US10556015B2 - Lysosomal targeting of enzymes, and uses thereof - Google Patents

Lysosomal targeting of enzymes, and uses thereof Download PDF

Info

Publication number
US10556015B2
US10556015B2 US15/521,130 US201515521130A US10556015B2 US 10556015 B2 US10556015 B2 US 10556015B2 US 201515521130 A US201515521130 A US 201515521130A US 10556015 B2 US10556015 B2 US 10556015B2
Authority
US
United States
Prior art keywords
protein
pcsk9
gaa
lysosomal
naglu
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
US15/521,130
Other versions
US20170333569A1 (en
Inventor
Bohong Zhang
Michael F. Concino
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Criteo SA
Takeda Pharmaceutical Co Ltd
Original Assignee
Criteo SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Criteo SA filed Critical Criteo SA
Priority to US15/521,130 priority Critical patent/US10556015B2/en
Assigned to SHIRE HUMAN GENETIC THERAPIES, INC. reassignment SHIRE HUMAN GENETIC THERAPIES, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: ZHANG, BOHONG, CONCINO, MICHAEL F.
Publication of US20170333569A1 publication Critical patent/US20170333569A1/en
Application granted granted Critical
Publication of US10556015B2 publication Critical patent/US10556015B2/en
Assigned to TAKEDA PHARMACEUTICAL COMPANY LIMITED reassignment TAKEDA PHARMACEUTICAL COMPANY LIMITED ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: SHIRE HUMAN GENETIC THERAPIES, INC.
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/65Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/24Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/48Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/64Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
    • C12N9/6421Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
    • C12N9/6424Serine endopeptidases (3.4.21)
    • C12N9/6454Dibasic site splicing serine proteases, e.g. kexin (3.4.21.61); furin (3.4.21.75) and other proprotein convertases
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/96Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y302/00Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
    • C12Y302/0102Alpha-glucosidase (3.2.1.20)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y302/00Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
    • C12Y302/0105Alpha-N-acetylglucosaminidase (3.2.1.50)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/06Fusion polypeptide containing a localisation/targetting motif containing a lysosomal/endosomal localisation signal
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site

Definitions

  • More than forty lysosomal storage diseases are caused, directly or indirectly, by the absence or deficiency of one or more lysosomal enzymes.
  • Pompe disease is a lysosomal storage disease caused by a deficiency or dysfunction of the lysosomal hydrolase acid alpha-glucosidase (GAA), a glycogen-degrading lysosomal enzyme. Deficiency of GAA results in lysosomal glycogen accumulation in many tissues, with cardiac and skeletal muscle tissues being most seriously affected. The combined incidence of all forms of Pompe disease is estimated to be 1:40,000. It is estimated that approximately one third of patients with Pompe disease have the rapidly progressive, fatal infantile-onset form, while the majority of patients present with the more slowly progressive, juvenile or late-onset forms.
  • GAA lysosomal hydrolase acid alpha-glucosidase
  • MPS III mucopolysaccharidosis III
  • GAG glycosaminoglycans
  • Mucopolysaccharidosis type IIIB (MPS IIIB; Sanfilippo B disease) is an autosomal recessive disorder that is caused by a deficiency of the enzyme alpha-N-acetyl-glucosaminidase (Naglu), resulting in the accumulation of heparan sulfate in lysosomes of particularly neurons and glial cells in the brain, with additional lysosomal accumulation of heparan sulfate elsewhere.
  • MPS IIIB manifests itself primarily in the brain.
  • Enzyme replacement therapy has been used to deliver enzymes for the treatment of various lysosomal storage diseases. Normally, lysosomal enzymes are synthesized in the cytosol and then traverse the endoplasmic reticulum (ER), where they are glycosylated with N-linked, high mannose type carbohydrates. In the Golgi apparatus, high mannose carbohydrates on glycoproteins are then modified by a series of glycotransferases to become mature N-glycan; one of these modifications is the addition of mannose-6-phosphate (M6P).
  • M6P mannose-6-phosphate
  • Proteins carrying this modification are then targeted to the lysosome via binding of the M6P moiety to the cation-independent mannose-6-phosphate receptor (CI-M6PR) and cation-dependant mannose-6-phoshate receptor (CD-M6PR).
  • CI-M6PR cation-independent mannose-6-phosphate receptor
  • CD-M6PR cation-dependant mannose-6-phoshate receptor
  • Efficacy of enzyme replacement therapy is critically dependent on proper lysosomal targeting of the replacement enzyme.
  • recombinantly produced Naglu protein is characterized by a dramatic lack of M6P phosphorylation, making lysosomal targeting of this enzyme and its effective use for ERT very difficult.
  • enzyme replacement therapy has shown limitations, such as limited clinical benefit resulting from poor cellular uptake of recombinant enzyme in skeletal muscle and cardiac tissues of the body (Schoser et al., Neurotherapeutics 5:569-578 (2008)).
  • the present invention provides an alternative lysosomal targeting approach for enzyme replacement therapy that is more efficient, reliable and consistent.
  • the present invention is, in part, based on the surprising discovery that a replacement enzyme can be effectively delivered to the lysosome through the use of a soluble extracellular protein, such as PCSK9, and its interaction with various secondary binding proteins, such as, but not limited to, amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein or low density lipoprotein receptor-related protein 8 (Lrp8).
  • APLP2 amyloid precursor-like protein 2
  • APP amyloid precursor protein
  • ARH autosomal recessive hypercholesterolemia
  • Lrp8 low density lipoprotein receptor-related protein 8
  • the present invention permits targeting of a therapeutic to a lysosome in a glycosylation or M6P-independent manner and can be used to deliver enzymes with low levels of glycosylation or even with complete absence of glycosylation. Accordingly, the present invention allows for simpler processes of manufacturing recombinant enzymes for enzyme replacement therapy. Since PCSK9 is ubiquitously expressed throughout the various tissues of the body, the invention provides an effective means for delivering replacement enzymes for diseases associated with the nervous system and/or other tissues inn the body.
  • the present invention provides a targeted therapeutic including a lysosomal enzyme and a lysosomal targeting moiety including a proprotein convertase protein or fragment thereof.
  • the lysosomal enzyme is selected from Table 3.
  • the lysosomal enzyme is an acid alpha-glucosidase (GAA) protein.
  • GAA protein comprises an amino acid sequence at least 80%, 90%, or 95% identical to SEQ ID NO:1. In some embodiments, the GAA protein comprises an amino acid sequence identical to SEQ ID NO:1.
  • the lysosomal enzyme is an alpha-N-acetylglucosaminidase (Naglu) protein.
  • Naglu protein comprises an amino acid sequence at least 80%, 90%, or 95% identical to SEQ ID NO:4. In some embodiments, the Naglu protein comprises an amino acid sequence identical to SEQ ID NO:4.
  • the proprotein convertase protein is selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9.
  • the proprotein convertase comprises an amino acid substitution selected from the group consisting of S386A, F379A and a combination thereof.
  • the proprotein convertase is a PCSK9 protein.
  • the PCSK9 protein comprises an amino acid sequence at least 80%, 90% or 95% identical to SEQ ID NO:7. In some embodiments, the PCSK9 protein comprises an amino acid sequence is identical to SEQ ID NO:7.
  • the targeted therapeutic is a fusion protein.
  • the lysosomal targeting moiety is fused to the N-terminus or C-terminus of the lysosomal enzyme.
  • the lysosomal targeting moiety and the lysosomal enzyme are fused via a linker.
  • the linker is a peptide linker.
  • the peptide linker comprises a cleavage site.
  • the cleavage site comprises a lysosomal protease recognition site.
  • the linker comprises a sequence of GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGG GAP (SEQ ID NO. 13).
  • the fusion protein comprises a sequence at least 80%, 90% or 95% identical to the amino acid sequence of SEQ ID NO. 21 or 22. In some embodiments, the fusion protein comprises a sequence identical to the amino acid sequence of SEQ ID NO. 21 or 22.
  • the targeted therapeutic comprises an auxiliary propeptide derived from a proprotein convertase protein a fragment thereof.
  • the auxiliary propeptide is derived from a proprotein convertase protein selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9.
  • the auxiliary propeptide is derived from PCSK9.
  • the auxiliary propeptide comprises a sequence at least 80%, 90% or 95% identical to the amino acid sequence of SEQ ID NO. 23.
  • the auxiliary propeptide comprises a sequence identical to the amino acid sequence of SEQ ID NO. 23.
  • the targeted therapeutic has a higher binding affinity for Amyloid Precursor-like Protein 2 (APLP2), Dynamin, Amyloid Precursor Protein (APP), Autosomal Recessive Hypercholesterolemia (ARH) protein, or Low Density Lipoprotein Receptor-related Protein 8 (Lrp8), than for an LDL receptor.
  • the targeted therapeutic has a binding affinity for Amyloid Precursor-like Protein 2 (APLP2), Dynamin, Amyloid Precursor Protein (APP), Autosomal Recessive Hypercholesterolemia (ARH) protein, or Low Density Lipoprotein Receptor-related Protein 8 (Lrp8) that is at least 2, 3, 4, 5, 6, 7, 8, 9 or 10 fold higher than for an LDL receptor.
  • the present invention provides a nucleic acid encoding any of the proteins disclosed herein.
  • the present invention provides a vector including any of the nucleic acids disclosed herein.
  • the present invention provides a host cell including any of the vectors disclosed herein.
  • the host cell is selected from a bacterial, yeast, insect or mammalian cell.
  • the host cell is a mammalian cell.
  • the mammalian cell is a human cell.
  • the mammalian cell is a CHO cell.
  • the present invention provides a method of producing a targeted therapeutic, the method including steps of a) culturing any of the host cells disclosed herein under conditions suitable for expression of the targeted therapeutic by the host cell; and b) harvesting the targeted therapeutic expressed by the host cell.
  • any of the fusion proteins disclosed herein and an auxiliary protein are cultured within the same host cell.
  • the fusion protein and the auxiliary protein are harvested from the host cell simultaneously.
  • the present invention provides a pharmaceutical composition comprising any of the targeted therapeutics disclosed herein, and a pharmaceutical acceptable carrier.
  • the present invention provides a method of treating a lysosomal storage disease including administering to a subject in need of treatment any of the pharmaceutical compositions disclosed herein.
  • the lysosomal storage disease is selected from Table 3.
  • the lysosomal storage disease is Pompe disease or Sanfilippo syndrome type B.
  • the pharmaceutical composition is administered intravenously, intramuscularly, subcutaneously, intrathecally and/or combinations thereof.
  • the present invention provides a method of delivering a targeted therapeutic to skeletal muscle, vascular smooth muscle or cardiac muscle, including administering to a subject in need of treatment any of the pharmaceutical compositions disclosed herein.
  • this composition includes a targeted therapeutic that is the fusion protein of SEQ ID NO. 21 or 22.
  • Amelioration is meant the prevention, reduction or palliation of a state, or improvement of the state of a subject. Amelioration includes, but does not require complete recovery or complete prevention of a disease condition. In some embodiments, amelioration includes increasing levels of relevant protein or its activity that is deficient in relevant disease tissues.
  • amino acid in its broadest sense, refers to any compound and/or substance that can be incorporated into a polypeptide chain.
  • an amino acid has the general structure H 2 N—C(H)(R)—COOH.
  • an amino acid is a naturally occurring amino acid.
  • an amino acid is a synthetic amino acid; in some embodiments, an amino acid is a d-amino acid; in some embodiments, an amino acid is an 1-amino acid.
  • Standard amino acid refers to any of the twenty standard 1-amino acids commonly found in naturally occurring peptides.
  • Nonstandard amino acid refers to any amino acid, other than the standard amino acids, regardless of whether it is prepared synthetically or obtained from a natural source.
  • synthetic amino acid encompasses chemically modified amino acids, including but not limited to salts, amino acid derivatives (such as amides), and/or substitutions.
  • Amino acids, including carboxy- and/or amino-terminal amino acids in peptides, can be modified by methylation, amidation, acetylation, protecting groups, and/or substitution with other chemical groups that can change the peptide's circulating half-life without adversely affecting their activity. Amino acids may participate in a disulfide bond.
  • Amino acids may comprise one or posttranslational modifications, such as association with one or more chemical entities (e.g., methyl groups, acetate groups, acetyl groups, phosphate groups, formyl moieties, isoprenoid groups, sulfate groups, polyethylene glycol moieties, lipid moieties, carbohydrate moieties, biotin moieties, etc.).
  • chemical entities e.g., methyl groups, acetate groups, acetyl groups, phosphate groups, formyl moieties, isoprenoid groups, sulfate groups, polyethylene glycol moieties, lipid moieties, carbohydrate moieties, biotin moieties, etc.
  • amino acid is used interchangeably with “amino acid residue,” and may refer to a free amino acid and/or to an amino acid residue of a peptide. It will be apparent from the context in which the term is used whether it refers to a free amino acid or a residue of a
  • animal refers to any member of the animal kingdom. In some embodiments, “animal” refers to humans, at any stage of development. In some embodiments, “animal” refers to non-human animals, at any stage of development. In certain embodiments, the non-human animal is a mammal (e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, and/or a pig). In some embodiments, animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, insects, and/or worms. In some embodiments, an animal may be a transgenic animal, genetically-engineered animal, and/or a clone.
  • mammal e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, and/or a pig.
  • biologically active refers to a characteristic of any agent that has activity in a biological system, and particularly in an organism. For instance, an agent that, when administered to an organism, has a biological effect on that organism, is considered to be biologically active.
  • an agent that, when administered to an organism, has a biological effect on that organism is considered to be biologically active.
  • a portion of that protein or polypeptide that shares at least one biological activity of the protein or polypeptide is typically referred to as a “biologically active” portion.
  • Cation-independent mannose-6-phosphate receptor As used herein, the term “cation-independent mannose-6-phosphate receptor (CI-M6PR)” refers to a cellular receptor that binds mannose-6-phosphate (M6P) tags on acid hydrolase precursors in the Golgi apparatus that are destined for transport to the lysosome. In addition to mannose-6-phosphates, the CI-M6PR also binds other proteins including IGF-II.
  • the CI-M6PR is also known as “M6P/IGF-II receptor”, “CI-M6PR/IGF-II receptor”, “CD222”, “MPR300”, “IGF-II receptor” or “IGF2 Receptor.” These terms and abbreviations thereof are used interchangeably herein.
  • Cell culture refers to a cell population that is gown in a medium under conditions suitable to survival and/or growth of the cell population. As will be clear to those of ordinary skill in the art, these terms as used herein may refer to the combination comprising the cell population and the medium in which the population is grown.
  • Diluent refers to a pharmaceutically acceptable (e.g., safe and non-toxic for administration to a human) diluting substance useful for the preparation of a reconstituted formulation.
  • exemplary diluents include sterile water, bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
  • Dosing regimen is a set of unit doses (typically more than one) that are administered individually to a subject, typically separated by periods of time.
  • a given therapeutic agent has a recommended dosing regimen, which may involve one or more doses.
  • a dosing regimen comprises a plurality of doses each of which are separated from one another by a time period of the same length; in some embodiments, a dosing regimen comprises a plurality of doses and at least two different time periods separating individual doses.
  • Enzyme replacement therapy refers to any therapeutic strategy that corrects an enzyme deficiency by providing the missing enzyme.
  • the missing enzyme is provided by intrathecal administration.
  • the missing enzyme is provided by infusing into bloodsteam. Once administered, enzyme is taken up by cells and transported to the lysosome, where the enzyme acts to eliminate material that has accumulated in the lysosomes due to the enzyme deficiency.
  • the therapeutic enzyme is delivered to lysosomes in the appropriate cells in target tissues where the storage defect is manifest.
  • expression of a nucleic acid sequence refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5′ cap formation, and/or 3′ end formation); (3) translation of an RNA into a polypeptide or protein; and/or (4) post-translational modification of a polypeptide or protein.
  • expression and “production,” and grammatical equivalent, are used interchangeably.
  • fragment refers to polypeptides and is defined as any discrete portion of a given polypeptide that is unique to or characteristic of that polypeptide.
  • the term as used herein also refers to any discrete portion of a given polypeptide that retains at least a fraction of the activity of the full-length polypeptide.
  • the fraction of activity retained is at least 10% of the activity of the full-length polypeptide. More preferably the fraction of activity retained is at least 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90% of the activity of the full-length polypeptide. More preferably still the fraction of activity retained is at least 95%, 96%, 97%, 98% or 99% of the activity of the full-length polypeptide.
  • the fraction of activity retained is 100% of the activity of the full-length polypeptide.
  • the term as used herein also refers to any portion of a given polypeptide that includes at least an established sequence element found in the full-length polypeptide.
  • the sequence element spans at least 4-5, more preferably at least about 10, 15, 20, 25, 30, 35, 40, 45, 50 or more amino acids of the full-length polypeptide.
  • Gene refers to any nucleotide sequence, DNA or RNA, at least some portion of which encodes a discrete final product, typically, but not limited to, a polypeptide, which functions in some aspect of a cellular process.
  • the term is not meant to refer only to the coding sequence that encodes the polypeptide or other discrete final product, but may also encompass regions preceding and following the coding sequence that modulate the basal level of expression, as well as intervening sequences (“introns”) between individual coding segments (“exons”).
  • a gene may include regulatory sequences (e.g., promoters, enhancers, poly adenylation sequences, termination sequences, Kozac sequences, tata box, etc.) and/or modification sequences.
  • a gene may include references to nucleic acids that do not encode proteins but rather encode functional RNA molecules such as tRNAs, RNAi-inducing agents, etc.
  • Gene product or expression product generally refers to an RNA transcribed from the gene (pre- and/or post-processing) or a polypeptide (pre- and/or post-modification) encoded by an RNA transcribed from the gene.
  • Genetic control element refers to any sequence element that modulates the expression of a gene to which it is operably linked. Genetic control elements may function by either increasing or decreasing the expression levels and may be located before, within or after the coding sequence. Genetic control elements may act at any stage of gene expression by regulating, for example, initiation, elongation or termination of transcription, mRNA splicing, mRNA editing, mRNA stability, mRNA localization within the cell, initiation, elongation or termination of translation, or any other stage of gene expression. Genetic control elements may function individually or in combination with one another.
  • the terms “improve,” “increase” or “reduce,” or grammatical equivalents indicate values that are relative to a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control subject (or multiple control subject) in the absence of the treatment described herein.
  • a “control subject” is a subject afflicted with the same form of disease as the subject being treated, who is about the same age as the subject being treated.
  • in vitro refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, etc., rather than within a multi-cellular organism.
  • in vivo refers to events that occur within a multi-cellular organism, such as a human and a non-human animal. In the context of cell-based systems, the term may be used to refer to events that occur within a living cell (as opposed to, for example, in vitro systems).
  • Intrathecal administration refers to an injection into the spinal canal (intrathecal space surrounding the spinal cord). Various techniques may be used including, without limitation, lateral cerebroventricular injection through a burrhole or cisternal or lumbar puncture or the like.
  • “intrathecal administration” or “intrathecal delivery” according to the present invention refers to IT administration or delivery via the lumbar area or region, i.e., lumbar IT administration or delivery.
  • lumbar region or “lumbar area” refers to the area between the third and fourth lumbar (lower back) vertebrae and, more inclusively, the L2-S1 region of the spine.
  • Linker refers to, in a fusion protein, an amino acid sequence other than that appearing at a particular position in the natural protein and is generally designed to be flexible or to interpose a structure, such as an a-helix, between two protein moieties.
  • a linker is also referred to as a spacer.
  • Lysosomal enzyme refers to any enzyme that is capable of reducing accumulated materials in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms.
  • Lysosomal enzymes suitable for the invention include both wild-type or modified lysosomal enzymes and can be produced using recombinant and synthetic methods or purified from nature sources. Exemplary lysosomal enzymes are listed in Table 2.
  • Lysosomal enzyme deficiency refers to a group of genetic disorders that result from deficiency in at least one of the enzymes that are required to break macromolecules (e.g., enzyme substrates) down to peptides, amino acids, monosaccharides, nucleic acids and fatty acids in lysosomes.
  • macromolecules e.g., enzyme substrates
  • peptides amino acids, monosaccharides, nucleic acids and fatty acids in lysosomes.
  • individuals suffering from lysosomal enzyme deficiencies have accumulated materials in various tissues (e.g., CNS, liver, spleen, gut, blood vessel walls and other organs).
  • Lysosomal storage disease refers to any disease resulting from the deficiency of one or more lysosomal enzymes necessary for metabolizing natural macromolecules. These diseases typically result in the accumulation of un-degraded molecules in the lysosomes, resulting in increased numbers of storage granules (also termed storage vesicles). These diseases and various examples are described in more detail below.
  • nucleic acid refers to any compound and/or substance that is or can be incorporated into a polynucleotide chain.
  • a nucleic acid is a compound and/or substance that is or can be incorporated into a polynucleotide chain via a phosphodiester linkage.
  • nucleic acid refers to individual nucleic acid residues (e.g., nucleotides and/or nucleosides).
  • nucleic acid refers to a polynucleotide chain comprising individual nucleic acid residues.
  • nucleic acid encompasses RNA as well as single and/or double-stranded DNA and/or cDNA.
  • nucleic acid “DNA,” “RNA,” and/or similar terms include nucleic acid analogs, i.e., analogs having other than a phosphodiester backbone.
  • peptide nucleic acids which are known in the art and have peptide bonds instead of phosphodiester bonds in the backbone, are considered within the scope of the present invention.
  • nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and/or encode the same amino acid sequence.
  • Nucleotide sequences that encode proteins and/or RNA may include introns.
  • Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, backbone modifications, etc. A nucleic acid sequence is presented in the 5′ to 3′ direction unless otherwise indicated.
  • a nucleic acid is or comprises natural nucleosides (e.g., adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine); nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, C-5 propynyl-cytidine, C-5 propynyl-uridine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaaden
  • the present invention is specifically directed to “unmodified nucleic acids,” meaning nucleic acids (e.g., polynucleotides and residues, including nucleotides and/or nucleosides) that have not been chemically modified in order to facilitate or achieve delivery.
  • nucleic acids e.g., polynucleotides and residues, including nucleotides and/or nucleosides
  • a patient refers to any organism to which a provided composition may be administered, e.g., for experimental, diagnostic, prophylactic, cosmetic, and/or therapeutic purposes. Typical patients include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and/or humans). In some embodiments, a patient is a human. A human includes pre and post natal forms.
  • pharmaceutically acceptable refers to substances that, within the scope of sound medical judgment, are suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • a polypeptide may include at least 3-5 amino acids, each of which is attached to others by way of at least one peptide bond.
  • peptides sometimes include “non-natural” amino acids or other entities that nonetheless are capable of integrating into a polypeptide chain, optionally.
  • polypeptide and peptide are used interchangeably.
  • Protein As used herein, the term “protein” of “therapeutic protein” refers to a polypeptide (i.e., a string of at least two amino acids linked to one another by peptide bonds). Proteins may include moieties other than amino acids (e.g., may be glycoproteins, proteoglycans, etc.) and/or may be otherwise processed or modified. Those of ordinary skill in the art will appreciate that a “protein” can be a complete polypeptide chain as produced by a cell (with or without a signal sequence), or can be a characteristic portion thereof. Those of ordinary skill will appreciate that a protein can sometimes include more than one polypeptide chain, for example linked by one or more disulfide bonds or associated by other means.
  • Polypeptides may contain 1-amino acids, d-amino acids, or both and may contain any of a variety of amino acid modifications or analogs known in the art. Useful modifications include, e.g., terminal acetylation, amidation, methylation, etc.
  • proteins may comprise natural amino acids, non-natural amino acids, synthetic amino acids, and combinations thereof.
  • the term “peptide” is generally used to refer to a polypeptide having a length of less than about 100 amino acids, less than about 50 amino acids, less than 20 amino acids, or less than 10 amino acids.
  • proteins are antibodies, antibody fragments, biologically active portions thereof, and/or characteristic portions thereof.
  • Recombinant protein and Recombinant polypeptide refer to a polypeptide expressed from a host cell, that has been genetically engineered to express that polypeptide.
  • a recombinant protein may be expressed in a host cell derived from an animal.
  • a recombinant protein may be expressed in a host cell derived from an insect.
  • a recombinant protein may be expressed in a host cell derived from a yeast.
  • a recombinant protein may be expressed in a host cell derived from a prokaryote.
  • a recombinant protein may be expressed in a host cell derived from an mammal.
  • a recombinant protein may be expressed in a host cell derived from a human.
  • the recombinantly expressed polypeptide may be identical or similar to a polypeptide that is normally expressed in the host cell.
  • the recombinantly expressed polypeptide may be foreign to the host cell, i.e. heterologous to peptides normally expressed in the host cell.
  • the recombinantly expressed polypeptide can be a chimeric, in that portions of the polypeptide contain amino acid sequences that are identical or similar to polypeptides normally expressed in the host cell, while other portions are foreign to the host cell.
  • subject refers to a human or any non-human animal (e.g., mouse, rat, rabbit, dog, cat, cattle, swine, sheep, horse or primate).
  • a human includes pre- and post-natal forms.
  • a subject is a human being.
  • a subject can be a patient, which refers to a human presenting to a medical provider for diagnosis or treatment of a disease.
  • the term “subject” is used herein interchangeably with “individual” or “patient.”
  • a subject can be afflicted with or is susceptible to a disease or disorder but may or may not display symptoms of the disease or disorder.
  • Target tissues refers to any tissue that is affected by the lysosomal storage disease to be treated or any tissue in which the deficient lysosomal enzyme is normally expressed.
  • target tissues include those tissues in which there is a detectable or abnormally high amount of enzyme substrate, for example stored in the cellular lysosomes of the tissue, in patients suffering from or susceptible to the lysosomal storage disease.
  • target tissues include those tissues that display disease-associated pathology, symptom, or feature.
  • target tissues include those tissues in which the deficient lysosomal enzyme is normally expressed at an elevated level.
  • a target tissue may be a brain target tissue, a spinal cord target tissue and/or a peripheral target tissue. Exemplary target tissues are described in detail below.
  • treatment refers to any administration of a therapeutic protein (e.g., lysosomal enzyme) that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of a particular disease, disorder, and/or condition (e.g., Hunters syndrome, Sanfilippo B syndrome).
  • a therapeutic protein e.g., lysosomal enzyme
  • Such treatment may be of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition.
  • Such treatment may be of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition.
  • therapeutically effective amount of a therapeutic agent means an amount that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and/or condition, to treat, diagnose, prevent, and/or delay the onset of the symptom(s) of the disease, disorder, and/or condition. It will be appreciated by those of ordinary skill in the art that a therapeutically effective amount is typically administered via a dosing regimen comprising at least one unit dose.
  • the present invention provides, among other things, methods and compositions for lysosomal targeting of a therapeutic protein (e.g., a lysosomal enzyme) based on a lysosomal targeting moiety that comprises PCSK9 (proprotein convertase subtilisin kexin type 9).
  • a therapeutic protein e.g., a lysosomal enzyme
  • PCSK9 prote convertase subtilisin kexin type 9
  • the present invention provides a targeted therapeutic comprising a lysosomal enzyme and a lysosomal targeting moiety that binds to amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and/or Annexin A2.
  • APLP2 amyloid precursor-like protein 2
  • APP amyloid precursor protein
  • ARH autosomal recess
  • the present invention may be used to target any therapeutic protein to a lysosome.
  • the present invention may be used to target a lysosomal enzyme to a lysosome for the treatment of a lysosomal storage disease.
  • a lysosomal enzyme is contemplated to encompass any enzyme or protein that, when targeted to the lysosome, is suitable for the treatment of a lysosomal storage disease.
  • lysosomal enzymes are acid alpha-glucosidase (GAA) protein, which is deficient in Pompe disease, and alpha-N-acetylglucosaminidase (Naglu) protein, which is deficient in Sanfilippo Syndrome Type B disease. Additional exemplary lysosomal enzymes are shown in Table 3.
  • a suitable GAA protein according to the present invention can be any molecule that can substitute for naturally-occurring GAA protein activity or rescue one or more phenotypes or symptoms associated with GAA-deficiency.
  • a GAA protein suitable for the invention is a polypeptide having an N-terminus and C-terminus and an amino acid sequence substantially similar or identical to mature human GAA protein.
  • human GAA is produced as a precursor molecule that is processed to a mature form. This process generally occurs by removing the 27 amino acid signal peptide as the protein enters the endoplasmic reticulum.
  • the precursor form including the 27 amino acid signal peptide is also referred to as Full-Length GAA protein, which contains 952 amino acids.
  • the N-terminal 27 amino acids are cleaved as the Full-Length GAA protein enters the endoplasmic reticulum, resulting in the Precursor Form GAA Protein.
  • the Precursor Form GAA Protein is then subsequently cleaved to remove a N-terminal propeptide sequence of 42 amino acids, to produce the Mature Form GAA protein (aa 70-952).
  • N-terminal 27 amino acids that constitute the signal peptide and the N-terminal 42 amino acids that constitute the propeptide are generally not required for GAA protein activity.
  • the use of the Full-Length GAA Protein (aa 1-952) and of the Precursor Form GAA Protein (aa 28-952) are also contemplated within the scope of the instant invention.
  • the amino acid sequences of the Mature Form GAA Protein (SEQ ID NO:1); Precursor Form GAA Protein (SEQ ID NO:2) and Full-Length GAA Protein (SEQ ID NO:3) of a typical wild-type or naturally-occurring human GAA protein are shown in Table 1 below.
  • GAA protein suitable for the present invention is a human Mature Form GAA Protein (SEQ ID NO:1).
  • a suitable GAA protein may be a homologue or an orthologue of human Mature Form GAA Protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.).
  • a suitable GAA protein may be a functional variant of human Mature Form GAA Protein.
  • a functional variant Mature Form GAA Protein may be a modified human Mature Form GAA Protein containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring human Mature Form GAA Protein (e.g., SEQ ID NO:1), while retaining substantial GAA protein activity.
  • a GAA protein suitable for the present invention is substantially homologous to human Mature Form GAA Protein (SEQ ID NO:1).
  • a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:1.
  • a GAA protein suitable for the present invention is substantially identical to human Mature Form GAA Protein (SEQ ID NO:1).
  • a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:1.
  • a GAA protein suitable for the present invention contains a fragment or a portion of human Mature Form GAA Protein.
  • a GAA protein suitable for the present invention is a human Precursor Form GAA Protein (SEQ ID NO:2).
  • a GAA protein suitable may be a homologue or an orthologue of human Precursor Form GAA Protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.).
  • a suitable GAA protein is a functional variant of a human Precursor Form GAA Protein, containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring human Precursor Form GAA Protein (e.g., SEQ ID NO:2), while retaining substantial GAA protein activity.
  • a GAA protein suitable for the present invention is substantially homologous to human Precursor Form GAA Protein (SEQ ID NO:2).
  • a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:2.
  • a GAA protein suitable for the present invention is substantially identical to SEQ ID NO:2.
  • a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:2.
  • a GAA protein suitable for the present invention contains a fragment or a portion of human Precursor Form GAA Protein.
  • a Precursor Form GAA Protein typically contains a propeptide sequence.
  • a GAA protein suitable for the present invention is a human Full-Length GAA Protein (SEQ ID NO:3).
  • a GAA protein suitable may be a homologue or an orthologue of Full-Length GAA Protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.).
  • a suitable GAA protein is a functional variant of human Full-Length GAA Protein, containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring full length GAA protein (e.g., SEQ ID NO:3), while retaining substantial GAA protein activity.
  • a GAA protein suitable for the present invention is substantially homologous to human Full-Length GAA Protein (SEQ ID NO:3).
  • a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:3.
  • a GAA protein suitable for the present invention is substantially identical to SEQ ID NO:3.
  • a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:3.
  • a GAA protein suitable for the present invention contains a fragment or a portion of human Full-Length GAA Protein.
  • a Full-Length GAA Protein typically contains a signal peptide sequence and a propeptide sequence.
  • a suitable Naglu protein according to the present invention can be any molecule that can substitute for naturally-occurring Naglu protein activity or rescue one or more phenotypes or symptoms associated with Naglu-deficiency.
  • a Naglu protein suitable for the invention is a polypeptide having an N-terminus and C-terminus and an amino acid sequence substantially similar or identical to mature human Naglu protein.
  • human Naglu is produced as a precursor molecule that is processed to a mature form. This process generally occurs by removing the 23 amino acid signal peptide as the protein enters the endoplasmic reticulum.
  • the precursor form is also referred to as full-length precursor or full-length Naglu protein, which contains 743 amino acids.
  • the N-terminal 23 amino acids are cleaved as the precursor protein enters the endoplasmic reticulum, resulting in a mature form.
  • the N-terminal 23 amino acids is generally not required for the Naglu protein activity.
  • the use of the full-length precursor of the Naglu protein is also contemplated within the scope of the instant invention.
  • the amino acid sequences of the mature form (SEQ ID NO:4) and full-length precursor (SEQ ID NO:5) of a typical wild-type or naturally-occurring human Naglu protein are shown in Table 2 below.
  • Naglu protein suitable for the present invention is a mature human Naglu protein (SEQ ID NO:4).
  • a suitable Naglu protein may be a homologue or an orthologue of the mature human Naglu protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.).
  • a suitable Naglu protein may be a functional variant of the mature human Naglu protein.
  • a functional variant of the mature human Naglu protein may be a modified mature human Naglu protein containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring Naglu protein (e.g., SEQ ID NO:4), while retaining substantial Naglu protein activity.
  • a Naglu protein suitable for the present invention is substantially homologous to mature human Naglu protein (SEQ ID NO:4).
  • a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:4.
  • a Naglu protein suitable for the present invention is substantially identical to mature human Naglu protein (SEQ ID NO:4).
  • a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:4.
  • a Naglu protein suitable for the present invention contains a fragment or a portion ofa mature Naglu protein.
  • a Naglu protein suitable for the present invention is a full-length Naglu protein (SEQ ID NO:5).
  • a Naglu protein suitable may be a homologue or an orthologue of the full-length human Naglu protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.).
  • a suitable Naglu protein is a functional variant of the full-length human Naglu protein, containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring full-length Naglu protein (e.g., SEQ ID NO:5), while retaining substantial Naglu protein activity.
  • a Naglu protein suitable for the present invention is substantially homologous to full-length human Naglu protein (SEQ ID NO:5).
  • a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:5.
  • a Naglu protein suitable for the present invention is substantially identical to SEQ ID NO:5.
  • a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:5.
  • a Naglu protein suitable for the present invention contains a fragment or a portion of a full-length Naglu protein. As used herein, a full-length Naglu protein typically contains a signal peptide sequence.
  • the present invention may be used to deliver any lysosomal enzymes that can be used to treat any lysosomal storage diseases, in particular those lysosomal storage diseases having skeletal muscle, kidney and/or CNS etiology and/or symptoms, including, but are not limited to, aspartylglucosaminuria, cholesterol ester storage disease, Wolman disease, cystinosis, Danon disease, Fabry disease, Farber lipogranulomatosis, Farber disease, fucosidosis, galactosialidosis types I/II, Gaucher disease types I/II/III, globoid cell leukodystrophy, Krabbe disease, glycogen storage disease II, Pompe disease, GM1-gangliosidosis types I/II/III, GM2-gangliosidosis type I, Tay Sachs disease, GM2-gangliosidosis type II, Sandhoff disease, GM2-gangliosidosis, ⁇ -mannosidosis types I/I
  • a lysosomal enzyme suitable for the invention may have a wild-type or naturally occurring sequence.
  • a lysosomal enzyme suitable for the invention may have a modified sequence having substantial homology or identify to the wild-type or naturally-occurring sequence (e.g., having at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% sequence identity to the wild-type or naturally-occurring sequence).
  • a lysosomal targeting moiety refers to any agent that can facilitate lysosomal delivery via binding to a protein other than the CI-M6PR receptor.
  • the lysosomal targeting moiety is able to bind, directly or indirectly, to one or more membrane proteins via a cis-his rich domain (CHRD) to form a protein complex.
  • CHRD cis-his rich domain
  • the lysosomal targeting moiety binds, directly or indirectly, to one or more secondary binding proteins selected from the group consisting of the low density lipoprotein receptor (LDLR), amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8), or combinations thereof.
  • LDLR low density lipoprotein receptor
  • APLP2 amyloid precursor-like protein 2
  • APP amyloid precursor protein
  • ARH autosomal recessive hypercholesterolemia
  • Lrp8 low density lipoprotein receptor-related protein 8
  • the lysosomal targeting moiety comprises a proprotein convertase, or fragment thereof.
  • the proprotein convertase is a mammalian proprotein convertase.
  • Mammalian proprotein convertases are members of a secretory serine protease family composed of nine members related to bacterial subtilisin and yeast kexin.
  • the catalytic domains of seven members of this family (PC1/3; PC2; Furin; PC4; PC5/6; PACE4 and PC7) exhibit homology to the catalytic domain of yeast kexin, and they are known to cleave after basic residues in target proteins.
  • the eighth member, SKI-1/S1P shows strong homology to bacterial pyrolysin and, similar to the other 7 family members, is known to cleave after basic residues in target proteins.
  • PCSK9 shows homology to fungal proteinase K and undergoes autoproteolytic cleavage at the (V/I)FAQ motif in the endoplasmic reticulum.
  • these proprotein convertases are synthesized as inactive zymogens that carry an N-terminal propeptide. It is thought that this propeptide facilitates proper folding of the convertase, and that it functions as a natural inhibitor of the enzyme until it is cleaved off.
  • PCSK9 Several PCs (Furin, PC5/6; PACE4, SKI-1/S1P and PCSK9) have been shown to play a central role in regulating sterols and/or lipid metabolism. This is especially true for PCSK9, whose over-activity/gain-of-function results in Familial Hypercholesterolemia (FH).
  • FH Familial Hypercholesterolemia
  • PCSK9 is highly expressed in the liver and produced as a preprotein that undergoes autoproteolytic cleavage during passage through the secretory pathyway. During this process, the C-terminus of the N-terminal propeptide occupies PCSK9's catalytic pocket, inhibiting its proteolytic activity and blocking access to other exogenous substrates.
  • PCSK9 binds to the EGF-A domain of the LDL receptor through part of its catalytic domain to form a non-covalent protein complex, which is internalized by endocytosis and targeted for degradation in the acidic compartment of the lysosome.
  • PCSK9-LDLR complex is necessary for LDL receptor (LDLR) recycling and removal of LDL from the extracellular space, it is not required for PCSK9 endocytosis to the lysosome.
  • LDLR LDL receptor
  • lysosomal targeting and function of PCSK9 relies on its C-terminal Cys-His-rich domain (CHRD), a region which allows for non-covalent binding with various membrane bound protein such as: amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A2 (LoSurdo et al., EMBO 12:1300-1305 (2011); Ni et al., J. Biol. Chem. 285:12882-12891 (2010); Saavedra et al., J. Biol. Chem.
  • CHRD C-terminal Cys-His-rich domain
  • a suitable lysosomal targeting moiety may be any proprotein convertase molecule, fragment or portion thereof (e.g., a motif or domain) capable of endocytosis to the lysosome.
  • the proprotein convertase molecule or fragment thereof comprises a CHRD motif.
  • the proprotein convertase is a mammalian proprotein convertase.
  • the proprotein convertase is selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9. In some specific embodiments, the proprotein convertase is PCSK9.
  • a suitable lysosomal targeting moiety may be any proprotein convertase molecule, fragment or portion thereof (e.g. a motif or domain) capable of binding, directly or indirectly, to the LDL receptor (LDLR).
  • the proprotein convertase molecule or fragment thereof is capable of binding, directly or indirectly, to a secondary binding protein selected from the group consisting of amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A.
  • binding to LDLR or secondary binding protein typically refers to a physiologically meaningful binding.
  • a physiologically meaningful binding typically has a dissociation constant (Kd) no greater than 10 ⁇ 7 under physiological conditions (e.g., pH 6-8, and in particular, pH 7.4).
  • the lysosomal targeting moiety comprises the PCSK9 preprotein (including the PCSK9 signal peptide ⁇ N-terminal 30 amino acids ⁇ and propeptide ⁇ N-terminal amino acids from position 31 to 122 ⁇ ) (SEQ ID NO:6).
  • the lysosomal targeting moiety comprises the PCSK9 protein without the N-terminal signal and propeptide, i.e., PCSK9 Mature Protein (SEQ ID NO:7).
  • a lysosomal targeting moiety is a peptide fragment derived from human PCSK9 preprotein (SEQ ID NO:6).
  • the amino acid sequences of a typical wild-type or naturally-occurring human PCSK9 preprotein and an auto-proteolytically cleaved human mature PCSK9 protein are shown in Table 4 below.
  • a lysosomal targeting moiety has a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the sequence of the PCSK9 preprotein (SEQ ID NO:6). In some embodiments, a lysosomal targeting moiety has a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the sequence of PCSK9 Mature Protein (SEQ ID NO:7). In some embodiments, a lysosomal targeting moiety is a fragment of human PCSK9 Preprotein.
  • a lysosomal targeting moiety contains one or more N-terminal, C-terminal or internal deletions, or combinations thereof, in the sequence of human PCSK9 Preprotein (SEQ ID NO:6). In some embodiments, a lysosomal targeting moiety contains one or more N-terminal, C-terminal or internal deletions, or combinations thereof, in the sequence of the human PCSK9 Mature Protein (SEQ ID NO:7).
  • a lysosomal targeting moiety is a modified human PCSK9 sequence (preprotein or mature form) containing amino acid substitutions, insertions or deletions.
  • the lysosomal targeting moiety has one or more amino acid substitutions, deletions or insertions within the catalytic domain of the preprotein or mature form of PCSK9.
  • the lysosomal targeting moiety has one or more mutations within the PCSK9 catalytic domain that diminish or enhance auto proteolytic cleavage.
  • the one more mutations within the catalytic domain comprise a S386A substitution.
  • the lysosomal targeting moiety has one or more mutations (amino acid substitutions, insertions or deletions) within the LDLR binding region that diminish or enhance binding to the LDL receptor.
  • the mutation within the LDLR binding region comprises a F379A substitution.
  • the lysosomal targeting moiety has one or more mutations (amino acid substitutions, insertions or deletions) within the CHRD region of the protein. In some embodiments, the lysosomal targeting moiety has one or more mutations within the CHRD region that enhance binding to one or more secondary binding proteins selected from the group consisting of amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A.
  • APLP2 amyloid precursor-like protein 2
  • APP amyloid precursor protein
  • ARH autosomal recessive hypercholesterolemia
  • Lrp8 low density lipoprotein receptor-related protein 8
  • the lysosomal targeting moiety has one or more mutations, substitutions, deletions or insertions within a region selected from the group consisting of the catalytic domain, propeptide, CHRD region, LDLR binding region and combinations thereof.
  • the one or more mutations are selected from the group consisting of S386A, F379A and combinations thereof.
  • the one or more mutations are selected from the group consisting of amino acid substitutions at positions R194 (elimination of LDL receptor binding), D186 and/or H226 (both elimination of protease activity); the substitution in these three cases may be A, as well as other amino acids such as L, G, V, and others.
  • a suitable lysosomal targeting moiety is a protein complex comprising a proprotein convertase, or fragment thereof, and one or more auxiliary proteins.
  • auxiliary protein is used to describe a protein (i.e., full length, fragment, peptide or motif) non-covalently bound to the catalytic domain of a proprotein convertase, or fragment thereof, which is capable of inhibiting enzyme activity and/or of enhancing cellular uptake of the proprotein convertase.
  • a suitable lysosomal targeting moiety is a protein complex comprising human PCSK9 and one or more auxiliary proteins.
  • the auxiliary protein comprises a protein (i.e., full length, fragment, peptide or motif) which binds within the catalytic domain of a human proprotein convertase.
  • the auxiliary protein partially occludes the catalytic site of PCSK9 or any other proprotein convertase when bound.
  • the auxiliary protein completely occludes the catalytic site of PCSK9 when bound.
  • the auxiliary protein binds within the catalytic domain of PCSK9 or any other proprotein convertase and reduces enzyme activity by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95%. In some embodiments, the auxiliary protein completely blocks enzyme activity when bound within the catalytic site of PCSK9 or any other proprotein convertase.
  • the auxiliary protein binds the LDLR receptor binding site within the catalytic domain of PCSK9 or any other proprotein convertase.
  • the auxiliary protein reduces binding between PCSK9, or any other proprotein convertase, and LDLR by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95%. In some embodiments, the auxiliary protein completely reduces binding of PCSK9, or any other proprotein convertase, to LDLR.
  • the auxiliary protein enhances cellular uptake of PCSK9, or any other proprotein convertase, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95%.
  • an auxiliary protein comprises a proprotein convertase propeptide, or fragment thereof.
  • the propeptide or fragment thereof is derived from a proprotein convertase protein selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9.
  • the propeptide or fragment thereof is derived from PCSK9.
  • the propeptide is derived from the PCSK9 preprotein (SEQ ID NO:6). In some embodiments, the propeptide comprises an amino acid sequence at least 50%, 60%, 70%, 80%, 85%, 90% or 95% identical SEQ ID NO:8. In some embodiments, the propeptide is identical to SEQ ID NO:8.
  • the amino acid sequences of a propeptide derived from a typical wild-type or naturally-occurring human PCSK9 preprotein is shown in Table 5 below.
  • a lysosomal enzyme and a targeting moiety can be associated, directly or indirectly.
  • a lysosomal enzyme and a targeting moiety are non-covalently associated. The association is typically stable at or about pH 7.4.
  • a targeting moiety can be biotinylated and bind avidin associated with a lysosomal enzyme.
  • a targeting moiety and a lysosomal enzyme are crosslinked to each other (e.g., using a chemical crosslinking agent).
  • a targeting moiety is fused to a lysosomal enzyme as a fusion protein.
  • the targeting moiety can be at the amino-terminus of the fusion protein, the carboxy-terminus, or can be inserted within the sequence of the lysosomal enzyme at a position where the presence of the targeting moiety does not unduly interfere with the therapeutic activity of the enzyme.
  • a lysosomal enzyme is a heteromeric protein, one or more of the subunits can be associated with a targeting moeity.
  • a lysosomal targeting moiety can be fused to the N-terminus or C-terminus of a lysosomal enzyme polypeptide, or inserted internally.
  • the lysosomal targeting moiety can be fused directly to the lysosomal enzyme polypeptide or can be separated from the lysosomal enzyme polypeptide by a linker or a spacer.
  • An amino acid linker or spacer is generally designed to be flexible or to interpose a structure, such as an alpha-helix, between two protein moieties.
  • a linker or spacer can be relatively short, such as a “GGG” or a poly “GAG” sequence GGGGGAAAAAGGGGG (SEQ ID NO:9), a “GAP” sequence of GAP (SEQ ID NO:10), a “PolyGP” sequence of GGGGGP (SEQ ID NO:11), or can be longer, such as, for example, 10-50 (e.g., 10-20, 10-25, 10-30, 10-35, 10-40, 10-45, 10-50) amino acids in length.
  • various short linker sequences can be present in tandem repeats.
  • a suitable linker may contain the “GAG” amino acid sequence of GGGGGAAAAAGGGGG (SEQ ID NO:9) present in tandem repeats.
  • such a linker may further contain one or more “GAP” sequences, that frame the “GAG” sequence of GGGGGAAAAAGGGGG (SEQ ID NO:9).
  • GAP GAG2 linker
  • a GAG2 linker may be used, which contains two tandem “GAG” repeats, each framed by a “GAP” sequence, such as GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAP (SEQ ID NO:12).
  • a GAG3 linker may be used, which contains three tandem “GAG” repeats, each framed by two “GAP” sequences, such as GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGG GAP (SEQ ID NO:13).
  • a suitable linker or spacer may contain a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to any of the linker sequences described herein, including, but not limited to, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, or SEQ ID NO:13.
  • linkers or spacers suitable for the invention are known in the art including those described in WO 2012122042, entitled “PEPTIDE LINKERS FOR POLYPEPTIDE COMPOSITIONS AND METHODS FOR USING SAME”, which is incorporated by reference in its entirety.
  • the association between a lysosomal enzyme and a lysosomal targeting moiety according to the present invention does not substantially alter enzyme activity.
  • the targeted therapeutic has an enzyme activity that is substantially similar or enhanced when compared to the corresponding native enzyme.
  • the enzyme activity of a targeted therapeutic retains at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% enzymatic activity as compared to the native enzyme.
  • the enzyme activity of a targeted therapeutic is enhanced by at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 70%, 80%, 90% or 100% compared to the native enzyme.
  • a targeted therapeutic of the present invention comprises a GAA or Naglu protein fused to a lysosomal targeting moiety.
  • the GAA or Naglu protein has a Km for a known substrate of at least about 0.10 nM (e.g., at least about 0.15 nM, 0.20 nM, 0.25 nM, 0.30 nM, or 0.35 nM).
  • the targeted therapeutic of the present invention permits substantial binding between the lysosomal targeting moiety and a secondary binding protein, such as, but not limited to, amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8), LDLR and Annexin A.
  • APLP2 amyloid precursor-like protein 2
  • APP amyloid precursor protein
  • ARH autosomal recessive hypercholesterolemia
  • Lrp8 low density lipoprotein receptor-related protein 8
  • LDLR low density lipoprotein receptor-related protein 8
  • the targeted therapeutic of the present invention may be engineered to permit substantial binding between the lysosomal targeting moiety and a secondary binding protein, such as, but not limited to amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A, but shows a reduction or complete block in LDLR binding.
  • APLP2 amyloid precursor-like protein 2
  • APP amyloid precursor protein
  • ARH autosomal recessive hypercholesterolemia
  • Lrp8 low density lipoprotein receptor-related protein 8
  • Annexin A but shows a reduction or complete block in LDLR binding.
  • the level of LDLR or secondary binding protein binding of the targeted therapeutic may be tested using any of a variety of well-known binding assays, such as, but not limited to, radiolabeled run on assay, radiolabeled binding assay, ELISA, Surface Plasmone Resonance and Isothermal Titration calorimetry.
  • the level of LDLR or secondary binding protein binding of the targeted therapeutics of the invention may be evaluated by cellular uptake studies.
  • the cellular uptake of a targeted therapeutic according to the present invention has a Kd of at least about 1.0e+2 nM (e.g., at least about 1.0e+3 nM, 1.0e+4 nM, or 1.0e+5 nM).
  • Targeted therapeutics may be produced via various methods known in the art.
  • a targeted therapeutic is a fusion protein comprising a lysosomal targeting moiety and a therapeutic protein (e.g., a lysosomal enzyme).
  • the fusion protein further comprises one or more auxiliary proteins. It is contemplated in accordance with the invention, that the targeted therapeutic, alone or further comprising an auxiliary binding protein, may be produced recombinantly.
  • a fusion protein according to the invention may be engineered using standard recombinant technology and produced using a cell culture system.
  • auxiliary protein may be achieved by co-expression of each component (fusion protein and auxiliary binding protein) to facilitate formation of the protein complex in vivo.
  • the auxiliary protein and the fusion protein may be recombinantely produced separately and brought together in vitro (e.g., following purification) to facilitate formation of the protein complex.
  • a fusion protein is engineered and expressed that comprises a lysosomal targeting moiety (e.g., PCSK9) and a therapeutic protein (e.g., GAA) and at the N-terminus, separated by a proteolytic cleavage site (e.g., for Furin), a signal peptide and propeptide of a proprotein convertases (e.g., PCSK9).
  • a lysosomal targeting moiety e.g., PCSK9
  • a therapeutic protein e.g., GAA
  • GAA proteolytic cleavage site
  • signal peptide and propeptide of a proprotein convertases e.g., PCSK9
  • This proteolytic site will be cleaved intracellularly and the fusion comprising a lysosomal targeting moiety (e.g., PCSK9) and a therapeutic protein (e.g., GAA) will form a complex with the released propeptide (from which the signal peptide is removed within the ER).
  • a lysosomal targeting moiety e.g., PCSK9
  • a therapeutic protein e.g., GAA
  • prokaryotic and eukaryotic cells may be used for producing fusion proteins including, without limitation, cell lines derived from bacteria strains, yeast strains, insect cells, animal cells, mammalian cells and human cells.
  • aspects of the present invention also provide for expression constructs and the generation of recombinant stable cell lines useful for expressing fusion proteins which are disclosed in the present specification.
  • aspects of the present invention also provide methods for producing cell lines that express fusion proteins using the disclosed nucleic acid sequences of the present specification.
  • nucleic acid molecules are provided comprising nucleic acid sequences encoding for a recombinant fusion protein (herein referred to as a transgene), such as GAA and Naglu fusion proteins described in various embodiments herein.
  • a transgene recombinant fusion protein
  • the nucleic acid encoding a transgene may be modified to provide increased expression of the fusion protein, which is also referred to as codon optimization.
  • the nucleic acid encoding a transgene can be modified by altering the open reading frame for the coding sequence.
  • the term “open reading frame” is synonymous with “ORF” and means any nucleotide sequence that is potentially able to encode a protein, or a portion of a protein.
  • An open reading frame usually begins with a start codon (represented as, e.g. AUG for an RNA molecule and ATG in a DNA molecule in the standard code) and is read in codon-triplets until the frame ends with a STOP codon (represented as, e.g. UAA, UGA or UAG for an RNA molecule and TAA, TGA or TAG in a DNA molecule in the standard code).
  • start codon represented as, e.g. AUG for an RNA molecule and ATG in a DNA molecule in the standard code
  • STOP codon represented as, e.g. UAA, UGA or UAG for an RNA molecule and TAA, TGA or TAG in a DNA molecule in the standard code.
  • codon means a sequence of three nucleotides in a nucleic acid molecule that specifies a particular amino acid during protein synthesis; also called a triplet or codon-triplet.
  • codons For example, of the 64 possible codons in the standard genetic code, two codons, GAA and GAG encode the amino acid Glutamine whereas the codons AAA and AAG specify the amino acid Lysine. In the standard genetic code three codons are stop codons, which do not specify an amino acid.
  • sequence As used herein, the term “synonymous codon” means any and all of the codons that code for a single amino acid. Except for Methionine and Tryptophan, amino acids are coded by two to six synonymous codons.
  • the four synonymous codons that code for the amino acid Alanine are GCA, GCC, GCG and GCU
  • the two synonymous codons that specify Glutamine are GAA and GAG
  • the two synonymous codons that encode Lysine are AAA and AAG.
  • a nucleic acid encoding the open reading frame of fusion protein may be modified using standard codon optimization methods.
  • codon optimization Various commercial algorithms for codon optimization are available and can be used to practice the present invention.
  • codon optimization does not alter the encoded amino acid sequences.
  • codon optimization may lead to amino acids alteration such as substitution, deletion or insertion. Typically, such amino acid alteration does not substantially alter the protein activity.
  • Exemplary nucleic acid sequences encoding PCSK9-GAA, Naglu-PCSK9 and the PCSK9 propeptide are each respectively shown in SEQ ID NO:14, 15 and 16 below.
  • SEQ ID NO:14 Exemplary nucleic acid sequence encoding PCSK9-GAA.
  • nucleotide sequence encoding PCSK9 Mature Protein (except nucleotide sequences encoding mutations F379A and S386A, which are underlined) is not underlined, bold or in italics.
  • the nucleotide sequence encoding the amino acid sequence of the GlyGlyGly linker is underlined.
  • nucleotide sequence encoding Mature Form GAA Protein amino acid sequence (aa70-952) is bold and in italics.
  • SEQ ID NO:15 Exemplary nucleic acid sequence encoding Naglu-PCSK9.
  • nucleotide sequence encoding Mature Form of Naglu is not underlined, bold or in italics.
  • the nucleotide sequence encoding the amino acid sequence of the GlyGlyGly linker is underlined.
  • nucleotide sequence encoding PCSK9 Mature Protein is in italics.
  • SEQ ID NO:16 Exemplary nucleic acid sequence encoding PCSK9 propeptide and PCSK9 N-terminal signal peptide.
  • a nucleotide change may alter a synonymous codon within the open reading frame in order to agree with the endogenous codon usage found in a particular heterologous cell selected for expression.
  • a nucleotide change may alter the G+C content within the open reading frame to better match the average G+C content of open reading frames found in endogenous nucleic acid sequence present in the heterologous host cell.
  • a nucleotide change may also alter a polymononucleotide region or an internal regulatory or structural site found within a protein sequence.
  • nucleic acid sequences providing increased expression of a fusion protein in a prokaryotic cell; yeast cell; insect cell; and in a mammalian cell.
  • a nucleic acid encoding a PCSK9-GAA fusion protein suitable for the present invention comprises a nucleotide sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:14.
  • a nucleic acid encoding a Naglu-PCSK9 fusion protein suitable for the present invention comprises a nucleotide sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:15.
  • a nucleic acid encoding a PCSK9 propeptided suitable for the present invention comprises a nucleotide sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:16.
  • a modified nucleic acid may or may not result in amino acid sequence alterations in a fusion protein. In the event there is amino acid alteration, such alteration typically does not substantially alter the biological activity of the protein.
  • a nucleic acid sequence encoding a fusion protein or auxiliary binding protein as described in the present application can be molecularly cloned (inserted) into a suitable vector for propagation or expression in a host cell.
  • a wide variety of expression vectors can be used to practice the present invention, including, without limitation, a prokaryotic expression vector; a yeast expression vector; an insect expression vector and a mammalian expression vector.
  • Exemplary vectors suitable for the present invention include, but are not limited to, viral based vectors (e.g., AAV based vectors, retrovirus based vectors, plasmid based vectors).
  • a nucleic acid encoding a fusion protein is operably linked to various regulatory sequences or elements.
  • regulatory sequences or elements may be incorporated in an expression vector suitable for the present invention.
  • exemplary regulatory sequences or elements include, but are not limited to, promoters, enhancers, repressors or suppressors, 5′ untranslated (or non-coding) sequences, introns, 3′ untranslated (or non-coding) sequences.
  • a “Promoter” or “Promoter sequence” is a DNA regulatory region capable of binding an RNA polymerase in a cell (e.g., directly or through other promoter bound proteins or substances) and initiating transcription of a coding sequence.
  • a promoter sequence is, in general, bound at its 3′ terminus by the transcription initiation site and extends upstream (5′ direction) to include the minimum number of bases or elements necessary to initiate transcription at any level.
  • the promoter may be operably associated with or operably linked to the expression control sequences, including enhancer and repressor sequences or with a nucleic acid to be expressed.
  • the promoter may be inducible.
  • the inducible promoter may be unidirectional or bio-directional.
  • the promoter may be a constitutive promoter.
  • the promoter can be a hybrid promoter, in which the sequence containing the transcriptional regulatory region is obtained from one source and the sequence containing the transcription initiation region is obtained from a second source.
  • Systems for linking control elements to coding sequence within a transgene are well known in the art (general molecular biological and recombinant DNA techniques are described in Sambrook, Fritsch, and Maniatis, Molecular Cloning: A Laboratory Manual , Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989, which is incorporated herein by reference).
  • Commercial vectors suitable for inserting a transgene for expression in various host cells under a variety of growth and induction conditions are also well known in the art.
  • a specific promoter may be used to control expression of the transgene in a mammalian host cell such as, but are not limited to, SR ⁇ -promoter (Takebe et al., Molec. and Cell. Bio.
  • the human CMV immediate early promoter Boshart et al., Cell 41:521-530 (1985); Foecking et al., Gene 45:101-105 (1986)
  • human CMV promoter the human CMV5 promoter
  • the murine CMV immediate early promoter the EF1- ⁇ -promoter
  • a hybrid CMV promoter for liver specific expression e.g., made by conjugating CMV immediate early promoter with the transcriptional promoter elements of either human ⁇ -1-antitrypsin (HAT) or albumin (HAL) promoter
  • promoters for hepatoma specific expression e.g., wherein the transcriptional promoter elements of either human albumin (HAL; about 1000 bp) or human ⁇ -1-antitrypsin (HAT, about 2000 bp) are combined with a 145 long enhancer element of human ⁇ -1-microglobulin and bikunin precursor gene (AMBP); HAL-AMBP and HAT-
  • the mammalian promoter is a constitutive promoter such as, but not limited to, the hypoxanthine phosphoribosyl transferase (HPTR) promoter, the adenosine deaminase promoter, the pyruvate kinase promoter, the beta-actin promoter as well as other constitutive promoters known to those of ordinary skill in the art.
  • HPTR hypoxanthine phosphoribosyl transferase
  • the adenosine deaminase promoter the pyruvate kinase promoter
  • beta-actin promoter as well as other constitutive promoters known to those of ordinary skill in the art.
  • a specific promoter may be used to control expression of a transgene in a prokaryotic host cell such as, but are not limited to, the ⁇ -lactamase promoter (Villa- Komaroff et al., Proc. Natl. Acad. Sci. USA 75:3727-3731 (1978)); the tac promoter (DeBoer et al., Proc. Natl. Acad. Sci.
  • the T7 promoter, the T3 promoter, the M13 promoter or the M16 promoter in a yeast host cell such as, but are not limited to, the GAL1, GAL4 or GAL10 promoter, the ADH (alcohol dehydrogenase) promoter, PGK (phosphoglycerol kinase) promoter, alkaline phosphatase promoter, glyceraldehyde-3-phosphate dehydrogenase III (TDH3) promoter, glyceraldehyde-3-phosphate dehydrogenase II (TDH2) promoter, glyceraldehyde-3-phosphate dehydrogenase I (TDH1) promoter, pyruvate kinase (PYK), enolase (ENO), or triose phosphate isomerase (TPI).
  • GAL1, GAL4 or GAL10 promoter in a yeast host cell
  • ADH alcohol dehydrogenase
  • PGK
  • the promoter may be a viral promoter, many of which are able to regulate expression of a transgene in several host cell types, including mammalian cells.
  • Viral promoters that have been shown to drive constitutive expression of coding sequences in eukaryotic cells include, for example, simian virus promoters, herpes simplex virus promoters, papilloma virus promoters, adenovirus promoters, human immunodeficiency virus (HIV) promoters, Rous sarcoma virus promoters, cytomegalovirus (CMV) promoters, the long terminal repeats (LTRs) of Moloney murine leukemia virus and other retroviruses, the thymidine kinase promoter of herpes simplex virus as well as other viral promoters known to those of ordinary skill in the art.
  • simian virus promoters include, for example, simian virus promoters, herpes simplex virus promoters, papill
  • the gene control elements of an expression vector may also include 5′ non-transcribing and 5′ non-translating sequences involved with the initiation of transcription and translation, respectively, such as a TATA box, capping sequence, CAAT sequence, Kozak sequence and the like.
  • Enhancer elements can optionally be used to increase expression levels of a polypeptide or protein to be expressed. Examples of enhancer elements that have been shown to function in mammalian cells include the SV40 early gene enhancer, as described in Dijkema et al., EMBO J.
  • LTR long terminal repeat
  • RSV Rous Sarcoma Virus
  • Genetic control elements of an expression vector will also include 3′ non-transcribing and 3′non-translating sequences involved with the termination of transcription and translation. Respectively, such as a poly polyadenylation (polyA) signal for stabilization and processing of the 3′ end of an mRNA transcribed from the promoter.
  • Poly A signals included, for example, the rabbit beta globin polyA signal, bovine growth hormone polyA signal, chicken beta globin terminator/polyA signal, or SV40 late polyA region.
  • Expression vectors will preferably but optionally include at least one selectable marker.
  • the selectable maker is a nucleic acid sequence encoding a resistance gene operably linked to one or more genetic regulatory elements, to bestow upon the host cell the ability to maintain viability when grown in the presence of a cyctotoxic chemical and/or drug.
  • a selectable agent may be used to maintain retention of the expression vector within the host cell.
  • the selectable agent is may be used to prevent modification (i.e. methylation) and/or silencing of the transgene sequence within the expression vector.
  • a selectable agent is used to maintain episomal expression of the vector within the host cell.
  • an agent and/or resistance gene may include, but is not limited to, methotrexate (MTX), dihydrofolate reductase (DHFR, U.S. Pat. Nos. 4,399,216; 4,634,665; 4,656,134; 4,956,288; 5,149,636; 5,179,017, ampicillin, neomycin (G418), zeomycin, mycophenolic acid, or glutamine synthetase (GS, U.S. Pat. Nos.
  • Expression vectors may be transfected, transformed or transduced into a host cell.
  • the terms “transfection,” “transformation” and “transduction” all refer to the introduction of an exogenous nucleic acid sequence into a host cell.
  • expression vectors containing nucleic acid sequences encoding a fusion therapeutic glycoprotein is transfected, transformed or transduced into a host cell.
  • one or more expression vectors containing nucleic acid sequences encoding a fusion therapeutic glycoprotein are transfected, transformed or transduced into a host cell sequentially.
  • a vector encoding a first fusion therapeutic glycoprotein protein may be transfected, transformed or transduced into a host cell, followed by the transfection, transformation or transduction of a vector encoding a second fusion therapeutic glycoprotein, and vice versa.
  • transformation, transfection and transduction methods examples include liposome delivery, i.e., LipofectamineTM (Gibco BRL) Method of Hawley-Nelson, Focus 15:73 (1193), electroporation, CaPO 4 delivery method of Graham and van der Erb, Virology, 52:456-457 (1978), DEAE-Dextran medicated delivery, microinjection, biolistic particle delivery, polybrene mediated delivery, cationic mediated lipid delivery, transduction, and viral infection, such as, e.g., retrovirus, lentivirus, adenovirus adeno-associated virus and Baculovirus (Insect cells).
  • liposome delivery i.e., LipofectamineTM (Gibco BRL) Method of Hawley-Nelson, Focus 15:73 (1193), electroporation, CaPO 4 delivery method of Graham and van der Erb, Virology, 52:456-457 (1978), DEAE-Dextran medicated delivery, microinjection, bio
  • expression vectors may be integrated stably in the genome or exist as extra-chromosomal constructs. Vectors may also be amplified and multiple copies may exist or be integrated in the genome.
  • cells of the invention may contain 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more copies of nucleic acids encoding a fusion therapeutic glycoprotein.
  • cells of the invention may contain multiple copies (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more) of nucleic acids encoding one or more fusion therapeutic glycoproteins.
  • Any mammalian cell or cell type susceptible to cell culture, and to expression of polypeptides, may be utilized in accordance with the present invention as a host cell.
  • mammalian cells that may be used in accordance with the present invention include HT1080 cells (Rasheed S, Nelson-Rees W A, Toth E M, Arnstein P, Gardner M B. Characterization of a newly derived human sarcoma cell line (HT1080).
  • mice sertoli cells TM4, Mather, Biol. Reprod., 23:243-251 (1980)); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1 587); human cervical carcinoma cells (HeLa, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N.Y. Acad.
  • a suitable mammalian cell is not a endosomal acidification-deficient cell.
  • hybridoma cell lines that express polypeptides or proteins may be utilized in accordance with the present invention.
  • hybridoma cell lines might have different nutrition requirements and/or might require different culture conditions for optimal growth and polypeptide or protein expression, and will be able to modify conditions as needed.
  • Non-limiting examples of non-mammalian host cells and cell lines that may be used in accordance with the present invention include cells and cell lines derived from Pichia pastoris, Pichia methanolica, Pichia angusta, Schizosacccharomyces pombe, Saccharomyces cerevisiae , and Yarrowia lipolytica for yeast; Sodoptera frugiperda, Trichoplusis ni, Drosophila melangoster and Manduca sexta for insects; and Escherichia coli, Salmonella typhimurium, Bacillus subtilis, Bacillus lichenifonnis, Bacteroides fragilis, Clostridia perfringens, Clostridia difficile for bacteria; and Xenopus Laevis from amphibian.
  • transgenic nonhuman mammals have been shown to produce therapeutic glycoproteins (e.g., lysosomal enzymes) in their milk.
  • Such transgenic nonhuman mammals may include mice, rabbits, goats, sheep, porcines or bovines. See U.S. Pat. Nos. 6,118,045 and 7,351,410, each of which are hereby incorporated by reference in their entirety.
  • Any and all methods suitable for producing recombinant protein can be used to produce therapeutic protein of the present invention.
  • the present invention further provides pharmaceutical compositions containing targeted therapeutics according to the present invention.
  • suitable pharmaceutical compositions contain at least one pharmaceutically acceptable excipient and are formulated for administration to humans.
  • compositions provided herein may be provided in a sterile injectable form (e.g., a form that is suitable for subcutaneous, intravenous, or intrathecal injection).
  • a sterile injectable form e.g., a form that is suitable for subcutaneous, intravenous, or intrathecal injection.
  • pharmaceutical compositions are provided in a liquid dosage form that is suitable for injection.
  • pharmaceutical compositions are provided as powders (e.g., lyophilized and/or sterilized), optionally under vacuum, which are reconstituted with an aqueous diluent (e.g., water, buffer, salt solution, etc.) prior to injection.
  • an aqueous diluent e.g., water, buffer, salt solution, etc.
  • compositions are diluted and/or reconstituted in water, sodium chloride solution, sodium acetate solution, benzyl alcohol solution, phosphate buffered saline, etc.
  • powder should be mixed gently with the aqueous diluent (e.g., not shaken).
  • provided pharmaceutical compositions comprise one or more pharmaceutically acceptable excipients (e.g., preservative, inert diluent, dispersing agent, surface active agent and/or emulsifier, buffering agent, etc.).
  • pharmaceutical compositions comprise one or more preservatives.
  • pharmaceutical compositions comprise no preservative.
  • compositions of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology.
  • such preparatory methods include the step of bringing active ingredient into association with one or more excipients and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping and/or packaging the product into a desired single- or multi-dose unit.
  • a pharmaceutical composition in accordance with the invention may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
  • a “unit dose” is discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
  • the amount of the active ingredient is generally equal to a dose which would be administered to a subject and/or a convenient fraction of such a dose such as, for example, one-half or one-third of such a dose.
  • Relative amounts of active ingredient, pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition in accordance with the invention may vary, depending upon the identity, size, and/or condition of the subject treated and/or depending upon the route by which the composition is to be administered.
  • the composition may comprise between 0.1% and 100% (w/w) active ingredient.
  • compositions of the present invention may additionally comprise a pharmaceutically acceptable excipient, which, as used herein, may be or comprise solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
  • a pharmaceutically acceptable excipient which, as used herein, may be or comprise solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
  • Remington's The Science and Practice of Pharmacy, 21st Edition, A. R. Gennaro, discloses various excipients used in formulating pharmaceutical compositions and known techniques for the preparation thereof.
  • Targeted therapeutics described herein can be administered by any appropriate route generally known in the art.
  • a targeted therapeutic or a pharmaceutical composition containing the same is administered systemically.
  • Systemic administration may be intravenous, intramuscular, intradermal, by inhalation, transdermal (topical), intraocular, subcutaneous, oral and/or transmucosal.
  • a targeted therapeutics or a pharmaceutical composition containing the same is administered by intramuscular injection.
  • a targeted therapeutics or a pharmaceutical composition containing the same is administered subcutaneously.
  • Administration may be performed by injecting a composition into areas including, but not limited to, the thigh region, abdominal region, gluteal region, or scapular region.
  • a targeted therapeutics or a pharmaceutical composition containing the same is administered intravenously.
  • a targeted therapeutics or a pharmaceutical composition containing the same is administered orally. More than one route can be used concurrently, if desired. All of the administration routes disclosed herein are generally known in the art, and the skilled artisan would know how to administer targeted therapeutics of the present invention by these routes.
  • compositions according to the present invention can be used for CNS delivery via various techniques and routes including, but not limited to, intraparenchymal, intracerebral, intravetricular cerebral (ICV), intrathecal (e.g., IT-Lumbar, IT-cisterna magna) administrations and any other techniques and routes for injection directly or indirectly to the CNS and/or CSF.
  • intraparenchymal intracerebral
  • intrathecal e.g., IT-Lumbar, IT-cisterna magna
  • compositions according to the present invention can be used for intrathecal administration.
  • intrathecal administration also referred to as intrathecal injection or intrathecal delivery
  • intrathecal injection or intrathecal delivery refers to an injection into the spinal canal (intrathecal space surrounding the spinal cord).
  • Various formulations for intrathecal administration are described in WO/2011/163652, the contents of which are incorporated herein by reference.
  • a pharmaceutical composition containing a targeted therapeutics may be injected at any region surrounding the spinal canal.
  • a pharmaceutical composition containing a targeted therapeutics is injected into the lumbar area or the cisterna magna or intraventricularly into a cerebral ventricle space.
  • the term “lumbar region” or “lumbar area” refers to the area between the third and fourth lumbar (lower back) vertebrae and, more inclusively, the L2-S1 region of the spine.
  • intrathecal injection via the lumbar region or lumber area is also referred to as “lumbar IT delivery” or “lumbar IT administration.”
  • a device for intrathecal administration contains a fluid access port (e.g., injectable port); a hollow body (e.g., catheter) having a first flow orifice in fluid communication with the fluid access port and a second flow orifice configured for insertion into spinal cord; and a securing mechanism for securing the insertion of the hollow body in the spinal cord.
  • a suitable securing mechanism contains one or more nobs mounted on the surface of the hollow body and a sutured ring adjustable over the one or more nobs to prevent the hollow body (e.g., catheter) from slipping out of the spinal cord.
  • the fluid access port comprises a reservoir.
  • the fluid access port comprises a mechanical pump (e.g., an infusion pump).
  • an implanted catheter is connected to either a reservoir (e.g., for bolus delivery), or an infusion pump.
  • the fluid access port may be implanted or external
  • intrathecal administration may be performed by either lumbar puncture (i.e., slow bolus) or via a port-catheter delivery system (i.e., infusion or bolus).
  • the catheter is inserted between the laminae of the lumbar vertebrae and the tip is threaded up the thecal space to the desired level (generally L3-L4).
  • formulations of the invention can be formulated in liquid solutions.
  • the enzyme may be formulated in solid form and re-dissolved or suspended immediately prior to use. Lyophilized forms are also included.
  • the injection can be, for example, in the form of a bolus injection or continuous infusion (e.g., using infusion pumps) of the enzyme.
  • the present invention may be used to effectively treat Pompe Disease, Sanfilippo Syndrome Type B and other lysosomal storage diseases.
  • Pompe disease or Glycogen Storage Disease Type II, is an autosomal recessive metabolic disorder resulting from a deficiency or dysfunction of the lysosomal hydrolase acid alpha-glucosidase (GAA).
  • GAA lysosomal hydrolase acid alpha-glucosidase
  • GAA is localized to lysosomes and plays an important role in the catabolism of glycogen into glucose. In the absence of the enzyme, these glycogen accumulates within the cells, ultimately causing engorgement, followed by cellular death and tissue destruction. Due the widespread expression of the enzyme, multiple cell types and organ systems are affected in Pompe patients.
  • Pompe disease is characterized by a degeneration within the peripheral tissues of the body.
  • glycogen build-up results in progressive muscle weakness (myopathy) throughout the body, specifically affecting the tissues of the heart, skeletal muscles, as well as liver and kidneys.
  • Typical findings are those of enlarged heart with non-specific conduction defects, along with several indicators of kidney disease, such as high levels of serum creatine kinase, aldolase, aspartate transaminase and lactic dehydrogenase.
  • the disease typically manifests itself in the first several month of life, with cardiomegaly, hypotonia, cardiomyopathy, respiratory distress and muscle weakness.
  • Some affected individuals experience a progressive loss of skeletal muscle, cardiac or kidney function, with most affected individuals dying of disease-associated complications in their first or second decade.
  • Sanfilippo Syndrome Type B (San B), or Mucopolysaccharidosis III B (MPS III B)
  • MGS III B Mucopolysaccharidosis III B
  • Naglu is localized to lysosomes and plays an important role in the catabolism of glycosaminoglycans (GAGs) heparan- and dermatan-sulfate. In the absence of enzyme, these substrates accumulate within cells, ultimately causing engorgement, followed by cellular death and tissue destruction. Due to the widespread expression of Naglu, multiple cell types and organ systems are affected in MPS III B patients.
  • a defining clinical feature of San B is central nervous system (CNS) degeneration, however, which typically results in cognitive impairment (e.g., decrease in IQ).
  • CNS central nervous system
  • MRI scans of affected individuals have revealed white matter lesions, dilated perivascular spaces in the brain parenchyma, ganglia, corpus callosum, and brainstem; atrophy; and ventriculomegaly (Wang et al. Molecular Genetics and Metabolism, 2009).
  • the disease typically manifests itself in the first years of life with organomegaly and skeletal abnormalities. Some affected individuals experience a progressive loss of cognitive function, with most affected individuals dying of disease-associated complications in their first or second decade.
  • compositions and methods of the present invention may be used to effectively treat individuals suffering from or susceptible to Pompe Disease or San B.
  • treat or “treatment,” as used herein, refer to amelioration of one or more symptoms associated with the disease, prevention or delay of the onset of one or more symptoms of the disease, and/or lessening of the severity or frequency of one or more symptoms of the disease.
  • treatment refers to partial or complete alleviation, amelioration, relief, inhibition, delay of onset, reduction of severity and/or incidence of impairment in a Pompe Disease or San B patient.
  • the term “impairment” includes various symptoms in various organ systems commonly associated with Pompe Disease and/or San B (e.g., in the brain and spinal cord or skeletal or heart muscle).
  • Symptoms of neurological impairment may include, for example, e.g., cognitive impairment; white matter lesions; dilated perivascular spaces in the brain parenchyma, ganglia, corpus callosum, and/or brainstem; atrophy; and/or ventriculomegaly, among others.
  • Symptoms often associated with Pompe Disease include, for example, weakness of skeletal muscle and heart failure and respiratory weakness.
  • a suitable control is a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control individual (or multiple control individuals) in the absence of the treatment described herein.
  • a “control individual” is an individual afflicted with a lysosomal storage disease (e.g., San B, Pompe Disease), who is about the same age and/or gender as the individual suffering from the same lysosmal storage disease, who is being treated (to ensure that the stages of the disease in the treated individual and the control individual(s) are comparable).
  • a lysosomal storage disease e.g., San B, Pompe Disease
  • the individual (also referred to as “patient” or “subject”) being treated is an individual (fetus, infant, child, adolescent, or adult human) having a lysosomal storage disease or having the potential to develop a lysosmal storage disease.
  • the lysosmal storage disease is Pompe Disease or Sanfilippo Syndrome.
  • the lysosomal storage disease is San B.
  • the individual can have residual endogenous GAA or Naglu expression and/or activity, or no measurable activity.
  • the individual having Pompe Disease may have GAA expression levels that are less than about 30-50%, less than about 25-30%, less than about 20-25%, less than about 15-20%, less than about 10-15%, less than about 5-10%, less than about 0.1-5% of normal GAA expression levels.
  • the individual having San B may have Naglu expression levels that are less than about 30-50%, less than about 25-30%, less than about 20-25%, less than about 15-20%, less than about 10-15%, less than about 5-10%, less than about 0.1-5% of normal Naglu expression levels.
  • the individual is an individual who has been recently diagnosed with the disease.
  • early treatment treatment commencing as soon as possible after diagnosis
  • the present invention provides, among other things, methods and compositions for lysosomal targeting of a therapeutic protein (e.g. a lysosmal enzyme) based on a lysosomal targeting moiety.
  • a therapeutic protein e.g. a lysosmal enzyme
  • the current example discloses a general method for producing one or more targeted therapeutic proteins, by generating a translational fusion protein between a lysosmal enzyme and a lysosomal targeting moiety.
  • one or more auxiliary proteins may also be produced to form a protein complex with the lysosmal targeting moiety.
  • lysosomal enzymes acid alpha-glucosidase (GAA) and N-acetylglucosaminidase (Naglu) were chosen as candidate proteins, since it has been demonstrated that deficiency of each individual protein plays a central role in the development of Pompe disease and Sanpfilippo Syndrome (Mucopolysaccharidosis III) Type B, respectively.
  • GAA acid alpha-glucosidase
  • Naglu N-acetylglucosaminidase
  • suitable fusion therapeutics of the current invention facilitate cellular uptake and lysosomal targeting and have an enzyme activity substantially similar to the native enzyme.
  • a lysosomal targeting moiety may be associated with a suitable therapeutic enzyme (e.g., lysosomal enzyme) covalently or non-covalently.
  • a lysosomal targeting moiety may be chemically conjugated to a therapeutic enzyme.
  • a lysosomal targeting moiety may be fused to a therapeutic enzyme as a fusion protein.
  • a lysosomal targeting moiety (lysosomal targeting moiety) may be coupled, and or bound, to an auxiliary protein, to form a protein complex.
  • a series of two constructs was created, each designed to express GAA or Naglu, fused to PCSK9.
  • PCSK9 is used as the representative lysosomal targeting moiety
  • any lysosomal targeting moiety such as, PC proteins, proteins with a CHRD domain, proteins capable of binding to low density lipoprotein receptor (LDLR), amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, or low density lipoprotein receptor-related protein 8 (Lrp8)) or fragment thereof, may be used.
  • LDLR low density lipoprotein receptor
  • APLP2 amyloid precursor-like protein 2
  • APP amyloid precursor protein
  • ARH autosomal recessive hypercholesterolemia
  • Lrp8 low density lipoprotein receptor-related protein 8
  • An exemplary PCSK9-GAA fusion protein comprising S386A and F379A point mutations was created by connecting a nucleid acid encoding PCSK9 comprising S386A and F379A point mutations to a nucleic acid encoding GAA via an intervening GlyGlyGly-encoding linker (SEQ ID NO:14).
  • the amino acid sequence resulting from the ranslation of (SEQ ID NO:14) is shown below (SEQ ID NO:17).
  • An exemplary Naglu-PCSK9 fusion protein comprising S386A and F379A point mutations was created by connecting a nucleic acid encoding Naglu to a nucleic acid encoding PCSK9 comprising S386A and F379A point mutations via an intervening GlyGlyGly-encoding linker (SEQ ID NO:15).
  • SEQ ID NO:15 The amino acid sequence resulting from the translation of (SEQ ID NO:15) is shown below (SEQ ID NO:18).
  • auxiliary protein was created by generating a nucleic acid encoding PCSK9 signal peptide and PCSK9 propeptide (SEQ ID NO:16).
  • SEQ ID NO:16 The amino acid sequence resulting from the translation of (SEQ ID NO:16) is shown below (SEQ ID NO:19).
  • An exemplary Sig/Pro-PCSK9-GAA fusion protein comprising S386A and F379A point mutations was created by connecting a nucleic acid encoding PCSK9 comprising S386A and F379A point mutations to a nucleic acid encoding GAA via an intervening GlyGlyGly-encoding linker.
  • the amino acid sequence resulting from the translation of this DNA is shown below (SEQ ID NO:20).
  • PCSK9 propeptide is in italics.
  • the amino acid sequence of a Furin proteolytic cleavage site is bolded and underlined.
  • the amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold) is not underlined, bold or in italics.
  • the amino acid sequence of the GlyGlyGly linker is underlined.
  • the amino acid sequence of Mature Form GAA Protein (aa70-952) is bold and in italics.
  • Nucleic acids encoding a fusion protein and an auxiliary protein can be individually subcloned into mammalian expression vectors of choice. These expression constructs may then be transfected into a human cell line, and the cell line may be screened to generate over-expressing cell clones. To produce functional targeted therapeutics, a fusion protein is co-espressed with an auxiliary protein, for example PCSK9 propeptide, to ensure proper association between the two, which ensures endocytosis of the complex.
  • an auxiliary protein for example PCSK9 propeptide
  • SEQ ID NO:17-19 are amino acid sequences which still contain the amino acids of PCSK9 or Naglu N-terminal signal peptides. These signal peptides are typically removed during intracellular processing and and are typically not present in the final targeted therapeutic drug product. Below are depitcted the amino acid sequences of targeted therapeutics resulting from, in order, expression of proteins defined by SEQ ID NO:17-19:
  • SEQ ID NO:20 is an amino acid sequences which still contains the amino acids of the PCSK9 N-terminal signal peptide and propeptide. It is envisioned that the signal peptide is typically removed during intracellular processing and is typically not present in the final targeted therapeutic drug product.
  • the Furin proteolytic cleavage site will be cleaved intracellularly and the fusion comprising PCSK9 and GAA will form a complex with the released propeptide.
  • recombinant protein may be produced in a wave bioreactor, using a mammalian cell culture expressing system. Following expression, protein/protein complexes may be purified using conventional protein purification methods.
  • each fusion protein can be evaluated for proper function, by examining its specific activity and enzyme kinetics using a well-defined cleavable substrate. Based on this analysis, PSK9-GAA- and Naglu-PCSK9 binding constants and specificity for the enzyme substrate can be compared to each respective wildtype lysosomal enzyme, to ensure enzyme function is similar to the native protein.
  • SPR surface plasmone resonance
  • the binding protein (such as, but not limited to this listed in Table 6 below) serving as “ligand” are diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system.
  • the PCSK9-GAA or Naglu-PCSK9 protein, serving as “ligand” are diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system.
  • a solution containing the binding proteins (such as, but not limited to this listed in Table 6 below), serving as the “analyte,” is then injected into the device.
  • a solution containing PCSK9-GAA or Naglu-PCSK9, serving as the “ligand” is injected into the microflow system and run over surface to bind the antibody to form a “capture complex.”
  • a solution containing binding protein, serving as the “analyte,” is then injected into the device.
  • a “capturing molecule,” such as anti-binding protein antibody, is diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system.
  • a solution containing recombinant “binding protein” (such as, but not limited to, those listed in Table 6 below), serving as the “ligand,” is injected into the microflow system and run over surface to bind the antibody to form a “capture complex.”
  • a solution containing purified PCSK9-GAA or Naglu-PCSK9 protein, serving as the “analyte,” is then injected into the device.
  • the analyte binds to the ligant and/or capture complex, and an increase in SPR signal (expressed in response units, RU) is observed.
  • a solution without the analyte is injected into the microfluidic device, resulting in dissociation of the interaction between analyte and ligant and/or capture complex, inn turn resulting in a decrease in SPR signal.
  • LDLR Low Density Lipoprotein Receptor
  • APLP Amyloid Precursor-like Protein 2
  • APP Dynamin Amyloid Precursor Protein
  • ARH Autosomal Recessive Hypercholesterolemia
  • a competitive inhibition study may also be performed using a SPR assay.
  • a purified protein comprising one or more human CHRD domains referred to as an “inhibitor protein”
  • an antibody that binds to the PCSK9 binding site on the human LDLR referred to as an “LDLR blocker”
  • LDLR blocker an antibody that binds to the PCSK9 binding site on the human LDLR
  • anti-binding protein antibody the “capturing molecule” is diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system.
  • a solution containing recombinant protein such as, but not limited to, amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, and low density lipoprotein receptor-related protein 8 (Lrp8)
  • LDLR low density lipoprotein receptor-related protein 8
  • a solution containing purified Naglu-PCSK9 or PCSK9-GAA protein with or without 20 ⁇ M inhibitor protein is injected into the device and analyzed for binding.
  • a solution without the analyte is injected into the microfluidic device, dissociating any possible interaction between the analyte and the capture complex, and resulting in a decrease in SPR signal.
  • the experimental conditions used for the assay are described in Table 8 below.
  • the inverse study can also be performed to evaluate competitive inhibition of Naglu-PCSK9 and PCSK9-GAA by an inhibitor protein or LDLR blocker (an antibody that blocks PCSK9 binding to the LDLR), in which the concentration of each PCSK9 fusion protein is held constant and assayed against varying concentrations of inhibitor protein or LDLR blocker.
  • inhibitor protein or LDLR blocker an antibody that blocks PCSK9 binding to the LDLR
  • anti-binding protein antibody “capturing molecule” is diluted in immobilization buffer and bound on the dextran surface of a SPR sensor chip housed in a microfluidic system.
  • a solution containing recombinant protein, serving as the “ligand,” is injected into the microflow system and run over surface to bind the antibody to form a “capture complex.”
  • a solution containing each purified PCSK9 fusion protein at 20 nM, along with 0-1.5 uM of inhibitor protein or LDLR blocker, is injected into the device and analyzed for binding.
  • a solution without the analyte is injected into the microfluidic device, dissociating any possible interaction between the analyte and the capture complex, and resulting in a decrease in SPR signal.
  • the experimental conditions for use in performing the assay are described in Table 9 below.
  • Example 4 teaches a general assay method that may be used to evaluate any lysosomal targeted therapeutic in accordance with the teachings of the instant application.
  • the cell line of choice for this assay is C2C12 cell, which is a mouse myoblast cell lines (Yaffe D.
  • C2C12 cell lines as described above, are treated with or without recombinant Naglu-PCSK9 or PCSK9-GAA which has been complexed with PPP. Following treatment, the cells are fixed and prepared for staining. Both control and treated cells are stained using antibodies specific for each lysosomal protein (GAA or Naglu) along with Lamp-1, a lysosome specific protein biomarker. Cells are assayed for cellular internalization of each fusion protein by immunofluroescent microscopy.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The invention provides compositions and methods for effective lysosomal targeting mediated by PCSK9. In particular, the compositions and methods provided by the invention may be used to treat lysosomal storage diseases such as Pompe Disease and Sanfilippo Syndrome Type B, and they may be used for targeting lysosomal enzymes to the various muscles of the human body.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS
This application is the U.S. National Stage Entry claiming priority and benefit to International Application PCT/US15/57214 filed on Oct. 23, 2015; which claims priority and benefit to U.S. Provisional Application No. 62/068,033 filed Oct. 24, 2014, the disclosures of each of which are hereby incorporated by reference in their entireties for all purposes.
BACKGROUND
More than forty lysosomal storage diseases are caused, directly or indirectly, by the absence or deficiency of one or more lysosomal enzymes.
Pompe disease is a lysosomal storage disease caused by a deficiency or dysfunction of the lysosomal hydrolase acid alpha-glucosidase (GAA), a glycogen-degrading lysosomal enzyme. Deficiency of GAA results in lysosomal glycogen accumulation in many tissues, with cardiac and skeletal muscle tissues being most seriously affected. The combined incidence of all forms of Pompe disease is estimated to be 1:40,000. It is estimated that approximately one third of patients with Pompe disease have the rapidly progressive, fatal infantile-onset form, while the majority of patients present with the more slowly progressive, juvenile or late-onset forms.
Sanfilippo syndrome, or mucopolysaccharidosis III (MPS III), on the other hand, is a rare genetic disorder characterized by the deficiency of enzymes involved in the degradation of glycosaminoglycans (GAG). Four distinct forms of MPS III, designated MPS IIIA, B, C, and D, have been identified. Each is characterized by the absence or deficiency of a different lysosomal enzyme. Mucopolysaccharidosis type IIIB (MPS IIIB; Sanfilippo B disease) is an autosomal recessive disorder that is caused by a deficiency of the enzyme alpha-N-acetyl-glucosaminidase (Naglu), resulting in the accumulation of heparan sulfate in lysosomes of particularly neurons and glial cells in the brain, with additional lysosomal accumulation of heparan sulfate elsewhere. MPS IIIB manifests itself primarily in the brain.
Enzyme replacement therapy (ERT) has been used to deliver enzymes for the treatment of various lysosomal storage diseases. Normally, lysosomal enzymes are synthesized in the cytosol and then traverse the endoplasmic reticulum (ER), where they are glycosylated with N-linked, high mannose type carbohydrates. In the Golgi apparatus, high mannose carbohydrates on glycoproteins are then modified by a series of glycotransferases to become mature N-glycan; one of these modifications is the addition of mannose-6-phosphate (M6P). Proteins carrying this modification are then targeted to the lysosome via binding of the M6P moiety to the cation-independent mannose-6-phosphate receptor (CI-M6PR) and cation-dependant mannose-6-phoshate receptor (CD-M6PR).
Efficacy of enzyme replacement therapy is critically dependent on proper lysosomal targeting of the replacement enzyme. However, recombinantly produced Naglu protein is characterized by a dramatic lack of M6P phosphorylation, making lysosomal targeting of this enzyme and its effective use for ERT very difficult. Similarly, for some diseases, such as Pompe, enzyme replacement therapy has shown limitations, such as limited clinical benefit resulting from poor cellular uptake of recombinant enzyme in skeletal muscle and cardiac tissues of the body (Schoser et al., Neurotherapeutics 5:569-578 (2008)).
Therefore, there remains a need to develop alternative methods for lysosomal targeting to ensure effective enzyme replacement therapy.
SUMMARY
The present invention provides an alternative lysosomal targeting approach for enzyme replacement therapy that is more efficient, reliable and consistent. The present invention is, in part, based on the surprising discovery that a replacement enzyme can be effectively delivered to the lysosome through the use of a soluble extracellular protein, such as PCSK9, and its interaction with various secondary binding proteins, such as, but not limited to, amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein or low density lipoprotein receptor-related protein 8 (Lrp8). Thus, the present invention permits targeting of a therapeutic to a lysosome in a glycosylation or M6P-independent manner and can be used to deliver enzymes with low levels of glycosylation or even with complete absence of glycosylation. Accordingly, the present invention allows for simpler processes of manufacturing recombinant enzymes for enzyme replacement therapy. Since PCSK9 is ubiquitously expressed throughout the various tissues of the body, the invention provides an effective means for delivering replacement enzymes for diseases associated with the nervous system and/or other tissues inn the body. Furthermore, many of PCSK9's potential cognate transmembrane binding partners, i.e., APLP2 and Dynamin, are known to be enriched in human skeletal muscle and tissues of the kidney (The Human Protein Atlas; Uhlen et al. Nat Biotechnol. 2010 28(12):1248-50. Uhlén et al. Mol Cell Proteomics. 2005 4(12):1920-32. Pontén et al. J Pathol. 2008 216(4):387-93. Lundberg et al. Mol Syst Biol. 2010 6:450. Pontén et al. Mol Syst Biol. 2009 5:337), which means that the invention provides an effective means for treating lysosomal storage diseases that affect these tissues, such as Pompe disease.
In one aspect, the present invention provides a targeted therapeutic including a lysosomal enzyme and a lysosomal targeting moiety including a proprotein convertase protein or fragment thereof.
In some embodiments, the lysosomal enzyme is selected from Table 3.
In some embodiments, the lysosomal enzyme is an acid alpha-glucosidase (GAA) protein. In some embodiments, the GAA protein comprises an amino acid sequence at least 80%, 90%, or 95% identical to SEQ ID NO:1. In some embodiments, the GAA protein comprises an amino acid sequence identical to SEQ ID NO:1.
In some embodiments, the lysosomal enzyme is an alpha-N-acetylglucosaminidase (Naglu) protein. In some embodiments, the Naglu protein comprises an amino acid sequence at least 80%, 90%, or 95% identical to SEQ ID NO:4. In some embodiments, the Naglu protein comprises an amino acid sequence identical to SEQ ID NO:4.
In some embodiments, the proprotein convertase protein is selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9. In some embodiments, the proprotein convertase comprises an amino acid substitution selected from the group consisting of S386A, F379A and a combination thereof. In some embodiments, the proprotein convertase is a PCSK9 protein.
In some embodiments, the PCSK9 protein comprises an amino acid sequence at least 80%, 90% or 95% identical to SEQ ID NO:7. In some embodiments, the PCSK9 protein comprises an amino acid sequence is identical to SEQ ID NO:7.
In some embodiments, the targeted therapeutic is a fusion protein. In some embodiments, the lysosomal targeting moiety is fused to the N-terminus or C-terminus of the lysosomal enzyme. In some embodiments, the lysosomal targeting moiety and the lysosomal enzyme are fused via a linker. In some embodiments, the linker is a peptide linker. In some embodiments, the peptide linker comprises a cleavage site. In some embodiments, the cleavage site comprises a lysosomal protease recognition site. In some embodiments, the linker comprises a sequence of GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGG GAP (SEQ ID NO. 13). In some embodiments, the fusion protein comprises a sequence at least 80%, 90% or 95% identical to the amino acid sequence of SEQ ID NO. 21 or 22. In some embodiments, the fusion protein comprises a sequence identical to the amino acid sequence of SEQ ID NO. 21 or 22.
In some embodiments, the targeted therapeutic comprises an auxiliary propeptide derived from a proprotein convertase protein a fragment thereof. In some embodiments, the auxiliary propeptide is derived from a proprotein convertase protein selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9. In some embodiments, the auxiliary propeptide is derived from PCSK9. In some embodiments, the auxiliary propeptide comprises a sequence at least 80%, 90% or 95% identical to the amino acid sequence of SEQ ID NO. 23. In some embodiments, the auxiliary propeptide comprises a sequence identical to the amino acid sequence of SEQ ID NO. 23. In some embodiments, the targeted therapeutic has a higher binding affinity for Amyloid Precursor-like Protein 2 (APLP2), Dynamin, Amyloid Precursor Protein (APP), Autosomal Recessive Hypercholesterolemia (ARH) protein, or Low Density Lipoprotein Receptor-related Protein 8 (Lrp8), than for an LDL receptor. In some embodiments, the targeted therapeutic has a binding affinity for Amyloid Precursor-like Protein 2 (APLP2), Dynamin, Amyloid Precursor Protein (APP), Autosomal Recessive Hypercholesterolemia (ARH) protein, or Low Density Lipoprotein Receptor-related Protein 8 (Lrp8) that is at least 2, 3, 4, 5, 6, 7, 8, 9 or 10 fold higher than for an LDL receptor.
In one aspect, the present invention provides a nucleic acid encoding any of the proteins disclosed herein.
In one aspect, the present invention provides a vector including any of the nucleic acids disclosed herein.
In one aspect, the present invention provides a host cell including any of the vectors disclosed herein. In some embodiments, the host cell is selected from a bacterial, yeast, insect or mammalian cell. In some embodiments, the host cell is a mammalian cell. In some embodiments, the the mammalian cell is a human cell. In some embodiments, the mammalian cell is a CHO cell.
In one aspect, the present invention provides a method of producing a targeted therapeutic, the method including steps of a) culturing any of the host cells disclosed herein under conditions suitable for expression of the targeted therapeutic by the host cell; and b) harvesting the targeted therapeutic expressed by the host cell. In some embodiments, any of the fusion proteins disclosed herein and an auxiliary protein are cultured within the same host cell. In some embodiments, the fusion protein and the auxiliary protein are harvested from the host cell simultaneously.
In one aspect, the present invention provides a pharmaceutical composition comprising any of the targeted therapeutics disclosed herein, and a pharmaceutical acceptable carrier.
In one aspect, the present invention provides a method of treating a lysosomal storage disease including administering to a subject in need of treatment any of the pharmaceutical compositions disclosed herein. In some embodiments, the lysosomal storage disease is selected from Table 3. In some embodiments, the lysosomal storage disease is Pompe disease or Sanfilippo syndrome type B. In some embodiments, the pharmaceutical composition is administered intravenously, intramuscularly, subcutaneously, intrathecally and/or combinations thereof.
In one aspect, the present invention provides a method of delivering a targeted therapeutic to skeletal muscle, vascular smooth muscle or cardiac muscle, including administering to a subject in need of treatment any of the pharmaceutical compositions disclosed herein. In some embodiments, this composition includes a targeted therapeutic that is the fusion protein of SEQ ID NO. 21 or 22.
Definitions
In order for the present invention to be more readily understood, certain terms are first defined below. Additional definitions for the following terms and other terms are set forth throughout the specification.
Approximately or about: As used herein, the term “approximately” or “about,” as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term “approximately” or “about” refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
Amelioration: As used herein, the term “amelioration” is meant the prevention, reduction or palliation of a state, or improvement of the state of a subject. Amelioration includes, but does not require complete recovery or complete prevention of a disease condition. In some embodiments, amelioration includes increasing levels of relevant protein or its activity that is deficient in relevant disease tissues.
Amino acid: As used herein, term “amino acid,” in its broadest sense, refers to any compound and/or substance that can be incorporated into a polypeptide chain. In some embodiments, an amino acid has the general structure H2N—C(H)(R)—COOH. In some embodiments, an amino acid is a naturally occurring amino acid. In some embodiments, an amino acid is a synthetic amino acid; in some embodiments, an amino acid is a d-amino acid; in some embodiments, an amino acid is an 1-amino acid. “Standard amino acid” refers to any of the twenty standard 1-amino acids commonly found in naturally occurring peptides. “Nonstandard amino acid” refers to any amino acid, other than the standard amino acids, regardless of whether it is prepared synthetically or obtained from a natural source. As used herein, “synthetic amino acid” encompasses chemically modified amino acids, including but not limited to salts, amino acid derivatives (such as amides), and/or substitutions. Amino acids, including carboxy- and/or amino-terminal amino acids in peptides, can be modified by methylation, amidation, acetylation, protecting groups, and/or substitution with other chemical groups that can change the peptide's circulating half-life without adversely affecting their activity. Amino acids may participate in a disulfide bond. Amino acids may comprise one or posttranslational modifications, such as association with one or more chemical entities (e.g., methyl groups, acetate groups, acetyl groups, phosphate groups, formyl moieties, isoprenoid groups, sulfate groups, polyethylene glycol moieties, lipid moieties, carbohydrate moieties, biotin moieties, etc.). The term “amino acid” is used interchangeably with “amino acid residue,” and may refer to a free amino acid and/or to an amino acid residue of a peptide. It will be apparent from the context in which the term is used whether it refers to a free amino acid or a residue of a peptide.
Animal: As used herein, the term “animal” refers to any member of the animal kingdom. In some embodiments, “animal” refers to humans, at any stage of development. In some embodiments, “animal” refers to non-human animals, at any stage of development. In certain embodiments, the non-human animal is a mammal (e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, and/or a pig). In some embodiments, animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, insects, and/or worms. In some embodiments, an animal may be a transgenic animal, genetically-engineered animal, and/or a clone.
Biologically active: As used herein, the phrase “biologically active” refers to a characteristic of any agent that has activity in a biological system, and particularly in an organism. For instance, an agent that, when administered to an organism, has a biological effect on that organism, is considered to be biologically active. In particular embodiments, where a protein or polypeptide is biologically active, a portion of that protein or polypeptide that shares at least one biological activity of the protein or polypeptide is typically referred to as a “biologically active” portion.
Cation-independent mannose-6-phosphate receptor (CI-M6PR): As used herein, the term “cation-independent mannose-6-phosphate receptor (CI-M6PR)” refers to a cellular receptor that binds mannose-6-phosphate (M6P) tags on acid hydrolase precursors in the Golgi apparatus that are destined for transport to the lysosome. In addition to mannose-6-phosphates, the CI-M6PR also binds other proteins including IGF-II. The CI-M6PR is also known as “M6P/IGF-II receptor”, “CI-M6PR/IGF-II receptor”, “CD222”, “MPR300”, “IGF-II receptor” or “IGF2 Receptor.” These terms and abbreviations thereof are used interchangeably herein.
Cell culture: These terms as used herein refer to a cell population that is gown in a medium under conditions suitable to survival and/or growth of the cell population. As will be clear to those of ordinary skill in the art, these terms as used herein may refer to the combination comprising the cell population and the medium in which the population is grown.
Diluent: As used herein, the term “diluent” refers to a pharmaceutically acceptable (e.g., safe and non-toxic for administration to a human) diluting substance useful for the preparation of a reconstituted formulation. Exemplary diluents include sterile water, bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
Dosing regimen: A “dosing regimen” (or “therapeutic regimen”), as that term is used herein, is a set of unit doses (typically more than one) that are administered individually to a subject, typically separated by periods of time. In some embodiments, a given therapeutic agent has a recommended dosing regimen, which may involve one or more doses. In some embodiments, a dosing regimen comprises a plurality of doses each of which are separated from one another by a time period of the same length; in some embodiments, a dosing regimen comprises a plurality of doses and at least two different time periods separating individual doses.
Enzyme replacement therapy (ERT): As used herein, the term “enzyme replacement therapy (ERT)” refers to any therapeutic strategy that corrects an enzyme deficiency by providing the missing enzyme. In some embodiments, the missing enzyme is provided by intrathecal administration. In some embodiments, the missing enzyme is provided by infusing into bloodsteam. Once administered, enzyme is taken up by cells and transported to the lysosome, where the enzyme acts to eliminate material that has accumulated in the lysosomes due to the enzyme deficiency. Typically, for lysosomal enzyme replacement therapy to be effective, the therapeutic enzyme is delivered to lysosomes in the appropriate cells in target tissues where the storage defect is manifest.
Expression: As used herein, “expression” of a nucleic acid sequence refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5′ cap formation, and/or 3′ end formation); (3) translation of an RNA into a polypeptide or protein; and/or (4) post-translational modification of a polypeptide or protein. In this application, the terms “expression” and “production,” and grammatical equivalent, are used interchangeably.
Fragment: The term “fragment” as used herein refers to polypeptides and is defined as any discrete portion of a given polypeptide that is unique to or characteristic of that polypeptide. The term as used herein also refers to any discrete portion of a given polypeptide that retains at least a fraction of the activity of the full-length polypeptide. Preferably the fraction of activity retained is at least 10% of the activity of the full-length polypeptide. More preferably the fraction of activity retained is at least 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90% of the activity of the full-length polypeptide. More preferably still the fraction of activity retained is at least 95%, 96%, 97%, 98% or 99% of the activity of the full-length polypeptide. Most preferably, the fraction of activity retained is 100% of the activity of the full-length polypeptide. The term as used herein also refers to any portion of a given polypeptide that includes at least an established sequence element found in the full-length polypeptide. Preferably, the sequence element spans at least 4-5, more preferably at least about 10, 15, 20, 25, 30, 35, 40, 45, 50 or more amino acids of the full-length polypeptide.
Gene: The term “gene” as used herein refers to any nucleotide sequence, DNA or RNA, at least some portion of which encodes a discrete final product, typically, but not limited to, a polypeptide, which functions in some aspect of a cellular process. The term is not meant to refer only to the coding sequence that encodes the polypeptide or other discrete final product, but may also encompass regions preceding and following the coding sequence that modulate the basal level of expression, as well as intervening sequences (“introns”) between individual coding segments (“exons”). In some embodiments, a gene may include regulatory sequences (e.g., promoters, enhancers, poly adenylation sequences, termination sequences, Kozac sequences, tata box, etc.) and/or modification sequences. In some embodiments, a gene may include references to nucleic acids that do not encode proteins but rather encode functional RNA molecules such as tRNAs, RNAi-inducing agents, etc.
Gene product or expression product: As used herein, the term “gene product” or “expression product” generally refers to an RNA transcribed from the gene (pre- and/or post-processing) or a polypeptide (pre- and/or post-modification) encoded by an RNA transcribed from the gene.
Genetic control element: The term “genetic control element” as used herein refers to any sequence element that modulates the expression of a gene to which it is operably linked. Genetic control elements may function by either increasing or decreasing the expression levels and may be located before, within or after the coding sequence. Genetic control elements may act at any stage of gene expression by regulating, for example, initiation, elongation or termination of transcription, mRNA splicing, mRNA editing, mRNA stability, mRNA localization within the cell, initiation, elongation or termination of translation, or any other stage of gene expression. Genetic control elements may function individually or in combination with one another.
Improve, increase, or reduce: As used herein, the terms “improve,” “increase” or “reduce,” or grammatical equivalents, indicate values that are relative to a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control subject (or multiple control subject) in the absence of the treatment described herein. A “control subject” is a subject afflicted with the same form of disease as the subject being treated, who is about the same age as the subject being treated.
In Vitro: As used herein, the term “in vitro” refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, etc., rather than within a multi-cellular organism.
In Vivo: As used herein, the term “in vivo” refers to events that occur within a multi-cellular organism, such as a human and a non-human animal. In the context of cell-based systems, the term may be used to refer to events that occur within a living cell (as opposed to, for example, in vitro systems).
Intrathecal administration: As used herein, the term “intrathecal administration” or “intrathecal injection” refers to an injection into the spinal canal (intrathecal space surrounding the spinal cord). Various techniques may be used including, without limitation, lateral cerebroventricular injection through a burrhole or cisternal or lumbar puncture or the like. In some embodiments, “intrathecal administration” or “intrathecal delivery” according to the present invention refers to IT administration or delivery via the lumbar area or region, i.e., lumbar IT administration or delivery. As used herein, the term “lumbar region” or “lumbar area” refers to the area between the third and fourth lumbar (lower back) vertebrae and, more inclusively, the L2-S1 region of the spine.
Linker: As used herein, the term “linker” refers to, in a fusion protein, an amino acid sequence other than that appearing at a particular position in the natural protein and is generally designed to be flexible or to interpose a structure, such as an a-helix, between two protein moieties. A linker is also referred to as a spacer.
Lysosomal enzyme: As used herein, the term “lysosomal enzyme” refers to any enzyme that is capable of reducing accumulated materials in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms. Lysosomal enzymes suitable for the invention include both wild-type or modified lysosomal enzymes and can be produced using recombinant and synthetic methods or purified from nature sources. Exemplary lysosomal enzymes are listed in Table 2.
Lysosomal enzyme deficiency: As used herein, “lysosomal enzyme deficiency” refers to a group of genetic disorders that result from deficiency in at least one of the enzymes that are required to break macromolecules (e.g., enzyme substrates) down to peptides, amino acids, monosaccharides, nucleic acids and fatty acids in lysosomes. As a result, individuals suffering from lysosomal enzyme deficiencies have accumulated materials in various tissues (e.g., CNS, liver, spleen, gut, blood vessel walls and other organs).
Lysosomal Storage Disease: As used herein, the term “lysosomal storage disease” refers to any disease resulting from the deficiency of one or more lysosomal enzymes necessary for metabolizing natural macromolecules. These diseases typically result in the accumulation of un-degraded molecules in the lysosomes, resulting in increased numbers of storage granules (also termed storage vesicles). These diseases and various examples are described in more detail below.
Nucleic acid: As used herein, the term “nucleic acid,” in its broadest sense, refers to any compound and/or substance that is or can be incorporated into a polynucleotide chain. In some embodiments, a nucleic acid is a compound and/or substance that is or can be incorporated into a polynucleotide chain via a phosphodiester linkage. In some embodiments, “nucleic acid” refers to individual nucleic acid residues (e.g., nucleotides and/or nucleosides). In some embodiments, “nucleic acid” refers to a polynucleotide chain comprising individual nucleic acid residues. In some embodiments, “nucleic acid” encompasses RNA as well as single and/or double-stranded DNA and/or cDNA. Furthermore, the terms “nucleic acid,” “DNA,” “RNA,” and/or similar terms include nucleic acid analogs, i.e., analogs having other than a phosphodiester backbone. For example, the so-called “peptide nucleic acids,” which are known in the art and have peptide bonds instead of phosphodiester bonds in the backbone, are considered within the scope of the present invention. The term “nucleotide sequence encoding an amino acid sequence” includes all nucleotide sequences that are degenerate versions of each other and/or encode the same amino acid sequence. Nucleotide sequences that encode proteins and/or RNA may include introns. Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, backbone modifications, etc. A nucleic acid sequence is presented in the 5′ to 3′ direction unless otherwise indicated. In some embodiments, a nucleic acid is or comprises natural nucleosides (e.g., adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine); nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, C-5 propynyl-cytidine, C-5 propynyl-uridine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, O(6)-methylguanine, and 2-thiocytidine); chemically modified bases; biologically modified bases (e.g., methylated bases); intercalated bases; modified sugars (e.g., 2′-fluororibose, ribose, 2′-deoxyribose, arabinose, and hexose); and/or modified phosphate groups (e.g., phosphorothioates and 5′-N-phosphoramidite linkages). In some embodiments, the present invention is specifically directed to “unmodified nucleic acids,” meaning nucleic acids (e.g., polynucleotides and residues, including nucleotides and/or nucleosides) that have not been chemically modified in order to facilitate or achieve delivery.
Patient: As used herein, the term “patient” or “subject” refers to any organism to which a provided composition may be administered, e.g., for experimental, diagnostic, prophylactic, cosmetic, and/or therapeutic purposes. Typical patients include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and/or humans). In some embodiments, a patient is a human. A human includes pre and post natal forms.
Pharmaceutically acceptable: The term “pharmaceutically acceptable” as used herein, refers to substances that, within the scope of sound medical judgment, are suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
Peptide: As used herein, a “peptide”, generally speaking, is a string of at least two amino acids attached to one another by a peptide bond. In some embodiments, a polypeptide may include at least 3-5 amino acids, each of which is attached to others by way of at least one peptide bond. Those of ordinary skill in the art will appreciate that peptides sometimes include “non-natural” amino acids or other entities that nonetheless are capable of integrating into a polypeptide chain, optionally. As used herein, the terms “polypeptide” and “peptide” are used interchangeably.
Protein: As used herein, the term “protein” of “therapeutic protein” refers to a polypeptide (i.e., a string of at least two amino acids linked to one another by peptide bonds). Proteins may include moieties other than amino acids (e.g., may be glycoproteins, proteoglycans, etc.) and/or may be otherwise processed or modified. Those of ordinary skill in the art will appreciate that a “protein” can be a complete polypeptide chain as produced by a cell (with or without a signal sequence), or can be a characteristic portion thereof. Those of ordinary skill will appreciate that a protein can sometimes include more than one polypeptide chain, for example linked by one or more disulfide bonds or associated by other means. Polypeptides may contain 1-amino acids, d-amino acids, or both and may contain any of a variety of amino acid modifications or analogs known in the art. Useful modifications include, e.g., terminal acetylation, amidation, methylation, etc. In some embodiments, proteins may comprise natural amino acids, non-natural amino acids, synthetic amino acids, and combinations thereof. The term “peptide” is generally used to refer to a polypeptide having a length of less than about 100 amino acids, less than about 50 amino acids, less than 20 amino acids, or less than 10 amino acids. In some embodiments, proteins are antibodies, antibody fragments, biologically active portions thereof, and/or characteristic portions thereof.
Recombinant protein and Recombinant polypeptide: These terms as used herein refer to a polypeptide expressed from a host cell, that has been genetically engineered to express that polypeptide. In some embodiments, a recombinant protein may be expressed in a host cell derived from an animal. In some embodiments, a recombinant protein may be expressed in a host cell derived from an insect. In some embodiments, a recombinant protein may be expressed in a host cell derived from a yeast. In some embodiments, a recombinant protein may be expressed in a host cell derived from a prokaryote. In some embodiments, a recombinant protein may be expressed in a host cell derived from an mammal. In some embodiments, a recombinant protein may be expressed in a host cell derived from a human. In some embodiments, the recombinantly expressed polypeptide may be identical or similar to a polypeptide that is normally expressed in the host cell. In some embodiments, the recombinantly expressed polypeptide may be foreign to the host cell, i.e. heterologous to peptides normally expressed in the host cell. Alternatively, in some embodiments the recombinantly expressed polypeptide can be a chimeric, in that portions of the polypeptide contain amino acid sequences that are identical or similar to polypeptides normally expressed in the host cell, while other portions are foreign to the host cell.
Subject: As used herein, the term “subject” refers to a human or any non-human animal (e.g., mouse, rat, rabbit, dog, cat, cattle, swine, sheep, horse or primate). A human includes pre- and post-natal forms. In many embodiments, a subject is a human being. A subject can be a patient, which refers to a human presenting to a medical provider for diagnosis or treatment of a disease. The term “subject” is used herein interchangeably with “individual” or “patient.” A subject can be afflicted with or is susceptible to a disease or disorder but may or may not display symptoms of the disease or disorder.
Target tissues: As used herein, the term “target tissues” refers to any tissue that is affected by the lysosomal storage disease to be treated or any tissue in which the deficient lysosomal enzyme is normally expressed. In some embodiments, target tissues include those tissues in which there is a detectable or abnormally high amount of enzyme substrate, for example stored in the cellular lysosomes of the tissue, in patients suffering from or susceptible to the lysosomal storage disease. In some embodiments, target tissues include those tissues that display disease-associated pathology, symptom, or feature. In some embodiments, target tissues include those tissues in which the deficient lysosomal enzyme is normally expressed at an elevated level. As used herein, a target tissue may be a brain target tissue, a spinal cord target tissue and/or a peripheral target tissue. Exemplary target tissues are described in detail below.
Treatment: As used herein, the term “treatment” (also “treat” or “treating”) refers to any administration of a therapeutic protein (e.g., lysosomal enzyme) that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of a particular disease, disorder, and/or condition (e.g., Hunters syndrome, Sanfilippo B syndrome). Such treatment may be of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition. Alternatively or additionally, such treatment may be of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition.
Therapeutically effective amount: As used herein, the term “therapeutically effective amount” of a therapeutic agent means an amount that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and/or condition, to treat, diagnose, prevent, and/or delay the onset of the symptom(s) of the disease, disorder, and/or condition. It will be appreciated by those of ordinary skill in the art that a therapeutically effective amount is typically administered via a dosing regimen comprising at least one unit dose.
DETAILED DESCRIPTION
The present invention provides, among other things, methods and compositions for lysosomal targeting of a therapeutic protein (e.g., a lysosomal enzyme) based on a lysosomal targeting moiety that comprises PCSK9 (proprotein convertase subtilisin kexin type 9). In some embodiments, the present invention provides a targeted therapeutic comprising a lysosomal enzyme and a lysosomal targeting moiety that binds to amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and/or Annexin A2.
Various aspects of the invention are described in further detail in the following subsections. The use of subsections is not meant to limit the invention. Each subsection may apply to any aspect of the invention. In this application, the use of “or” means “and/or” unless stated otherwise.
Lysosomal Enzymes
The present invention may be used to target any therapeutic protein to a lysosome. In particular, the present invention may be used to target a lysosomal enzyme to a lysosome for the treatment of a lysosomal storage disease. According to the present invention, a lysosomal enzyme is contemplated to encompass any enzyme or protein that, when targeted to the lysosome, is suitable for the treatment of a lysosomal storage disease. As non-limiting examples, particularly suitable lysosomal enzymes are acid alpha-glucosidase (GAA) protein, which is deficient in Pompe disease, and alpha-N-acetylglucosaminidase (Naglu) protein, which is deficient in Sanfilippo Syndrome Type B disease. Additional exemplary lysosomal enzymes are shown in Table 3.
GAA Protein
A suitable GAA protein according to the present invention can be any molecule that can substitute for naturally-occurring GAA protein activity or rescue one or more phenotypes or symptoms associated with GAA-deficiency. In some embodiments, a GAA protein suitable for the invention is a polypeptide having an N-terminus and C-terminus and an amino acid sequence substantially similar or identical to mature human GAA protein.
Typically, human GAA is produced as a precursor molecule that is processed to a mature form. This process generally occurs by removing the 27 amino acid signal peptide as the protein enters the endoplasmic reticulum. Typically, the precursor form including the 27 amino acid signal peptide is also referred to as Full-Length GAA protein, which contains 952 amino acids. The N-terminal 27 amino acids are cleaved as the Full-Length GAA protein enters the endoplasmic reticulum, resulting in the Precursor Form GAA Protein. The Precursor Form GAA Protein is then subsequently cleaved to remove a N-terminal propeptide sequence of 42 amino acids, to produce the Mature Form GAA protein (aa 70-952). Thus, it is contemplated that the N-terminal 27 amino acids that constitute the signal peptide and the N-terminal 42 amino acids that constitute the propeptide are generally not required for GAA protein activity. However, the use of the Full-Length GAA Protein (aa 1-952) and of the Precursor Form GAA Protein (aa 28-952) are also contemplated within the scope of the instant invention. The amino acid sequences of the Mature Form GAA Protein (SEQ ID NO:1); Precursor Form GAA Protein (SEQ ID NO:2) and Full-Length GAA Protein (SEQ ID NO:3) of a typical wild-type or naturally-occurring human GAA protein are shown in Table 1 below.
TABLE 1
Mature and Precursor GAA Protein
Mature Form GAA AHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMG
Protein QPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETEN
RLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVL
LNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAP
TPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDV
YIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTR
AHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAIS
SSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDFTNPTALAWWED
MVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAA
TICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRY
AGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQ
LGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAH
VAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGT
WYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIP
LQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFL
ARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTK
VLDICVSLLMGEQFLVSWC (SEQ ID NO: 1)
Precursor Form GHILLHDFLLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQAHPGRPRAVPTQ
GAA Protein CDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPS
YKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANR
RYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFAD
QFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPF
YLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVV
QQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDL
DYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYD
EGLRRGVFITNETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFD
GMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATICASSHQFLST
HYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSW
EQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHN
SLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFL
EFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEAL
GSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESR
QQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVR
VTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGE
QFLVSWC (SEQ ID NO: 2)
Full-Length GAA MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHP
Protein AHQQGASRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGC
CYIPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPK
DILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEE
PFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLS
TSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQP
SPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGY
SSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELH
QGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTA
FPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELEN
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEALASHRALVKARGTR
PFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCG
FLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLR
YALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVL
QAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAP
LDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGES
LEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLS
NGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC (SEQ ID NO: 3)
Thus, in some embodiments, GAA protein suitable for the present invention is a human Mature Form GAA Protein (SEQ ID NO:1). In some embodiments, a suitable GAA protein may be a homologue or an orthologue of human Mature Form GAA Protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.). In other embodiments, a suitable GAA protein may be a functional variant of human Mature Form GAA Protein. A functional variant Mature Form GAA Protein may be a modified human Mature Form GAA Protein containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring human Mature Form GAA Protein (e.g., SEQ ID NO:1), while retaining substantial GAA protein activity. Thus, in some embodiments, a GAA protein suitable for the present invention is substantially homologous to human Mature Form GAA Protein (SEQ ID NO:1). In some embodiments, a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:1. In some embodiments, a GAA protein suitable for the present invention is substantially identical to human Mature Form GAA Protein (SEQ ID NO:1). In some embodiments, a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:1. In some embodiments, a GAA protein suitable for the present invention contains a fragment or a portion of human Mature Form GAA Protein.
Alternatively, a GAA protein suitable for the present invention is a human Precursor Form GAA Protein (SEQ ID NO:2). In some embodiments, a GAA protein suitable may be a homologue or an orthologue of human Precursor Form GAA Protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.). In some embodiments, a suitable GAA protein is a functional variant of a human Precursor Form GAA Protein, containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring human Precursor Form GAA Protein (e.g., SEQ ID NO:2), while retaining substantial GAA protein activity. Thus, in some embodiments, a GAA protein suitable for the present invention is substantially homologous to human Precursor Form GAA Protein (SEQ ID NO:2). In some embodiments, a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:2. In some embodiments, a GAA protein suitable for the present invention is substantially identical to SEQ ID NO:2. In some embodiments, a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:2. In some embodiments, a GAA protein suitable for the present invention contains a fragment or a portion of human Precursor Form GAA Protein. As used herein, a Precursor Form GAA Protein typically contains a propeptide sequence.
Alternatively, a GAA protein suitable for the present invention is a human Full-Length GAA Protein (SEQ ID NO:3). In some embodiments, a GAA protein suitable may be a homologue or an orthologue of Full-Length GAA Protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.). In some embodiments, a suitable GAA protein is a functional variant of human Full-Length GAA Protein, containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring full length GAA protein (e.g., SEQ ID NO:3), while retaining substantial GAA protein activity. Thus, in some embodiments, a GAA protein suitable for the present invention is substantially homologous to human Full-Length GAA Protein (SEQ ID NO:3). In some embodiments, a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:3. In some embodiments, a GAA protein suitable for the present invention is substantially identical to SEQ ID NO:3. In some embodiments, a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:3. In some embodiments, a GAA protein suitable for the present invention contains a fragment or a portion of human Full-Length GAA Protein. As used herein, a Full-Length GAA Protein typically contains a signal peptide sequence and a propeptide sequence.
Naglu Protein
A suitable Naglu protein according to the present invention can be any molecule that can substitute for naturally-occurring Naglu protein activity or rescue one or more phenotypes or symptoms associated with Naglu-deficiency. In some embodiments, a Naglu protein suitable for the invention is a polypeptide having an N-terminus and C-terminus and an amino acid sequence substantially similar or identical to mature human Naglu protein.
Typically, human Naglu is produced as a precursor molecule that is processed to a mature form. This process generally occurs by removing the 23 amino acid signal peptide as the protein enters the endoplasmic reticulum. Typically, the precursor form is also referred to as full-length precursor or full-length Naglu protein, which contains 743 amino acids. The N-terminal 23 amino acids are cleaved as the precursor protein enters the endoplasmic reticulum, resulting in a mature form. Thus, it is contemplated that the N-terminal 23 amino acids is generally not required for the Naglu protein activity. However, the use of the full-length precursor of the Naglu protein is also contemplated within the scope of the instant invention. The amino acid sequences of the mature form (SEQ ID NO:4) and full-length precursor (SEQ ID NO:5) of a typical wild-type or naturally-occurring human Naglu protein are shown in Table 2 below.
TABLE 2
Mature and Precursor Naglu Protein
Mature Form of DEAREAAAVRALVARLLGPGPAADFSVSVERALAAKPGLDTYSLGGGGAARVRV
Naglu RGSTGVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPAVPGELTEATPNRYRY
YQNVCTQSYSFVWWDWARWEREIDWMALNGINLALAWSGQEAIWQRVYLALGLT
QAEINEFFTGPAFLAWGRMGNLHTWDGPLPPSWHIKQLYLQHRVLDQMRSFGMT
PVLPAFAGHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPIFPIIGS
LFLRELIKEFGTDHIYGADTFNEMQPPSSEPSYLAAATTAVYEAMTAVDTEAVW
LLQGWLFQHQPQFWGPAQIRAVLGAVPRGRLLVLDLFAESQPVYTRTASFQGQP
FIWCMLHNFGGNHGLFGALEAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVY
SLMAELGWRKDPVPDLAAWVTSFAARRYGVSHPDAGAAWRLLLRSVYNCSGEAC
RGHNRSPLVRRPSLQMNTSIWYNRSDVFEAWRLLLTSAPSLATSPAFRYDLLDL
TRQAVQELVSLYYEEARSAYLSKELASLLRAGGVLAYELLPALDEVLASDSRFL
LGSWLEQARAAAVSEAEADFYEQNSRYQLTLWGPEGNILDYANKQLAGLVANYY
TPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVD
LAKKIFLKYYPRWVAGSW (SEQ ID NO: 4)
Full-Length MEAVAVAAAVGVLLLAGAGGAAGDEAREAAAVRALVARLLGPGPAADFSVSVER
Precursor/Full- ALAAKPGLDTYSLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWSGSQL
Length Naglu  RLPRPLPAVPGELTEATPNRYRYYQNVCTQSYSFVWWDWARWEREIDWMALNGI
Protein NLALAWSGQEAIWQRVYLALGLTQAEINEFFTGPAFLAWGRMGNLHTWDGPLPP
SWHIKQLYLQHRVLDQMRSFGMTPVLPAFAGHVPEAVTRVFPQVNVTKMGSWGH
FNCSYSCSFLLAPEDPIFPIIGSLFLRELIKEFGTDHIYGADTFNEMQPPSSEP
SYLAAATTAVYEAMTAVDTEAVWLLQGWLFQHQPQFWGPAQIRAVLGAVPRGRL
LVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGGNHGLFGALEAVNGGPEAARL
FPNSTMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPDLAAWVTSFAARRYGVS
HPDAGAAWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTSIWYNRSDVFEAW
RLLLTSAPSLATSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELASLLRA
GGVLAYELLPALDEVLASDSRFLLGSWLEQARAAAVSEAEADFYEQNSRYQLTL
WGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVF
QLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPRWVAGSW
(SEQ ID NO: 5)
Thus, in some embodiments, Naglu protein suitable for the present invention is a mature human Naglu protein (SEQ ID NO:4). In some embodiments, a suitable Naglu protein may be a homologue or an orthologue of the mature human Naglu protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.). In other embodiments, a suitable Naglu protein may be a functional variant of the mature human Naglu protein. A functional variant of the mature human Naglu protein may be a modified mature human Naglu protein containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring Naglu protein (e.g., SEQ ID NO:4), while retaining substantial Naglu protein activity. Thus, in some embodiments, a Naglu protein suitable for the present invention is substantially homologous to mature human Naglu protein (SEQ ID NO:4). In some embodiments, a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:4. In some embodiments, a Naglu protein suitable for the present invention is substantially identical to mature human Naglu protein (SEQ ID NO:4). In some embodiments, a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:4. In some embodiments, a Naglu protein suitable for the present invention contains a fragment or a portion ofa mature Naglu protein.
Alternatively, a Naglu protein suitable for the present invention is a full-length Naglu protein (SEQ ID NO:5). In some embodiments, a Naglu protein suitable may be a homologue or an orthologue of the full-length human Naglu protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.). In some embodiments, a suitable Naglu protein is a functional variant of the full-length human Naglu protein, containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring full-length Naglu protein (e.g., SEQ ID NO:5), while retaining substantial Naglu protein activity. Thus, in some embodiments, a Naglu protein suitable for the present invention is substantially homologous to full-length human Naglu protein (SEQ ID NO:5). In some embodiments, a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:5. In some embodiments, a Naglu protein suitable for the present invention is substantially identical to SEQ ID NO:5. In some embodiments, a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:5. In some embodiments, a Naglu protein suitable for the present invention contains a fragment or a portion of a full-length Naglu protein. As used herein, a full-length Naglu protein typically contains a signal peptide sequence.
Additional Lysosomal Enzymes
The present invention may be used to deliver any lysosomal enzymes that can be used to treat any lysosomal storage diseases, in particular those lysosomal storage diseases having skeletal muscle, kidney and/or CNS etiology and/or symptoms, including, but are not limited to, aspartylglucosaminuria, cholesterol ester storage disease, Wolman disease, cystinosis, Danon disease, Fabry disease, Farber lipogranulomatosis, Farber disease, fucosidosis, galactosialidosis types I/II, Gaucher disease types I/II/III, globoid cell leukodystrophy, Krabbe disease, glycogen storage disease II, Pompe disease, GM1-gangliosidosis types I/II/III, GM2-gangliosidosis type I, Tay Sachs disease, GM2-gangliosidosis type II, Sandhoff disease, GM2-gangliosidosis, α-mannosidosis types I/II, .beta.-mannosidosis, metachromatic leukodystrophy, mucolipidosis type I, sialidosis types I/II, mucolipidosis types II/III, I-cell disease, mucolipidosis type IIIC pseudo-Hurler polydystrophy, mucopolysaccharidosis type I, mucopolysaccharidosis type II, mucopolysaccharidosis type MA, Sanfilippo syndrome, mucopolysaccharidosis type IIIB, mucopolysaccharidosis type IIIC, mucopolysaccharidosis type HID, mucopolysaccharidosis type IVA, Morquio syndrome, mucopolysaccharidosis type IVB, mucopolysaccharidosis type VI, mucopolysaccharidosis type VII, Sly syndrome, mucopolysaccharidosis type IX, multiple sulfatase deficiency, neuronal ceroid lipofuscinosis, CLN1 Batten disease, CLN2 Batten diseae, Niemann-Pick disease types A/B, Niemann-Pick disease type C1, Niemann-Pick disease type C2, pycnodysostosis, Schindler disease types I/II, Gaucher disease and sialic acid storage disease.
A detailed review of the genetic etiology, clinical manifestations, and molecular biology of the lysosomal storage diseases are detailed in Scriver et al., eds., The Metabolic and Molecular Basis of Inherited Disease, 7.sup.th Ed., Vol. II, McGraw Hill, (1995). Thus, the enzymes deficient in the above diseases are known to those of skill in the art, some of these are exemplified in Table 3 below:
TABLE 3
Enzymes Associated With Lysosomal Storage Disease
Disease Name Enzyme Deficiency Substance Stored
Pompe Disease Acid-a1, 4-Glucosidase Glycogen α-1-4 linked
Oligosaccharides
GM1 Gangliodsidosis β-Galactosidase GM1 Gangliosides
Tay-Sachs Disease β-Hexosaminidase A GM2 Ganglioside
GM2 Gangliosidosis: AB GM2 Activator Protein GM2 Ganglioside
Variant
Sandhoff Disease β-Hexosaminidase A&B GM2 Ganglioside
Fabry Disease α-Galactosidase A Globosides
Gaucher Disease Glucocerebrosidase Glucosylceramide
Metachromatic Arylsulfatase A Sulphatides
Leukodystrophy
Krabbe Disease Galactosylceramidase Galactocerebroside
Niemann Pick, Types A & B Acid Sphingomyelinase Sphingomyelin
Niemann-Pick, Type C Cholesterol Esterification Sphingomyelin
Defect
Niemann-Pick, Type D Unknown Sphingomyelin
Farber Disease Acid Ceramidase Ceramide
Wolman Disease Acid Lipase Cholesteryl Esters
Hurler Syndrome α-L-Iduronidase Heparan & Dermatan
(MPS IH) Sulfates
Scheie Syndrome α-L-Iduronidase Heparan & Dermatan, Sulfates
(MPS IS)
Hurler-Scheie α-L-Iduronidase Heparan & Dermatan
(MPS IH/S) Sulfates
Hunter Syndrome Iduronate Sulfatase Heparan & Dermatan
(MPS II) Sulfates
Sanfilippo A Heparan N-Sulfatase Heparan Sulfate
(MPS IIIA)
Sanfilippo B α-N- Heparan Sulfate
(MPS IIIB) Acetylglucosaminidase
Sanfilippo C Acetyl-CoA- Heparan Sulfate
(MPS IIIC) Glucosaminide
Acetyltransferase
Sanfilippo D N-Acetylglucosamine-6- Heparan Sulfate
(MPS IIID) Sulfatase
Morquio B β-Galactosidase Keratan Sulfate
(MPS IVB)
Maroteaux-Lamy Arylsulfatase B Dermatan Sulfate
(MPS VI)
Sly Syndrome β-Glucuronidase
(MPS VII)
α -Mannosidosis α-Mannosidase Mannose/Oligosaccharides
β -Mannosidosis β-Mannosidase Mannose/Oligosaccharides
Fucosidosis α-L-Fucosidase Fucosyl/Oligosaccharides
Aspartylglucosaminuria N-Aspartyl-β- Aspartylglucosamine
Glucosaminidase Asparagines
Sialidosis (Mucolipidosis I) α-Neuraminidase Sialyloligosaccharides
Galactosialidosis Lysosomal Protective Sialyloligosaccharides
(Goldberg Syndrome) Protein Deficiency
Schindler Disease α -N-Acetyl-
Galactosaminidase
Mucolipidosis II (I-Cell N-Acetylglucosamine-1- Heparan Sulfate
Disease) Phosphotransferase
Mucolipidosis III (Pseudo- Same as ML II
Hurler Polydystrophy)
Cystinosis Cystine Transport Protein Free Cystine
Salla Disease Sialic Acid Transport Free Sialic Acid and Glucuronic
Protein Acid
Infantile Sialic Acid Sialic Acid Transport Free Sialic Acid and Glucuronic
Storage Disease Protein Acid
Infantile Neuronal Ceroid Palmitoyl-Protein Lipofuscins
Lipofuscinosis Thioesterase
Mucolipidosis IV Unknown Gangliosides & Hyaluronic Acid
Prosaposin Saposins A, B, C or D

In some embodiments, a suitable lysosomal enzyme may be a naturally occurring lysosomal enzyme. In some embodiments, a suitable lysosomal enzyme may be a recombinant version of a naturally occurring lysosomal enzyme.
In some embodiments, a lysosomal enzyme suitable for the invention may have a wild-type or naturally occurring sequence. In some embodiments, a lysosomal enzyme suitable for the invention may have a modified sequence having substantial homology or identify to the wild-type or naturally-occurring sequence (e.g., having at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% sequence identity to the wild-type or naturally-occurring sequence).
Lysosomal Targeting Moiety
According to the present invention, a lysosomal targeting moiety refers to any agent that can facilitate lysosomal delivery via binding to a protein other than the CI-M6PR receptor. In some embodiments, the lysosomal targeting moiety is able to bind, directly or indirectly, to one or more membrane proteins via a cis-his rich domain (CHRD) to form a protein complex. In some embodiments, the lysosomal targeting moiety binds, directly or indirectly, to one or more secondary binding proteins selected from the group consisting of the low density lipoprotein receptor (LDLR), amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8), or combinations thereof. In some embodiments, the lysosomal targeting moiety comprises a proprotein convertase, or fragment thereof. In some embodiments, the proprotein convertase is a mammalian proprotein convertase.
Proprotein Convertase
Mammalian proprotein convertases are members of a secretory serine protease family composed of nine members related to bacterial subtilisin and yeast kexin. The catalytic domains of seven members of this family (PC1/3; PC2; Furin; PC4; PC5/6; PACE4 and PC7) exhibit homology to the catalytic domain of yeast kexin, and they are known to cleave after basic residues in target proteins. The eighth member, SKI-1/S1P, shows strong homology to bacterial pyrolysin and, similar to the other 7 family members, is known to cleave after basic residues in target proteins. Finally, the last member, PCSK9, shows homology to fungal proteinase K and undergoes autoproteolytic cleavage at the (V/I)FAQ motif in the endoplasmic reticulum. Like many other proteases, these proprotein convertases are synthesized as inactive zymogens that carry an N-terminal propeptide. It is thought that this propeptide facilitates proper folding of the convertase, and that it functions as a natural inhibitor of the enzyme until it is cleaved off.
Among the nine family members, five PCs (Furin, PC5/6; PACE4, SKI-1/S1P and PCSK9) have been shown to play a central role in regulating sterols and/or lipid metabolism. This is especially true for PCSK9, whose over-activity/gain-of-function results in Familial Hypercholesterolemia (FH). PCSK9 is highly expressed in the liver and produced as a preprotein that undergoes autoproteolytic cleavage during passage through the secretory pathyway. During this process, the C-terminus of the N-terminal propeptide occupies PCSK9's catalytic pocket, inhibiting its proteolytic activity and blocking access to other exogenous substrates.
PCSK9 binds to the EGF-A domain of the LDL receptor through part of its catalytic domain to form a non-covalent protein complex, which is internalized by endocytosis and targeted for degradation in the acidic compartment of the lysosome.
Data suggest, that while the PCSK9-LDLR complex is necessary for LDL receptor (LDLR) recycling and removal of LDL from the extracellular space, it is not required for PCSK9 endocytosis to the lysosome. Several studies have shown that disruption of PCSK9 binding to LDLR, through mutations within its catalytic domain or via the use of blocking antibodies does not impede PCSK9 internalization. This suggests that alternative mechanisms exist by which PCSK9 is internalized. In particular, it has been suggested that lysosomal targeting and function of PCSK9 relies on its C-terminal Cys-His-rich domain (CHRD), a region which allows for non-covalent binding with various membrane bound protein such as: amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A2 (LoSurdo et al., EMBO 12:1300-1305 (2011); Ni et al., J. Biol. Chem. 285:12882-12891 (2010); Saavedra et al., J. Biol. Chem. 287:43492-43501 (2012); DeVay et al., J. Biol. Chem. 288:10805-10818 (2013); and Chaparro-Riggers et al., J. Biol. Chem. 287:11090-11097 (2012); the contents of all of which are hereby incorporated by reference.)
Exemplary Lysosomal Targeting Moieties
In some embodiments, a suitable lysosomal targeting moiety may be any proprotein convertase molecule, fragment or portion thereof (e.g., a motif or domain) capable of endocytosis to the lysosome. In some embodiments, the proprotein convertase molecule or fragment thereof, comprises a CHRD motif. In some embodiments, the proprotein convertase is a mammalian proprotein convertase. In some embodiments, the proprotein convertase is selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9. In some specific embodiments, the proprotein convertase is PCSK9.
In some embodiments, a suitable lysosomal targeting moiety may be any proprotein convertase molecule, fragment or portion thereof (e.g. a motif or domain) capable of binding, directly or indirectly, to the LDL receptor (LDLR). In some embodiments, the proprotein convertase molecule or fragment thereof, is capable of binding, directly or indirectly, to a secondary binding protein selected from the group consisting of amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A. As used herein, binding to LDLR or secondary binding protein typically refers to a physiologically meaningful binding. For example, a physiologically meaningful binding typically has a dissociation constant (Kd) no greater than 10−7 under physiological conditions (e.g., pH 6-8, and in particular, pH 7.4).
In some embodiments, the lysosomal targeting moiety comprises the PCSK9 preprotein (including the PCSK9 signal peptide {N-terminal 30 amino acids} and propeptide {N-terminal amino acids from position 31 to 122}) (SEQ ID NO:6). In some embodiments, the lysosomal targeting moiety comprises the PCSK9 protein without the N-terminal signal and propeptide, i.e., PCSK9 Mature Protein (SEQ ID NO:7). In some embodiments, a lysosomal targeting moiety is a peptide fragment derived from human PCSK9 preprotein (SEQ ID NO:6). The amino acid sequences of a typical wild-type or naturally-occurring human PCSK9 preprotein and an auto-proteolytically cleaved human mature PCSK9 protein are shown in Table 4 below.
TABLE 4
Human PCSK9 Sequences
PCSK9  MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAE
Preprotein APEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYL
TKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERIT
PPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRF
HRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEF
IRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACL
YSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTC
FVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPED
QRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSC
SSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAP
PAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREA
SIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAY
AVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
(SEQ ID NO: 6)
PCSK9 Mature SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFE
Protein NVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGT
VSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTA
AGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDI
IGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKD
VINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVAR
CAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLP
QANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQ
PNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSAL
PGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
(SEQ ID NO: 7)
In some embodiments, a lysosomal targeting moiety has a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the sequence of the PCSK9 preprotein (SEQ ID NO:6). In some embodiments, a lysosomal targeting moiety has a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the sequence of PCSK9 Mature Protein (SEQ ID NO:7). In some embodiments, a lysosomal targeting moiety is a fragment of human PCSK9 Preprotein. In some embodiments, a lysosomal targeting moiety contains one or more N-terminal, C-terminal or internal deletions, or combinations thereof, in the sequence of human PCSK9 Preprotein (SEQ ID NO:6). In some embodiments, a lysosomal targeting moiety contains one or more N-terminal, C-terminal or internal deletions, or combinations thereof, in the sequence of the human PCSK9 Mature Protein (SEQ ID NO:7).
In some embodiments, a lysosomal targeting moiety is a modified human PCSK9 sequence (preprotein or mature form) containing amino acid substitutions, insertions or deletions. In some embodiments, the lysosomal targeting moiety has one or more amino acid substitutions, deletions or insertions within the catalytic domain of the preprotein or mature form of PCSK9. In some specific embodiments, the lysosomal targeting moiety has one or more mutations within the PCSK9 catalytic domain that diminish or enhance auto proteolytic cleavage. In some embodiments, the one more mutations within the catalytic domain comprise a S386A substitution.
In some embodiments, the lysosomal targeting moiety has one or more mutations (amino acid substitutions, insertions or deletions) within the LDLR binding region that diminish or enhance binding to the LDL receptor. In some embodiments, the mutation within the LDLR binding region comprises a F379A substitution.
In some embodiments, the lysosomal targeting moiety has one or more mutations (amino acid substitutions, insertions or deletions) within the CHRD region of the protein. In some embodiments, the lysosomal targeting moiety has one or more mutations within the CHRD region that enhance binding to one or more secondary binding proteins selected from the group consisting of amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A.
In some embodiments, the lysosomal targeting moiety has one or more mutations, substitutions, deletions or insertions within a region selected from the group consisting of the catalytic domain, propeptide, CHRD region, LDLR binding region and combinations thereof. In some embodiments, the one or more mutations are selected from the group consisting of S386A, F379A and combinations thereof. In some embodiments, the one or more mutations are selected from the group consisting of amino acid substitutions at positions R194 (elimination of LDL receptor binding), D186 and/or H226 (both elimination of protease activity); the substitution in these three cases may be A, as well as other amino acids such as L, G, V, and others.
Lysosomal Targeting Moiety Complex
In some embodiments, a suitable lysosomal targeting moiety is a protein complex comprising a proprotein convertase, or fragment thereof, and one or more auxiliary proteins. As used herein, the term “auxiliary protein” is used to describe a protein (i.e., full length, fragment, peptide or motif) non-covalently bound to the catalytic domain of a proprotein convertase, or fragment thereof, which is capable of inhibiting enzyme activity and/or of enhancing cellular uptake of the proprotein convertase.
In some embodiments, a suitable lysosomal targeting moiety is a protein complex comprising human PCSK9 and one or more auxiliary proteins. In some embodiments, the auxiliary protein comprises a protein (i.e., full length, fragment, peptide or motif) which binds within the catalytic domain of a human proprotein convertase. In some embodiments, the auxiliary protein partially occludes the catalytic site of PCSK9 or any other proprotein convertase when bound. In some embodiments, the auxiliary protein completely occludes the catalytic site of PCSK9 when bound. In some embodiments, the auxiliary protein binds within the catalytic domain of PCSK9 or any other proprotein convertase and reduces enzyme activity by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95%. In some embodiments, the auxiliary protein completely blocks enzyme activity when bound within the catalytic site of PCSK9 or any other proprotein convertase.
In some embodiments, the auxiliary protein binds the LDLR receptor binding site within the catalytic domain of PCSK9 or any other proprotein convertase.
In some embodiments, the auxiliary protein reduces binding between PCSK9, or any other proprotein convertase, and LDLR by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95%. In some embodiments, the auxiliary protein completely reduces binding of PCSK9, or any other proprotein convertase, to LDLR.
In some embodiments, the auxiliary protein enhances cellular uptake of PCSK9, or any other proprotein convertase, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95%.
In some embodiments, an auxiliary protein comprises a proprotein convertase propeptide, or fragment thereof. In some embodiments, the propeptide or fragment thereof is derived from a proprotein convertase protein selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9. In some embodiments, the propeptide or fragment thereof is derived from PCSK9.
In some embodiments, the propeptide is derived from the PCSK9 preprotein (SEQ ID NO:6). In some embodiments, the propeptide comprises an amino acid sequence at least 50%, 60%, 70%, 80%, 85%, 90% or 95% identical SEQ ID NO:8. In some embodiments, the propeptide is identical to SEQ ID NO:8. The amino acid sequences of a propeptide derived from a typical wild-type or naturally-occurring human PCSK9 preprotein is shown in Table 5 below.
TABLE 5
Human PCSK9 Propeptide Sequence
PCSK9  QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKD
Pro- PWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTK
peptide ILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVF
AQ (SEQ ID NO: 8)

Association Between Lysosomal Enzyme and Lysosomal Targeting Moiety
A lysosomal enzyme and a targeting moiety can be associated, directly or indirectly. In some embodiments, a lysosomal enzyme and a targeting moiety are non-covalently associated. The association is typically stable at or about pH 7.4. For example, a targeting moiety can be biotinylated and bind avidin associated with a lysosomal enzyme. In some embodiments, a targeting moiety and a lysosomal enzyme are crosslinked to each other (e.g., using a chemical crosslinking agent).
In some embodiments, a targeting moiety is fused to a lysosomal enzyme as a fusion protein. The targeting moiety can be at the amino-terminus of the fusion protein, the carboxy-terminus, or can be inserted within the sequence of the lysosomal enzyme at a position where the presence of the targeting moiety does not unduly interfere with the therapeutic activity of the enzyme. Where a lysosomal enzyme is a heteromeric protein, one or more of the subunits can be associated with a targeting moeity.
Linker or Spacer
A lysosomal targeting moiety can be fused to the N-terminus or C-terminus of a lysosomal enzyme polypeptide, or inserted internally. The lysosomal targeting moiety can be fused directly to the lysosomal enzyme polypeptide or can be separated from the lysosomal enzyme polypeptide by a linker or a spacer. An amino acid linker or spacer is generally designed to be flexible or to interpose a structure, such as an alpha-helix, between two protein moieties. A linker or spacer can be relatively short, such as a “GGG” or a poly “GAG” sequence GGGGGAAAAAGGGGG (SEQ ID NO:9), a “GAP” sequence of GAP (SEQ ID NO:10), a “PolyGP” sequence of GGGGGP (SEQ ID NO:11), or can be longer, such as, for example, 10-50 (e.g., 10-20, 10-25, 10-30, 10-35, 10-40, 10-45, 10-50) amino acids in length. In some embodiments, various short linker sequences can be present in tandem repeats. For example, a suitable linker may contain the “GAG” amino acid sequence of GGGGGAAAAAGGGGG (SEQ ID NO:9) present in tandem repeats. In some embodiments, such a linker may further contain one or more “GAP” sequences, that frame the “GAG” sequence of GGGGGAAAAAGGGGG (SEQ ID NO:9). For example, in some embodiments a GAG2 linker may be used, which contains two tandem “GAG” repeats, each framed by a “GAP” sequence, such as GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAP (SEQ ID NO:12). In some embodiments a GAG3 linker may be used, which contains three tandem “GAG” repeats, each framed by two “GAP” sequences, such as GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGG GAP (SEQ ID NO:13).
In some embodiments, a suitable linker or spacer may contain a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to any of the linker sequences described herein, including, but not limited to, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, or SEQ ID NO:13.
Additional linkers or spacers suitable for the invention are known in the art including those described in WO 2012122042, entitled “PEPTIDE LINKERS FOR POLYPEPTIDE COMPOSITIONS AND METHODS FOR USING SAME”, which is incorporated by reference in its entirety.
It is contemplated that the association between a lysosomal enzyme and a lysosomal targeting moiety according to the present invention does not substantially alter enzyme activity. In some embodiments, the targeted therapeutic has an enzyme activity that is substantially similar or enhanced when compared to the corresponding native enzyme. In some embodiments, the enzyme activity of a targeted therapeutic retains at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% enzymatic activity as compared to the native enzyme. In some embodiments, the enzyme activity of a targeted therapeutic is enhanced by at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 70%, 80%, 90% or 100% compared to the native enzyme.
In some embodiments, a targeted therapeutic of the present invention comprises a GAA or Naglu protein fused to a lysosomal targeting moiety. In some embodiments, the GAA or Naglu protein has a Km for a known substrate of at least about 0.10 nM (e.g., at least about 0.15 nM, 0.20 nM, 0.25 nM, 0.30 nM, or 0.35 nM).
It is also contemplated that in some embodiments, the targeted therapeutic of the present invention permits substantial binding between the lysosomal targeting moiety and a secondary binding protein, such as, but not limited to, amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8), LDLR and Annexin A. In some embodiments, the targeted therapeutic of the present invention may be engineered to permit substantial binding between the lysosomal targeting moiety and a secondary binding protein, such as, but not limited to amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A, but shows a reduction or complete block in LDLR binding. In some embodiments, the level of LDLR or secondary binding protein binding of the targeted therapeutic may be tested using any of a variety of well-known binding assays, such as, but not limited to, radiolabeled run on assay, radiolabeled binding assay, ELISA, Surface Plasmone Resonance and Isothermal Titration calorimetry. In some embodiments, the level of LDLR or secondary binding protein binding of the targeted therapeutics of the invention may be evaluated by cellular uptake studies.
In some embodiments, the cellular uptake of a targeted therapeutic according to the present invention has a Kd of at least about 1.0e+2 nM (e.g., at least about 1.0e+3 nM, 1.0e+4 nM, or 1.0e+5 nM).
Production of Targeted Therapeutics
Targeted therapeutics according to the present invention may be produced via various methods known in the art. In some embodiments, a targeted therapeutic is a fusion protein comprising a lysosomal targeting moiety and a therapeutic protein (e.g., a lysosomal enzyme). In some embodiments, the fusion protein further comprises one or more auxiliary proteins. It is contemplated in accordance with the invention, that the targeted therapeutic, alone or further comprising an auxiliary binding protein, may be produced recombinantly. For example, a fusion protein according to the invention may be engineered using standard recombinant technology and produced using a cell culture system. In some embodiments, it is envisioned that the addition of an auxiliary protein may be achieved by co-expression of each component (fusion protein and auxiliary binding protein) to facilitate formation of the protein complex in vivo. Alternatively, in some embodiments, the auxiliary protein and the fusion protein may be recombinantely produced separately and brought together in vitro (e.g., following purification) to facilitate formation of the protein complex. In some embodiments, it is envisioned that a fusion protein is engineered and expressed that comprises a lysosomal targeting moiety (e.g., PCSK9) and a therapeutic protein (e.g., GAA) and at the N-terminus, separated by a proteolytic cleavage site (e.g., for Furin), a signal peptide and propeptide of a proprotein convertases (e.g., PCSK9). This proteolytic site will be cleaved intracellularly and the fusion comprising a lysosomal targeting moiety (e.g., PCSK9) and a therapeutic protein (e.g., GAA) will form a complex with the released propeptide (from which the signal peptide is removed within the ER).
Various prokaryotic and eukaryotic cells may be used for producing fusion proteins including, without limitation, cell lines derived from bacteria strains, yeast strains, insect cells, animal cells, mammalian cells and human cells. Aspects of the present invention also provide for expression constructs and the generation of recombinant stable cell lines useful for expressing fusion proteins which are disclosed in the present specification. In addition, aspects of the present invention also provide methods for producing cell lines that express fusion proteins using the disclosed nucleic acid sequences of the present specification.
Nucleic Acids Encoding Recombinant Fusion Proteins
In some embodiments, nucleic acid molecules are provided comprising nucleic acid sequences encoding for a recombinant fusion protein (herein referred to as a transgene), such as GAA and Naglu fusion proteins described in various embodiments herein. In some embodiments, the nucleic acid encoding a transgene may be modified to provide increased expression of the fusion protein, which is also referred to as codon optimization. For example, the nucleic acid encoding a transgene can be modified by altering the open reading frame for the coding sequence. As used herein, the term “open reading frame” is synonymous with “ORF” and means any nucleotide sequence that is potentially able to encode a protein, or a portion of a protein. An open reading frame usually begins with a start codon (represented as, e.g. AUG for an RNA molecule and ATG in a DNA molecule in the standard code) and is read in codon-triplets until the frame ends with a STOP codon (represented as, e.g. UAA, UGA or UAG for an RNA molecule and TAA, TGA or TAG in a DNA molecule in the standard code). As used herein, the term “codon” means a sequence of three nucleotides in a nucleic acid molecule that specifies a particular amino acid during protein synthesis; also called a triplet or codon-triplet. For example, of the 64 possible codons in the standard genetic code, two codons, GAA and GAG encode the amino acid Glutamine whereas the codons AAA and AAG specify the amino acid Lysine. In the standard genetic code three codons are stop codons, which do not specify an amino acid. As used herein, the term “synonymous codon” means any and all of the codons that code for a single amino acid. Except for Methionine and Tryptophan, amino acids are coded by two to six synonymous codons. For example, in the standard genetic code the four synonymous codons that code for the amino acid Alanine are GCA, GCC, GCG and GCU, the two synonymous codons that specify Glutamine are GAA and GAG and the two synonymous codons that encode Lysine are AAA and AAG.
In some embodiments, a nucleic acid encoding the open reading frame of fusion protein may be modified using standard codon optimization methods. Various commercial algorithms for codon optimization are available and can be used to practice the present invention. Typically, codon optimization does not alter the encoded amino acid sequences. In some embodiments, codon optimization may lead to amino acids alteration such as substitution, deletion or insertion. Typically, such amino acid alteration does not substantially alter the protein activity.
Exemplary nucleic acid sequences encoding PCSK9-GAA, Naglu-PCSK9 and the PCSK9 propeptide are each respectively shown in SEQ ID NO:14, 15 and 16 below.
SEQ ID NO:14 Exemplary nucleic acid sequence encoding PCSK9-GAA.
ATGGGCACCGTCAGCTCCAGGCGGTCCTGGTGGCCGCTGCCACTGCTGCT
GCTGCTGCTGCTGCTCCTGGGTCCCGCGGGCGCCCGTGCGAGCATCCCGT
GGAACCTGGAGCGGATTACCCCTCCACGGTACCGGGCGGATGAATACCAG
CCCCCCGACGGAGGCAGCCTGGTGGAGGTGTATCTCCTAGACACCAGCAT
ACAGAGTGACCACCGGGAAATCGAGGGCAGGGTCATGGTCACCGACTTCG
AGAATGTGCCCGAGGAGGACGGGACCCGCTTCCACAGACAGGCCAGCAAG
TGTGACAGTCATGGCACCCACCTGGCAGGGGTGGTCAGCGGCCGGGATGC
CGGCGTGGCCAAGGGTGCCAGCATGCGCAGCCTGCGCGTGCTCAACTGCC
AAGGGAAGGGCACGGTTAGCGGCACCCTCATAGGCCTGGAGTTTATTCGG
AAAAGCCAGCTGGTCCAGCCTGTGGGGCCACTGGTGGTGCTGCTGCCCCT
GGCGGGTGGGTACAGCCGCGTCCTCAACGCCGCCTGCCAGCGCCTGGCGA
GGGCTGGGGTCGTGCTGGTCACCGCTGCCGGCAACTTCCGGGACGATGCC
TGCCTCTACTCCCCAGCCTCAGCTCCCGAGGTCATCACAGTTGGGGCCAC
CAATGCCCAAGACCAGCCGGTGACCCTGGGGACTTTGGGGACCAACTTTG
GCCGCTGTGTGGACCTCTTTGCCCCAGGGGAGGACATCATTGGTGCCTCC
AGCGACTGCAGCACCTGCGCTGTGTCACAGAGTGGGACAGCACAGGCTGC
TGCCCACGTGGCTGGCATTGCAGCCATGATGCTGTCTGCCGAGCCGGAGC
TCACCCTGGCCGAGTTGAGGCAGAGACTGATCCACTTCTCTGCCAAAGAT
GTCATCAATGAGGCCTGGTTCCCTGAGGACCAGCGGGTACTGACCCCCAA
CCTGGTGGCCGCCCTGCCCCCCAGCACCCATGGGGCAGGTTGGCAGCTGT
TTTGCAGGACTGTATGGTCAGCACACTCGGGGCCTACACGGATGGCCACA
GCCGTCGCCCGCTGCGCCCCAGATGAGGAGCTGCTGAGCTGCTCCAGTTT
CTCCAGGAGTGGGAAGCGGCGGGGCGAGCGCATGGAGGCCCAAGGGGGCA
AGCTGGTCTGCCGGGCCCACAACGCTTTTGGGGGTGAGGGTGTCTACGCC
ATTGCCAGGTGCTGCCTGCTACCCCAGGCCAACTGCAGCGTCCACACAGC
TCCACCAGCTGAGGCCAGCATGGGGACCCGTGTCCACTGCCACCAACAGG
GCCACGTCCTCACAGGCTGCAGCTCCCACTGGGAGGTGGAGGACCTTGGC
ACCCACAAGCCGCCTGTGCTGAGGCCACGAGGTCAGCCCAACCAGTGCGT
GGGCCACAGGGAGGCCAGCATCCACGCTTCCTGCTGCCATGCCCCAGGTC
TGGAATGCAAAGTCAAGGAGCATGGAATCCCGGCCCCTCAGGAGCAGGTG
ACCGTGGCCTGCGAGGAGGGCTGGACCCTGACTGGCTGCAGTGCCCTCCC
TGGGACCTCCCACGTCCTGGGGGCCTACGCCGTAGACAACACGTGTGTAG
TCAGGAGCCGGGACGTCAGCACTACAGGCAGCACCAGCGAAGGGGCCGTG
ACAGCCGTTGCCATCTGCTGCCGGAGCCGGCACCTGGCGCAGGCCTCCCA
Figure US10556015-20200211-C00001
Figure US10556015-20200211-C00002
Figure US10556015-20200211-C00003
Figure US10556015-20200211-C00004
Figure US10556015-20200211-C00005
Figure US10556015-20200211-C00006
Figure US10556015-20200211-C00007
Figure US10556015-20200211-C00008
Figure US10556015-20200211-C00009
Figure US10556015-20200211-C00010
Figure US10556015-20200211-C00011
Figure US10556015-20200211-C00012
Figure US10556015-20200211-C00013
Figure US10556015-20200211-C00014
Figure US10556015-20200211-C00015
Figure US10556015-20200211-C00016
Figure US10556015-20200211-C00017
Figure US10556015-20200211-C00018
Figure US10556015-20200211-C00019
Figure US10556015-20200211-C00020
Figure US10556015-20200211-C00021
Figure US10556015-20200211-C00022
Figure US10556015-20200211-C00023
Figure US10556015-20200211-C00024
Figure US10556015-20200211-C00025
Figure US10556015-20200211-C00026
Figure US10556015-20200211-C00027
Figure US10556015-20200211-C00028

(1) The nucleotide sequence encoding PCSK9 signal peptide is underlined.
(2) The nucleotide sequence encoding PCSK9 Mature Protein (except nucleotide sequences encoding mutations F379A and S386A, which are underlined) is not underlined, bold or in italics.
(3) The nucleotide sequence encoding the amino acid sequence of the GlyGlyGly linker is underlined.
(4) The nucleotide sequence encoding Mature Form GAA Protein amino acid sequence (aa70-952) is bold and in italics.
SEQ ID NO:15 Exemplary nucleic acid sequence encoding Naglu-PCSK9.
ATGGAGGCGGTGGCGGTGGCCGCGGCGGTGGGGGTCCTTCTCCTGGCCGG
GGCCGGGGGCGCGGCAGGCGACGAGGCCCGGGAGGCGGCGGCCGTGCGGG
CGCTCGTGGCCCGGCTGCTGGGGCCAGGCCCCGCGGCCGACTTCTCCGTG
TCGGTGGAGCGCGCTCTGGCTGCCAAGCCGGGCTTGGACACCTACAGCCT
GGGCGGCGGCGGCGCGGCGCGCGTGCGGGTGCGCGGCTCCACGGGCGTGG
CGGCCGCCGCGGGGCTGCACCGCTACCTGCGCGACTTCTGTGGCTGCCAC
GTGGCCTGGTCCGGCTCTCAGCTGCGCCTGCCGCGGCCACTGCCAGCCGT
GCCGGGGGAGCTGACCGAGGCCACGCCCAACAGGTACCGCTATTACCAGA
ATGTGTGCACGCAAAGCTACTCCTTCGTGTGGTGGGACTGGGCCCGCTGG
GAGCGAGAGATAGACTGGATGGCGCTGAATGGCATCAACCTGGCACTGGC
CTGGAGCGGCCAGGAGGCCATCTGGCAGCGGGTGTACCTGGCCTTGGGCC
TGACCCAGGCAGAGATCAATGAGTTCTTTACTGGTCCTGCCTTCCTGGCC
TGGGGGCGAATGGGCAACCTGCACACCTGGGATGGCCCCCTGCCCCCCTC
CTGGCACATCAAGCAGCTTTACCTGCAGCACCGGGTCCTGGACCAGATGC
GCTCCTTCGGCATGACCCCAGTGCTGCCTGCATTCGCGGGGCATGTTCCC
GAGGCTGTCACCAGGGTGTTCCCTCAGGTCAATGTCACGAAGATGGGCAG
TTGGGGCCACTTTAACTGTTCCTACTCCTGCTCCTTCCTTCTGGCTCCGG
AAGACCCCATATTCCCCATCATCGGGAGCCTCTTCCTGCGAGAGCTGATC
AAAGAGTTTGGCACAGACCACATCTATGGGGCCGACACTTTCAATGAGAT
GCAGCCACCTTCCTCAGAGCCCTCCTACCTTGCCGCAGCCACCACTGCCG
TCTATGAGGCCATGACTGCAGTGGATACTGAGGCTGTGTGGCTGCTCCAA
GGCTGGCTCTTCCAGCACCAGCCGCAGTTCTGGGGGCCCGCCCAGATCAG
GGCTGTGCTGGGAGCTGTGCCCCGTGGCCGCCTCCTGGTTCTGGACCTGT
TTGCTGAGAGCCAGCCTGTGTATACCCGCACTGCCTCCTTCCAGGGCCAG
CCCTTCATCTGGTGCATGCTGCACAACTTTGGGGGAAACCATGGTCTTTT
TGGAGCCCTAGAGGCTGTGAACGGAGGCCCAGAAGCTGCCCGCCTCTTCC
CCAACTCCACCATGGTAGGCACGGGCATGGCCCCCGAGGGCATCAGCCAG
AACGAAGTGGTCTATTCCCTCATGGCTGAGCTGGGCTGGCGAAAGGACCC
AGTGCCAGATTTGGCAGCCTGGGTGACCAGCTTTGCCGCCCGGCGGTATG
GGGTCTCCCACCCGGACGCAGGGGCAGCGTGGAGGCTACTGCTCCGGAGT
GTGTACAACTGCTCCGGGGAGGCCTGCAGGGGCCACAATCGTAGCCCGCT
GGTCAGGCGGCCGTCCCTACAGATGAATACCAGCATCTGGTACAACCGAT
CTGATGTGTTTGAGGCCTGGCGGCTGCTGCTCACATCTGCTCCCTCCCTG
GCCACCAGCCCCGCCTTCCGCTACGACCTGCTGGACCTCACTCGGCAGGC
AGTGCAGGAGCTGGTCAGCTTGTACTATGAGGAGGCAAGAAGCGCCTACC
TGAGCAAGGAGCTGGCCTCCCTGTTGAGGGCTGGAGGCGTCCTGGCCTAT
GAGCTGCTGCCGGCACTGGACGAGGTGCTGGCTAGTGACAGCCGCTTCTT
GCTGGGCAGCTGGCTAGAGCAGGCCCGAGCAGCGGCAGTCAGTGAGGCCG
AGGCCGATTTCTACGAGCAGAACAGCCGCTACCAGCTGACCTTGTGGGGG
CCAGAAGGCAACATCCTGGACTATGCCAACAAGCAGCTGGCGGGGTTGGT
GGCCAACTACTACACCCCTCGCTGGCGGCTTTTCCTGGAGGCGCTGGTTG
ACAGTGTGGCCCAGGGCATCCCTTTCCAACAGCACCAGTTTGACAAAAAT
GTCTTCCAACTGGAGCAGGCCTTCGTTCTCAGCAAGCAGAGGTACCCCAG
CCAGCCGCGAGGAGACACTGTGGACCTGGCCAAGAAGATCTTCCTCAAAT
ATTACCCCCGCTGGGTGGCCGGCTCTTGGGGAGGTGGA AGCATCCCGTGG
AACCTGGAGCGGATTACCCCTCCACGGTACCGGGCGGATGAATACCAGCC
CCCCGACGGAGGCAGCCTGGTGGAGGTGTATCTCCTAGACACCAGCATAC
AGAGTGACCACCGGGAAATCGAGGGCAGGGTCATGGTCACCGACTTCGAG
AATGTGCCCGAGGAGGACGGGACCCGCTTCCACAGACAGGCCAGCAAGTG
TGACAGTCATGGCACCCACCTGGCAGGGGTGGTCAGCGGCCGGGATGCCG
GCGTGGCCAAGGGTGCCAGCATGCGCAGCCTGCGCGTGCTCAACTGCCAA
GGGAAGGGCACGGTTAGCGGCACCCTCATAGGCCTGGAGTTTATTCGGAA
AAGCCAGCTGGTCCAGCCTGTGGGGCCACTGGTGGTGCTGCTGCCCCTGG
CGGGTGGGTACAGCCGCGTCCTCAACGCCGCCTGCCAGCGCCTGGCGAGG
GCTGGGGTCGTGCTGGTCACCGCTGCCGGCAACTTCCGGGACGATGCCTG
CCTCTACTCCCCAGCCTCAGCTCCCGAGGTCATCACAGTTGGGGCCACCA
ATGCCCAAGACCAGCCGGTGACCCTGGGGACTTTGGGGACCAACTTTGGC
CGCTGTGTGGACCTCTTTGCCCCAGGGGAGGACATCATTGGTGCCTCCAG
CGACTGCAGCACCTGC GCT GTGTCACAGAGTGGGACA GCA CAGGCTGCTG
CCCACGTGGCTGGCATTGCAGCCATGATGCTGTCTGCCGAGCCGGAGCTC
ACCCTGGCCGAGTTGAGGCAGAGACTGATCCACTTCTCTGCCAAAGATGT
CATCAATGAGGCCTGGTTCCCTGAGGACCAGCGGGTACTGACCCCCAACC
TGGTGGCCGCCCTGCCCCCCAGCACCCATGGGGCAGGTTGGCAGCTGTTT
TGCAGGACTGTATGGTCAGCACACTCGGGGCCTACACGGATGGCCACAGC
CGTCGCCCGCTGCGCCCCAGATGAGGAGCTGCTGAGCTGCTCCAGTTTCT
CCAGGAGTGGGAAGCGGCGGGGCGAGCGCATGGAGGCCCAAGGGGGCAAG
CTGGTCTGCCGGGCCCACAACGCTTTTGGGGGTGAGGGTGTCTACGCCAT
TGCCAGGTGCTGCCTGCTACCCCAGGCCAACTGCAGCGTCCACACAGCTC
CACCAGCTGAGGCCAGCATGGGGACCCGTGTCCACTGCCACCAACAGGGC
CACGTCCTCACAGGCTGCAGCTCCCACTGGGAGGTGGAGGACCTTGGCAC
CCACAAGCCGCCTGTGCTGAGGCCACGAGGTCAGCCCAACCAGTGCGTGG
GCCACAGGGAGGCCAGCATCCACGCTTCCTGCTGCCATGCCCCAGGTCTG
GAATGCAAAGTCAAGGAGCATGGAATCCCGGCCCCTCAGGAGCAGGTGAC
CGTGGCCTGCGAGGAGGGCTGGACCCTGACTGGCTGCAGTGCCCTCCCTG
GGACCTCCCACGTCCTGGGGGCCTACGCCGTAGACAACACGTGTGTAGTC
AGGAGCCGGGACGTCAGCACTACAGGCAGCACCAGCGAAGGGGCCGTGAC
AGCCGTTGCCATCTGCTGCCGGAGCCGGCACCTGGCGCAGGCCTCCCAGG
AGCTCCAGTAG

(1) The nucleotide sequence encoding Naglu signal peptide is underlined.
(2) The nucleotide sequence encoding Mature Form of Naglu is not underlined, bold or in italics.
(3) The nucleotide sequence encoding the amino acid sequence of the GlyGlyGly linker is underlined.
(4) The nucleotide sequence encoding PCSK9 Mature Protein (except the nucleotide sequences encoding mutations F379A and S386A, which are additionally underlined) is in italics.
SEQ ID NO:16 Exemplary nucleic acid sequence encoding PCSK9 propeptide and PCSK9 N-terminal signal peptide.
ATGGGCACCGTCAGCTCCAGGCGGTCCTGGTGGCCGCTGCCACTGCTGCT
GCTGCTGCTGCTGCTCCTGGGTCCCGCGGGCGCCCGTGCG CAGGAGGACG
AGGACGGCGACTACGAGGAGCTGGTGCTAGCCTTGCGTTCCGAGGAGGAC
GGCCTGGCCGAAGCACCCGAGCACGGAACCACAGCCACCTTCCACCGCTG
CGCCAAGGATCCGTGGAGGTTGCCTGGCACCTACGTGGTGGTGCTGAAGG
AGGAGACCCACCTCTCGCAGTCAGAGCGCACTGCCCGCCGCCTGCAGGCC
CAGGCTGCCCGCCGGGGATACCTCACCAAGATCCTGCATGTCTTCCATGG
CCTTCTTCCTGGCTTCCTGGTGAAGATGAGTGGCGACCTGCTGGAGCTGG
CCTTGAAGTTGCCCCATGTCGACTACATCGAGGAGGACTCCTCTGTCTTT
GCCCAGTGA

(1) The nucleotide sequence encoding PCSK9 signal peptide is underlined.
(2) The nucleotide sequence encoding PCSK9 propeptide is in italics.
In some embodiments, a nucleotide change may alter a synonymous codon within the open reading frame in order to agree with the endogenous codon usage found in a particular heterologous cell selected for expression. Alternatively or additionally, a nucleotide change may alter the G+C content within the open reading frame to better match the average G+C content of open reading frames found in endogenous nucleic acid sequence present in the heterologous host cell. A nucleotide change may also alter a polymononucleotide region or an internal regulatory or structural site found within a protein sequence. Thus, a variety of modified or optimized nucleotide sequences are envisioned including, without limitation, nucleic acid sequences providing increased expression of a fusion protein in a prokaryotic cell; yeast cell; insect cell; and in a mammalian cell.
Thus, in some embodiments, a nucleic acid encoding a PCSK9-GAA fusion protein suitable for the present invention comprises a nucleotide sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:14. In some embodiments, a nucleic acid encoding a Naglu-PCSK9 fusion protein suitable for the present invention comprises a nucleotide sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:15. In some embodiments, a nucleic acid encoding a PCSK9 propeptided suitable for the present invention comprises a nucleotide sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:16. A modified nucleic acid may or may not result in amino acid sequence alterations in a fusion protein. In the event there is amino acid alteration, such alteration typically does not substantially alter the biological activity of the protein.
Expression Vectors
A nucleic acid sequence encoding a fusion protein or auxiliary binding protein as described in the present application, can be molecularly cloned (inserted) into a suitable vector for propagation or expression in a host cell. A wide variety of expression vectors can be used to practice the present invention, including, without limitation, a prokaryotic expression vector; a yeast expression vector; an insect expression vector and a mammalian expression vector. Exemplary vectors suitable for the present invention include, but are not limited to, viral based vectors (e.g., AAV based vectors, retrovirus based vectors, plasmid based vectors). Typically, a nucleic acid encoding a fusion protein is operably linked to various regulatory sequences or elements.
Regulatory Sequences or Elements
Various regulatory sequences or elements may be incorporated in an expression vector suitable for the present invention. Exemplary regulatory sequences or elements include, but are not limited to, promoters, enhancers, repressors or suppressors, 5′ untranslated (or non-coding) sequences, introns, 3′ untranslated (or non-coding) sequences.
As used herein, a “Promoter” or “Promoter sequence” is a DNA regulatory region capable of binding an RNA polymerase in a cell (e.g., directly or through other promoter bound proteins or substances) and initiating transcription of a coding sequence. A promoter sequence is, in general, bound at its 3′ terminus by the transcription initiation site and extends upstream (5′ direction) to include the minimum number of bases or elements necessary to initiate transcription at any level. The promoter may be operably associated with or operably linked to the expression control sequences, including enhancer and repressor sequences or with a nucleic acid to be expressed. In some embodiments, the promoter may be inducible. In some embodiments, the inducible promoter may be unidirectional or bio-directional. In some embodiments, the promoter may be a constitutive promoter. In some embodiments, the promoter can be a hybrid promoter, in which the sequence containing the transcriptional regulatory region is obtained from one source and the sequence containing the transcription initiation region is obtained from a second source. Systems for linking control elements to coding sequence within a transgene are well known in the art (general molecular biological and recombinant DNA techniques are described in Sambrook, Fritsch, and Maniatis, Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989, which is incorporated herein by reference). Commercial vectors suitable for inserting a transgene for expression in various host cells under a variety of growth and induction conditions are also well known in the art.
In some embodiments, a specific promoter may be used to control expression of the transgene in a mammalian host cell such as, but are not limited to, SRα-promoter (Takebe et al., Molec. and Cell. Bio. 8:466-472 (1988)), the human CMV immediate early promoter (Boshart et al., Cell 41:521-530 (1985); Foecking et al., Gene 45:101-105 (1986)), human CMV promoter, the human CMV5 promoter, the murine CMV immediate early promoter, the EF1-α-promoter, a hybrid CMV promoter for liver specific expression (e.g., made by conjugating CMV immediate early promoter with the transcriptional promoter elements of either human α-1-antitrypsin (HAT) or albumin (HAL) promoter), or promoters for hepatoma specific expression (e.g., wherein the transcriptional promoter elements of either human albumin (HAL; about 1000 bp) or human α-1-antitrypsin (HAT, about 2000 bp) are combined with a 145 long enhancer element of human α-1-microglobulin and bikunin precursor gene (AMBP); HAL-AMBP and HAT-AMBP); the SV40 early promoter region (Benoist at al., Nature 290:304-310 (1981)), the Orgyia pseudotsugata immediate early promoter, the herpes thymidine kinase promoter (Wagner at al., Proc. Natl. Acad. Sci. USA 78:1441-1445 (1981)); or the regulatory sequences of the metallothionein gene (Brinster et al., Nature 296:39-42 (1982)). In some embodiments, the mammalian promoter is a constitutive promoter such as, but not limited to, the hypoxanthine phosphoribosyl transferase (HPTR) promoter, the adenosine deaminase promoter, the pyruvate kinase promoter, the beta-actin promoter as well as other constitutive promoters known to those of ordinary skill in the art.
In some embodiments, a specific promoter may be used to control expression of a transgene in a prokaryotic host cell such as, but are not limited to, the β-lactamase promoter (Villa-Komaroff et al., Proc. Natl. Acad. Sci. USA 75:3727-3731 (1978)); the tac promoter (DeBoer et al., Proc. Natl. Acad. Sci. USA 80:21-25 (1983)); the T7 promoter, the T3 promoter, the M13 promoter or the M16 promoter; in a yeast host cell such as, but are not limited to, the GAL1, GAL4 or GAL10 promoter, the ADH (alcohol dehydrogenase) promoter, PGK (phosphoglycerol kinase) promoter, alkaline phosphatase promoter, glyceraldehyde-3-phosphate dehydrogenase III (TDH3) promoter, glyceraldehyde-3-phosphate dehydrogenase II (TDH2) promoter, glyceraldehyde-3-phosphate dehydrogenase I (TDH1) promoter, pyruvate kinase (PYK), enolase (ENO), or triose phosphate isomerase (TPI).
In some embodiments, the promoter may be a viral promoter, many of which are able to regulate expression of a transgene in several host cell types, including mammalian cells. Viral promoters that have been shown to drive constitutive expression of coding sequences in eukaryotic cells include, for example, simian virus promoters, herpes simplex virus promoters, papilloma virus promoters, adenovirus promoters, human immunodeficiency virus (HIV) promoters, Rous sarcoma virus promoters, cytomegalovirus (CMV) promoters, the long terminal repeats (LTRs) of Moloney murine leukemia virus and other retroviruses, the thymidine kinase promoter of herpes simplex virus as well as other viral promoters known to those of ordinary skill in the art.
In some embodiments, the gene control elements of an expression vector may also include 5′ non-transcribing and 5′ non-translating sequences involved with the initiation of transcription and translation, respectively, such as a TATA box, capping sequence, CAAT sequence, Kozak sequence and the like. Enhancer elements can optionally be used to increase expression levels of a polypeptide or protein to be expressed. Examples of enhancer elements that have been shown to function in mammalian cells include the SV40 early gene enhancer, as described in Dijkema et al., EMBO J. (1985) 4: 761 and the enhancer/promoter derived from the long terminal repeat (LTR) of the Rous Sarcoma Virus (RSV), as described in Gorman et al., Proc. Natl. Acad. Sci. USA (1982b) 79:6777 and human cytomegalovirus, as described in Boshart et al., Cell (1985) 41:521. Genetic control elements of an expression vector will also include 3′ non-transcribing and 3′non-translating sequences involved with the termination of transcription and translation. Respectively, such as a poly polyadenylation (polyA) signal for stabilization and processing of the 3′ end of an mRNA transcribed from the promoter. Poly A signals included, for example, the rabbit beta globin polyA signal, bovine growth hormone polyA signal, chicken beta globin terminator/polyA signal, or SV40 late polyA region.
Selectable Markers
Expression vectors will preferably but optionally include at least one selectable marker. In some embodiments, the selectable maker is a nucleic acid sequence encoding a resistance gene operably linked to one or more genetic regulatory elements, to bestow upon the host cell the ability to maintain viability when grown in the presence of a cyctotoxic chemical and/or drug. In some embodiments, a selectable agent may be used to maintain retention of the expression vector within the host cell. In some embodiments, the selectable agent is may be used to prevent modification (i.e. methylation) and/or silencing of the transgene sequence within the expression vector. In some embodiments, a selectable agent is used to maintain episomal expression of the vector within the host cell. In some embodiments, the selectable agent is used to promote stable integration of the transgene sequence into the host cell genome. In some embodiments, an agent and/or resistance gene may include, but is not limited to, methotrexate (MTX), dihydrofolate reductase (DHFR, U.S. Pat. Nos. 4,399,216; 4,634,665; 4,656,134; 4,956,288; 5,149,636; 5,179,017, ampicillin, neomycin (G418), zeomycin, mycophenolic acid, or glutamine synthetase (GS, U.S. Pat. Nos. 5,122,464; 5,770,359; 5,827,739) for eukaryotic host cell; tetracycline, ampicillin, kanamycin or chlorampenichol for a prokaryotic host cell; and URA3, LEU2, HIS3, LYS2, HIS4, ADE8, CUP1 or TRP1 for a yeast host cell.
Expression vectors may be transfected, transformed or transduced into a host cell. As used herein, the terms “transfection,” “transformation” and “transduction” all refer to the introduction of an exogenous nucleic acid sequence into a host cell. In some embodiments, expression vectors containing nucleic acid sequences encoding a fusion therapeutic glycoprotein is transfected, transformed or transduced into a host cell. In some embodiments, one or more expression vectors containing nucleic acid sequences encoding a fusion therapeutic glycoprotein are transfected, transformed or transduced into a host cell sequentially. For example, a vector encoding a first fusion therapeutic glycoprotein protein may be transfected, transformed or transduced into a host cell, followed by the transfection, transformation or transduction of a vector encoding a second fusion therapeutic glycoprotein, and vice versa. Examples of transformation, transfection and transduction methods, which are well known in the art, include liposome delivery, i.e., Lipofectamine™ (Gibco BRL) Method of Hawley-Nelson, Focus 15:73 (1193), electroporation, CaPO4 delivery method of Graham and van der Erb, Virology, 52:456-457 (1978), DEAE-Dextran medicated delivery, microinjection, biolistic particle delivery, polybrene mediated delivery, cationic mediated lipid delivery, transduction, and viral infection, such as, e.g., retrovirus, lentivirus, adenovirus adeno-associated virus and Baculovirus (Insect cells). General aspects of cell host transformations have been described in the art, such as by Axel in U.S. Pat. No. 4,399,216; Sambrook, supra, Chapters 1-4 and 16-18; Ausubel, supra, chapters 1, 9, 13, 15, and 16. For various techniques for transforming mammalian cells, see Keown et al., Methods in Enzymology (1989), Keown et al., Methods in Enzymology, 185:527-537 (1990), and Mansour et al., Nature, 336:348-352 (1988).
Once introduced inside cells, expression vectors may be integrated stably in the genome or exist as extra-chromosomal constructs. Vectors may also be amplified and multiple copies may exist or be integrated in the genome. In some embodiments, cells of the invention may contain 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more copies of nucleic acids encoding a fusion therapeutic glycoprotein. In some embodiments, cells of the invention may contain multiple copies (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more) of nucleic acids encoding one or more fusion therapeutic glycoproteins.
Mammalian Cell Lines
Any mammalian cell or cell type susceptible to cell culture, and to expression of polypeptides, may be utilized in accordance with the present invention as a host cell. Non-limiting examples of mammalian cells that may be used in accordance with the present invention include HT1080 cells (Rasheed S, Nelson-Rees W A, Toth E M, Arnstein P, Gardner M B. Characterization of a newly derived human sarcoma cell line (HT1080). Cancer 33:1027-1033, 1974), human embryonic kidney 293 cells (HEK293), HeLa cells; BALB/c mouse myeloma line (NSO/l, ECACC No: 85110503); human retinoblasts (PER.C6 (CruCell, Leiden, The Netherlands)); monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol., 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells +/−DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77:4216 (1980)); mouse sertoli cells (TM4, Mather, Biol. Reprod., 23:243-251 (1980)); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1 587); human cervical carcinoma cells (HeLa, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N.Y. Acad. Sci., 383:44-68 (1982)); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2). In some embodiments, a suitable mammalian cell is not a endosomal acidification-deficient cell.
Additionally, any number of commercially and non-commercially available hybridoma cell lines that express polypeptides or proteins may be utilized in accordance with the present invention. One skilled in the art will appreciate that hybridoma cell lines might have different nutrition requirements and/or might require different culture conditions for optimal growth and polypeptide or protein expression, and will be able to modify conditions as needed.
Non-Mammalian Cell Lines
Any non-mammalian derived cell or cell type susceptible to cell culture, and to expression of polypeptides, may be utilized in accordance with the present invention as a host cell. Non-limiting examples of non-mammalian host cells and cell lines that may be used in accordance with the present invention include cells and cell lines derived from Pichia pastoris, Pichia methanolica, Pichia angusta, Schizosacccharomyces pombe, Saccharomyces cerevisiae, and Yarrowia lipolytica for yeast; Sodoptera frugiperda, Trichoplusis ni, Drosophila melangoster and Manduca sexta for insects; and Escherichia coli, Salmonella typhimurium, Bacillus subtilis, Bacillus lichenifonnis, Bacteroides fragilis, Clostridia perfringens, Clostridia difficile for bacteria; and Xenopus Laevis from amphibian.
In other embodiments, transgenic nonhuman mammals have been shown to produce therapeutic glycoproteins (e.g., lysosomal enzymes) in their milk. Such transgenic nonhuman mammals may include mice, rabbits, goats, sheep, porcines or bovines. See U.S. Pat. Nos. 6,118,045 and 7,351,410, each of which are hereby incorporated by reference in their entirety.
Any and all methods suitable for producing recombinant protein can be used to produce therapeutic protein of the present invention.
Pharmaceutical Compositions and Administration
The present invention further provides pharmaceutical compositions containing targeted therapeutics according to the present invention. Typically, suitable pharmaceutical compositions contain at least one pharmaceutically acceptable excipient and are formulated for administration to humans.
For example, pharmaceutical compositions provided herein may be provided in a sterile injectable form (e.g., a form that is suitable for subcutaneous, intravenous, or intrathecal injection). For example, in some embodiments, pharmaceutical compositions are provided in a liquid dosage form that is suitable for injection. In some embodiments, pharmaceutical compositions are provided as powders (e.g., lyophilized and/or sterilized), optionally under vacuum, which are reconstituted with an aqueous diluent (e.g., water, buffer, salt solution, etc.) prior to injection. In some embodiments, pharmaceutical compositions are diluted and/or reconstituted in water, sodium chloride solution, sodium acetate solution, benzyl alcohol solution, phosphate buffered saline, etc. In some embodiments, powder should be mixed gently with the aqueous diluent (e.g., not shaken).
In some embodiments, provided pharmaceutical compositions comprise one or more pharmaceutically acceptable excipients (e.g., preservative, inert diluent, dispersing agent, surface active agent and/or emulsifier, buffering agent, etc.). In some embodiments, pharmaceutical compositions comprise one or more preservatives. In some embodiments, pharmaceutical compositions comprise no preservative.
Compositions of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In some embodiments, such preparatory methods include the step of bringing active ingredient into association with one or more excipients and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping and/or packaging the product into a desired single- or multi-dose unit.
A pharmaceutical composition in accordance with the invention may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses. As used herein, a “unit dose” is discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient is generally equal to a dose which would be administered to a subject and/or a convenient fraction of such a dose such as, for example, one-half or one-third of such a dose.
Relative amounts of active ingredient, pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition in accordance with the invention may vary, depending upon the identity, size, and/or condition of the subject treated and/or depending upon the route by which the composition is to be administered. By way of example, the composition may comprise between 0.1% and 100% (w/w) active ingredient.
Pharmaceutical compositions of the present invention may additionally comprise a pharmaceutically acceptable excipient, which, as used herein, may be or comprise solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired. Remington's The Science and Practice of Pharmacy, 21st Edition, A. R. Gennaro, (Lippincott, Williams & Wilkins, Baltimore, Md., 2006) discloses various excipients used in formulating pharmaceutical compositions and known techniques for the preparation thereof. Except insofar as any conventional excipient medium is incompatible with a substance or its derivatives, such as by producing any undesirable biological effect or otherwise interacting in a deleterious manner with any other component(s) of the pharmaceutical composition, its use is contemplated to be within the scope of this invention.
Targeted therapeutics described herein (or a composition or medicament containing a targeted therapeutics described herein) can be administered by any appropriate route generally known in the art. In some embodiments, a targeted therapeutic or a pharmaceutical composition containing the same is administered systemically. Systemic administration may be intravenous, intramuscular, intradermal, by inhalation, transdermal (topical), intraocular, subcutaneous, oral and/or transmucosal. In some embodiments, a targeted therapeutics or a pharmaceutical composition containing the same is administered by intramuscular injection. In some embodiments, a targeted therapeutics or a pharmaceutical composition containing the same is administered subcutaneously. Administration may be performed by injecting a composition into areas including, but not limited to, the thigh region, abdominal region, gluteal region, or scapular region. In some embodiments, a targeted therapeutics or a pharmaceutical composition containing the same is administered intravenously. In some embodiments, a targeted therapeutics or a pharmaceutical composition containing the same is administered orally. More than one route can be used concurrently, if desired. All of the administration routes disclosed herein are generally known in the art, and the skilled artisan would know how to administer targeted therapeutics of the present invention by these routes.
In some embodiments, pharmaceutical compositions according to the present invention can be used for CNS delivery via various techniques and routes including, but not limited to, intraparenchymal, intracerebral, intravetricular cerebral (ICV), intrathecal (e.g., IT-Lumbar, IT-cisterna magna) administrations and any other techniques and routes for injection directly or indirectly to the CNS and/or CSF.
In some embodiments, pharmaceutical compositions according to the present invention can be used for intrathecal administration. As used herein, intrathecal administration (also referred to as intrathecal injection or intrathecal delivery) refers to an injection into the spinal canal (intrathecal space surrounding the spinal cord). Various formulations for intrathecal administration are described in WO/2011/163652, the contents of which are incorporated herein by reference.
According to the present invention, a pharmaceutical composition containing a targeted therapeutics may be injected at any region surrounding the spinal canal. In some embodiments, a pharmaceutical composition containing a targeted therapeutics is injected into the lumbar area or the cisterna magna or intraventricularly into a cerebral ventricle space. As used herein, the term “lumbar region” or “lumbar area” refers to the area between the third and fourth lumbar (lower back) vertebrae and, more inclusively, the L2-S1 region of the spine. Typically, intrathecal injection via the lumbar region or lumber area is also referred to as “lumbar IT delivery” or “lumbar IT administration.”
Various devices may be used for intrathecal delivery according to the present invention. In some embodiments, a device for intrathecal administration contains a fluid access port (e.g., injectable port); a hollow body (e.g., catheter) having a first flow orifice in fluid communication with the fluid access port and a second flow orifice configured for insertion into spinal cord; and a securing mechanism for securing the insertion of the hollow body in the spinal cord. As a non-limiting example, a suitable securing mechanism contains one or more nobs mounted on the surface of the hollow body and a sutured ring adjustable over the one or more nobs to prevent the hollow body (e.g., catheter) from slipping out of the spinal cord. In various embodiments, the fluid access port comprises a reservoir. In some embodiments, the fluid access port comprises a mechanical pump (e.g., an infusion pump). In some embodiments, an implanted catheter is connected to either a reservoir (e.g., for bolus delivery), or an infusion pump. The fluid access port may be implanted or external
In some embodiments, intrathecal administration may be performed by either lumbar puncture (i.e., slow bolus) or via a port-catheter delivery system (i.e., infusion or bolus). In some embodiments, the catheter is inserted between the laminae of the lumbar vertebrae and the tip is threaded up the thecal space to the desired level (generally L3-L4).
For injection, formulations of the invention can be formulated in liquid solutions. In addition, the enzyme may be formulated in solid form and re-dissolved or suspended immediately prior to use. Lyophilized forms are also included. The injection can be, for example, in the form of a bolus injection or continuous infusion (e.g., using infusion pumps) of the enzyme.
Treatment of Pompe Disease, San B and Other Lysosomal Storage Diseases
The present invention may be used to effectively treat Pompe Disease, Sanfilippo Syndrome Type B and other lysosomal storage diseases.
Pompe disease, or Glycogen Storage Disease Type II, is an autosomal recessive metabolic disorder resulting from a deficiency or dysfunction of the lysosomal hydrolase acid alpha-glucosidase (GAA). GAA is localized to lysosomes and plays an important role in the catabolism of glycogen into glucose. In the absence of the enzyme, these glycogen accumulates within the cells, ultimately causing engorgement, followed by cellular death and tissue destruction. Due the widespread expression of the enzyme, multiple cell types and organ systems are affected in Pompe patients.
Unlike San B, which displays CNS degeneration as the predominant defining clinical feature, Pompe disease is characterized by a degeneration within the peripheral tissues of the body. In particular, glycogen build-up results in progressive muscle weakness (myopathy) throughout the body, specifically affecting the tissues of the heart, skeletal muscles, as well as liver and kidneys. Typical findings are those of enlarged heart with non-specific conduction defects, along with several indicators of kidney disease, such as high levels of serum creatine kinase, aldolase, aspartate transaminase and lactic dehydrogenase. The disease typically manifests itself in the first several month of life, with cardiomegaly, hypotonia, cardiomyopathy, respiratory distress and muscle weakness. Some affected individuals experience a progressive loss of skeletal muscle, cardiac or kidney function, with most affected individuals dying of disease-associated complications in their first or second decade.
Sanfilippo Syndrome Type B (San B), or Mucopolysaccharidosis III B (MPS III B), is a heritable metabolic disorder resulting from a deficiency of the enzyme Naglu. Naglu is localized to lysosomes and plays an important role in the catabolism of glycosaminoglycans (GAGs) heparan- and dermatan-sulfate. In the absence of enzyme, these substrates accumulate within cells, ultimately causing engorgement, followed by cellular death and tissue destruction. Due to the widespread expression of Naglu, multiple cell types and organ systems are affected in MPS III B patients.
A defining clinical feature of San B is central nervous system (CNS) degeneration, however, which typically results in cognitive impairment (e.g., decrease in IQ). Additionally, MRI scans of affected individuals have revealed white matter lesions, dilated perivascular spaces in the brain parenchyma, ganglia, corpus callosum, and brainstem; atrophy; and ventriculomegaly (Wang et al. Molecular Genetics and Metabolism, 2009). The disease typically manifests itself in the first years of life with organomegaly and skeletal abnormalities. Some affected individuals experience a progressive loss of cognitive function, with most affected individuals dying of disease-associated complications in their first or second decade.
Compositions and methods of the present invention may be used to effectively treat individuals suffering from or susceptible to Pompe Disease or San B. The terms “treat” or “treatment,” as used herein, refer to amelioration of one or more symptoms associated with the disease, prevention or delay of the onset of one or more symptoms of the disease, and/or lessening of the severity or frequency of one or more symptoms of the disease.
In some embodiments, treatment refers to partial or complete alleviation, amelioration, relief, inhibition, delay of onset, reduction of severity and/or incidence of impairment in a Pompe Disease or San B patient. As used herein, the term “impairment” includes various symptoms in various organ systems commonly associated with Pompe Disease and/or San B (e.g., in the brain and spinal cord or skeletal or heart muscle). Symptoms of neurological impairment may include, for example, e.g., cognitive impairment; white matter lesions; dilated perivascular spaces in the brain parenchyma, ganglia, corpus callosum, and/or brainstem; atrophy; and/or ventriculomegaly, among others. Symptoms often associated with Pompe Disease include, for example, weakness of skeletal muscle and heart failure and respiratory weakness.
The terms, “improve,” “increase” or “reduce,” as used herein, indicate values that are relative to a control. In some embodiments, a suitable control is a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control individual (or multiple control individuals) in the absence of the treatment described herein. A “control individual” is an individual afflicted with a lysosomal storage disease (e.g., San B, Pompe Disease), who is about the same age and/or gender as the individual suffering from the same lysosmal storage disease, who is being treated (to ensure that the stages of the disease in the treated individual and the control individual(s) are comparable).
The individual (also referred to as “patient” or “subject”) being treated is an individual (fetus, infant, child, adolescent, or adult human) having a lysosomal storage disease or having the potential to develop a lysosmal storage disease. In some embodiments, the lysosmal storage disease is Pompe Disease or Sanfilippo Syndrome. In some specific embodiments the lysosomal storage disease is San B. The individual can have residual endogenous GAA or Naglu expression and/or activity, or no measurable activity. For example, the individual having Pompe Disease may have GAA expression levels that are less than about 30-50%, less than about 25-30%, less than about 20-25%, less than about 15-20%, less than about 10-15%, less than about 5-10%, less than about 0.1-5% of normal GAA expression levels. For example, the individual having San B may have Naglu expression levels that are less than about 30-50%, less than about 25-30%, less than about 20-25%, less than about 15-20%, less than about 10-15%, less than about 5-10%, less than about 0.1-5% of normal Naglu expression levels.
In some embodiments, the individual is an individual who has been recently diagnosed with the disease. Typically, early treatment (treatment commencing as soon as possible after diagnosis) is important to minimize the effects of the disease and to maximize the benefits of treatment.
All references cited herein are incorporated herein by reference in their entirety.
The invention will be more fully understood by reference to the following examples. They should not, however, be construed as limiting the scope of the invention.
EXAMPLES Example 1: Generation of Components for PCSK9 Fusion Proteins
The present invention provides, among other things, methods and compositions for lysosomal targeting of a therapeutic protein (e.g. a lysosmal enzyme) based on a lysosomal targeting moiety. The current example, discloses a general method for producing one or more targeted therapeutic proteins, by generating a translational fusion protein between a lysosmal enzyme and a lysosomal targeting moiety. It will be understood from the teachings within the specification, that in some embodiments, one or more auxiliary proteins may also be produced to form a protein complex with the lysosmal targeting moiety.
The lysosomal enzymes acid alpha-glucosidase (GAA) and N-acetylglucosaminidase (Naglu) were chosen as candidate proteins, since it has been demonstrated that deficiency of each individual protein plays a central role in the development of Pompe disease and Sanpfilippo Syndrome (Mucopolysaccharidosis III) Type B, respectively. However, it will be understood by one skilled in the art, that such an approach is broadly applicable in generating fusion therapeutics for conditions associated with any lysosomal storage disease. It is contemplated that suitable fusion therapeutics of the current invention facilitate cellular uptake and lysosomal targeting and have an enzyme activity substantially similar to the native enzyme.
A lysosomal targeting moiety may be associated with a suitable therapeutic enzyme (e.g., lysosomal enzyme) covalently or non-covalently. For example, a lysosomal targeting moiety may be chemically conjugated to a therapeutic enzyme. Alternatively, a lysosomal targeting moiety may be fused to a therapeutic enzyme as a fusion protein. In yet further embodiments, a lysosomal targeting moiety (lysosomal targeting moiety) may be coupled, and or bound, to an auxiliary protein, to form a protein complex. In this example, a series of two constructs was created, each designed to express GAA or Naglu, fused to PCSK9. While PCSK9 is used as the representative lysosomal targeting moiety, it will be understood by one skilled in the art, that any lysosomal targeting moiety such as, PC proteins, proteins with a CHRD domain, proteins capable of binding to low density lipoprotein receptor (LDLR), amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, or low density lipoprotein receptor-related protein 8 (Lrp8)) or fragment thereof, may be used. For the example, a construct was also generated, encoding an auxiliary protein capable of forming a protein complex with a lysosmal targeting moiety.
PCSK9-GAA
An exemplary PCSK9-GAA fusion protein comprising S386A and F379A point mutations was created by connecting a nucleid acid encoding PCSK9 comprising S386A and F379A point mutations to a nucleic acid encoding GAA via an intervening GlyGlyGly-encoding linker (SEQ ID NO:14). The amino acid sequence resulting from the ranslation of (SEQ ID NO:14) is shown below (SEQ ID NO:17).
(SEQ ID NO: 17)
MGTVSSRRSWWPLPLLLLLLLLLGPAGARASIPWNLERITPPRYRADEYQPPDGGSLVEV
YLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGV
AKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAA
CQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCV
DLFAPGEDIIGASSDCSTC A VSQSGT A QAAAHVAGIAAMMLSAEPELTLAELRQRLIHFS
AKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCA
PDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVH
TAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASI
HASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCV
Figure US10556015-20200211-C00029
Figure US10556015-20200211-C00030
Figure US10556015-20200211-C00031
Figure US10556015-20200211-C00032
Figure US10556015-20200211-C00033
Figure US10556015-20200211-C00034
Figure US10556015-20200211-C00035
Figure US10556015-20200211-C00036
Figure US10556015-20200211-C00037
Figure US10556015-20200211-C00038
Figure US10556015-20200211-C00039
Figure US10556015-20200211-C00040
Figure US10556015-20200211-C00041
Figure US10556015-20200211-C00042
Figure US10556015-20200211-C00043
Figure US10556015-20200211-C00044

(1) The amino acid sequence of PCSK9 signal peptide is underlined.
(2) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold) is not underlined, bold or in italics.
(3) The amino acid sequence of the GlyGlyGly linker is underlined.
(4) The amino acid sequence of Mature Form GAA Protein (aa70-952) is bold and in italics.
Naglu-PCSK9
An exemplary Naglu-PCSK9 fusion protein comprising S386A and F379A point mutations was created by connecting a nucleic acid encoding Naglu to a nucleic acid encoding PCSK9 comprising S386A and F379A point mutations via an intervening GlyGlyGly-encoding linker (SEQ ID NO:15). The amino acid sequence resulting from the translation of (SEQ ID NO:15) is shown below (SEQ ID NO:18).
(SEQ ID NO: 18)
MEAVAVAAAVGVLLLAGAGGAAGDEAREAAAVRALVARLLGPGPAADFSVSVERALAA
KPGLDTYSLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPA
VPGELTEATPNRYRYYQNVCTQSYSFVWWDWARWEREIDWMALNGINLALAWSGQEA
IWQRVYLALGLTQAEINEFFTGPAFLAWGRMGNLHTWDGPLPPSWHIKQLYLQHRVLDQ
MRSFGMTPVLPAFAGHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPIFPIIGS
LFLRELIKEFGTDHIYGADTFNEMQPPSSEPSYLAAATTAVYEAMTAVDTEAVWLLQGW
LFQHQPQFWGPAQIRAVLGAVPRGRLLVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGG
NHGLFGALEAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPD
LAAWVTSFAARRYGVSHPDAGAAWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTS
IWYNRSDVFEAWRLLLTSAPSLATSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELA
SLLRAGGVLAYELLPALDEVLASDSRFLLGSWLEQARAAAVSEAEADFYEQNSRYQLTL
WGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQ
AFVLSKQRYPSQPRGDTVDLAKKIFLKYYPRWVAGSWGGG SIPWNLERITPPRYRADEYQ
PPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVV
SGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVL
NAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVD
Figure US10556015-20200211-C00045
EAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSS
FSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRV
HCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKV
KEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTA
VAICCRSRHLAQASQELQ 

(1) The amino acid sequence of Naglu signal peptide is underlined.
(2) The amino acid sequence of Mature Form of Naglu is not underlined, bold or in italics.
(3) The amino acid sequence of the GlyGlyGly linker is underlined.
(4) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold as well) is in italics.
PCSK9-Propeptide (PPP)
To facilitate formation of a lysosmal targeting moiety protein complex, a suitable auxiliary protein was created by generating a nucleic acid encoding PCSK9 signal peptide and PCSK9 propeptide (SEQ ID NO:16). The amino acid sequence resulting from the translation of (SEQ ID NO:16) is shown below (SEQ ID NO:19).
(SEQ ID NO: 19)
MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEED
GLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQA
QAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVF
AQ

The amino acid sequence of PCSK9 signal peptide is underlined.
Sig/Pro-PCSK9-GAA
An exemplary Sig/Pro-PCSK9-GAA fusion protein comprising S386A and F379A point mutations was created by connecting a nucleic acid encoding PCSK9 comprising S386A and F379A point mutations to a nucleic acid encoding GAA via an intervening GlyGlyGly-encoding linker. The amino acid sequence resulting from the translation of this DNA is shown below (SEQ ID NO:20).
MGTVSSRRSWWPLPLLLLLLLLLGPAGARA QEDEDGDYEELVLALRSEEDGLAEAPEHGT
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFL
VKMSGDLLELALKLPHVDYIEEDSSVFAQ RRRRR SIPWNLERITPPRYRADEYQPPDGGSLV
EVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDA
GVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLN
AACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGR
CVDLFAPGEDIIGASSDCSTC A VSQSGT A QAAAHVAGIAAMMLSAEPELTLAELRQRLIH
FSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVAR
CAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCS
VHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHRE
ASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNT
Figure US10556015-20200211-C00046
Figure US10556015-20200211-C00047
Figure US10556015-20200211-C00048
Figure US10556015-20200211-C00049
Figure US10556015-20200211-C00050
Figure US10556015-20200211-C00051
Figure US10556015-20200211-C00052
Figure US10556015-20200211-C00053
Figure US10556015-20200211-C00054
Figure US10556015-20200211-C00055
Figure US10556015-20200211-C00056
Figure US10556015-20200211-C00057
Figure US10556015-20200211-C00058
Figure US10556015-20200211-C00059
Figure US10556015-20200211-C00060
Figure US10556015-20200211-C00061

(1) The amino acid sequence of PCSK9 signal peptide is underlined.
(2) The amino acid sequence of PCSK9 propeptide is in italics.
(3) The amino acid sequence of a Furin proteolytic cleavage site is bolded and underlined.
(4) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold) is not underlined, bold or in italics.
(5) The amino acid sequence of the GlyGlyGly linker is underlined.
(6) The amino acid sequence of Mature Form GAA Protein (aa70-952) is bold and in italics.
Nucleic acids encoding a fusion protein and an auxiliary protein can be individually subcloned into mammalian expression vectors of choice. These expression constructs may then be transfected into a human cell line, and the cell line may be screened to generate over-expressing cell clones. To produce functional targeted therapeutics, a fusion protein is co-espressed with an auxiliary protein, for example PCSK9 propeptide, to ensure proper association between the two, which ensures endocytosis of the complex.
SEQ ID NO:17-19 are amino acid sequences which still contain the amino acids of PCSK9 or Naglu N-terminal signal peptides. These signal peptides are typically removed during intracellular processing and and are typically not present in the final targeted therapeutic drug product. Below are depitcted the amino acid sequences of targeted therapeutics resulting from, in order, expression of proteins defined by SEQ ID NO:17-19:
PCSK9-GAA
(SEQ ID NO: 21)
SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDG
TRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIR
KSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAP
EVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTC A VSQSGT A QAAAH
VAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGA
GWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVC
RAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWE
VEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVAC
EEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQ
Figure US10556015-20200211-C00062
Figure US10556015-20200211-C00063
Figure US10556015-20200211-C00064
Figure US10556015-20200211-C00065
Figure US10556015-20200211-C00066
Figure US10556015-20200211-C00067
Figure US10556015-20200211-C00068
Figure US10556015-20200211-C00069
Figure US10556015-20200211-C00070
Figure US10556015-20200211-C00071
Figure US10556015-20200211-C00072
Figure US10556015-20200211-C00073
Figure US10556015-20200211-C00074
Figure US10556015-20200211-C00075
Figure US10556015-20200211-C00076
Figure US10556015-20200211-C00077

(1) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold) is not underlined, bold or in italics.
(2) The amino acid sequence of the GlyGlyGly linker is underlined.
(3) The amino acid sequence of Mature Form GAA Protein (aa70-952) is bold and in italics.
Naglu-PCSK9
(SEQ ID NO: 22)
DEAREAAAVRALVARLLGPGPAADFSVSVERALAAKPGLDTYSLGGGGAARVRVRGST
GVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPAVPGELTEATPNRYRYYQNVCTQSY
SFVWWDWARWEREIDWMALNGINLALAWSGQEAIWQRVYLALGLTQAEINEFFTGPAF
LAWGRMGNLHTWDGPLPPSWHIKQLYLQHRVLDQMRSFGMTPVLPAFAGHVPEAVTRV
FPQVNVTKMGSWGHFNCSYSCSFLLAPEDPIFPIIGSLFLRELIKEFGTDHIYGADTFNEM
QPPSSEPSYLAAATTAVYEAMTAVDTEAVWLLQGWLFQHQPQFWGPAQIRAVLGAVPRG
RLLVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGGNHGLFGALEAVNGGPEAARLFPN
STMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPDLAAWVTSFAARRYGVSHPDAGA
AWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTSIWYNRSDVFEAWRLLLTSAPSLA
TSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELASLLRAGGVLAYELLPALDEVLA
SDSRFLLGSWLEQARAAAVSEAEADFYEQNSRYQLTLWGPEGNILDYANKQLAGLVANY
YTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVDLAKK
IFLKYYPRWVAGSWGGG SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEG
RVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKG
TVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDAC
Figure US10556015-20200211-C00078
AAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGA
GWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHN
AFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTH
KPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCS
ALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ 

(1) The amino acid sequence of Mature Form of Naglu is not underlined, bold or in italics.
(2) The amino acid sequence of the GlyGlyGly linker is underlined.
(3) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold as well) is in italics.
PCSK9-Propeptide (PPP)
(SEQ ID NO: 23)
QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVV
VLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDL
LELALKLPHVDYIEEDSSVFAQ
SEQ ID NO:20 is an amino acid sequences which still contains the amino acids of the PCSK9 N-terminal signal peptide and propeptide. It is envisioned that the signal peptide is typically removed during intracellular processing and is typically not present in the final targeted therapeutic drug product. The Furin proteolytic cleavage site will be cleaved intracellularly and the fusion comprising PCSK9 and GAA will form a complex with the released propeptide.
For protein based assays and receptor binding experiments, recombinant protein may be produced in a wave bioreactor, using a mammalian cell culture expressing system. Following expression, protein/protein complexes may be purified using conventional protein purification methods.
Example 2: Activity Assay
Following purification, each fusion protein can be evaluated for proper function, by examining its specific activity and enzyme kinetics using a well-defined cleavable substrate. Based on this analysis, PSK9-GAA- and Naglu-PCSK9 binding constants and specificity for the enzyme substrate can be compared to each respective wildtype lysosomal enzyme, to ensure enzyme function is similar to the native protein.
Example 3: Fusion Protein Binding Studies
Studies will also be carried out to determine the binding properties of PCSK9-GAA and Naglu-PCSK9 fusion proteins, and evaluate their specificity for various cognate protein binding partners. For the approach, a surface plasmone resonance (SPR) assay will be employed using standard techniques.
There are four possible scenarios of carrying out this SPR assay. Firstly, the binding protein (such as, but not limited to this listed in Table 6 below) serving as “ligand” are diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system. A solution containing purified PCSK9-GAA or Naglu-PCSK9 protein, serving as the “analyte”, is then injected into the device. Secondly, the PCSK9-GAA or Naglu-PCSK9 protein, serving as “ligand,” are diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system. A solution containing the binding proteins (such as, but not limited to this listed in Table 6 below), serving as the “analyte,” is then injected into the device. Thirdly, a “capturing molecule,” such as an anti-PCSK9-GAA or anti-Naglu-PCSK9 antibody, is diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system. Next, a solution containing PCSK9-GAA or Naglu-PCSK9, serving as the “ligand,” is injected into the microflow system and run over surface to bind the antibody to form a “capture complex.” A solution containing binding protein, serving as the “analyte,” is then injected into the device.
Fourthly, a “capturing molecule,” such as anti-binding protein antibody, is diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system. Next, a solution containing recombinant “binding protein” (such as, but not limited to, those listed in Table 6 below), serving as the “ligand,” is injected into the microflow system and run over surface to bind the antibody to form a “capture complex.” A solution containing purified PCSK9-GAA or Naglu-PCSK9 protein, serving as the “analyte,” is then injected into the device.
In all four scenarios, as the solution runs over the SPR sensor chip, the analyte binds to the ligant and/or capture complex, and an increase in SPR signal (expressed in response units, RU) is observed. After a predetermined period of time, a solution without the analyte is injected into the microfluidic device, resulting in dissociation of the interaction between analyte and ligant and/or capture complex, inn turn resulting in a decrease in SPR signal.
TABLE 6
Potential PCSK9 Secondary Binding Proteins
Low Density Lipoprotein Receptor (LDLR)
Amyloid Precursor-like Protein 2 (APLP2)
Dynamin
Amyloid Precursor Protein (APP)
Autosomal Recessive Hypercholesterolemia (ARH)
Proposed experimental conditions for use with the surface plasmone resonance (SPR) assay are described in Table 7 below.
TABLE 7
Experimental Design For Exemplary Surface Plasmone Resonance Assay (Scenario 4)
Capturing Analyte Flow Association Dissociation
Molecule Ligand Analyte Conc. Rate Time Time
anti- Protein Naglu-PCSK9  0 nM 30 μl/min 300 sec 300 sec
binding from Naglu-PCSK9 0.625 nM  
protein Table 6 Naglu-PCSK9 1.25 nM
antibody Naglu-PCSK9 2.5 nM 
Naglu-PCSK9  5 nM
Naglu-PCSK9 10 nM
Naglu-PCSK9 20 nM
anti- Protein PCSK9-GAA-  0 nM 30 μl/min 300 sec 300 sec
binding from PCSK9-GAA 0.625 nM  
protein Table 6 PCSK9-GAA 1.25 nM
antibody PCSK9-GAA 2.5 nM 
PCSK9-GAA  5 nM
PCSK9-GAA 10 nM
PCSK9-GAA 20 nM
To evaluate the overall specificity of each PCSK9 fusion protein, a competitive inhibition study may also be performed using a SPR assay. For the study, a purified protein comprising one or more human CHRD domains, referred to as an “inhibitor protein,” can be used. Since it is suggested that PCSK9 binds to cognate proteins via it's CHRD domain, the protein can competitively inhibit binding between PCSK9 and the potential target binding partner. Alternatively, an antibody that binds to the PCSK9 binding site on the human LDLR, referred to as an “LDLR blocker”, may also be used. Briefly, anti-binding protein antibody, the “capturing molecule,” is diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system. Next, a solution containing recombinant protein (such as, but not limited to, amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, and low density lipoprotein receptor-related protein 8 (Lrp8)) or LDLR, serving as the “Ligand,” is injected into the microflow system and run over the surface to bind the antibody to form a “capture complex.” A solution containing purified Naglu-PCSK9 or PCSK9-GAA protein with or without 20 μM inhibitor protein is injected into the device and analyzed for binding. After a predetermined period of time, a solution without the analyte is injected into the microfluidic device, dissociating any possible interaction between the analyte and the capture complex, and resulting in a decrease in SPR signal. The experimental conditions used for the assay are described in Table 8 below.
TABLE 8
Experimental Design For Exemplary Surface Plasmone Resonance Assay
Capturing Analyte Inhibitor Flow Assoc. Dissoc.
Molecule Ligand Analyte (Conc.) (Conc.) Rate Time Time
anti- protein Naglu-PCSK9 0.0 nM 0.0 μM  30 μl/ 300 sec 300 sec
binding from Naglu-PCSK9 0.0 nM 20 μM min
protein table 6 Naglu-PCSK9 0.625 nM  20 μM
antibody Naglu-PCSK9 1.25 nM  20 μM
Naglu-PCSK9 2.5 nM 20 μM
Naglu-PCSK9 5 nM 20 μM
Naglu-PCSK9  10 nM 20 μM
Naglu-PCSK9  20 nM 20 μM
anti- protein PCSK9-GAA 0.0 nM 0.0 μM  30 μl/ 300 sec 300 sec
binding from PCSK9-GAA 0.0 nM 20 μM min
protein table 6 PCSK9-GAA 0.625 nM  20 μM
antibody PCSK9-GAA 1.25 nM  20 μM
PCSK9-GAA 2.5 nM 20 μM
PCSK9-GAA 5 nM 20 μM
PCSK9-GAA  10 nM 20 μM
PCSK9-GAA  20 nM 20 μM
The inverse study can also be performed to evaluate competitive inhibition of Naglu-PCSK9 and PCSK9-GAA by an inhibitor protein or LDLR blocker (an antibody that blocks PCSK9 binding to the LDLR), in which the concentration of each PCSK9 fusion protein is held constant and assayed against varying concentrations of inhibitor protein or LDLR blocker. Briefly, anti-binding protein antibody “capturing molecule” is diluted in immobilization buffer and bound on the dextran surface of a SPR sensor chip housed in a microfluidic system. Next, a solution containing recombinant protein, serving as the “ligand,” is injected into the microflow system and run over surface to bind the antibody to form a “capture complex.” A solution containing each purified PCSK9 fusion protein at 20 nM, along with 0-1.5 uM of inhibitor protein or LDLR blocker, is injected into the device and analyzed for binding. After a predetermined period of time, a solution without the analyte is injected into the microfluidic device, dissociating any possible interaction between the analyte and the capture complex, and resulting in a decrease in SPR signal. The experimental conditions for use in performing the assay are described in Table 9 below.
TABLE 9
Experimental Design For Exemplary Surface Plasmone Resonance Assay
Capturing Analyte Inhibitor Flow Assoc. Dissoc.
Molecule Ligand Analyte (Conc.) (Conc.) Rate Time Time
anti- protein Naglu-PCSK9 20 nM 0.0 nM 30 μl/ 300 sec 300 sec
binding from Naglu-PCSK9 20 nM 25 nM min
protein table 6 Naglu-PCSK9 20 nM 50 nM
Naglu-PCSK9 20 nM 100 nM
Naglu-PCSK9 20 nM 200 nM
Naglu-PCSK9 20 nM 400 nM
Naglu-PCSK9 20 nM 600 nM
Naglu-PCSK9 20 nM 1.0 μM
Naglu-PCSK9 20 nM 1.5 μM
anti- protein PCSK9-GAA 20 nM 0.0 nM 30 μl/ 300 sec 300 sec
binding from PCSK9-GAA 20 nM 25 nM min
protein table 6 PCSK9-GAA 20 nM 50 nM
PCSK9-GAA 20 nM 100 nM
PCSK9-GAA 20 nM 200 nM
PCSK9-GAA 20 nM 400 nM
PCSK9-GAA 20 nM 600 nM
PCSK9-GAA 20 nM 1.0 μM
PCSK9-GAA 20 nM 1.5 μM
Example 4: In Vitro Studies
Cellular Uptake Assays
Studies may also be performed to assess lysosomal targeting and cellular uptake of lysosomal targeted therapeutics, in accordance with the claimed invention. In this particular representative example, a lysosmal targeting assay is described that uses PCSK9-GAA and Naglu-PCSK9 fusion proteins. However, one skilled in the art will appreciate that Example 4 teaches a general assay method that may be used to evaluate any lysosomal targeted therapeutic in accordance with the teachings of the instant application. The cell line of choice for this assay is C2C12 cell, which is a mouse myoblast cell lines (Yaffe D. and Saxel O; Serial passaging and differentiation of myogenic cells isolated from dystrophic mouse muscle; Nature 270 (5639): 725-727 (1977)) that has been utilized by scientists estimating the cellular uptake of GAA into muscle cells. The C2C12 cells are grown to confluence and treated with a solution of recombinant Naglu-PCSK9 or PCSK9-GAA, which is complexed with recombinant PCSK9-Propeptide (PPP). After a specified period of time, supernatant is removed, cells washed repeatedly; and following lysis each sample is assayed for Naglu and/or GAA enzyme activity.
Visualization of Lysosomal Targeting and Entry of Naglu-PCSK9 and PCSK9-GAA
Studies may also be carried out to evaluate cellular lysosomal targeting and entry using fluorescent immunomicroscopy. For the study, C2C12 cell lines, as described above, are treated with or without recombinant Naglu-PCSK9 or PCSK9-GAA which has been complexed with PPP. Following treatment, the cells are fixed and prepared for staining. Both control and treated cells are stained using antibodies specific for each lysosomal protein (GAA or Naglu) along with Lamp-1, a lysosome specific protein biomarker. Cells are assayed for cellular internalization of each fusion protein by immunofluroescent microscopy.

Claims (5)

We claim:
1. A targeted therapeutic fusion protein comprising a lysosomal enzyme fused to a lysosomal targeting moiety comprising a proprotein convertase subtilisin kexin type 9 (PCSK9) protein comprising amino acid substitutions S386A and F379A.
2. The targeted therapeutic fusion protein of claim 1, wherein the lysosomal enzyme is an acid alpha glucosidase (GAA) protein, comprising an amino acid sequence at least 80% identical to SEQ ID NO: 1.
3. The targeted therapeutic fusion protein of claim 1, wherein the lysosomal enzyme is an alpha-N-acetylglucosaminidase (Naglu) protein comprising an amino acid sequence at least 80% identical to SEQ ID NO: 4.
4. The targeted therapeutic fusion protein of claim 1, wherein the lysosomal targeting moiety and the lysosomal enzyme are fused via a linker.
5. The targeted therapeutic fusion protein of claim 4, wherein the linker comprises a sequence of GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAPG GGGGAAAAAGGGGGGAP, which is SEQ ID NO: 13.
US15/521,130 2014-10-24 2015-10-23 Lysosomal targeting of enzymes, and uses thereof Active US10556015B2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/521,130 US10556015B2 (en) 2014-10-24 2015-10-23 Lysosomal targeting of enzymes, and uses thereof

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US201462068033P 2014-10-24 2014-10-24
US15/521,130 US10556015B2 (en) 2014-10-24 2015-10-23 Lysosomal targeting of enzymes, and uses thereof
PCT/US2015/057214 WO2016065319A1 (en) 2014-10-24 2015-10-23 Lysosomal targeting of enzymes, and uses thereof

Publications (2)

Publication Number Publication Date
US20170333569A1 US20170333569A1 (en) 2017-11-23
US10556015B2 true US10556015B2 (en) 2020-02-11

Family

ID=54478975

Family Applications (1)

Application Number Title Priority Date Filing Date
US15/521,130 Active US10556015B2 (en) 2014-10-24 2015-10-23 Lysosomal targeting of enzymes, and uses thereof

Country Status (4)

Country Link
US (1) US10556015B2 (en)
EP (1) EP3220958A1 (en)
MA (1) MA40791A (en)
WO (1) WO2016065319A1 (en)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11208458B2 (en) 2017-06-07 2021-12-28 Regeneron Pharmaceuticals, Inc. Compositions and methods for internalizing enzymes
US20220133863A1 (en) * 2010-06-25 2022-05-05 Shire Human Genetic Therapies, Inc. Treatment of sanfilippo syndrome type b
US11421211B2 (en) * 2016-09-12 2022-08-23 Genethon Acid-alpha glucosidase variants and uses thereof
US12168041B2 (en) 2010-06-25 2024-12-17 Takeda Pharmaceutical Company Limited Methods and compositions for CNS delivery of arylsulfatase A
US12252544B2 (en) 2018-05-17 2025-03-18 Regeneron Pharmaceuticals, Inc. Anti-CD63 antibodies, conjugates, and uses thereof
US12258597B2 (en) 2018-02-07 2025-03-25 Regeneron Pharmaceuticals, Inc. Methods and compositions for therapeutic protein delivery

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DK3386534T3 (en) * 2015-12-08 2020-11-30 Regeneron Pharma Compositions and methods for internalizing enzymes
WO2018046774A1 (en) * 2016-09-12 2018-03-15 Genethon Acid-alpha glucosidase variants and uses thereof
EP3293203A1 (en) * 2016-09-12 2018-03-14 Genethon Acid-alpha glucosidase variants and uses thereof
JP7252211B2 (en) * 2017-09-08 2023-04-04 ザ ヌムール ファウンデーション Agents, devices, and blood circulation systems for treating lysosomal storage diseases and methods for treating lysosomal storage diseases
KR102871690B1 (en) 2018-04-30 2025-10-16 리제너론 파마슈티칼스 인코포레이티드 Antibodies and bispecific antigen-binding molecules and conjugates binding to HER2 and/or APLP2 and uses thereof
US12053510B2 (en) 2018-05-01 2024-08-06 Orfoneuro Aps Treatment of neuronal ceroid lipofuscinosis
WO2024151982A1 (en) * 2023-01-13 2024-07-18 Amicus Therapeutics, Inc. Gene therapy constructs for the treatment of pompe disease

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003102583A1 (en) 2002-05-29 2003-12-11 Symbiontics, Inc. Targeted therapeutic proteins
WO2005078077A2 (en) 2004-02-10 2005-08-25 Zystor Therapeutics, Inc. Acid alpha-glucosidase and fragments thereof
US20050281805A1 (en) 2002-05-29 2005-12-22 Symbiontics, Inc. Targeted therapeutic proteins
WO2009137721A2 (en) 2008-05-07 2009-11-12 Zystor Therapeutics, Inc. Lysosomal targeting peptides and uses thereof
WO2010148253A2 (en) 2009-06-17 2010-12-23 Zystor Therapeutics, Inc. Formulations for lysosomal enzymes
US20110003315A1 (en) * 2006-05-08 2011-01-06 Institut De Recherches Cliniques De Montreal Chimeric pcsk9 proteins, cells comprising same, and assays using same
WO2011163652A2 (en) 2010-06-25 2011-12-29 Shire Human Genetic Therapies, Inc. Treatment of sanfilippo syndrome type b
EP2471929A1 (en) * 2010-12-29 2012-07-04 Algenics Production of high mannose glycosylated proteins stored in the plastid of microalgae
WO2014085621A1 (en) 2012-11-27 2014-06-05 Biomarin Pharmaceutical Inc. Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof

Patent Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003102583A1 (en) 2002-05-29 2003-12-11 Symbiontics, Inc. Targeted therapeutic proteins
US20050281805A1 (en) 2002-05-29 2005-12-22 Symbiontics, Inc. Targeted therapeutic proteins
WO2005078077A2 (en) 2004-02-10 2005-08-25 Zystor Therapeutics, Inc. Acid alpha-glucosidase and fragments thereof
US20110003315A1 (en) * 2006-05-08 2011-01-06 Institut De Recherches Cliniques De Montreal Chimeric pcsk9 proteins, cells comprising same, and assays using same
WO2009137721A2 (en) 2008-05-07 2009-11-12 Zystor Therapeutics, Inc. Lysosomal targeting peptides and uses thereof
US20110223147A1 (en) * 2008-05-07 2011-09-15 Zystor Therapeutics, Inc. Lysosomal targeting peptides and uses thereof
WO2010148253A2 (en) 2009-06-17 2010-12-23 Zystor Therapeutics, Inc. Formulations for lysosomal enzymes
WO2011163652A2 (en) 2010-06-25 2011-12-29 Shire Human Genetic Therapies, Inc. Treatment of sanfilippo syndrome type b
US20110318327A1 (en) * 2010-06-25 2011-12-29 Shire Human Genetic Therapies, Inc. Treatment of sanfilippo syndrome type b
EP2471929A1 (en) * 2010-12-29 2012-07-04 Algenics Production of high mannose glycosylated proteins stored in the plastid of microalgae
WO2014085621A1 (en) 2012-11-27 2014-06-05 Biomarin Pharmaceutical Inc. Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
Bosshart, H. et al., "The cytoplasmic domain mediates localization of furin to the trans-Golgi network en route to the endosomal/lysosomal system", J Cell Biol., 126(5): 1157-1172 (1994).
Desnick et al., Enzyme Replacement Therapy for Lysosomal Diseases: Lessons from 20 Years of Experience and Remaining Challenges, Annu. Rev. Genom. Human Genet., 2012, 13:307-335. *
DeVay, R. M. et al., "Characterization of Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) Trafficking Reveals a Novel Lysosomal Targeting Mechanism via Amyloid Precursor-like Protein 2 (APLP2)", J Biol Chem., 288(15): 10805-18 (2013).
Kourimate et al., Cellular and secreted pro-protein convertase subtilisin/kexin type 9 catalytic activity in hepatocytes, Atherosclerosis, 206 (2009), pp. 134-140. *
Wolins N. et al., "Aggregation as a Determinant of Protein Fate in Post-Golgi Compartments: Role of the Luminal Domain of Furin in Lysosomal Targeting", J Cell Biol, 139(7): 1735-1745 (2007).
Wolins N. et al., "The luminal domain of furin mediates in aggregation in the trans-Golgi network and targeting to lysosomes", Molecular Biology of the Cell, & 37th Annual Meeting of the American Society for Cell Biology; Washington, D.C., USA; Dec. 13-17, vol. 8, Suppl., p. 422a (1997).

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20220133863A1 (en) * 2010-06-25 2022-05-05 Shire Human Genetic Therapies, Inc. Treatment of sanfilippo syndrome type b
US12168041B2 (en) 2010-06-25 2024-12-17 Takeda Pharmaceutical Company Limited Methods and compositions for CNS delivery of arylsulfatase A
US11421211B2 (en) * 2016-09-12 2022-08-23 Genethon Acid-alpha glucosidase variants and uses thereof
US11208458B2 (en) 2017-06-07 2021-12-28 Regeneron Pharmaceuticals, Inc. Compositions and methods for internalizing enzymes
US12215138B2 (en) 2017-06-07 2025-02-04 Regeneron Pharmaceuticals, Inc. Compositions and methods for internalizing enzymes
US12258597B2 (en) 2018-02-07 2025-03-25 Regeneron Pharmaceuticals, Inc. Methods and compositions for therapeutic protein delivery
US12252544B2 (en) 2018-05-17 2025-03-18 Regeneron Pharmaceuticals, Inc. Anti-CD63 antibodies, conjugates, and uses thereof

Also Published As

Publication number Publication date
EP3220958A1 (en) 2017-09-27
US20170333569A1 (en) 2017-11-23
WO2016065319A1 (en) 2016-04-28
MA40791A (en) 2017-09-27

Similar Documents

Publication Publication Date Title
US10556015B2 (en) Lysosomal targeting of enzymes, and uses thereof
US10603364B2 (en) Lysosomal targeting and uses thereof
EP1981546B1 (en) Enzyme replacement therapy for treating lysosomal storage diseases
US20180009904A1 (en) Lysosomal targeting and uses thereof
EP2925776B1 (en) Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof
US20200376095A1 (en) Mannose-6-phosphate bearing peptides fused to lysosomal enzymes
US20240091321A1 (en) Variant igf2 constructs
KR20140033155A (en) Methods for coupling targeting peptides onto recombinant lysosomal enzymes for improved treatments of lysosomal storage diseases
AU2012322811A1 (en) Recombinant human NaGlu protein and uses thereof
RS55669B1 (en) PRODUCTION OF ACTIVE HIGHLY PHOSPHORILIZED HUMAN N-ACETYLGLAKTOSAMINE-6-SULFATASE AND ITS APPLICATIONS
AU2019202865B2 (en) Peptide linkers for polypeptide compositions and methods for using same
EP4389772A1 (en) Targeted delivery of therapeutic enzymes
US20240167007A1 (en) Mutated arylsulfatase a with increased stability
HK40104659A (en) Targeted delivery of therapeutic enzymes
HK1216026B (en) Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof

Legal Events

Date Code Title Description
AS Assignment

Owner name: SHIRE HUMAN GENETIC THERAPIES, INC., MASSACHUSETTS

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:ZHANG, BOHONG;CONCINO, MICHAEL F.;SIGNING DATES FROM 20151214 TO 20160120;REEL/FRAME:044153/0839

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE AFTER FINAL ACTION FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED

STCF Information on status: patent grant

Free format text: PATENTED CASE

CC Certificate of correction
AS Assignment

Owner name: TAKEDA PHARMACEUTICAL COMPANY LIMITED, JAPAN

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:SHIRE HUMAN GENETIC THERAPIES, INC.;REEL/FRAME:056420/0964

Effective date: 20210226

MAFP Maintenance fee payment

Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1551); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

Year of fee payment: 4