leukocyte infiltration (mainly neutrophils, macrophages and T cells) and secretion of inflammatory cytokines (TNF-alpha, IFN-gamma, IL-I, IL-6), chemokines and destructive enzymes such as matrix metalloproteases. Activation of T cells is believed to be an important pathogenic factor in the disease although its exact role and potential as a therapeutic target has not yet been identified. The abnormal activation of T cells do, however, most likely occur years before the clinical diagnosis of the disease as T cell dependent IgG antibodies specific for immunoglobulin Fc (i.e rheumatoid factors) and citrullinated protein epitopes are highly predictive for disease (1, 2). Importantly, the risk for developing arthritis is dramatically increased in individuals who have both such antibodies and express certain MHC class II molecules, that share a specific peptide pocket, the so called MHC shared epitope (3, 4). The MHC class II region is also the strongest known genetic factor associated with RA. Taken together, these findings argue for a pathogenic role of MHC class II restricted autoreactive T cells. It has however been difficult to identify a single specificity of such T cells although T cell reactivity to several autoantigens, such as BiP, RA33 and GPI and also joint specific antigens such as type II collagen (CII), have been reported (5-8).
Since there is no way to cure inflammatory joint diseases today there is a need for developing a way to cure the disease.
SUMMARY OF THE INVENTION
The object of the present invention is to solve the above, discussed problem in connection with inflammatory joint diseases.
It has surprisingly been found that by the use of a compound comprising (a) a peptide and (b) a carrier, wherein said peptide having at least the motif X-X-X-X-X-X-X, wherein at least one amino acid residue X is glycosylated, said peptide being linked to the peptide binding protein and said carrier comprises at least a MHC binding motif being linked to said peptide it is possible for the first time to reduce and/or eliminate an inflammatory joint disease. Thereby a mammal suffering from such a disease will bee cured or at least the disease will be reduced.
Additionally the invention relates to a pharmaceutical composition comprising said compound as well as the use of said compound for the treatment of an inflammatory disease or disorder, such as arthritis, rheumatoid arthritis, ankylosing spondylitis, psoriasis arthritis, osteoarthritis, relapsing polychondritis and Menieres disease
In a specific embodiment, said compound is used to vaccinate a mammal and thereby cure or prevent an inflammatory disease or disorder.
Further advantages and objects with the present invention will be described in more detail, inter alia with reference to the accompanying drawings.
DESCRIPTION OF THE DRAWINGS
FIG. 1 shows peptide/Aq complexes activate antigen-specific T-cell hybridomas.
(A) HCQ.3 hybridoma, specific for GalOK264 CII259-273 epitope; (B) HCQ.4 hybridoma, specific for non-modified (K264) CII259-273 epitope.
FIG. 2 shows a criss-cross test of T-cell hybridoma specificities for peptide/Aq complexes. (A) HCQ.3 hybridoma, specific for GalOK264 CII259-273 epitope; (B) HCQ.4 hybridoma, specific for non-modified (K264) CII259-273 epitope.
FIG. 3 shows that GalOK264/Aq complexes suppress development of CIA. (A) Incidence of arthritis (percent of affected mice); (B) Mean clinical score of arthritis severity including both arthritic and healthy mice; (C) Anti-CII IgG serum levels. All data represent mean±SE of 10 mice per group. *, p<0.05; **, p<0.0I and ***, p<0.001.
FIG. 4 shows that GalOK264/Aq complexes reduce arthritis progression in chronic stage. (A) Mean arthritis score for 202 days of the chronic mice chosen for treatment; (B) Mean clinical score of GalOK264/Aq treated mice after reimmunisation; (C) Anti-CII IgG serum levels.
FIG. 5 shows transfer of T cells from GalOK264/Aq treated mice provided protection against CA development. (A) Mean clinical score of arthritis after T-cell transfer; (B) Anti-CII IgG serum levels.
FIG. 6 shows that GalOK264/Aq treatment blocked arthritis progression in H2q/r FI mice.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
In the context of the present application and invention the following definitions apply:
The term “MHC class II molecule” is intended to mean a protein consisting of an alpha and a beta chain, coded from two distinct genes. This protein is normally cell surface bound on so-called antigen presenting cells (APC) and serve as a receptor for peptides. The peptide is bound to a specific site, the peptide binding site, in the MHC molecule and the resulting protein structure (the peptide bound to the two chain MHC class II molecule) is recognized by the T cell receptor.
This interaction is the crucial molecular and antigen specific event in the immune response and has been well described.
The term “MHC binding motif” is intended to mean the amino acids of the variable region, (i.e. polymorphic) of an MHC class II molecule, which can contact and bind the peptide of the invention in the peptide-binding site. The variable region of an MHC class II molecule being defined as the first amino acid residues 1-90 of the alpha and the beta chain in the form seen on the cell surface.
The term “variable region on the MHC molecule” is intended to mean the first domain of both alpha and beta chains each encompassing amino acids 1-90.
The term “constant region on a MHC or Ig molecule” is intended to mean the part of the MHC class II molecule that is not part of the variable domains/regions.
The term “carrier” is intended to mean a compound, such as a protein, which can bind to the peptide of the invention and present that particular peptide to specific T cell receptors. T cell receptors (TCR), which normally are bound to T cells normally recognising type II collagen, a joint cartilage protein.
The term “peptide” is intended to mean a sequence of amino acid residues having from six to 50 amino acid residues.
The term “polypeptide” is intended to mean a sequence of amino acid residues having more 51 or more amino acid residues.
In the present context, amino acid names and atom names are used as defined by the Protein DataBank (PDB), which is based on the IUPAC nomenclature (IUPAC Nomenclature and Symbolism for Amino Acids and Pep-tides (residue names, atom names etc.), Eur J Biochem., 138, 9-37 (1984) together with their corrections in Eur J Biochem., 152, 1 (1985). The term “amino acid” is intended to indicate an amino acid from the group consisting of alanine (Ala or A), cysteine (Cys or C) aspartic acid (Asp or D), glutamic acid (Glu or E), phenyl-alanine (Phe or F), glycine (Gly or G), histidine (His or H), isoleucine (Ile or I), lysine (Lys or K), leucine (Leu or L), methionine (Met or M), asparagine (Asn or N), proline (Pro or P), glutamine (Gln or Q), arginine (Arg or R), serine (Ser or S), threonine (Thr or T), valine (Val or V), tryptophan (Trp or W) and tyrosine (Tyr or Y), or derivatives thereof.
Description
Compound
The invention relates to a compound, comprising a peptide and a carrier.
Said peptide having at least the motif X-X-X-X-X-X-X, wherein at least one amino acid residue X is glycosylated, such as an O-linked galactose. Other examples of the glycosylated structures are N-acetyl galactosamine, glucose, N-acetyl glucosamine, glucose, mannose, fucose, as well as their mono- and dideoxygenated, mono- and difluorogenated, and C-glycoside derivatives. Said peptide being linked to the carrier and the linking between said peptide and said peptide binding protein may be covalent or they may be bound in another way as long as they can bind and remain bound to each other. The glycosylated amino acid residue X of said peptide may be hydroxylysine or a variant thereof. A variant of the lysine side chain could be any structure that is acceptable for recognition by a T cell receptor, such as hydroxynorvaline. Said peptide may comprise from 4 to 50 amino acid residues, such as 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acid residues. Said peptide may comprise at least one of the following amino acid sequences X-F-K-X-X-X-X-X-X-X (SEQ. ID. NO.: 12), X-F-K-X-E-X-X-X-X-X (SEQ. ID. NO.: 13), A-G-F-K-G-E-A (SEQ. ID. NO. 5) or A-A-A-K-A-A-A (SEQ. ID. NO.: 6) wherein K may be hydroxylysine. Additionally, said peptide also have a MHC class II binding motif, i.e., have the ability to bind to such a molecule. A MHC class II binding motif is capable of binding to a threedimensional structure formed by the alpha and the beta chains of the first domain of the MHC class II molecule. The amino acids of critical importance for this peptide binding structure are both located in a beta pleated sheath forming the bottom of the peptide binding structure (alpha 1-49, beta 1-49) and two alpha helices (alpha50-80, beta 50-90) forming the sides of these cleft-forming structure.
Peptides forming specific motifs unique for each MHC class II allele binds to this peptide binding structure. MHC class II alleles associated with rheumatoid arthritis forms peptide binding structure with many similarities encompassing them to bind peptides with certain binding motifs. One example of a peptide, according to the invention, is derived from collagen II, positions 260-273 (IAGFKGEQGPKGEP) (SEQ. ID. NO.: 11) which binds the DRB1*0401/DRA, the DRBI*1001/DRA and the DRB1*0101/DRA molecules. However, the peptide may be synthetic or semisynthetic or derived from other proteins as long as the peptide is identical or have similar structure as the peptide above. The MHC binding positions for binding to the DRB1*0401/DRA molecule has been hypothesised to be F263 and E266 in this peptide and the TCR binding positions K264, Q267 and K270. These TCR contacting positions could be of different importance for different TCR, i.e., they could be substituted into other amino acid residues.
Additionally, the above, mentioned peptide (IAGFKGEQGPKGEP) (SEQ. ID. NO. 11) may have one or more modifications such as hydroxylation, galactosylation or galactoglucosylation. Examples of positions, which could be modified, are positions K264 and K270 as well as deamidation of position Q267. Accordingly one or more of the amino acid residues may be substituted with another amino acid residue as long as it have the capability to be part of the MHC binding motif and function as a composition which can be used to prevent/reduce or treat a mammal suffering from a joint inflammatory disease or disorder or induce an immune response and thereby function as a vaccine. Examples of mammals includes human, dog, pig, sheep, cat, camel and horse.
The carrier of the compound to which the peptide is linked comprises at least the variable region of the MHC class II molecule, being defined as the first domains of the alpha and the beta chain, i.e., the first amino acid residues 1-90 of the alpha and the beta chain and a constant region. The alpha and the beta chains being linked to each other, such as by a leucine zipper domain.
The carrier comprises at least at least a MHC binding motif being linked to said peptide. However, one or more amino acid residues may be substituted as long as the carrier can bind the peptide and induce an immune response in a mammal. The variable part may be modified by up to 30 amino acid residues, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid residues. Examples of variable regions are those, which originate form MHC class II molecules DRB1*0401/DRA, DRBI*0402/DRA, DRBI*0403/DRA, DRBI*0404/DRA, DRBI*0405/DRA, DRB1*0406/DRA, DRBI*0407/DRA, DRBI*0408/DRA, DRBI*0409/DRA, DRBI*0410/DRA, DRBI*0101/DRA, DRB1*0102/DRA, DRBI*1001/DRA, DRBI*1002/DRA. Example sequences of one of the sequences to be used are depicted; SEQ NO 1, DRA V domain and SEQ NO 2, DRB1*0401 V domain.
According to one embodiment the compound comprises the above identified peptide and the carrier comprises a variable and a constant region, wherein said variable region comprises a peptide having 80% identity to the polypeptide sequence in its full length shown in SEQ ID NO 1 and a second polypeptide having 80% identity in its full length to the polypeptide sequence shown in SEQ ID NO 2, such as 85, 90, 95 or 100% identity in its foil length to one or both of the polypeptides shown in SEQ ID NO 1 and 2.
The carrier may also contain one or more constant regions, such as the constant regions of the MHC class II molecule or regions of an immunoglobulin such as the constant regions of IgG. For example, the class II first domain (i.e the variable or polymorphic domain) can be covalently linked to the IgG structure changing the first V domains of the VH and the VL chains. The constant and the variable regions may be covalently linked to each other. Said constant region may be selected from the group consisting of the constant region of an MHC class II molecule or an immunoglobulin. Example of a constant region being one comprising a peptide having 80% identity to the polypeptide sequence in its full length shown in SEQ ID NO 3 and a second polypeptide having 80% identity in its full length to the polypeptide sequence shown in SEQ ID NO 4, such as having 90% or 95% identity to the polypeptide sequence in its foil length shown in SEQ ID NO 3 and a second polypeptide having 90% or 95% identity in its foil length to the polypeptide sequence shown in SEQ ID NO 4 or being identical to the polypeptide sequence shown in SEQ ID NO 3 and 4.
In another embodiment, the constant region of the carrier may be a polypeptide sequence which is at least 25% of the polypeptide sequences SEQ ID NO 3 and 4, i.e., the constant region of the MHC class II, such as 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100%. Additionally there may be one or more substitutions of the polypeptides as long as the polypeptide sequences are linked together to form a carrier as defined above. The polypeptide sequences may be covalently linked to each other through a leucine zipper domain or part of a leucine zipper domain.
SEQ ID NO 1:
DR alpha V domain:
IKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEE
FGRFASFEAQGALANIAVDKANLEIMTKRSNYT
SEQ ID NO 2:
The DR beta V domain (from DRB1*0401)
GDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEY
RAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFT
SEQ ID NO 3:
DR alpha constant domain to be used:
PITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKP
VTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPL
LKHWEFDAPSPLPETTEN
SEQ ID NO 4:
DR beta (from DRB1*0401) constant domain to be
used:
VQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQE
EKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPL
TVEWRARSESAQS

A Pharmaceutical Composition
According to another aspect the invention relates to a pharmaceutical composition comprising above defined compound and a pharmaceutically acceptable carrier, excipient or diluter.
Pharmaceutical formulations of the compound of the invention are typically administered in a composition that includes one or more pharmaceutically acceptable carriers and diluters. Such pharmaceutical compositions may be prepared in a manner known in the art that is sufficiently storage stable and suitable for administration to humans and animals. The pharmaceutical composition may be lyophilised.
“Pharmaceutically acceptable” means a carrier, diluent or excipient that at the dosage and concentrations employed does not cause any unwanted effects in the patients to whom it is administered. Such pharmaceutically acceptable carriers or excipients are well-known in the art (see Remington's Pharmaceutical Sciences, 18th edition, A. R Gennaro, Ed., Mack Publishing Company (1990) and handbook of Pharmaceutical Excipients, 3rd edition, A. Kibbe, Ed., Pharmaceutical Press (2000).
The pharmaceutical composition may be admixed with adjuvants such as lactose, sucrose, starch powder, cellulose esters of alkanoic acids, stearic acid, talc, magnesium stearate, magnesium oxide, sodium and calcium salts of phosphoric and sulphuric acids, acacia, gelatin, sodium alginate, polyvinyl-pyrrolidine, and/or polyvinyl alcohol, and tableted or encapsulated for conventional administration. Alternatively, they may be dissolved in saline, water, polyethylene glycol, propylene glycol, ethanol, oils (such as corn oil, peanut oil, cottonseed oil or sesame oil), tragacanth gum, and/or various buffers. Other adjuvants and modes of administration are well known in the pharmaceutical art. The carrier or diluent may include time delay material, such as glyceryl monostearate or glyceryl distearate alone or with a wax, or other materials well known in the art.
The pharmaceutical compositions may be subjected to conventional pharmaceutical operations such as sterilisation and/or may contain conventional adjuvants such as preservatives, stabilisers, wetting agents, emulsifiers, buffers, fillers, etc., e.g., as disclosed elsewhere herein.
The pharmaceutical composition according to the invention may be administered locally or systemically such as topically, intravenously, orally, parenterally or as implants and even rectal use is possible. Suitable solid or liquid pharmaceutical preparation forms are, for example granules, powders, tablets, coated tablets, (micro) capsules, suppositories, syrups, emulsions, suspensions, creams, aerosols, drops or injectable solution in ampule form and also preparations with protracted release of active compounds, in the preparation of excipients, diluents, adjuvants or carriers are customarily used as described above.
The pharmaceutical composition will be administered to a patient in a pharmaceutically effective dose. By “pharmaceutically effective dose” is meant a dose that is sufficient to produce the desired effects in relation to the condition for which it is administered. The exact dose is dependent on the activity of the compound, manner of administration, nature and severity of the disorder, age and body weight of the patient and different doses may be needed. The administration of the dose can be carried out both by single administration in the form of an individual dose unit or else several smaller dose units and also by multiple administration of subdivided doses at specific intervals, e.g. vaccination.
The pharmaceutical composition of the invention may be administered alone or in combination with other therapeutic agents. These agents may be incorporated as part of the same pharmaceutical composition or may be administered separately. The “patient” for the purposes of the present invention includes both humans and other mammals. Thus the methods are applicable to both human therapy and veterinary applications.
Pharmaceutical formulations of the nucleotide sequence molecule or polypeptide of the invention are typically administered in a composition that includes one or more pharmaceutically acceptable carriers or excipients. Such pharmaceutical compositions may be prepared in a manner known in the art that is sufficiently storage stable and suitable for administration to humans and animals.
In a final aspect the above mentioned compound as well as pharmaceutical composition may be used for the treatment of a disease or a disorder such as an inflammatory joint disease threw vaccination. Examples of diseases are arthritis, reumatoid arthritis, anylosing spondylitis, psoriasis arthritis, osteoarthritis, relapsing polychondritis and Menieres disease. The vaccination may be performed by the use of any vaccination system such as DNA vaccination in which DNA is used that is translated into proteins in vivo corresponding to the above described structures. The said DNA can be administered as pure DNA or inserted into carrier structures.
Following examples are intended to illustrate, but not to limit, the invention in any manner, shape, or form, either explicitly or implicitly.
EXAMPLES Example I
Design of the MHC Class II Aq Constructs
The cDNAs for Aalphaq and Abetaq were amplified from a first strand cDNA reaction (first strand cDNA, Pharmacia, Piscataway, N.J.). The cDNAs were further modified to include cloning sites immediately upstream of the start codon, and the 3′ end from the transmembrane domain and downstream was replaced by an inframe cloning site. Next, DNA for the leucine zipper (13) domain from Jun including a 3′ end coding for 6 histidines was cloned in frame with the beta-chain cDNA. The DNA for the leucine zipper domain from Fos was added to the alpha chain construct. The resulting constructs were cloned separately into pMTAL (Invitrogen, La Jolla, Calif.) or pRmHa-3 (14) to allow for heavy metal-induced expression in insect cells. pMTAL contains the resistance gene for hygromycin. Where pRmHa-3 was used a Copia promoter-driven hygromycin gene was used as selection marker.
Example 2
Transfection, Expression and Purification of Soluble Aq
The linearised Aq alpha-chain and Aq beta-chain constructs were co-transfected at equimolar ratios into Drosophila melanogaster SL2 cells (ATCC, CRL-1963) using calcium phosphate transfection. Stable transfectants were derived by hygromycin selection and kept under selection in Schneider's Drosophila medium (Gibco™, Paisley, Scotland, UK) containing 100 μg/ml of hygromycin B (Sigma-Aldrich Chemie GmbH, Steinheim, Germany). Large-scale cell cultures were prepared in Fernbach bottles using a magnetic stirrer. For expression of soluble Aq, transfected cells were grown in serum-free Insect express complete medium (PAA Laboratories GmbH, Linz, Austria) at 25° C., induced with 0.7 mM CuSO4 for three days, and the supernatants were clarified by centrifugation and filtration. The SL2 cells produced ˜2-3 mg of recombinant protein per liter of culture. The expressed soluble Aq molecules were purified from the clarified media using Ni-NTA (Qiagen GmbH, Hilden, Germany) affinity chromatography and the manufacturer's recommended protocol. The dialysed protein fractions were examined by ELISA, SDS-PAGE and Western blot analysis. Non-reducing SDS-PAGE analysis of NiNTA purified Aq on 4-20% gradient gel showed two bands with molecular weights of 29 and 33 kDa (approximately the predicted sizes of alpha and β beta chains), which demonstrates that the expressed proteins form heterodimers consisting of alpha and beta chains. Positive fractions were pooled, concentrated 5- to 10-fold by MICROSEP 30K OMEGA (PALL, GelmanSciences, Ann Arbor, Mich.) or Amicon® centrifugal filter devices (MILLIPORE Co, Billerica, Mass.) and loaded with a peptide to form MHC-peptide complexes. All protein concentrations were determined using a Dc protein assay (Bio-Rad Laboratories, Hercules, Calif.).
Example 3
ELISA, SDS-PAGE and Western Blot Analyses of Aq
The alpha- and beta-chains of the purified Aq protein were detected by sandwich ELISA, using Y3P mAb (specific for the native alpha-chain) as capturing antibodies and biotinylated 7-16.17 (BD PharMingen, Los Angeles, Calif.) mAb (specific for the beta-chain) as detecting antibodies. Flat-bottom 96-well plates (Nunc, Roskilde, Denmark) were coated with 2.5 g/mL Y3P and incubated overnight at 4° C. The plates were then washed with PBS, blocked with 1% BSA (Sigma, St Louis, Mo.) in PBS for 1 h, washed again, and incubated for 2 h with 50 μL from the protein fractions at room temperature. Plates were washed again, followed by addition of 1 μg/mL biotinylated 7-16.17 for 1 h. After washing, the biotin-labeled antibody was detected by europium-labeled streptavidin using the DELFIA system (Wallac, Turku, Finland).
Protein purity was assessed by SDS-PAGE. Samples were electrophoresed in 4-20% polyacrylamide gradient ready mini-gels (Bio-Rad Laboratories, Hercules, Calif.) under denaturing and non-reducing conditions and the gels were silver stained according to the manufacturer's instructions. In parallel experiments, the gels were electrotransferred onto nitrocellulose membranes (0.45 μm). The membranes were blocked in 5% non-fat dry milk in PBS for 1 h and blotted with different MHC class II specific antibodies (M5/114, 7-16.17, 7-23.1, PCQ.6, 34-5-3, Y3P) at 4° C. overnight. After repeated washing, blots were incubated with peroxidase-conjugated goat anti-mouse IgG or goat anti-rat IgG (for M5/114) antibodies (Jackson) for 1 h. Immunoblots were developed using DAB (Vector Laboratories Inc., Burlingame, Calif.).
Example 4
Preparation of Peptide/Aq Complexes
Empty soluble Aq molecules were loaded with 5 to 50-fold molar excess of GalOK264 CII259-273, non-modified CII259-273 or MOG79-90 peptides at 4° C. for 72 h. GalOK264 CII259-273 is a peptide from type II collagen (CII) position 259-273 which has a lysine at position 264, which is hydroxylated and galactosylated.
Non-modified is the same peptide but with a lysine without modifications of its side chain. MOG=myelin oligodendrocytic glycoprotein. MHC-peptide complexes were separated by anion-exchange HPLC (Resource™ Q column) using an ÄKTA™ explorer 100 Air system (Amersham Pharmacia Biotech AB, Uppsala, Sweden) with UNICORN V4.00 software. Separations were done with a loading solution of 10 mM Tris pH 8.5 (buffer A) and a gradient elution up to 1 M NaCl (buffer B) in 10 mM Tris. The eluted protein fractions were concentrated by ultrafiltration (MICROSEP 30K OMEGA), dialyzed against PBS and examined by ELISA, SDS-PAGE and T-cell hybridoma tests. MHC-peptide complexes were purified further on a Superdex 200 gel filtration column (Amersham Pharmacia Biotech AB, Uppsala, Sweden), concentrated again by Amicon® centrifugal filter devices (MILLIPORE Co, Billerica, Mass.) and stored at −20° C. until used.
Example 5
Activation of T Cell Hybridomas
Peptide/Aq complexes were diluted in sterile PBS and coated onto plates by incubation at 4° C. for overnight or added directly in soluble form to the hybridomas. The coated plates were then washed twice with sterile PBS to remove unbound protein complexes, and 5×104 T-hybridoma cells were added per well in 200 μL of DMEM supplemented with 5% FCS, 100 IU/mL penicillin and 100 μg/mL streptomycin. T-cell hybridoma HCQ.3 and HCQ.4, specific for GalOK264 and for non-modified CII259-273 (K264), respectively (12), have been used in FIG. 1. To block the activation of the hybridomas, 5 μg/ml of 7-16.17 antibodies were added to the immobilised complexes. In the criss-cross test (FIG. 2) five μg/ml of soluble peptide/Aq complexes were added directly (without coating) to HCQ.3 and HCQ.4 hybridoma cells (5×104). Medium alone (without antigen) was used as a negative control.
After 24 h, IL-2 in the culture supernatants was measured by sandwich ELISA using DELFIA system (Wallac, Turku, Finland). Recombinant mouse IL-2 served as a positive control and standard. Data are represented as mean+−SE of triplicates
Example 6
Induction and Clinical Evaluation of Arthritis
Animals
Male B10.Q, (B10.Q×B10.RIII)FI or B10.Q×(BALB/c×B10.Q)F2 mice, 8-10 weeks of age, were used in the experiments. The founders of the B10.Q and B10.RIII mice were originally provided by Dr. Jan Klein (Tubingen, Germany) and BALB/c mice purchased from The Jackson Laboratory (Bar Harbor, Me.). The mice were bred and used at the animal department of Medical Inflammation Research (http://www.inflam.lu.se) and kept under standardized conditions.
In FIG. 3 is used B10.Q mice (10 animals per group), which were immunised with 100 μg rat CII in CFA on day 0 and boosted on day 35 with 50 μg rat CII in IFA. On days 20 and 34 (arrows), mice were treated by intravenous administration of purified peptide/Aq complexes (100 μg in 200 μl PBS). Sample sera were collected at days 35 and 70 after immunisation and incubated in serial dilutions in rat CII-coated wells. Levels of IgG anti-CII antibodies were measured by ELISA.
In FIG. 4 is used B10.Q(BALB/c×B10.Q)FI mice were immunised with 100 μg of rat CII emulsified in IFA on day 0 at the base of the tail and boosted on day 35 with 50 μg of rat CII in IFA. The mice were scored for a period of 202 days for arthritis development. Mice, which developed chronic arthritis were selected for the treatment experiment. All selected animals were reimmunised on day 205 (day 0 of the reimmunisation) with 50 μg rat CII in IFA and scored the next 75 days for clinical signs of arthritis. On days 7, 11 and 28 after reimmunisation (arrows), mice were treated by intravenous (100 μg in 200 ul PBS) administration of purified GalOK264/Aq complexes (10 mice in this group). PBS was administrated (i.v.) as a control on the same days (7 mice in this group). Sample sera were collected at days 0 and 75 after reimmunisation and measured by ELISA. Data are represented as mean±SE.
In FIG. 5 three groups of donor B 10. Q mice (5 mice in each group) were injected i.v. with 200 ug GalOK264/Aq in 100 ul PBS, 200 μg MOG/Aq in 100 μl PBS or 100 μl PBS alone. Five days later, T cells were purified from each mouse individually by negative selection and transferred i.v. (1×106 cells per mouse) to the CII-immunised recipients (5 days after immunisation). Sample sera were collected at days 35 and 70 after immunization measured by ELISA. Results are expressed as the mean±SE.
In FIG. 6 are (B10.Q×B10.RIII)FI mice immunised at day 0 with bovine CII. On days 20 and 34 (arrows), the mice were treated by intravenous administration of purified peptide/Aq complexes (100 μg in 200 μl PBS (9 mice per group) (A). Sample sera were collected at days 35 and 70 after immunisation and measured for levels of anti-CII antibodies by ELISA (B). In another experiment, (B10.Q×B10.RIII)FI mice (5 mice per group) were administrated once with 200 μg in 200 μl PBS peptide/Aq complexes at the day of immunisation (day 0) and sera were collected at day 18 (C). All data represent mean±SE. *, p<0.05; **, p<0.01.
Antigens
Rat type II collagen (CII) was prepared from the Swarm chondrosarcoma and bovine CII from joint cartilage, by limited pepsin digestion, and further purified as previously described (15). The CII peptides (non-modified CII259-273: GIAGFKGEQGPKGEP (SEQ. ID. NO.: 8), GalOK264 CII259-273: GIAGFK(Gal-Hyl)GEQGPKGEP (SEQ. ID. NO.: 9), and the various galactosylated peptides that were deoxygenated at OH groups on the galactose ( position 2, 3 and 4 respectively) were synthesized, purified and characterized as previously described (9, 10, 11, 16, 17). The CII was dissolved in 0.1 M acetic acid. Mouse myelin oligodendrocytic glycoprotein MOG79-90 peptide (GKVTLRIQNVRF) (SEQ. ID. NO.: 10) was purchased from Schafer-N(Copenhagen, Denmark). All peptides were dissolved in PBS. The collagen and peptides were stored at 4° C. until used.
To induce CIA, each mouse was injected with 100 μg of CII (rat CII for B10.Q and bovine CII for (B10.Q×B10.RIII)FI mice), emulsified 1:1 in complete Freund's adjuvant (CFA; Difco, Detroit, Mich.) at the base of the tail in a total volume of 100 μl. Thirty-five days later, the mice were given a booster injection of 50 μg of rat CII emulsified 1:1 in incomplete Freund's adjuvant (IFA; Difco, Detroit, Mich.) in a total volume of 50 μl. Development of clinical arthritis was followed through visual scoring of the animals based on the number of inflamed joints in each paw, starting two weeks postimmunisation and continuing until the end of the experiment. An extended scoring protocol (18) ranging from 1-15 for each paw with a maximum score of 60 per mouse was used. The mice were examined 2 to 4 times a week for at least 70 days after immunization.
The B10.Q(BALB/c×B10.Q)F2 mice were immunized with 100 μg of rat CII emulsified in IFA intradermally (i.d.) at the base of the tail on day 0 and boosted on day 35 i.d. with 50 μg of rat CII in IFA. The mice were scored for a minimum period of 202 days for arthritis development. Mice, which developed chronic arthritis (mice with severe arthritis for a minimum period of 120 days were considered as chronic) including the ones with clear relapses, were selected for the treatment protocol.
Peptide/Aq Complex Treatment Protocols
Animals were treated by either intravenous (i.v.) or intranasal (i.n.) administration of purified peptide/Aq complexes. In the intravenous treatment of CIA model, mice were injected with GalOK264/Aq, deoxygenated GalOK264/Aq, K264/Aq or as negative control MOG/Aq complex (100 μg in 200 μL PBS) on days 20 and 34 postimmunisation (for the chronic model on days 7, 11 and 28 after reimmunisation). Control mice were injected intravenously with 200 μL PBS on the same days. In the intranasal treatment experiments, mice were administrated with 10 μg (in 20 μL PBS) of peptide/Aq complex on the days mentioned above.
Example 6
Measurement of Serum Anti-CII Antibody Levels
Mice were bled at the time of boost immunization (day 35) as well as at the termination of experiment (day 70) and sera were analyzed for anti-CII IgG antibody levels by quantitative ELISA (19). Briefly, 96-well ELISA plates (Nunc, Roskilde, Denmark) were coated overnight at 4° C. with 10 μg/mL native rat CII in PBS. The wells were washed three times with PBS-0.1% Tween 20 and then 150 μL of blocking buffer (5% BSA in PBS) was added to each well and incubated for 1 h at room temperature. After washing, 50 μL of samples in serial dilutions from 1/100 to I/105 were added and incubated for 2 h at room temperature. After three washes, peroxidase-conjugated goat anti-mouse IgG was added and incubated at room temperature for 1 h. After extensive washing, plates were developed using ABTS (Roche Diagnostics GmbH, Mannheim, Germany) as substrate and the absorbance was then measured at 405 nm in a Spectra Max Plus reader (Göteborgs Termometerfabrik, Göteborg, Sweden). A standard serum from arthritic and non-immunised syngeneic mice was added to each plate in serial dilutions as positive and negative controls, respectively.
TABLE 1
Peptide/Aq complexes suppress development
of CIA in B10.Q mice.
Mean Mean Mean anti-CII IgG
Inci- day of peak of (μg/mL)
Treatment dence onset severity day 35 day 70
GalOK264/ 0/10 N/A N/A 54.3 ± 36.9 ±
Aq(i.v.) (0%) 10.5 10.5
GalOK264/ 1/10 60 2 59.8 ± 38.8 ±
Aq(i.n.) (10%) 15.4 15.8
PBS 8/10 44 +/− 26.2 +/− 135.9 ± 96.6 ±
(control)(i.v.) (80%) 5 15.4 30.9 35.1
B10.Q mice (10 mice per group) were immunised with 100 microgrammes rat CII in CFA on day 0 and boosted on day 35 with 50 microgrammes rat CII in IFA. On days 20 and 34, mice were treated by intravenous (i.v.) (100 microgrammes in 200 microlitres PBS) or intranasal (i.n.) (10 microgrammes in 20 microlitres PBS) administration of purified GalOK264/Aq complex. PBS (200 microlitres) was administrated (i.v.) as a control on the same days. Mice were monitored for clinical signs of arthritis for 70 days. Levels of IgG anti-CII were measured at days 35 and 70 by ELISA. All values are shown as mean±standard deviation. N/A denotes not applicable.
Example 7
Histology
Hind paws were removed after ending the experiment, fixed in 4% neutral buffered formaldehyde overnight and then decalcified in 5% (w/v) EDTA at 4° C. until the bones were pliable. Tissues were then dehydrated in a gradient of alcohols, paraffin embedded, sectioned at 5 μm, mounted on glass slides, and stained with hematoxylin and eosin (H&E). Serial H&E-stained sections were analyzed microscopically for the degree of inflammation and for cartilage and bone destruction. Analyses were performed in a blinded fashion.
Example 8
T-cell transfer
For the T-cell transfer experiment, 15 B10.Q mice (recipients) were immunized with CII/CFA (day 0) and boosted with CII/IFA on day 35 using the standard immunization protocol. At the same time (day 0), three groups (5 mice per each group) of other B10.Q mice (donors) were injected i.v. with 200 μg GalOK264/Aq in 100 μl PBS, 200 μg MOG/Aq in 100 μl PBS or 200 μl PBS alone, respectively. Five days later, erythrocyte free spleen and lymph node cells from each mouse were passed through 40 μm nylon cell strainer (BD Biosciences Discovery Labware, Bedford, Mass.) and then T cells were purified by negative selection using antibodies against MHC class II+(M5/114) and CDIIb+(MI/70) expressing cells (BD Biosciences PharMingen, San Diego, Calif.) and Dynabeads® (Dynal ASA, Oslo, Norway) followed by magnetic sorting. The purity of the resulting T cells was measured by flow cytometry and were found to be contaminated with <0.3% MHC II+ expressing cells. Purified T cells were analysed by FACS for expression of CD25+, CD62L+, CD45RB+ and NK 1.1+ surface markers but no differences between the individual mice or groups were found. Purified T cells (1×106) from each individual donor were resuspended in a final volume of 200 μl sterile PBS and transferred intravenously into recipient mice.
Statistics
Statistical difference in the incidence of disease between groups of mice described in the examples was determined using Chi Square test. To compare nonparametric data for statistical significance, we applied the Mann-Whitney U or Kruskal Wallis test on all clinical results and in vitro experiments using the StatView™ programme (SAS, Institute Inc., USA).
REFERENCES
1. Aho, K., Palosuo, T., Raunio, V., Puska, P., Aromaa, A. & Salonen, J. T. (1985) Arthritis Rheum 28, 485-489.
2. Rantapaa-Dahlqvist, S., de Jong, B. A., Berglin, E., Hallmans, G., Wadell, G., Stenlund, H., Sundin, U. & van Venrooij, W. J. (2003) Arthritis Rheum 48, 2741-9.
3. Berglin, E., Padyukov, L., Sundin, U., Hallmans, G., Stenlund, H., Van Venrooij, W. J., Klareskog, L. & Dahlqvist, S. R. (2004) Arthritis Res Ther 6, R303-8.
4. van Gaalen, F. A., van Aken, J., Huizinga, T. W., Schreuder, G. M., Breedveld, F. C., Zanelli, E., van Venrooij, W. J., Verweij, C. L., Toes, R. E. & de Vries, R. R. (2004) Arthritis Rheum 50, 2113-21.
5. Corrigall, V. M., Bodman-Smith, M. D., Fife, M. S., Canas, B., Myers, L. K., Wooley, P., Soh, C, Staines, N. A., Pappin, D. J., Berlo, S. E., van Eden, W., van Der Zee, R., Lanchbury, J. S. & Panayi, G. S. (2001) J Immunol 166, 1492-8.
6. Fritsch, R., Eselbock, D., Skriner, K., Jahn-Schmid, B., Scheinecker, C, Bohle, B., Tohidast-Akrad, M., Hayer, S., Neumuller, J., Pinol-Roma, S., Smolen, J. S. & Steiner, G. (2002) J Immunol 169, 1068-76.
7. Cook, A. D., Rowley, M. J., Mackay, I. R., Gough, A. & Emery, P. (1996) Arthritis Rheum 39, 1720-1727.
8. Bäcklund, J., Carlsen, S., H[delta]ger, T., Holm, B., Fugger, L., Kihlberg, J., Burkhardt, H. & Holmdahl, R. (2002) Proc Natl Acad Sci USA 99, 9960-9965.
9. Michaelsson, E., Andersson, M., Engström, A. & Holmdahl, R. (1992) Eur J Immunol 22, 1819-25.
10. Holm, B., Backlund, J., Recio, M. A., Holmdahl, R. & Kihlberg, J. (2002) Chembiochem 3, 1209-1222.
11. Holm, B., Baquer, S. M., Holm, L, Holmdahl, R. & Kihlberg, J. (2003) Bioorganic and Medicinal Chemistry 11, 3981-7.
12. Corthay, A., Backhand, J., Broddefalk, J., Michaelsson, E., Goldschmidt, T. J., Kihlberg, J. & Holmdahl, R. (1998) Eur J Immunol 28, 2580-2590.
13. Scott, C. A., Garcia, K. C, Carbone, F. R., Wilson, I. A. & Teyton, L. (1996) J Exp Med 183, 2087-95.
14. Bunch, T. A., Grinblat, Y. & Goldstein, L. S. (1988) Nucleic Acids Res 16, 1043-61.
15. Andersson, M. & Holmdahl, R. (1990) Eur J Immunol 20, 1061-1066.
16. Broddefalk, J., Bäcklund, J., Almqvist, F., Johansson, M., Holmdahl, R. & Kihlberg, J. (1998) J Am Chem Soc 120, 7676-7683.
17. Holm, B., Broddefalk, J., Flodell, S., Wellner, E. & Kihlberg, J. (2000) Tetrahedron 56, 1579-1586.
18. Holmdahl, R., Carlsen, S., Mikulowska, A., Vestberg, M., Brunsberg, U., Hansson, A.-S., Sundvall, M., Jansson, L. & Pettersson, U. (1998) in Human Genome Methods, ed. Adolpho, K. W. (CRC press, New York), pp. 215-238.
19. Holmdahl, R., Klareskog, L., Andersson, M. & Hansen, C. (1986) Immunogenetics 24, 84-89.

Claims (10)

The invention claimed is:
1. A compound comprising (a) a peptide and (b) a carrier, wherein said peptide is bound within the peptide-binding site of said carrier, and
a. said peptide consists of IAGFKGEQGPKG (SEQ. ID. NO.: 7), wherein at least the lysine at position 5 of said peptide is a glycosylated hydroxylysine, and
b. said carrier comprises at least the variable region of a naturally occurring MHC class II molecule wherein said carrier does not comprise the transmembrane domain and cytoplasmic domain of the alpha and beta chains of said naturally occurring MHC class II molecule and said alpha and beta chains are linked to each other by a leucine zipper or an immunoglobulin, and
wherein said carrier comprises the variable region of an MHC class II molecule selected from the group consisting of DRB1*0401/DRA, DRB1*0101/DRA, and DRB1*1001/DRA.
2. The compound according to claim 1, wherein at least one lysine of said peptide (a) is O-linked glycosylated.
3. The compound according to claim 1, wherein said peptide (a) is covalently bound to said carrier (b).
4. The compound according to claim 1, wherein said carrier comprises a constant region of a MHC class II molecule linked to said variable region of said MHC class II molecule or a constant region of an immunoglobulin linked to said variable region of said MHC class II molecule, wherein said constant region of said MHC class II molecule does not comprise the transmembrane domain and cytoplasmic domain of the alpha and beta chains of said MHC class II molecule.
5. The compound according to claim 4, wherein said constant region of said carrier comprises at least 25% of the polypeptide sequence shown in SEQ ID NO: 3 or SEQ ID NO: 4.
6. The compound according to claim 5, wherein said constant region of said carrier comprises at least 30% of the polypeptide sequences shown in SEQ ID NO: 3 or SEQ ID NO: 4.
7. A pharmaceutical composition comprising
a compound comprising a peptide consisting of IAGFKGEQGPKG (SEQ. ID. NO.: 7), wherein at least the lysine at position 5 of said peptide is a glycosylated hydroxylysine, and a carrier comprising at least the variable region of a naturally occurring MHC class II molecule, wherein said carrier does not comprise the transmembrane domain and cytoplasmic domain of the alpha and beta chains of said naturally occurring MHC class II molecule and said alpha and beta chains are linked to each other by a leucine zipper or an immunoglobulin, and said peptide is bound within the peptide-binding site of said carrier, and
wherein said carrier comprises the variable region of an MHC class II molecule selected from the group consisting of DRB1*0401/DRA, DRB1*0101/DRA, and DRB1*1001/DRA: and
a pharmaceutically acceptable carrier, excipient or diluter.
8. The compound according to claim 1, wherein at least one amino acid residue K of said peptide (a) is O-linked galactosylated.
9. The compound according to claim 1, wherein said variable region of a naturally occurring MHC class II molecule is a recombinant variable region of a naturally occurring MHC class II molecule.
10. The compound according to claim 1, wherein said carrier comprises the variable region of an MHC class II molecule selected from the group consisting of DRB1*0401/DRA and DRB1*0101/DRA.
US14/658,962 2005-11-17 2015-03-16 Compound comprising an autoantigenic peptide and a carrier with a MHC binding motif Active 2027-07-19 US10588951B2 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US14/658,962 US10588951B2 (en) 2005-11-17 2015-03-16 Compound comprising an autoantigenic peptide and a carrier with a MHC binding motif
US16/685,424 US12115214B2 (en) 2005-11-17 2019-11-15 Compound comprising an autoantigenic peptide and a carrier with a MHC binding motif

Applications Claiming Priority (7)

Application Number Priority Date Filing Date Title
SE0502530-9 2005-11-17
SE0502530 2005-11-17
SE0502530 2005-11-17
US75848106P 2006-01-12 2006-01-12
PCT/SE2006/001290 WO2007058587A1 (en) 2005-11-17 2006-11-15 A compound comprising an autoantigenic peptide and a carrier with a mhc binding motif
US9272408A 2008-05-29 2008-05-29
US14/658,962 US10588951B2 (en) 2005-11-17 2015-03-16 Compound comprising an autoantigenic peptide and a carrier with a MHC binding motif

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
US12/092,724 Continuation US20090227516A1 (en) 2005-11-17 2006-11-15 Compound comprising an autoantigenic peptide and a carrier with a mhc binding motif
PCT/SE2006/001290 Continuation WO2007058587A1 (en) 2005-11-17 2006-11-15 A compound comprising an autoantigenic peptide and a carrier with a mhc binding motif

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/685,424 Division US12115214B2 (en) 2005-11-17 2019-11-15 Compound comprising an autoantigenic peptide and a carrier with a MHC binding motif

Publications (2)

Publication Number Publication Date
US20150231216A1 US20150231216A1 (en) 2015-08-20
US10588951B2 true US10588951B2 (en) 2020-03-17

Family

ID=38048898

Family Applications (3)

Application Number Title Priority Date Filing Date
US12/092,724 Abandoned US20090227516A1 (en) 2005-11-17 2006-11-15 Compound comprising an autoantigenic peptide and a carrier with a mhc binding motif
US14/658,962 Active 2027-07-19 US10588951B2 (en) 2005-11-17 2015-03-16 Compound comprising an autoantigenic peptide and a carrier with a MHC binding motif
US16/685,424 Active 2030-04-01 US12115214B2 (en) 2005-11-17 2019-11-15 Compound comprising an autoantigenic peptide and a carrier with a MHC binding motif

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US12/092,724 Abandoned US20090227516A1 (en) 2005-11-17 2006-11-15 Compound comprising an autoantigenic peptide and a carrier with a mhc binding motif

Family Applications After (1)

Application Number Title Priority Date Filing Date
US16/685,424 Active 2030-04-01 US12115214B2 (en) 2005-11-17 2019-11-15 Compound comprising an autoantigenic peptide and a carrier with a MHC binding motif

Country Status (5)

Country Link
US (3) US20090227516A1 (en)
EP (1) EP1948226B1 (en)
AU (1) AU2006316036B2 (en)
CA (1) CA2629881C (en)
WO (1) WO2007058587A1 (en)

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2708942A1 (en) * 2007-12-19 2009-06-25 Mivac Development Aktiebolag Compositions and methods for treatment of autoimmune and allergic diseases
US11041013B2 (en) 2008-03-14 2021-06-22 Cel-Sci Corporation Methods of preparation and composition of peptide constructs useful for treatment of rheumatoid arthritis
WO2012162564A1 (en) 2011-05-25 2012-11-29 Cel-Sci Corporation Method for inducing an immune response and formulations thereof
CN114206945B (en) * 2019-08-09 2025-11-04 弗劳恩霍夫应用研究促进协会 Production of MHC II/CII peptide complexes
CN118750607A (en) * 2019-08-09 2024-10-11 弗劳恩霍夫应用研究促进协会 HLA-DR/CII peptide complex for the treatment of arthritis

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1996040944A2 (en) 1995-06-07 1996-12-19 Zymogenetics, Inc. Fused soluble mhc heterodimer:peptide complexes and their uses
WO1998005684A2 (en) 1996-08-05 1998-02-12 President And Fellows Of Havard College Mhc binding peptide oligomers and methods of use
WO2001036448A2 (en) 1999-10-27 2001-05-25 Cel-Sci Corporation Preparation and composition of peptides useful for treatment of autoimmune and transplant related graft versus host conditions
US6451314B1 (en) 1988-06-23 2002-09-17 Anergen, Inc. MHC conjugates useful in ameliorating autoimmunity

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2762327B1 (en) 1997-04-22 1999-07-02 Transgene Sa NUCLEIC ACID SEQUENCE OF CIITA GENES, LIKELY TO BE INVOLVED IN THE CONTROL AND REGULATION OF GENE EXPRESSION ENCODING MHC TYPE II MOLECULES AND THEIR USE, IN PARTICULAR AS A MEDICAMENT

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6451314B1 (en) 1988-06-23 2002-09-17 Anergen, Inc. MHC conjugates useful in ameliorating autoimmunity
WO1996040944A2 (en) 1995-06-07 1996-12-19 Zymogenetics, Inc. Fused soluble mhc heterodimer:peptide complexes and their uses
WO1998005684A2 (en) 1996-08-05 1998-02-12 President And Fellows Of Havard College Mhc binding peptide oligomers and methods of use
WO2001036448A2 (en) 1999-10-27 2001-05-25 Cel-Sci Corporation Preparation and composition of peptides useful for treatment of autoimmune and transplant related graft versus host conditions

Non-Patent Citations (53)

* Cited by examiner, † Cited by third party
Title
"Adjuvant Induced Arthritis-Adjuvants," Chondrex, www.chondrex.com/animal-models/adjuvant-induced-arthritis-adjuvants (screenshot Jun. 6, 2019).
"Adjuvant Induced Arthritis—Adjuvants," Chondrex, www.chondrex.com/animal-models/adjuvant-induced-arthritis-adjuvants (screenshot Jun. 6, 2019).
Aho, K., Palosuo, T., Raunio, V., Puska, P., Aromaa, A. & Salonen, J. T., "When does rheumatoid arthritis start?" (1985) Arthritis Rheum 28, 485-489.
Andersson, M. & Holmdahl, R., "Analysis of type II collagen-reactive T cells in the mouse. I. Different regulation of autoreactive vs. non-autoreactive anti-type II collagen T cells in the DBA/1 mouse" (1990) Eur J Immunol 20, 1061-1066.
Apr. 8, 2015 Canadian Intellectual Property Office Office Action in CA 2,629,881 to Rikard Holmdahl et al. national entry date May 14, 2008 from PCT/SE2006/001290 filed Nov. 15, 2006, A Compound Comprising an Autoantigenic Peptide and a Carrier with a MHC Binding Motif.
Bäcklund et al. "Glycosylation of type II collagen is of major importance for T cell tolerance and pathology in collagen-induced arthritis." European Journal of Immunology. 2002. 32(12):3776-84.
Bäcklund et al. "Predominant selection of T cells specific for the glycosylated collagen type II epitope (263-270) in humanized transgenic mice and in rheumatoid arthritis." Proceedings of the National Academy of Sciences of the USA.2002. 99(15) 9960-9965.
Bajtner et al., "Chronic development of collagen-induced arthritis is associated with arthritogenic antibodies against specific epitopes on type II collagen," Arthritis Research & Therapy vol. 7 No. 5 2005.
Berglin, E., Padyukov, L., Sundin, U., Hallmans, G., Stenlund, H., Van Venrooij, W. J., Klareskog, L. & Dahlqvist, S. R., "A combination of autoantibodies to cyclic citrullinated peptide (CCP) and HLA-DRB1 locus antigens is strongly associated with future onset of rheumatoid arthritis" (2004) Arthritis Res Ther 6, R303-8.
Bevaart et al., "Evaluation of Therapeutic Targets in Animal Models of Arthritis," Arthritis & Rheumatism. 62, 2192-2205 (2010).
Broddefalk et al. "Preparation of a diglycosylated hydroxylysine building block used in ssolid-phase synthesis of a glycopeptide from type II collagen." Journal of Organic Chemistry. 1999. 64, 8948-8953.
Broddefalk et al. "T cells recognize a glycopeptide derived from type II collagen in a model for rheumatoid arthritis." Journal of the American Chemical Society. 1998. 120(31), 7676-7683.
Broddefalk et al. "Use of acid-labile protective groups for carbohydrate moieties in synthesis of glycopeptides related to type II collagen." Tetrahedron. 1998. 54, 12047-12070.
Broddefalk, J., Backlund, J., Almqvist, F., Johansson, M., Holmdahl, R. & Kihlberg, J., "T Cells Recognize a Glycopeptide Derived from Type II Collagen in a Model for Rheumatoid Arthritis" (1998) J Am Chem Soc 120, 7676-7683.
Bunch, T. A., Grinblat, Y. & Goldstein, L. S., "Characterization and use of the Drosophila metallothionein promoter in cultured Drosophila melanogaster cells" (1988) Nucleic Acids Res 16, 1043-61.
Cook, A. D., Rowley, M. J., Mackay, I. R., Gough, A. & Emery, P., "Antibodies to Type II Collagen in Early Rheumatoid Arthritis" (1996) Arthritis Rheum 39, 1720-1727.
Corrigall, V. M., Bodman-Smith, M. D., Fife, M. S., Canas, B., Myers, L. K., Wooley, P., Soh, C, Staines, N. A., Pappin, D. J., Berlo, S. E., van Eden, W., van Der Zee, R., Lanchbury, J. S. & Panayi, G. S. (2001) J Immunol 166, 1492-8.
Corthay et al. "Epitope glycosylation plays a critical role for T cell recognition of type II collagen in collagen-induced arthritis." European Journal of Immunology. 1998. 28(8), 2580-2590.
Cresswell, P (Annual Rev. Immunol. 1994, 12: 259-293) (Year: 1994). *
Dzhambazov et al. "The major T cell epitope on type II collagen is glycosylated in normal cartilage but modified by arthritis in both rats and humans." European Journal of Immunology. 2005. 35(2), 357-366.
Dzhambazov, et. al., "Therapeutic Vaccination of Active Arthritis with a Glycosylated Collagen Type II Peptide in Complex with MHC Class II Molecules 1," The Journal of Immunology, 2006, vol. 176, pp. 1525-1533.
Dzhambazov, Nandakumar, Kihlberg, Fugger, Holmdahl, and Vestberg. Therapeutic vaccination of active arthritis with a glycosylated collagen type II peptide in complex with MHC class II molecules. J Immunol 2006, 176: 1525-1533.
Freysdottir, "Mucosal tolerance to KLH reduces BSA-induced arthritis in rats-an indication of bystander suppression," J Clin Immunol. May 2007;27(3):284-93 Abstract.
Freysdottir, "Mucosal tolerance to KLH reduces BSA-induced arthritis in rats—an indication of bystander suppression," J Clin Immunol. May 2007;27(3):284-93 Abstract.
Fritsch, R., Eselbock, D., Skriner, K., Jahn-Schmid, B., Scheinecker, C, Bohle, B., Tohidast-Akrad, M., Hayer, S., Neumuller, J., Pinal-Roma, S., Smolen, J. S. & Steiner, G., "Characterization of Autoreactive T Cells to the Autoantigens Heterogeneous Nuclear Ribonucleoprotein A2 (RA33) and Filaggrin in Patients with Rheumatoid Arthritis" (2002) J Immunol 169, 1068-76.
Holm et al. "Glycopeptide specificity of helper T cells obtained in mouse models for rheumatoid arthritis." Chembiochem. 2002 3(12), 1209-1222.
Holm, B., Baquer, S. M., Holm, L, Holmdahl, R. & Kihlberg, J., "Role of the Galactosyl Moiety of Collagen Glycopeptides for T-Cell Stimulation in a Model for Rheumatoid Arthritis," (2003) Bioorganic and Medicinal Chemistry 11, 3981-7.
Holm, et. al., "An Improved Synthesis of a Galactosylated Hyroxylysine Building Block and it use in Solid-Phase Glycopeptide Synthesis," Tetrahedron, 2000, vol. 56, pp. 1579-1586.
Holmdahl, R., Carlsen, S., Mikulowska, A., Vestberg, M., Brunsberg, U., Hansson, A.-S., Sundvall, M., Jansson, L. & Pettersson, U., "Genetic Analysis of Mouse Model" (1998) in Human Genome Methods, ed. Adolpho, K. W. (CRC press, New York), pp. 215-238.
Holmdahl, R., Klareskog, L., Andersson, M. & Hansen, C., "High antibody response to autologous type II collagen is restricted to H-2q" (1986) Immunogenetics 24, 84-89 (Abstract only).
Kalandadze et al (J. Biol. Chem. 1996, 271 (33), 20156-20162) (Year: 1996). *
Kjellén et al. "The structural basis of MHC control of collagen-induced arthritis; binding of the immunodominant type II collagen 256-270 glycopeptide to H-2Aq and H-2Ap molecules." European Journal of Immunology. 1998. 28(2):755-767.
Latham et al (J. Immunol. Jan. 4, 2005, 174: 3978-3985) (Year: 2005). *
Malmström et al. "T cells that are naturally tolerant to cartilage-derived type II collagen are involved in the development of collagen-induced arthritis." Arthritis Research. 2000. 2, 315-326.
May 14, 2014 Canadian Intellectual Property Office Office Action in CA 2,629,881 to Rikard Holmdahl et al. national entry date May 14, 2008 from PCT/SE2006/001290 filed Nov. 15, 2006, A Compound Comprising an Autoantigenic Peptide and a Carrier with a MHC Binding Motif.
Michaëlsson et al. "Antigen processing and presentation of a naturally glycosylated protein elicits major histocompatibility complex class II-restricted, carbohydrate-specific T cells." European Journal of Immunology. 1996. 26(8):1906-1910.
Michaëlsson et al. "Identification of an immunodominant type-II collagen peptide recognized by T cells in H-2q mice: self tolerance at the level of determinant selection." European Journal of Immunology. 1992. 22(7): 1819-1825.
Michaëlsson et al. "T cell recognition of carbohydrates on type II collagen." Journal of Experimental Medicine. 1994. 180(2), 745-749.
Myers et al. "Characterization of a tolerogenic T cell epitope of type II collagen and its relevance to collagen-induced arthritis." Journal of Immunology. 1992. 149: 1439-1443.
Myers, "Peptide-Induced Suppression of Collagen-Induced Arthritis in HLA-DR1 Transgenic Mice," American College of Theumatology, vol. 46, No. 12, Dec. 2002, pp. 3369-3377.
Nelson et al (PNAS, 1993, 90: 1227-1231) (Year: 1993). *
Ponchel et al., "CD4+ T-cell subsets in rheumatoid arthritis," Int. J. Clin. Rheumatol. (2012) 7(1), 37-53.
Rammensee et al (MHC Ligands and Peptide Motifs, 1997, Landes Bioscience, Austin, Texas, pp. 300-301) (Year: 1997). *
Rantapaa-Dahlqvist, S., de Jong, B. A., Berglin, E., Hallmans, G., Wadell, G., Stenlund, H., Sundin, U. & van Venrooij, W. J., "Antibodies against cyclic citrullinated peptide and IgA rheumatoid factor predict the development of rheumatoid arthritis" (2003) Arthritis Rheum 48, 2741-9.
Raposo, Merky, Lundqvist, Yamada, Urbonaviciute, Niaudet, Viljanen, Kihlberg, Kyewski, Ekwal, Holmdahl, and Bäcklund, T cells specific for post-translational modifications escape intrathymic tolerance induction. 2018, Nature Communications 9 (1): 353.
Scott, C. A., Garcia, K. C, Carbone, F. R., Wilson, I. A. & Teyton, L., "Role of Chain Pairing for the Production of Functional Soluble IA Major Histocompatibility Complex Class II Molecules" (1996) J Exp Med 183, 2087-95.
Van Eden et al., "Arthritis induced by a T-lymphocyte clone that responds to Mycobacterium tuberculosis and to cartilage proteoglycan," PNAS 1985; 5117-5120, Abstract.
Van Eden et al., "Cloning of the mycobacterial epitope recognized by T lymphocytes in adjuvant arthritis," Nature 331; 171-172 Jan. 14, 1988.
Van Gaalen, F. A., van Aken, J., Huizinga, T. W., Schreuder, G. M., Breedveld, F. C., Zanelli, E., van Ven-rooij, W. J., Verweij, C. L., Toes, R. E. & de Vries, R. R., "Association between HLA class II genes and autoantibodies to cyclic citrullinated peptides (CCPs) influences the severity of rheumatoid arthritis" (2004) Arthritis Rheum 50, 2113-21.
Vanderlugdt et al., "Epitope spreading in immune-mediated diseases: implications for immunotherapy," Nature Reviews Immunology 2, 85-95 (2002) Abstract.
Vanderlugdt et al., "Epitope Spreading," Current Opinion in Immunology, vol. 8, Issue 6, Dec. 1996, pp. 831-836, Abstract.
Von Delwig et al (Arthritis & Rheumatism, Feb. 2006, 54(s): 482-491) (Year: 2006). *
Zuo et al. "A single-chain class II MHC-IgG3 fusion protein inhibits autoimmune arthritis by induction of antigen-specific hyporesponsiveness." Journal of Immunology. 2002. 168(5):2554-2559.

Also Published As

Publication number Publication date
EP1948226A1 (en) 2008-07-30
WO2007058587A1 (en) 2007-05-24
US20200085927A1 (en) 2020-03-19
AU2006316036B2 (en) 2011-12-15
AU2006316036A1 (en) 2007-05-24
US12115214B2 (en) 2024-10-15
CA2629881A1 (en) 2007-05-24
CA2629881C (en) 2017-09-12
US20150231216A1 (en) 2015-08-20
US20090227516A1 (en) 2009-09-10
EP1948226B1 (en) 2012-05-02

Similar Documents

Publication Publication Date Title
US12115214B2 (en) Compound comprising an autoantigenic peptide and a carrier with a MHC binding motif
RU2198895C2 (en) Conjugate eliciting ability to activate immune system and pharmaceutical composition comprising indicated conjugate
AU2001275246B2 (en) T cell receptor fusions and conjugates and methods of use thereof
JP4099119B2 (en) Surface complex lymphotoxin
Dzhambazov et al. Therapeutic vaccination of active arthritis with a glycosylated collagen type II peptide in complex with MHC class II molecules
AU2001275246A1 (en) T cell receptor fusions and conjugates and methods of use thereof
TW413636B (en) A conjugate between a modified superantigen and a target-seeking compound and the use of the conjugate
AU2018243550B2 (en) ALT-803 in combination with anti-CD38 antibody for cancer therapies
AU2017213117A1 (en) Recombinant IgG Fc multimers
Friedman et al. Characterization of human T cells reactive with the Mycoplasma arthritidis-derived superantigen (MAM): generation of a monoclonal antibody against V beta 17, the T cell receptor gene product expressed by a large fraction of MAM-reactive human T cells.
EP1340769B1 (en) CD4-gamma2 and CD4-IgG2 chimeras
JP4587566B2 (en) Method for generating or enhancing a T cell response against a target cell using a complex comprising an HLA class I molecule and an attachment means
JP3001969B2 (en) M-CSF monoclonal antibody recognizing neutralizing conformational epitope
JP5709876B2 (en) Composition for treating multiple sclerosis
US6984503B1 (en) Use of recombinant bovine CD14 in the treatment and prevention of coliform mastitis in dairy cows
AU2002211214B2 (en) Method and composition for altering a B cell mediated pathology
AU2002211214A1 (en) Method and composition for altering a B cell mediated pathology
EP0563627A2 (en) Anti-tumor method and anti-tumor agent
ES2387407T3 (en) Compound comprising an autoantigenic peptide and a carrier with a CMH binding motif
EP1367393A1 (en) Methods for using the CD 163 pathway for modulating an immune response
US20190256592A1 (en) Binding agents for use in therapy
Cohen et al. A new set of monoclonal antibodies to human MHC class II alpha chains demonstrates that most alpha epitopes are inaccessible on the living cell surface
Fugger et al. Therapeutic Vaccination of Active Arthritis
US20030211470A1 (en) CD4-IgG2-based salvage therapy of HIV-1 infection

Legal Events

Date Code Title Description
STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED

STCF Information on status: patent grant

Free format text: PATENTED CASE

MAFP Maintenance fee payment

Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1551); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

Year of fee payment: 4