US10556015B2 - Lysosomal targeting of enzymes, and uses thereof - Google Patents
Lysosomal targeting of enzymes, and uses thereof Download PDFInfo
- Publication number
- US10556015B2 US10556015B2 US15/521,130 US201515521130A US10556015B2 US 10556015 B2 US10556015 B2 US 10556015B2 US 201515521130 A US201515521130 A US 201515521130A US 10556015 B2 US10556015 B2 US 10556015B2
- Authority
- US
- United States
- Prior art keywords
- protein
- pcsk9
- gaa
- lysosomal
- naglu
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 230000002132 lysosomal effect Effects 0.000 title claims abstract description 133
- 102000004190 Enzymes Human genes 0.000 title claims abstract description 113
- 108090000790 Enzymes Proteins 0.000 title claims abstract description 113
- 230000008685 targeting Effects 0.000 title claims abstract description 79
- 108090000623 proteins and genes Proteins 0.000 claims description 296
- 102000004169 proteins and genes Human genes 0.000 claims description 281
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 82
- 230000001225 therapeutic effect Effects 0.000 claims description 53
- 108020001507 fusion proteins Proteins 0.000 claims description 48
- 102000037865 fusion proteins Human genes 0.000 claims description 47
- 238000006467 substitution reaction Methods 0.000 claims description 19
- 239000002253 acid Substances 0.000 claims description 10
- 108010028144 alpha-Glucosidases Proteins 0.000 claims description 6
- 101710172072 Kexin Proteins 0.000 claims description 4
- 108010009380 alpha-N-acetyl-D-glucosaminidase Proteins 0.000 claims description 4
- 102100034561 Alpha-N-acetylglucosaminidase Human genes 0.000 claims description 3
- 102100024295 Maltase-glucoamylase Human genes 0.000 claims 1
- 241000282414 Homo sapiens Species 0.000 abstract description 63
- 238000000034 method Methods 0.000 abstract description 32
- 102100033448 Lysosomal alpha-glucosidase Human genes 0.000 abstract description 26
- 206010053185 Glycogen storage disease type II Diseases 0.000 abstract description 25
- 208000015439 Lysosomal storage disease Diseases 0.000 abstract description 25
- 201000004502 glycogen storage disease II Diseases 0.000 abstract description 23
- 208000032007 Glycogen storage disease due to acid maltase deficiency Diseases 0.000 abstract description 22
- 239000000203 mixture Substances 0.000 abstract description 16
- 101001098868 Homo sapiens Proprotein convertase subtilisin/kexin type 9 Proteins 0.000 abstract description 11
- 208000025820 Sanfilippo syndrome type B Diseases 0.000 abstract description 7
- 208000036709 mucopolysaccharidosis type 3B Diseases 0.000 abstract description 7
- 208000012227 mucopolysaccharidosis type IIIB Diseases 0.000 abstract description 7
- 230000001404 mediated effect Effects 0.000 abstract description 3
- 210000003205 muscle Anatomy 0.000 abstract description 2
- 102100038955 Proprotein convertase subtilisin/kexin type 9 Human genes 0.000 abstract 1
- 235000018102 proteins Nutrition 0.000 description 274
- 210000004027 cell Anatomy 0.000 description 99
- 235000001014 amino acid Nutrition 0.000 description 76
- 229940024606 amino acid Drugs 0.000 description 69
- 108090000765 processed proteins & peptides Proteins 0.000 description 65
- 150000001413 amino acids Chemical class 0.000 description 60
- 150000007523 nucleic acids Chemical class 0.000 description 55
- 102000004196 processed proteins & peptides Human genes 0.000 description 54
- 229920001184 polypeptide Polymers 0.000 description 49
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 46
- 230000014509 gene expression Effects 0.000 description 39
- 108020004707 nucleic acids Proteins 0.000 description 38
- 102000039446 nucleic acids Human genes 0.000 description 38
- 201000010099 disease Diseases 0.000 description 35
- 102100024640 Low-density lipoprotein receptor Human genes 0.000 description 34
- 102000006437 Proprotein Convertases Human genes 0.000 description 34
- 108010044159 Proprotein Convertases Proteins 0.000 description 34
- 108010001831 LDL receptors Proteins 0.000 description 33
- 239000008194 pharmaceutical composition Substances 0.000 description 30
- 210000001519 tissue Anatomy 0.000 description 30
- 230000000694 effects Effects 0.000 description 28
- 101710137189 Amyloid-beta A4 protein Proteins 0.000 description 26
- 102100022704 Amyloid-beta precursor protein Human genes 0.000 description 26
- 101710151993 Amyloid-beta precursor protein Proteins 0.000 description 26
- 208000030673 Homozygous familial hypercholesterolemia Diseases 0.000 description 26
- 102100034389 Low density lipoprotein receptor adapter protein 1 Human genes 0.000 description 26
- DZHSAHHDTRWUTF-SIQRNXPUSA-N amyloid-beta polypeptide 42 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 DZHSAHHDTRWUTF-SIQRNXPUSA-N 0.000 description 26
- 208000006112 autosomal recessive hypercholesterolemia Diseases 0.000 description 26
- 208000032655 familial 4 hypercholesterolemia Diseases 0.000 description 26
- 239000002243 precursor Substances 0.000 description 25
- 108010076504 Protein Sorting Signals Proteins 0.000 description 23
- 239000003814 drug Substances 0.000 description 23
- 230000035772 mutation Effects 0.000 description 23
- 239000002773 nucleotide Substances 0.000 description 22
- 125000003729 nucleotide group Chemical group 0.000 description 22
- 102000014914 Carrier Proteins Human genes 0.000 description 21
- 239000012634 fragment Substances 0.000 description 21
- 210000003712 lysosome Anatomy 0.000 description 21
- 230000001868 lysosomic effect Effects 0.000 description 21
- 238000011282 treatment Methods 0.000 description 21
- 108091008324 binding proteins Proteins 0.000 description 20
- 108020004705 Codon Proteins 0.000 description 19
- 238000007913 intrathecal administration Methods 0.000 description 19
- 208000005340 mucopolysaccharidosis III Diseases 0.000 description 19
- 239000000243 solution Substances 0.000 description 19
- 239000012491 analyte Substances 0.000 description 17
- 230000007812 deficiency Effects 0.000 description 17
- 239000013604 expression vector Substances 0.000 description 17
- 238000003556 assay Methods 0.000 description 16
- 102100037182 Cation-independent mannose-6-phosphate receptor Human genes 0.000 description 15
- 108091028043 Nucleic acid sequence Proteins 0.000 description 15
- 230000003197 catalytic effect Effects 0.000 description 15
- 102000043859 Dynamin Human genes 0.000 description 14
- 108700021058 Dynamin Proteins 0.000 description 14
- YWXYYJSYQOXTPL-SLPGGIOYSA-N isosorbide mononitrate Chemical compound [O-][N+](=O)O[C@@H]1CO[C@@H]2[C@@H](O)CO[C@@H]21 YWXYYJSYQOXTPL-SLPGGIOYSA-N 0.000 description 14
- 210000004962 mammalian cell Anatomy 0.000 description 14
- 208000024891 symptom Diseases 0.000 description 14
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 13
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 13
- 238000012217 deletion Methods 0.000 description 13
- 230000037430 deletion Effects 0.000 description 13
- 239000007924 injection Substances 0.000 description 13
- 238000002347 injection Methods 0.000 description 13
- 238000003780 insertion Methods 0.000 description 13
- 230000037431 insertion Effects 0.000 description 13
- 239000013598 vector Substances 0.000 description 13
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 12
- 229920002971 Heparan sulfate Polymers 0.000 description 12
- 102100040705 Low-density lipoprotein receptor-related protein 8 Human genes 0.000 description 12
- 241001465754 Metazoa Species 0.000 description 12
- 108010031117 low density lipoprotein receptor-related protein 8 Proteins 0.000 description 12
- 229920002683 Glycosaminoglycan Polymers 0.000 description 11
- 208000008955 Mucolipidoses Diseases 0.000 description 11
- 241000699666 Mus <mouse, genus> Species 0.000 description 11
- 230000001105 regulatory effect Effects 0.000 description 11
- 101710145225 Cation-independent mannose-6-phosphate receptor Proteins 0.000 description 10
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 10
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 10
- 108700019146 Transgenes Proteins 0.000 description 10
- 238000002641 enzyme replacement therapy Methods 0.000 description 10
- 230000004927 fusion Effects 0.000 description 10
- 230000002068 genetic effect Effects 0.000 description 10
- 102000053786 human PCSK9 Human genes 0.000 description 10
- 230000004952 protein activity Effects 0.000 description 10
- 102000004961 Furin Human genes 0.000 description 9
- 108090001126 Furin Proteins 0.000 description 9
- 108090000288 Glycoproteins Proteins 0.000 description 9
- 102000003886 Glycoproteins Human genes 0.000 description 9
- 230000004700 cellular uptake Effects 0.000 description 9
- 239000003795 chemical substances by application Substances 0.000 description 9
- 208000035475 disorder Diseases 0.000 description 9
- 239000003446 ligand Substances 0.000 description 9
- 210000002027 skeletal muscle Anatomy 0.000 description 9
- 239000000126 substance Substances 0.000 description 9
- NBSCHQHZLSJFNQ-QTVWNMPRSA-N D-Mannose-6-phosphate Chemical compound OC1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H](O)[C@@H]1O NBSCHQHZLSJFNQ-QTVWNMPRSA-N 0.000 description 8
- 108020004414 DNA Proteins 0.000 description 8
- 241000238631 Hexapoda Species 0.000 description 8
- 241001494479 Pecora Species 0.000 description 8
- 241000700159 Rattus Species 0.000 description 8
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 8
- 238000012986 modification Methods 0.000 description 8
- 208000011045 mucopolysaccharidosis type 3 Diseases 0.000 description 8
- 230000014616 translation Effects 0.000 description 8
- 241000701022 Cytomegalovirus Species 0.000 description 7
- 229920002307 Dextran Polymers 0.000 description 7
- 108700026244 Open Reading Frames Proteins 0.000 description 7
- 241000282898 Sus scrofa Species 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- 210000003169 central nervous system Anatomy 0.000 description 7
- 230000002950 deficient Effects 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 7
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Natural products NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 7
- -1 mannose carbohydrates Chemical class 0.000 description 7
- 230000004048 modification Effects 0.000 description 7
- 239000000546 pharmaceutical excipient Substances 0.000 description 7
- 125000006850 spacer group Chemical group 0.000 description 7
- 210000000278 spinal cord Anatomy 0.000 description 7
- 238000003860 storage Methods 0.000 description 7
- 239000000758 substrate Substances 0.000 description 7
- 238000013519 translation Methods 0.000 description 7
- 108091026890 Coding region Proteins 0.000 description 6
- 229920000045 Dermatan sulfate Polymers 0.000 description 6
- 101001098833 Homo sapiens Proprotein convertase subtilisin/kexin type 6 Proteins 0.000 description 6
- 241000124008 Mammalia Species 0.000 description 6
- 102100034028 Membrane-bound transcription factor site-1 protease Human genes 0.000 description 6
- 101710193467 Membrane-bound transcription factor site-1 protease Proteins 0.000 description 6
- 241000009328 Perro Species 0.000 description 6
- 102100038946 Proprotein convertase subtilisin/kexin type 6 Human genes 0.000 description 6
- DMWVGXGXHPOEPT-UHFFFAOYSA-N Src Inhibitor-1 Chemical compound C=12C=C(OC)C(OC)=CC2=NC=NC=1NC(C=C1)=CC=C1OC1=CC=CC=C1 DMWVGXGXHPOEPT-UHFFFAOYSA-N 0.000 description 6
- 210000004556 brain Anatomy 0.000 description 6
- 238000004113 cell culture Methods 0.000 description 6
- 239000003085 diluting agent Substances 0.000 description 6
- 239000012530 fluid Substances 0.000 description 6
- 230000000977 initiatory effect Effects 0.000 description 6
- 210000003734 kidney Anatomy 0.000 description 6
- 238000005259 measurement Methods 0.000 description 6
- 238000013518 transcription Methods 0.000 description 6
- 230000035897 transcription Effects 0.000 description 6
- 102100022548 Beta-hexosaminidase subunit alpha Human genes 0.000 description 5
- 229920002527 Glycogen Polymers 0.000 description 5
- 206010072927 Mucolipidosis type I Diseases 0.000 description 5
- 241000283973 Oryctolagus cuniculus Species 0.000 description 5
- 102100038950 Proprotein convertase subtilisin/kexin type 7 Human genes 0.000 description 5
- 101710180647 Proprotein convertase subtilisin/kexin type 7 Proteins 0.000 description 5
- 239000004480 active ingredient Substances 0.000 description 5
- 230000004075 alteration Effects 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 238000003776 cleavage reaction Methods 0.000 description 5
- 239000003623 enhancer Substances 0.000 description 5
- 229940096919 glycogen Drugs 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 238000001802 infusion Methods 0.000 description 5
- 108091006086 inhibitor proteins Proteins 0.000 description 5
- 239000002777 nucleoside Substances 0.000 description 5
- 238000005457 optimization Methods 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 230000000750 progressive effect Effects 0.000 description 5
- 230000007017 scission Effects 0.000 description 5
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 5
- 241000894007 species Species 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- OEANUJAFZLQYOD-CXAZCLJRSA-N (2r,3s,4r,5r,6r)-6-[(2r,3r,4r,5r,6r)-5-acetamido-3-hydroxy-2-(hydroxymethyl)-6-methoxyoxan-4-yl]oxy-4,5-dihydroxy-3-methoxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](OC)O[C@H](CO)[C@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](OC)[C@H](C(O)=O)O1 OEANUJAFZLQYOD-CXAZCLJRSA-N 0.000 description 4
- 102000000412 Annexin Human genes 0.000 description 4
- 108050008874 Annexin Proteins 0.000 description 4
- 102000053602 DNA Human genes 0.000 description 4
- 208000001905 GM2 Gangliosidoses Diseases 0.000 description 4
- 201000008905 GM2 gangliosidosis Diseases 0.000 description 4
- 101000823116 Homo sapiens Alpha-1-antitrypsin Proteins 0.000 description 4
- 101001045440 Homo sapiens Beta-hexosaminidase subunit alpha Proteins 0.000 description 4
- 108010031792 IGF Type 2 Receptor Proteins 0.000 description 4
- 108091092195 Intron Proteins 0.000 description 4
- 206010028095 Mucopolysaccharidosis IV Diseases 0.000 description 4
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 4
- 238000009825 accumulation Methods 0.000 description 4
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 210000004899 c-terminal region Anatomy 0.000 description 4
- 230000015556 catabolic process Effects 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 230000012202 endocytosis Effects 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 102000051631 human SERPINA1 Human genes 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 210000003292 kidney cell Anatomy 0.000 description 4
- 210000004185 liver Anatomy 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 108020004999 messenger RNA Proteins 0.000 description 4
- 208000022018 mucopolysaccharidosis type 2 Diseases 0.000 description 4
- 208000025919 mucopolysaccharidosis type 7 Diseases 0.000 description 4
- 229920001542 oligosaccharide Polymers 0.000 description 4
- 150000002482 oligosaccharides Chemical class 0.000 description 4
- 108091033319 polynucleotide Proteins 0.000 description 4
- 102000040430 polynucleotide Human genes 0.000 description 4
- 239000002157 polynucleotide Substances 0.000 description 4
- 239000003755 preservative agent Substances 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 238000012545 processing Methods 0.000 description 4
- 102000005962 receptors Human genes 0.000 description 4
- 108020003175 receptors Proteins 0.000 description 4
- 230000000717 retained effect Effects 0.000 description 4
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 4
- 238000010361 transduction Methods 0.000 description 4
- 230000026683 transduction Effects 0.000 description 4
- 230000009466 transformation Effects 0.000 description 4
- 230000003612 virological effect Effects 0.000 description 4
- ZDTFMPXQUSBYRL-UUOKFMHZSA-N 2-Aminoadenosine Chemical compound C12=NC(N)=NC(N)=C2N=CN1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O ZDTFMPXQUSBYRL-UUOKFMHZSA-N 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 241000283690 Bos taurus Species 0.000 description 3
- 241000282693 Cercopithecidae Species 0.000 description 3
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 3
- 208000001948 Farber Lipogranulomatosis Diseases 0.000 description 3
- 208000033149 Farber disease Diseases 0.000 description 3
- 208000017462 Galactosialidosis Diseases 0.000 description 3
- 208000015872 Gaucher disease Diseases 0.000 description 3
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 3
- 208000010055 Globoid Cell Leukodystrophy Diseases 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101001018026 Homo sapiens Lysosomal alpha-glucosidase Proteins 0.000 description 3
- 102000004157 Hydrolases Human genes 0.000 description 3
- 108090000604 Hydrolases Proteins 0.000 description 3
- 108010003381 Iduronidase Proteins 0.000 description 3
- 102000004627 Iduronidase Human genes 0.000 description 3
- 208000028226 Krabbe disease Diseases 0.000 description 3
- 206010056886 Mucopolysaccharidosis I Diseases 0.000 description 3
- 206010056893 Mucopolysaccharidosis VII Diseases 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 108010033276 Peptide Fragments Proteins 0.000 description 3
- 102000007079 Peptide Fragments Human genes 0.000 description 3
- 239000004365 Protease Substances 0.000 description 3
- 108020005115 Pyruvate Kinase Proteins 0.000 description 3
- 102000013009 Pyruvate Kinase Human genes 0.000 description 3
- 241000714474 Rous sarcoma virus Species 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 230000000468 autoproteolytic effect Effects 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 230000007547 defect Effects 0.000 description 3
- 230000007850 degeneration Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 238000010494 dissociation reaction Methods 0.000 description 3
- 230000005593 dissociations Effects 0.000 description 3
- 238000013401 experimental design Methods 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- GIVLTTJNORAZON-HDBOBKCLSA-N ganglioside GM2 (18:0) Chemical compound O[C@@H]1[C@@H](O)[C@H](OC[C@H](NC(=O)CCCCCCCCCCCCCCCCC)[C@H](O)\C=C\CCCCCCCCCCCCC)O[C@H](CO)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@]2(O[C@H]([C@H](NC(C)=O)[C@@H](O)C2)[C@H](O)[C@H](O)CO)C(O)=O)[C@@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](CO)O1 GIVLTTJNORAZON-HDBOBKCLSA-N 0.000 description 3
- 201000008977 glycoproteinosis Diseases 0.000 description 3
- 230000013595 glycosylation Effects 0.000 description 3
- 238000006206 glycosylation reaction Methods 0.000 description 3
- 102000045921 human GAA Human genes 0.000 description 3
- 210000005260 human cell Anatomy 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 210000004705 lumbosacral region Anatomy 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 230000011987 methylation Effects 0.000 description 3
- 238000007069 methylation reaction Methods 0.000 description 3
- 201000002273 mucopolysaccharidosis II Diseases 0.000 description 3
- 208000010978 mucopolysaccharidosis type 4 Diseases 0.000 description 3
- 210000004165 myocardium Anatomy 0.000 description 3
- 125000003835 nucleoside group Chemical group 0.000 description 3
- 210000004789 organ system Anatomy 0.000 description 3
- 230000002265 prevention Effects 0.000 description 3
- 230000006337 proteolytic cleavage Effects 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 230000002103 transcriptional effect Effects 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- 230000009261 transgenic effect Effects 0.000 description 3
- 230000032258 transport Effects 0.000 description 3
- 241001430294 unidentified retrovirus Species 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical group N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- ZAYHVCMSTBRABG-JXOAFFINSA-N 5-methylcytidine Chemical compound O=C1N=C(N)C(C)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 ZAYHVCMSTBRABG-JXOAFFINSA-N 0.000 description 2
- 102000007698 Alcohol dehydrogenase Human genes 0.000 description 2
- 108010021809 Alcohol dehydrogenase Proteins 0.000 description 2
- 102000004149 Annexin A2 Human genes 0.000 description 2
- 108090000668 Annexin A2 Proteins 0.000 description 2
- 206010068220 Aspartylglucosaminuria Diseases 0.000 description 2
- 206010003694 Atrophy Diseases 0.000 description 2
- 102100026189 Beta-galactosidase Human genes 0.000 description 2
- 101710124976 Beta-hexosaminidase A Proteins 0.000 description 2
- 208000006029 Cardiomegaly Diseases 0.000 description 2
- 241001112696 Clostridia Species 0.000 description 2
- 208000028698 Cognitive impairment Diseases 0.000 description 2
- 206010011777 Cystinosis Diseases 0.000 description 2
- LEVWYRKDKASIDU-QWWZWVQMSA-N D-cystine Chemical compound OC(=O)[C@H](N)CSSC[C@@H](N)C(O)=O LEVWYRKDKASIDU-QWWZWVQMSA-N 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- 208000024720 Fabry Disease Diseases 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 2
- 101001028831 Homo sapiens Cation-independent mannose-6-phosphate receptor Proteins 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- 208000000563 Hyperlipoproteinemia Type II Diseases 0.000 description 2
- 102000018251 Hypoxanthine Phosphoribosyltransferase Human genes 0.000 description 2
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 2
- 208000026350 Inborn Genetic disease Diseases 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 206010072928 Mucolipidosis type II Diseases 0.000 description 2
- 208000002678 Mucopolysaccharidoses Diseases 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 208000002537 Neuronal Ceroid-Lipofuscinoses Diseases 0.000 description 2
- 102000012288 Phosphopyruvate Hydratase Human genes 0.000 description 2
- 108010022181 Phosphopyruvate Hydratase Proteins 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- 102100032859 Protein AMBP Human genes 0.000 description 2
- 208000013608 Salla disease Diseases 0.000 description 2
- 208000021811 Sandhoff disease Diseases 0.000 description 2
- 208000000828 Sialic Acid Storage Disease Diseases 0.000 description 2
- 208000017460 Sialidosis type 2 Diseases 0.000 description 2
- 241000700584 Simplexvirus Species 0.000 description 2
- 201000001828 Sly syndrome Diseases 0.000 description 2
- 208000022292 Tay-Sachs disease Diseases 0.000 description 2
- 102000006601 Thymidine Kinase Human genes 0.000 description 2
- 108020004440 Thymidine kinase Proteins 0.000 description 2
- 102000005924 Triose-Phosphate Isomerase Human genes 0.000 description 2
- 108700015934 Triose-phosphate isomerases Proteins 0.000 description 2
- 108700001567 Type I Schindler Disease Proteins 0.000 description 2
- 206010045261 Type IIa hyperlipidaemia Diseases 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- 206010072731 White matter lesion Diseases 0.000 description 2
- 208000026589 Wolman disease Diseases 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- 201000008333 alpha-mannosidosis Diseases 0.000 description 2
- 230000009435 amidation Effects 0.000 description 2
- 238000007112 amidation reaction Methods 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 230000037444 atrophy Effects 0.000 description 2
- 239000008228 bacteriostatic water for injection Substances 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 210000000133 brain stem Anatomy 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 230000030833 cell death Effects 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- 208000010877 cognitive disease Diseases 0.000 description 2
- 230000006957 competitive inhibition Effects 0.000 description 2
- 210000000877 corpus callosum Anatomy 0.000 description 2
- 229960003067 cystine Drugs 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 230000006735 deficit Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- AVJBPWGFOQAPRH-FWMKGIEWSA-L dermatan sulfate Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@H](OS([O-])(=O)=O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](C([O-])=O)O1 AVJBPWGFOQAPRH-FWMKGIEWSA-L 0.000 description 2
- 229940051593 dermatan sulfate Drugs 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 230000004064 dysfunction Effects 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 201000001386 familial hypercholesterolemia Diseases 0.000 description 2
- 239000012467 final product Substances 0.000 description 2
- 125000002485 formyl group Chemical group [H]C(*)=O 0.000 description 2
- 201000008049 fucosidosis Diseases 0.000 description 2
- 210000000609 ganglia Anatomy 0.000 description 2
- 150000002270 gangliosides Chemical class 0.000 description 2
- 208000016361 genetic disease Diseases 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 210000002288 golgi apparatus Anatomy 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 150000002632 lipids Chemical group 0.000 description 2
- 210000005229 liver cell Anatomy 0.000 description 2
- 238000009593 lumbar puncture Methods 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- 208000030159 metabolic disease Diseases 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 201000007769 mucolipidosis Diseases 0.000 description 2
- 208000020460 mucolipidosis II alpha/beta Diseases 0.000 description 2
- 208000020468 mucolipidosis III alpha/beta Diseases 0.000 description 2
- 206010028093 mucopolysaccharidosis Diseases 0.000 description 2
- 208000012091 mucopolysaccharidosis type IVB Diseases 0.000 description 2
- 150000003833 nucleoside derivatives Chemical class 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 239000000825 pharmaceutical preparation Substances 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 2
- 150000004713 phosphodiesters Chemical class 0.000 description 2
- 108010079892 phosphoglycerol kinase Proteins 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000002335 preservative effect Effects 0.000 description 2
- 210000001236 prokaryotic cell Anatomy 0.000 description 2
- 235000019419 proteases Nutrition 0.000 description 2
- 238000000159 protein binding assay Methods 0.000 description 2
- 230000002797 proteolythic effect Effects 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 208000011985 sialidosis Diseases 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 208000011580 syndromic disease Diseases 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 229940126585 therapeutic drug Drugs 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- RIFDKYBNWNPCQK-IOSLPCCCSA-N (2r,3s,4r,5r)-2-(hydroxymethyl)-5-(6-imino-3-methylpurin-9-yl)oxolane-3,4-diol Chemical compound C1=2N(C)C=NC(=N)C=2N=CN1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O RIFDKYBNWNPCQK-IOSLPCCCSA-N 0.000 description 1
- RKSLVDIXBGWPIS-UAKXSSHOSA-N 1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-iodopyrimidine-2,4-dione Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 RKSLVDIXBGWPIS-UAKXSSHOSA-N 0.000 description 1
- QLOCVMVCRJOTTM-TURQNECASA-N 1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-prop-1-ynylpyrimidine-2,4-dione Chemical compound O=C1NC(=O)C(C#CC)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 QLOCVMVCRJOTTM-TURQNECASA-N 0.000 description 1
- PISWNSOQFZRVJK-XLPZGREQSA-N 1-[(2r,4s,5r)-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-methyl-2-sulfanylidenepyrimidin-4-one Chemical compound S=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 PISWNSOQFZRVJK-XLPZGREQSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 1
- YKBGVTZYEHREMT-KVQBGUIXSA-N 2'-deoxyguanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 YKBGVTZYEHREMT-KVQBGUIXSA-N 0.000 description 1
- CKTSBUTUHBMZGZ-SHYZEUOFSA-N 2'‐deoxycytidine Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 CKTSBUTUHBMZGZ-SHYZEUOFSA-N 0.000 description 1
- JRYMOPZHXMVHTA-DAGMQNCNSA-N 2-amino-7-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-1h-pyrrolo[2,3-d]pyrimidin-4-one Chemical compound C1=CC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O JRYMOPZHXMVHTA-DAGMQNCNSA-N 0.000 description 1
- RHFUOMFWUGWKKO-XVFCMESISA-N 2-thiocytidine Chemical compound S=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 RHFUOMFWUGWKKO-XVFCMESISA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- LMMLLWZHCKCFQA-UGKPPGOTSA-N 4-amino-1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)-2-prop-1-ynyloxolan-2-yl]pyrimidin-2-one Chemical compound C1=CC(N)=NC(=O)N1[C@]1(C#CC)O[C@H](CO)[C@@H](O)[C@H]1O LMMLLWZHCKCFQA-UGKPPGOTSA-N 0.000 description 1
- XXSIICQLPUAUDF-TURQNECASA-N 4-amino-1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-prop-1-ynylpyrimidin-2-one Chemical compound O=C1N=C(N)C(C#CC)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 XXSIICQLPUAUDF-TURQNECASA-N 0.000 description 1
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 description 1
- 101710163881 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 description 1
- ZAYHVCMSTBRABG-UHFFFAOYSA-N 5-Methylcytidine Natural products O=C1N=C(N)C(C)=CN1C1C(O)C(O)C(CO)O1 ZAYHVCMSTBRABG-UHFFFAOYSA-N 0.000 description 1
- AGFIRQJZCNVMCW-UAKXSSHOSA-N 5-bromouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(Br)=C1 AGFIRQJZCNVMCW-UAKXSSHOSA-N 0.000 description 1
- FHIDNBAQOFJWCA-UAKXSSHOSA-N 5-fluorouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 FHIDNBAQOFJWCA-UAKXSSHOSA-N 0.000 description 1
- KDOPAZIWBAHVJB-UHFFFAOYSA-N 5h-pyrrolo[3,2-d]pyrimidine Chemical compound C1=NC=C2NC=CC2=N1 KDOPAZIWBAHVJB-UHFFFAOYSA-N 0.000 description 1
- BXJHWYVXLGLDMZ-UHFFFAOYSA-N 6-O-methylguanine Chemical compound COC1=NC(N)=NC2=C1NC=N2 BXJHWYVXLGLDMZ-UHFFFAOYSA-N 0.000 description 1
- UEHOMUNTZPIBIL-UUOKFMHZSA-N 6-amino-9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-7h-purin-8-one Chemical compound O=C1NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O UEHOMUNTZPIBIL-UUOKFMHZSA-N 0.000 description 1
- FVFVNNKYKYZTJU-UHFFFAOYSA-N 6-chloro-1,3,5-triazine-2,4-diamine Chemical group NC1=NC(N)=NC(Cl)=N1 FVFVNNKYKYZTJU-UHFFFAOYSA-N 0.000 description 1
- HCAJQHYUCKICQH-VPENINKCSA-N 8-Oxo-7,8-dihydro-2'-deoxyguanosine Chemical compound C1=2NC(N)=NC(=O)C=2NC(=O)N1[C@H]1C[C@H](O)[C@@H](CO)O1 HCAJQHYUCKICQH-VPENINKCSA-N 0.000 description 1
- HDZZVAMISRMYHH-UHFFFAOYSA-N 9beta-Ribofuranosyl-7-deazaadenin Natural products C1=CC=2C(N)=NC=NC=2N1C1OC(CO)C(O)C1O HDZZVAMISRMYHH-UHFFFAOYSA-N 0.000 description 1
- 101150020357 ADE8 gene Proteins 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical group CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 1
- 108010055851 Acetylglucosaminidase Proteins 0.000 description 1
- 102000006772 Acid Ceramidase Human genes 0.000 description 1
- 108020005296 Acid Ceramidase Proteins 0.000 description 1
- 102100022900 Actin, cytoplasmic 1 Human genes 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 102100036664 Adenosine deaminase Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102100035028 Alpha-L-iduronidase Human genes 0.000 description 1
- 208000029602 Alpha-N-acetylgalactosaminidase deficiency Diseases 0.000 description 1
- 102100026277 Alpha-galactosidase A Human genes 0.000 description 1
- 208000031277 Amaurotic familial idiocy Diseases 0.000 description 1
- 102100022146 Arylsulfatase A Human genes 0.000 description 1
- 102100031491 Arylsulfatase B Human genes 0.000 description 1
- 102000004625 Aspartate Aminotransferases Human genes 0.000 description 1
- 108010003415 Aspartate Aminotransferases Proteins 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 101000588395 Bacillus subtilis (strain 168) Beta-hexosaminidase Proteins 0.000 description 1
- 241000606124 Bacteroides fragilis Species 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 102100030981 Beta-alanine-activating enzyme Human genes 0.000 description 1
- 102100032487 Beta-mannosidase Human genes 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- YDNKGFDKKRUKPY-JHOUSYSJSA-N C16 ceramide Natural products CCCCCCCCCCCCCCCC(=O)N[C@@H](CO)[C@H](O)C=CCCCCCCCCCCCCC YDNKGFDKKRUKPY-JHOUSYSJSA-N 0.000 description 1
- 101100327917 Caenorhabditis elegans chup-1 gene Proteins 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 102000005572 Cathepsin A Human genes 0.000 description 1
- 108010059081 Cathepsin A Proteins 0.000 description 1
- 108010036867 Cerebroside-Sulfatase Proteins 0.000 description 1
- 241000282552 Chlorocebus aethiops Species 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 102000004420 Creatine Kinase Human genes 0.000 description 1
- 108010042126 Creatine kinase Proteins 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000938605 Crocodylia Species 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- LVNMAAGSAUGNIC-BQBZGAKWSA-N Cys-His Chemical group SC[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CNC=N1 LVNMAAGSAUGNIC-BQBZGAKWSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical class OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 208000011518 Danon disease Diseases 0.000 description 1
- 101710088194 Dehydrogenase Proteins 0.000 description 1
- CKTSBUTUHBMZGZ-UHFFFAOYSA-N Deoxycytidine Natural products O=C1N=C(N)C=CN1C1OC(CO)C(O)C1 CKTSBUTUHBMZGZ-UHFFFAOYSA-N 0.000 description 1
- 102100024746 Dihydrofolate reductase Human genes 0.000 description 1
- 108090000204 Dipeptidase 1 Proteins 0.000 description 1
- 241000045500 Diseae Species 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 101000930875 Drosophila melanogaster Glyceraldehyde-3-phosphate dehydrogenase 1 Proteins 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 108010067770 Endopeptidase K Proteins 0.000 description 1
- 102000010911 Enzyme Precursors Human genes 0.000 description 1
- 108010062466 Enzyme Precursors Proteins 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 108050001049 Extracellular proteins Proteins 0.000 description 1
- 102000001390 Fructose-Bisphosphate Aldolase Human genes 0.000 description 1
- 108010068561 Fructose-Bisphosphate Aldolase Proteins 0.000 description 1
- 101150094690 GAL1 gene Proteins 0.000 description 1
- 101150038242 GAL10 gene Proteins 0.000 description 1
- 201000008892 GM1 Gangliosidosis Diseases 0.000 description 1
- 102100028496 Galactocerebrosidase Human genes 0.000 description 1
- 108010042681 Galactosylceramidase Proteins 0.000 description 1
- 102100028501 Galanin peptides Human genes 0.000 description 1
- 102100024637 Galectin-10 Human genes 0.000 description 1
- 102100039556 Galectin-4 Human genes 0.000 description 1
- 101001035782 Gallus gallus Hemoglobin subunit beta Proteins 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 102000004547 Glucosylceramidase Human genes 0.000 description 1
- 108010017544 Glucosylceramidase Proteins 0.000 description 1
- 102000053187 Glucuronidase Human genes 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- 101710162677 Glyceraldehyde-3-phosphate dehydrogenase 2 Proteins 0.000 description 1
- 208000001500 Glycogen Storage Disease Type IIb Diseases 0.000 description 1
- 208000035148 Glycogen storage disease due to LAMP-2 deficiency Diseases 0.000 description 1
- 101150009006 HIS3 gene Proteins 0.000 description 1
- 101150069554 HIS4 gene Proteins 0.000 description 1
- 101001120470 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) Peptidoglycan-associated lipoprotein Proteins 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 102100021519 Hemoglobin subunit beta Human genes 0.000 description 1
- 108091005904 Hemoglobin subunit beta Proteins 0.000 description 1
- 208000028782 Hereditary disease Diseases 0.000 description 1
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 1
- 108010000540 Hexosaminidases Proteins 0.000 description 1
- 102000002268 Hexosaminidases Human genes 0.000 description 1
- 101500025164 Homo sapiens Alpha-1-microglobulin Proteins 0.000 description 1
- 101001019502 Homo sapiens Alpha-L-iduronidase Proteins 0.000 description 1
- 101000773364 Homo sapiens Beta-alanine-activating enzyme Proteins 0.000 description 1
- 101100121078 Homo sapiens GAL gene Proteins 0.000 description 1
- 101000608765 Homo sapiens Galectin-4 Proteins 0.000 description 1
- 101500025163 Homo sapiens Inter-alpha-trypsin inhibitor light chain Proteins 0.000 description 1
- 101001051093 Homo sapiens Low-density lipoprotein receptor Proteins 0.000 description 1
- 101000797623 Homo sapiens Protein AMBP Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- 208000015178 Hurler syndrome Diseases 0.000 description 1
- 108700037017 Hyaluronidase Deficiency Proteins 0.000 description 1
- 208000005503 Hyaluronidase deficiency Diseases 0.000 description 1
- 206010021118 Hypotonia Diseases 0.000 description 1
- XQFRJNBWHJMXHO-RRKCRQDMSA-N IDUR Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 XQFRJNBWHJMXHO-RRKCRQDMSA-N 0.000 description 1
- 102000038460 IGF Type 2 Receptor Human genes 0.000 description 1
- 108010053927 Iduronate Sulfatase Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 description 1
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 1
- 229920000288 Keratan sulfate Polymers 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 102000007330 LDL Lipoproteins Human genes 0.000 description 1
- 108010007622 LDL Lipoproteins Proteins 0.000 description 1
- 101150048357 Lamp1 gene Proteins 0.000 description 1
- 241000713666 Lentivirus Species 0.000 description 1
- 102000004882 Lipase Human genes 0.000 description 1
- 108090001060 Lipase Proteins 0.000 description 1
- 241000255908 Manduca sexta Species 0.000 description 1
- 208000027933 Mannosidase Deficiency disease Diseases 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 208000024556 Mendelian disease Diseases 0.000 description 1
- 201000011442 Metachromatic leukodystrophy Diseases 0.000 description 1
- 108090000157 Metallothionein Proteins 0.000 description 1
- 241000713869 Moloney murine leukemia virus Species 0.000 description 1
- 206010072929 Mucolipidosis type III Diseases 0.000 description 1
- 208000028781 Mucopolysaccharidosis type 1 Diseases 0.000 description 1
- 208000025797 Mucopolysaccharidosis type 4A Diseases 0.000 description 1
- 208000025923 Mucopolysaccharidosis type 4B Diseases 0.000 description 1
- 208000025915 Mucopolysaccharidosis type 6 Diseases 0.000 description 1
- 208000000149 Multiple Sulfatase Deficiency Disease Diseases 0.000 description 1
- 208000035032 Multiple sulfatase deficiency Diseases 0.000 description 1
- 108010085220 Multiprotein Complexes Proteins 0.000 description 1
- 102000007474 Multiprotein Complexes Human genes 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101000822667 Mus musculus Something about silencing protein 10 Proteins 0.000 description 1
- 208000007379 Muscle Hypotonia Diseases 0.000 description 1
- 208000010428 Muscle Weakness Diseases 0.000 description 1
- 208000021642 Muscular disease Diseases 0.000 description 1
- 206010028372 Muscular weakness Diseases 0.000 description 1
- 201000009623 Myopathy Diseases 0.000 description 1
- 108010027520 N-Acetylgalactosamine-4-Sulfatase Proteins 0.000 description 1
- 102100031688 N-acetylgalactosamine-6-sulfatase Human genes 0.000 description 1
- CRJGESKKUOMBCT-VQTJNVASSA-N N-acetylsphinganine Chemical compound CCCCCCCCCCCCCCC[C@@H](O)[C@H](CO)NC(C)=O CRJGESKKUOMBCT-VQTJNVASSA-N 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- YLLUGDKHOCGIFR-JPLGWGRCSA-N N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(=O)C1(O)[C@H](N)[C@@H](O)[C@H](O)[C@H](O1)CO)C(=O)O Chemical compound N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(=O)C1(O)[C@H](N)[C@@H](O)[C@H](O)[C@H](O1)CO)C(=O)O YLLUGDKHOCGIFR-JPLGWGRCSA-N 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 101000652829 Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) Exo-alpha-sialidase Proteins 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 208000014060 Niemann-Pick disease Diseases 0.000 description 1
- 201000000788 Niemann-Pick disease type C1 Diseases 0.000 description 1
- 201000000785 Niemann-Pick disease type C2 Diseases 0.000 description 1
- 108091092724 Noncoding DNA Proteins 0.000 description 1
- 241000320412 Ogataea angusta Species 0.000 description 1
- 241001452677 Ogataea methanolica Species 0.000 description 1
- 241001465803 Orgyia pseudotsugata Species 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 101000690429 Panax ginseng Floral homeotic protein AGAMOUS Proteins 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 108091093037 Peptide nucleic acid Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 102100036197 Prosaposin Human genes 0.000 description 1
- 101710152403 Prosaposin Proteins 0.000 description 1
- 208000008425 Protein deficiency Diseases 0.000 description 1
- 108010067787 Proteoglycans Proteins 0.000 description 1
- 102000016611 Proteoglycans Human genes 0.000 description 1
- 101710081551 Pyrolysin Proteins 0.000 description 1
- 108091030071 RNAI Proteins 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 206010038687 Respiratory distress Diseases 0.000 description 1
- 206010070833 Respiratory muscle weakness Diseases 0.000 description 1
- 101100394989 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) hisI gene Proteins 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 101000828148 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) Transposon Ty3-G Gag polyprotein Proteins 0.000 description 1
- 101000790437 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) Transposon Ty3-I Gag polyprotein Proteins 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 208000025802 Sanfilippo syndrome type C Diseases 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 201000002883 Scheie syndrome Diseases 0.000 description 1
- 101100085270 Schizosaccharomyces pombe (strain 972 / ATCC 24843) ade5 gene Proteins 0.000 description 1
- 102000012479 Serine Proteases Human genes 0.000 description 1
- 108010022999 Serine Proteases Proteins 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 108010061312 Sphingomyelin Phosphodiesterase Proteins 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 229930182558 Sterol Natural products 0.000 description 1
- 108090000787 Subtilisin Proteins 0.000 description 1
- 102000005262 Sulfatase Human genes 0.000 description 1
- 108700026226 TATA Box Proteins 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 102000005488 Thioesterase Human genes 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical class OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 108700009124 Transcription Initiation Site Proteins 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 244000000188 Vaccinium ovalifolium Species 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 241000269368 Xenopus laevis Species 0.000 description 1
- 241000235015 Yarrowia lipolytica Species 0.000 description 1
- 108010084455 Zeocin Proteins 0.000 description 1
- LEBBDRXHHNYZIA-LDUWYPJVSA-N [(2s,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl] n-[(z)-1,3-dihydroxyoctadec-4-en-2-yl]carbamate Chemical compound CCCCCCCCCCCCC\C=C/C(O)C(CO)NC(=O)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O LEBBDRXHHNYZIA-LDUWYPJVSA-N 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 102000005421 acetyltransferase Human genes 0.000 description 1
- 108020002494 acetyltransferase Proteins 0.000 description 1
- 102000010126 acid sphingomyelin phosphodiesterase activity proteins Human genes 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 108091006088 activator proteins Proteins 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- 108010030291 alpha-Galactosidase Proteins 0.000 description 1
- 102000012086 alpha-L-Fucosidase Human genes 0.000 description 1
- 108010061314 alpha-L-Fucosidase Proteins 0.000 description 1
- 108010012864 alpha-Mannosidase Proteins 0.000 description 1
- 102000019199 alpha-Mannosidase Human genes 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical class OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 125000000613 asparagine group Chemical class N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- 108010055059 beta-Mannosidase Proteins 0.000 description 1
- 102000006635 beta-lactamase Human genes 0.000 description 1
- 201000006486 beta-mannosidosis Diseases 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 239000011616 biotin Chemical group 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 108010006025 bovine growth hormone Proteins 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 210000001217 buttock Anatomy 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 108020001778 catalytic domains Proteins 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000033077 cellular process Effects 0.000 description 1
- 229940106189 ceramide Drugs 0.000 description 1
- ZVEQCJWYRWKARO-UHFFFAOYSA-N ceramide Natural products CCCCCCCCCCCCCCC(O)C(=O)NC(CO)C(O)C=CCCC=C(C)CCCCCCCCC ZVEQCJWYRWKARO-UHFFFAOYSA-N 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 210000004289 cerebral ventricle Anatomy 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000010382 chemical cross-linking Methods 0.000 description 1
- 150000005829 chemical entities Chemical class 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 208000024042 cholesterol ester storage disease Diseases 0.000 description 1
- 208000013760 cholesteryl ester storage disease Diseases 0.000 description 1
- 108010008846 chordin Proteins 0.000 description 1
- 102000006533 chordin Human genes 0.000 description 1
- 210000003703 cisterna magna Anatomy 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 230000003920 cognitive function Effects 0.000 description 1
- 238000004891 communication Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 239000002537 cosmetic Substances 0.000 description 1
- 239000003431 cross linking reagent Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 210000000172 cytosol Anatomy 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 238000002716 delivery method Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 102000004419 dihydrofolate reductase Human genes 0.000 description 1
- 108020001096 dihydrofolate reductase Proteins 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000009088 enzymatic function Effects 0.000 description 1
- 230000032050 esterification Effects 0.000 description 1
- 238000005886 esterification reaction Methods 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 210000001723 extracellular space Anatomy 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 125000002446 fucosyl group Chemical group C1([C@@H](O)[C@H](O)[C@H](O)[C@@H](O1)C)* 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 230000030279 gene silencing Effects 0.000 description 1
- 230000009368 gene silencing by RNA Effects 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 150000002298 globosides Chemical class 0.000 description 1
- 150000008271 glucosaminides Chemical class 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 150000002305 glucosylceramides Chemical class 0.000 description 1
- 102000005396 glutamine synthetase Human genes 0.000 description 1
- 108020002326 glutamine synthetase Proteins 0.000 description 1
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 125000003827 glycol group Chemical group 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 229940029575 guanosine Drugs 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 230000004217 heart function Effects 0.000 description 1
- 210000005003 heart tissue Anatomy 0.000 description 1
- 108010089932 heparan sulfate sulfatase Proteins 0.000 description 1
- 150000002402 hexoses Chemical class 0.000 description 1
- 102000043555 human LDLR Human genes 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 238000000111 isothermal titration calorimetry Methods 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 230000000366 juvenile effect Effects 0.000 description 1
- 208000017476 juvenile neuronal ceroid lipofuscinosis Diseases 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- KXCLCNHUUKTANI-RBIYJLQWSA-N keratan Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@H](COS(O)(=O)=O)O[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@H](O[C@@H](O[C@H]3[C@H]([C@@H](COS(O)(=O)=O)O[C@@H](O)[C@@H]3O)O)[C@H](NC(C)=O)[C@H]2O)COS(O)(=O)=O)O[C@H](COS(O)(=O)=O)[C@@H]1O KXCLCNHUUKTANI-RBIYJLQWSA-N 0.000 description 1
- 208000017169 kidney disease Diseases 0.000 description 1
- 230000003907 kidney function Effects 0.000 description 1
- 208000036546 leukodystrophy Diseases 0.000 description 1
- 230000037356 lipid metabolism Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000008297 liquid dosage form Substances 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000005265 lung cell Anatomy 0.000 description 1
- 108010045758 lysosomal proteins Proteins 0.000 description 1
- 230000017156 mRNA modification Effects 0.000 description 1
- 238000002595 magnetic resonance imaging Methods 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 230000003458 metachromatic effect Effects 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 238000000386 microscopy Methods 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 208000000690 mucopolysaccharidosis VI Diseases 0.000 description 1
- 208000036707 mucopolysaccharidosis type 3C Diseases 0.000 description 1
- 208000020004 mucopolysaccharidosis type 9 Diseases 0.000 description 1
- 208000012224 mucopolysaccharidosis type IIIC Diseases 0.000 description 1
- 208000027333 mucopolysaccharidosis type IIID Diseases 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 210000002464 muscle smooth vascular Anatomy 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- 229960000951 mycophenolic acid Drugs 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 210000003098 myoblast Anatomy 0.000 description 1
- 230000001114 myogenic effect Effects 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 210000004498 neuroglial cell Anatomy 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 201000008051 neuronal ceroid lipofuscinosis Diseases 0.000 description 1
- 201000007642 neuronal ceroid lipofuscinosis 1 Diseases 0.000 description 1
- 201000007607 neuronal ceroid lipofuscinosis 3 Diseases 0.000 description 1
- VVGIYYKRAMHVLU-UHFFFAOYSA-N newbouldiamide Natural products CCCCCCCCCCCCCCCCCCCC(O)C(O)C(O)C(CO)NC(=O)CCCCCCCCCCCCCCCCC VVGIYYKRAMHVLU-UHFFFAOYSA-N 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 235000016709 nutrition Nutrition 0.000 description 1
- 230000035764 nutrition Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000020477 pH reduction Effects 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- GJVFBWCTGUSGDD-UHFFFAOYSA-L pentamethonium bromide Chemical compound [Br-].[Br-].C[N+](C)(C)CCCCC[N+](C)(C)C GJVFBWCTGUSGDD-UHFFFAOYSA-L 0.000 description 1
- CWCMIVBLVUHDHK-ZSNHEYEWSA-N phleomycin D1 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC[C@@H](N=1)C=1SC=C(N=1)C(=O)NCCCCNC(N)=N)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C CWCMIVBLVUHDHK-ZSNHEYEWSA-N 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 238000012805 post-processing Methods 0.000 description 1
- 238000007781 pre-processing Methods 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 201000010108 pycnodysostosis Diseases 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000004064 recycling Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- RHFUOMFWUGWKKO-UHFFFAOYSA-N s2C Natural products S=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 RHFUOMFWUGWKKO-UHFFFAOYSA-N 0.000 description 1
- 239000012266 salt solution Substances 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 210000000717 sertoli cell Anatomy 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 238000007493 shaping process Methods 0.000 description 1
- 231100001055 skeletal defect Toxicity 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 235000003702 sterols Nutrition 0.000 description 1
- 150000003432 sterols Chemical class 0.000 description 1
- 108060007951 sulfatase Proteins 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L sulfate group Chemical group S(=O)(=O)([O-])[O-] QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000004114 suspension culture Methods 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 101150003389 tdh2 gene Proteins 0.000 description 1
- 150000003505 terpenes Chemical group 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 108020002982 thioesterase Proteins 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 238000000844 transformation Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- HDZZVAMISRMYHH-KCGFPETGSA-N tubercidin Chemical compound C1=CC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O HDZZVAMISRMYHH-KCGFPETGSA-N 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 210000000689 upper leg Anatomy 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/65—Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
- C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
- C12N9/6424—Serine endopeptidases (3.4.21)
- C12N9/6454—Dibasic site splicing serine proteases, e.g. kexin (3.4.21.61); furin (3.4.21.75) and other proprotein convertases
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/96—Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/0102—Alpha-glucosidase (3.2.1.20)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/0105—Alpha-N-acetylglucosaminidase (3.2.1.50)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/06—Fusion polypeptide containing a localisation/targetting motif containing a lysosomal/endosomal localisation signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
Definitions
- More than forty lysosomal storage diseases are caused, directly or indirectly, by the absence or deficiency of one or more lysosomal enzymes.
- Pompe disease is a lysosomal storage disease caused by a deficiency or dysfunction of the lysosomal hydrolase acid alpha-glucosidase (GAA), a glycogen-degrading lysosomal enzyme. Deficiency of GAA results in lysosomal glycogen accumulation in many tissues, with cardiac and skeletal muscle tissues being most seriously affected. The combined incidence of all forms of Pompe disease is estimated to be 1:40,000. It is estimated that approximately one third of patients with Pompe disease have the rapidly progressive, fatal infantile-onset form, while the majority of patients present with the more slowly progressive, juvenile or late-onset forms.
- GAA lysosomal hydrolase acid alpha-glucosidase
- MPS III mucopolysaccharidosis III
- GAG glycosaminoglycans
- Mucopolysaccharidosis type IIIB (MPS IIIB; Sanfilippo B disease) is an autosomal recessive disorder that is caused by a deficiency of the enzyme alpha-N-acetyl-glucosaminidase (Naglu), resulting in the accumulation of heparan sulfate in lysosomes of particularly neurons and glial cells in the brain, with additional lysosomal accumulation of heparan sulfate elsewhere.
- MPS IIIB manifests itself primarily in the brain.
- Enzyme replacement therapy has been used to deliver enzymes for the treatment of various lysosomal storage diseases. Normally, lysosomal enzymes are synthesized in the cytosol and then traverse the endoplasmic reticulum (ER), where they are glycosylated with N-linked, high mannose type carbohydrates. In the Golgi apparatus, high mannose carbohydrates on glycoproteins are then modified by a series of glycotransferases to become mature N-glycan; one of these modifications is the addition of mannose-6-phosphate (M6P).
- M6P mannose-6-phosphate
- Proteins carrying this modification are then targeted to the lysosome via binding of the M6P moiety to the cation-independent mannose-6-phosphate receptor (CI-M6PR) and cation-dependant mannose-6-phoshate receptor (CD-M6PR).
- CI-M6PR cation-independent mannose-6-phosphate receptor
- CD-M6PR cation-dependant mannose-6-phoshate receptor
- Efficacy of enzyme replacement therapy is critically dependent on proper lysosomal targeting of the replacement enzyme.
- recombinantly produced Naglu protein is characterized by a dramatic lack of M6P phosphorylation, making lysosomal targeting of this enzyme and its effective use for ERT very difficult.
- enzyme replacement therapy has shown limitations, such as limited clinical benefit resulting from poor cellular uptake of recombinant enzyme in skeletal muscle and cardiac tissues of the body (Schoser et al., Neurotherapeutics 5:569-578 (2008)).
- the present invention provides an alternative lysosomal targeting approach for enzyme replacement therapy that is more efficient, reliable and consistent.
- the present invention is, in part, based on the surprising discovery that a replacement enzyme can be effectively delivered to the lysosome through the use of a soluble extracellular protein, such as PCSK9, and its interaction with various secondary binding proteins, such as, but not limited to, amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein or low density lipoprotein receptor-related protein 8 (Lrp8).
- APLP2 amyloid precursor-like protein 2
- APP amyloid precursor protein
- ARH autosomal recessive hypercholesterolemia
- Lrp8 low density lipoprotein receptor-related protein 8
- the present invention permits targeting of a therapeutic to a lysosome in a glycosylation or M6P-independent manner and can be used to deliver enzymes with low levels of glycosylation or even with complete absence of glycosylation. Accordingly, the present invention allows for simpler processes of manufacturing recombinant enzymes for enzyme replacement therapy. Since PCSK9 is ubiquitously expressed throughout the various tissues of the body, the invention provides an effective means for delivering replacement enzymes for diseases associated with the nervous system and/or other tissues inn the body.
- the present invention provides a targeted therapeutic including a lysosomal enzyme and a lysosomal targeting moiety including a proprotein convertase protein or fragment thereof.
- the lysosomal enzyme is selected from Table 3.
- the lysosomal enzyme is an acid alpha-glucosidase (GAA) protein.
- GAA protein comprises an amino acid sequence at least 80%, 90%, or 95% identical to SEQ ID NO:1. In some embodiments, the GAA protein comprises an amino acid sequence identical to SEQ ID NO:1.
- the lysosomal enzyme is an alpha-N-acetylglucosaminidase (Naglu) protein.
- Naglu protein comprises an amino acid sequence at least 80%, 90%, or 95% identical to SEQ ID NO:4. In some embodiments, the Naglu protein comprises an amino acid sequence identical to SEQ ID NO:4.
- the proprotein convertase protein is selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9.
- the proprotein convertase comprises an amino acid substitution selected from the group consisting of S386A, F379A and a combination thereof.
- the proprotein convertase is a PCSK9 protein.
- the PCSK9 protein comprises an amino acid sequence at least 80%, 90% or 95% identical to SEQ ID NO:7. In some embodiments, the PCSK9 protein comprises an amino acid sequence is identical to SEQ ID NO:7.
- the targeted therapeutic is a fusion protein.
- the lysosomal targeting moiety is fused to the N-terminus or C-terminus of the lysosomal enzyme.
- the lysosomal targeting moiety and the lysosomal enzyme are fused via a linker.
- the linker is a peptide linker.
- the peptide linker comprises a cleavage site.
- the cleavage site comprises a lysosomal protease recognition site.
- the linker comprises a sequence of GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGG GAP (SEQ ID NO. 13).
- the fusion protein comprises a sequence at least 80%, 90% or 95% identical to the amino acid sequence of SEQ ID NO. 21 or 22. In some embodiments, the fusion protein comprises a sequence identical to the amino acid sequence of SEQ ID NO. 21 or 22.
- the targeted therapeutic comprises an auxiliary propeptide derived from a proprotein convertase protein a fragment thereof.
- the auxiliary propeptide is derived from a proprotein convertase protein selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9.
- the auxiliary propeptide is derived from PCSK9.
- the auxiliary propeptide comprises a sequence at least 80%, 90% or 95% identical to the amino acid sequence of SEQ ID NO. 23.
- the auxiliary propeptide comprises a sequence identical to the amino acid sequence of SEQ ID NO. 23.
- the targeted therapeutic has a higher binding affinity for Amyloid Precursor-like Protein 2 (APLP2), Dynamin, Amyloid Precursor Protein (APP), Autosomal Recessive Hypercholesterolemia (ARH) protein, or Low Density Lipoprotein Receptor-related Protein 8 (Lrp8), than for an LDL receptor.
- the targeted therapeutic has a binding affinity for Amyloid Precursor-like Protein 2 (APLP2), Dynamin, Amyloid Precursor Protein (APP), Autosomal Recessive Hypercholesterolemia (ARH) protein, or Low Density Lipoprotein Receptor-related Protein 8 (Lrp8) that is at least 2, 3, 4, 5, 6, 7, 8, 9 or 10 fold higher than for an LDL receptor.
- the present invention provides a nucleic acid encoding any of the proteins disclosed herein.
- the present invention provides a vector including any of the nucleic acids disclosed herein.
- the present invention provides a host cell including any of the vectors disclosed herein.
- the host cell is selected from a bacterial, yeast, insect or mammalian cell.
- the host cell is a mammalian cell.
- the mammalian cell is a human cell.
- the mammalian cell is a CHO cell.
- the present invention provides a method of producing a targeted therapeutic, the method including steps of a) culturing any of the host cells disclosed herein under conditions suitable for expression of the targeted therapeutic by the host cell; and b) harvesting the targeted therapeutic expressed by the host cell.
- any of the fusion proteins disclosed herein and an auxiliary protein are cultured within the same host cell.
- the fusion protein and the auxiliary protein are harvested from the host cell simultaneously.
- the present invention provides a pharmaceutical composition comprising any of the targeted therapeutics disclosed herein, and a pharmaceutical acceptable carrier.
- the present invention provides a method of treating a lysosomal storage disease including administering to a subject in need of treatment any of the pharmaceutical compositions disclosed herein.
- the lysosomal storage disease is selected from Table 3.
- the lysosomal storage disease is Pompe disease or Sanfilippo syndrome type B.
- the pharmaceutical composition is administered intravenously, intramuscularly, subcutaneously, intrathecally and/or combinations thereof.
- the present invention provides a method of delivering a targeted therapeutic to skeletal muscle, vascular smooth muscle or cardiac muscle, including administering to a subject in need of treatment any of the pharmaceutical compositions disclosed herein.
- this composition includes a targeted therapeutic that is the fusion protein of SEQ ID NO. 21 or 22.
- Amelioration is meant the prevention, reduction or palliation of a state, or improvement of the state of a subject. Amelioration includes, but does not require complete recovery or complete prevention of a disease condition. In some embodiments, amelioration includes increasing levels of relevant protein or its activity that is deficient in relevant disease tissues.
- amino acid in its broadest sense, refers to any compound and/or substance that can be incorporated into a polypeptide chain.
- an amino acid has the general structure H 2 N—C(H)(R)—COOH.
- an amino acid is a naturally occurring amino acid.
- an amino acid is a synthetic amino acid; in some embodiments, an amino acid is a d-amino acid; in some embodiments, an amino acid is an 1-amino acid.
- Standard amino acid refers to any of the twenty standard 1-amino acids commonly found in naturally occurring peptides.
- Nonstandard amino acid refers to any amino acid, other than the standard amino acids, regardless of whether it is prepared synthetically or obtained from a natural source.
- synthetic amino acid encompasses chemically modified amino acids, including but not limited to salts, amino acid derivatives (such as amides), and/or substitutions.
- Amino acids, including carboxy- and/or amino-terminal amino acids in peptides, can be modified by methylation, amidation, acetylation, protecting groups, and/or substitution with other chemical groups that can change the peptide's circulating half-life without adversely affecting their activity. Amino acids may participate in a disulfide bond.
- Amino acids may comprise one or posttranslational modifications, such as association with one or more chemical entities (e.g., methyl groups, acetate groups, acetyl groups, phosphate groups, formyl moieties, isoprenoid groups, sulfate groups, polyethylene glycol moieties, lipid moieties, carbohydrate moieties, biotin moieties, etc.).
- chemical entities e.g., methyl groups, acetate groups, acetyl groups, phosphate groups, formyl moieties, isoprenoid groups, sulfate groups, polyethylene glycol moieties, lipid moieties, carbohydrate moieties, biotin moieties, etc.
- amino acid is used interchangeably with “amino acid residue,” and may refer to a free amino acid and/or to an amino acid residue of a peptide. It will be apparent from the context in which the term is used whether it refers to a free amino acid or a residue of a
- animal refers to any member of the animal kingdom. In some embodiments, “animal” refers to humans, at any stage of development. In some embodiments, “animal” refers to non-human animals, at any stage of development. In certain embodiments, the non-human animal is a mammal (e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, and/or a pig). In some embodiments, animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, insects, and/or worms. In some embodiments, an animal may be a transgenic animal, genetically-engineered animal, and/or a clone.
- mammal e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, and/or a pig.
- biologically active refers to a characteristic of any agent that has activity in a biological system, and particularly in an organism. For instance, an agent that, when administered to an organism, has a biological effect on that organism, is considered to be biologically active.
- an agent that, when administered to an organism, has a biological effect on that organism is considered to be biologically active.
- a portion of that protein or polypeptide that shares at least one biological activity of the protein or polypeptide is typically referred to as a “biologically active” portion.
- Cation-independent mannose-6-phosphate receptor As used herein, the term “cation-independent mannose-6-phosphate receptor (CI-M6PR)” refers to a cellular receptor that binds mannose-6-phosphate (M6P) tags on acid hydrolase precursors in the Golgi apparatus that are destined for transport to the lysosome. In addition to mannose-6-phosphates, the CI-M6PR also binds other proteins including IGF-II.
- the CI-M6PR is also known as “M6P/IGF-II receptor”, “CI-M6PR/IGF-II receptor”, “CD222”, “MPR300”, “IGF-II receptor” or “IGF2 Receptor.” These terms and abbreviations thereof are used interchangeably herein.
- Cell culture refers to a cell population that is gown in a medium under conditions suitable to survival and/or growth of the cell population. As will be clear to those of ordinary skill in the art, these terms as used herein may refer to the combination comprising the cell population and the medium in which the population is grown.
- Diluent refers to a pharmaceutically acceptable (e.g., safe and non-toxic for administration to a human) diluting substance useful for the preparation of a reconstituted formulation.
- exemplary diluents include sterile water, bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
- Dosing regimen is a set of unit doses (typically more than one) that are administered individually to a subject, typically separated by periods of time.
- a given therapeutic agent has a recommended dosing regimen, which may involve one or more doses.
- a dosing regimen comprises a plurality of doses each of which are separated from one another by a time period of the same length; in some embodiments, a dosing regimen comprises a plurality of doses and at least two different time periods separating individual doses.
- Enzyme replacement therapy refers to any therapeutic strategy that corrects an enzyme deficiency by providing the missing enzyme.
- the missing enzyme is provided by intrathecal administration.
- the missing enzyme is provided by infusing into bloodsteam. Once administered, enzyme is taken up by cells and transported to the lysosome, where the enzyme acts to eliminate material that has accumulated in the lysosomes due to the enzyme deficiency.
- the therapeutic enzyme is delivered to lysosomes in the appropriate cells in target tissues where the storage defect is manifest.
- expression of a nucleic acid sequence refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5′ cap formation, and/or 3′ end formation); (3) translation of an RNA into a polypeptide or protein; and/or (4) post-translational modification of a polypeptide or protein.
- expression and “production,” and grammatical equivalent, are used interchangeably.
- fragment refers to polypeptides and is defined as any discrete portion of a given polypeptide that is unique to or characteristic of that polypeptide.
- the term as used herein also refers to any discrete portion of a given polypeptide that retains at least a fraction of the activity of the full-length polypeptide.
- the fraction of activity retained is at least 10% of the activity of the full-length polypeptide. More preferably the fraction of activity retained is at least 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90% of the activity of the full-length polypeptide. More preferably still the fraction of activity retained is at least 95%, 96%, 97%, 98% or 99% of the activity of the full-length polypeptide.
- the fraction of activity retained is 100% of the activity of the full-length polypeptide.
- the term as used herein also refers to any portion of a given polypeptide that includes at least an established sequence element found in the full-length polypeptide.
- the sequence element spans at least 4-5, more preferably at least about 10, 15, 20, 25, 30, 35, 40, 45, 50 or more amino acids of the full-length polypeptide.
- Gene refers to any nucleotide sequence, DNA or RNA, at least some portion of which encodes a discrete final product, typically, but not limited to, a polypeptide, which functions in some aspect of a cellular process.
- the term is not meant to refer only to the coding sequence that encodes the polypeptide or other discrete final product, but may also encompass regions preceding and following the coding sequence that modulate the basal level of expression, as well as intervening sequences (“introns”) between individual coding segments (“exons”).
- a gene may include regulatory sequences (e.g., promoters, enhancers, poly adenylation sequences, termination sequences, Kozac sequences, tata box, etc.) and/or modification sequences.
- a gene may include references to nucleic acids that do not encode proteins but rather encode functional RNA molecules such as tRNAs, RNAi-inducing agents, etc.
- Gene product or expression product generally refers to an RNA transcribed from the gene (pre- and/or post-processing) or a polypeptide (pre- and/or post-modification) encoded by an RNA transcribed from the gene.
- Genetic control element refers to any sequence element that modulates the expression of a gene to which it is operably linked. Genetic control elements may function by either increasing or decreasing the expression levels and may be located before, within or after the coding sequence. Genetic control elements may act at any stage of gene expression by regulating, for example, initiation, elongation or termination of transcription, mRNA splicing, mRNA editing, mRNA stability, mRNA localization within the cell, initiation, elongation or termination of translation, or any other stage of gene expression. Genetic control elements may function individually or in combination with one another.
- the terms “improve,” “increase” or “reduce,” or grammatical equivalents indicate values that are relative to a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control subject (or multiple control subject) in the absence of the treatment described herein.
- a “control subject” is a subject afflicted with the same form of disease as the subject being treated, who is about the same age as the subject being treated.
- in vitro refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, etc., rather than within a multi-cellular organism.
- in vivo refers to events that occur within a multi-cellular organism, such as a human and a non-human animal. In the context of cell-based systems, the term may be used to refer to events that occur within a living cell (as opposed to, for example, in vitro systems).
- Intrathecal administration refers to an injection into the spinal canal (intrathecal space surrounding the spinal cord). Various techniques may be used including, without limitation, lateral cerebroventricular injection through a burrhole or cisternal or lumbar puncture or the like.
- “intrathecal administration” or “intrathecal delivery” according to the present invention refers to IT administration or delivery via the lumbar area or region, i.e., lumbar IT administration or delivery.
- lumbar region or “lumbar area” refers to the area between the third and fourth lumbar (lower back) vertebrae and, more inclusively, the L2-S1 region of the spine.
- Linker refers to, in a fusion protein, an amino acid sequence other than that appearing at a particular position in the natural protein and is generally designed to be flexible or to interpose a structure, such as an a-helix, between two protein moieties.
- a linker is also referred to as a spacer.
- Lysosomal enzyme refers to any enzyme that is capable of reducing accumulated materials in mammalian lysosomes or that can rescue or ameliorate one or more lysosomal storage disease symptoms.
- Lysosomal enzymes suitable for the invention include both wild-type or modified lysosomal enzymes and can be produced using recombinant and synthetic methods or purified from nature sources. Exemplary lysosomal enzymes are listed in Table 2.
- Lysosomal enzyme deficiency refers to a group of genetic disorders that result from deficiency in at least one of the enzymes that are required to break macromolecules (e.g., enzyme substrates) down to peptides, amino acids, monosaccharides, nucleic acids and fatty acids in lysosomes.
- macromolecules e.g., enzyme substrates
- peptides amino acids, monosaccharides, nucleic acids and fatty acids in lysosomes.
- individuals suffering from lysosomal enzyme deficiencies have accumulated materials in various tissues (e.g., CNS, liver, spleen, gut, blood vessel walls and other organs).
- Lysosomal storage disease refers to any disease resulting from the deficiency of one or more lysosomal enzymes necessary for metabolizing natural macromolecules. These diseases typically result in the accumulation of un-degraded molecules in the lysosomes, resulting in increased numbers of storage granules (also termed storage vesicles). These diseases and various examples are described in more detail below.
- nucleic acid refers to any compound and/or substance that is or can be incorporated into a polynucleotide chain.
- a nucleic acid is a compound and/or substance that is or can be incorporated into a polynucleotide chain via a phosphodiester linkage.
- nucleic acid refers to individual nucleic acid residues (e.g., nucleotides and/or nucleosides).
- nucleic acid refers to a polynucleotide chain comprising individual nucleic acid residues.
- nucleic acid encompasses RNA as well as single and/or double-stranded DNA and/or cDNA.
- nucleic acid “DNA,” “RNA,” and/or similar terms include nucleic acid analogs, i.e., analogs having other than a phosphodiester backbone.
- peptide nucleic acids which are known in the art and have peptide bonds instead of phosphodiester bonds in the backbone, are considered within the scope of the present invention.
- nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and/or encode the same amino acid sequence.
- Nucleotide sequences that encode proteins and/or RNA may include introns.
- Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, backbone modifications, etc. A nucleic acid sequence is presented in the 5′ to 3′ direction unless otherwise indicated.
- a nucleic acid is or comprises natural nucleosides (e.g., adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine); nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, C-5 propynyl-cytidine, C-5 propynyl-uridine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaaden
- the present invention is specifically directed to “unmodified nucleic acids,” meaning nucleic acids (e.g., polynucleotides and residues, including nucleotides and/or nucleosides) that have not been chemically modified in order to facilitate or achieve delivery.
- nucleic acids e.g., polynucleotides and residues, including nucleotides and/or nucleosides
- a patient refers to any organism to which a provided composition may be administered, e.g., for experimental, diagnostic, prophylactic, cosmetic, and/or therapeutic purposes. Typical patients include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and/or humans). In some embodiments, a patient is a human. A human includes pre and post natal forms.
- pharmaceutically acceptable refers to substances that, within the scope of sound medical judgment, are suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- a polypeptide may include at least 3-5 amino acids, each of which is attached to others by way of at least one peptide bond.
- peptides sometimes include “non-natural” amino acids or other entities that nonetheless are capable of integrating into a polypeptide chain, optionally.
- polypeptide and peptide are used interchangeably.
- Protein As used herein, the term “protein” of “therapeutic protein” refers to a polypeptide (i.e., a string of at least two amino acids linked to one another by peptide bonds). Proteins may include moieties other than amino acids (e.g., may be glycoproteins, proteoglycans, etc.) and/or may be otherwise processed or modified. Those of ordinary skill in the art will appreciate that a “protein” can be a complete polypeptide chain as produced by a cell (with or without a signal sequence), or can be a characteristic portion thereof. Those of ordinary skill will appreciate that a protein can sometimes include more than one polypeptide chain, for example linked by one or more disulfide bonds or associated by other means.
- Polypeptides may contain 1-amino acids, d-amino acids, or both and may contain any of a variety of amino acid modifications or analogs known in the art. Useful modifications include, e.g., terminal acetylation, amidation, methylation, etc.
- proteins may comprise natural amino acids, non-natural amino acids, synthetic amino acids, and combinations thereof.
- the term “peptide” is generally used to refer to a polypeptide having a length of less than about 100 amino acids, less than about 50 amino acids, less than 20 amino acids, or less than 10 amino acids.
- proteins are antibodies, antibody fragments, biologically active portions thereof, and/or characteristic portions thereof.
- Recombinant protein and Recombinant polypeptide refer to a polypeptide expressed from a host cell, that has been genetically engineered to express that polypeptide.
- a recombinant protein may be expressed in a host cell derived from an animal.
- a recombinant protein may be expressed in a host cell derived from an insect.
- a recombinant protein may be expressed in a host cell derived from a yeast.
- a recombinant protein may be expressed in a host cell derived from a prokaryote.
- a recombinant protein may be expressed in a host cell derived from an mammal.
- a recombinant protein may be expressed in a host cell derived from a human.
- the recombinantly expressed polypeptide may be identical or similar to a polypeptide that is normally expressed in the host cell.
- the recombinantly expressed polypeptide may be foreign to the host cell, i.e. heterologous to peptides normally expressed in the host cell.
- the recombinantly expressed polypeptide can be a chimeric, in that portions of the polypeptide contain amino acid sequences that are identical or similar to polypeptides normally expressed in the host cell, while other portions are foreign to the host cell.
- subject refers to a human or any non-human animal (e.g., mouse, rat, rabbit, dog, cat, cattle, swine, sheep, horse or primate).
- a human includes pre- and post-natal forms.
- a subject is a human being.
- a subject can be a patient, which refers to a human presenting to a medical provider for diagnosis or treatment of a disease.
- the term “subject” is used herein interchangeably with “individual” or “patient.”
- a subject can be afflicted with or is susceptible to a disease or disorder but may or may not display symptoms of the disease or disorder.
- Target tissues refers to any tissue that is affected by the lysosomal storage disease to be treated or any tissue in which the deficient lysosomal enzyme is normally expressed.
- target tissues include those tissues in which there is a detectable or abnormally high amount of enzyme substrate, for example stored in the cellular lysosomes of the tissue, in patients suffering from or susceptible to the lysosomal storage disease.
- target tissues include those tissues that display disease-associated pathology, symptom, or feature.
- target tissues include those tissues in which the deficient lysosomal enzyme is normally expressed at an elevated level.
- a target tissue may be a brain target tissue, a spinal cord target tissue and/or a peripheral target tissue. Exemplary target tissues are described in detail below.
- treatment refers to any administration of a therapeutic protein (e.g., lysosomal enzyme) that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of a particular disease, disorder, and/or condition (e.g., Hunters syndrome, Sanfilippo B syndrome).
- a therapeutic protein e.g., lysosomal enzyme
- Such treatment may be of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition.
- Such treatment may be of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition.
- therapeutically effective amount of a therapeutic agent means an amount that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and/or condition, to treat, diagnose, prevent, and/or delay the onset of the symptom(s) of the disease, disorder, and/or condition. It will be appreciated by those of ordinary skill in the art that a therapeutically effective amount is typically administered via a dosing regimen comprising at least one unit dose.
- the present invention provides, among other things, methods and compositions for lysosomal targeting of a therapeutic protein (e.g., a lysosomal enzyme) based on a lysosomal targeting moiety that comprises PCSK9 (proprotein convertase subtilisin kexin type 9).
- a therapeutic protein e.g., a lysosomal enzyme
- PCSK9 prote convertase subtilisin kexin type 9
- the present invention provides a targeted therapeutic comprising a lysosomal enzyme and a lysosomal targeting moiety that binds to amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and/or Annexin A2.
- APLP2 amyloid precursor-like protein 2
- APP amyloid precursor protein
- ARH autosomal recess
- the present invention may be used to target any therapeutic protein to a lysosome.
- the present invention may be used to target a lysosomal enzyme to a lysosome for the treatment of a lysosomal storage disease.
- a lysosomal enzyme is contemplated to encompass any enzyme or protein that, when targeted to the lysosome, is suitable for the treatment of a lysosomal storage disease.
- lysosomal enzymes are acid alpha-glucosidase (GAA) protein, which is deficient in Pompe disease, and alpha-N-acetylglucosaminidase (Naglu) protein, which is deficient in Sanfilippo Syndrome Type B disease. Additional exemplary lysosomal enzymes are shown in Table 3.
- a suitable GAA protein according to the present invention can be any molecule that can substitute for naturally-occurring GAA protein activity or rescue one or more phenotypes or symptoms associated with GAA-deficiency.
- a GAA protein suitable for the invention is a polypeptide having an N-terminus and C-terminus and an amino acid sequence substantially similar or identical to mature human GAA protein.
- human GAA is produced as a precursor molecule that is processed to a mature form. This process generally occurs by removing the 27 amino acid signal peptide as the protein enters the endoplasmic reticulum.
- the precursor form including the 27 amino acid signal peptide is also referred to as Full-Length GAA protein, which contains 952 amino acids.
- the N-terminal 27 amino acids are cleaved as the Full-Length GAA protein enters the endoplasmic reticulum, resulting in the Precursor Form GAA Protein.
- the Precursor Form GAA Protein is then subsequently cleaved to remove a N-terminal propeptide sequence of 42 amino acids, to produce the Mature Form GAA protein (aa 70-952).
- N-terminal 27 amino acids that constitute the signal peptide and the N-terminal 42 amino acids that constitute the propeptide are generally not required for GAA protein activity.
- the use of the Full-Length GAA Protein (aa 1-952) and of the Precursor Form GAA Protein (aa 28-952) are also contemplated within the scope of the instant invention.
- the amino acid sequences of the Mature Form GAA Protein (SEQ ID NO:1); Precursor Form GAA Protein (SEQ ID NO:2) and Full-Length GAA Protein (SEQ ID NO:3) of a typical wild-type or naturally-occurring human GAA protein are shown in Table 1 below.
- GAA protein suitable for the present invention is a human Mature Form GAA Protein (SEQ ID NO:1).
- a suitable GAA protein may be a homologue or an orthologue of human Mature Form GAA Protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.).
- a suitable GAA protein may be a functional variant of human Mature Form GAA Protein.
- a functional variant Mature Form GAA Protein may be a modified human Mature Form GAA Protein containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring human Mature Form GAA Protein (e.g., SEQ ID NO:1), while retaining substantial GAA protein activity.
- a GAA protein suitable for the present invention is substantially homologous to human Mature Form GAA Protein (SEQ ID NO:1).
- a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:1.
- a GAA protein suitable for the present invention is substantially identical to human Mature Form GAA Protein (SEQ ID NO:1).
- a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:1.
- a GAA protein suitable for the present invention contains a fragment or a portion of human Mature Form GAA Protein.
- a GAA protein suitable for the present invention is a human Precursor Form GAA Protein (SEQ ID NO:2).
- a GAA protein suitable may be a homologue or an orthologue of human Precursor Form GAA Protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.).
- a suitable GAA protein is a functional variant of a human Precursor Form GAA Protein, containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring human Precursor Form GAA Protein (e.g., SEQ ID NO:2), while retaining substantial GAA protein activity.
- a GAA protein suitable for the present invention is substantially homologous to human Precursor Form GAA Protein (SEQ ID NO:2).
- a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:2.
- a GAA protein suitable for the present invention is substantially identical to SEQ ID NO:2.
- a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:2.
- a GAA protein suitable for the present invention contains a fragment or a portion of human Precursor Form GAA Protein.
- a Precursor Form GAA Protein typically contains a propeptide sequence.
- a GAA protein suitable for the present invention is a human Full-Length GAA Protein (SEQ ID NO:3).
- a GAA protein suitable may be a homologue or an orthologue of Full-Length GAA Protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.).
- a suitable GAA protein is a functional variant of human Full-Length GAA Protein, containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring full length GAA protein (e.g., SEQ ID NO:3), while retaining substantial GAA protein activity.
- a GAA protein suitable for the present invention is substantially homologous to human Full-Length GAA Protein (SEQ ID NO:3).
- a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:3.
- a GAA protein suitable for the present invention is substantially identical to SEQ ID NO:3.
- a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:3.
- a GAA protein suitable for the present invention contains a fragment or a portion of human Full-Length GAA Protein.
- a Full-Length GAA Protein typically contains a signal peptide sequence and a propeptide sequence.
- a suitable Naglu protein according to the present invention can be any molecule that can substitute for naturally-occurring Naglu protein activity or rescue one or more phenotypes or symptoms associated with Naglu-deficiency.
- a Naglu protein suitable for the invention is a polypeptide having an N-terminus and C-terminus and an amino acid sequence substantially similar or identical to mature human Naglu protein.
- human Naglu is produced as a precursor molecule that is processed to a mature form. This process generally occurs by removing the 23 amino acid signal peptide as the protein enters the endoplasmic reticulum.
- the precursor form is also referred to as full-length precursor or full-length Naglu protein, which contains 743 amino acids.
- the N-terminal 23 amino acids are cleaved as the precursor protein enters the endoplasmic reticulum, resulting in a mature form.
- the N-terminal 23 amino acids is generally not required for the Naglu protein activity.
- the use of the full-length precursor of the Naglu protein is also contemplated within the scope of the instant invention.
- the amino acid sequences of the mature form (SEQ ID NO:4) and full-length precursor (SEQ ID NO:5) of a typical wild-type or naturally-occurring human Naglu protein are shown in Table 2 below.
- Naglu protein suitable for the present invention is a mature human Naglu protein (SEQ ID NO:4).
- a suitable Naglu protein may be a homologue or an orthologue of the mature human Naglu protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.).
- a suitable Naglu protein may be a functional variant of the mature human Naglu protein.
- a functional variant of the mature human Naglu protein may be a modified mature human Naglu protein containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring Naglu protein (e.g., SEQ ID NO:4), while retaining substantial Naglu protein activity.
- a Naglu protein suitable for the present invention is substantially homologous to mature human Naglu protein (SEQ ID NO:4).
- a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:4.
- a Naglu protein suitable for the present invention is substantially identical to mature human Naglu protein (SEQ ID NO:4).
- a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:4.
- a Naglu protein suitable for the present invention contains a fragment or a portion ofa mature Naglu protein.
- a Naglu protein suitable for the present invention is a full-length Naglu protein (SEQ ID NO:5).
- a Naglu protein suitable may be a homologue or an orthologue of the full-length human Naglu protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.).
- a suitable Naglu protein is a functional variant of the full-length human Naglu protein, containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring full-length Naglu protein (e.g., SEQ ID NO:5), while retaining substantial Naglu protein activity.
- a Naglu protein suitable for the present invention is substantially homologous to full-length human Naglu protein (SEQ ID NO:5).
- a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:5.
- a Naglu protein suitable for the present invention is substantially identical to SEQ ID NO:5.
- a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:5.
- a Naglu protein suitable for the present invention contains a fragment or a portion of a full-length Naglu protein. As used herein, a full-length Naglu protein typically contains a signal peptide sequence.
- the present invention may be used to deliver any lysosomal enzymes that can be used to treat any lysosomal storage diseases, in particular those lysosomal storage diseases having skeletal muscle, kidney and/or CNS etiology and/or symptoms, including, but are not limited to, aspartylglucosaminuria, cholesterol ester storage disease, Wolman disease, cystinosis, Danon disease, Fabry disease, Farber lipogranulomatosis, Farber disease, fucosidosis, galactosialidosis types I/II, Gaucher disease types I/II/III, globoid cell leukodystrophy, Krabbe disease, glycogen storage disease II, Pompe disease, GM1-gangliosidosis types I/II/III, GM2-gangliosidosis type I, Tay Sachs disease, GM2-gangliosidosis type II, Sandhoff disease, GM2-gangliosidosis, ⁇ -mannosidosis types I/I
- a lysosomal enzyme suitable for the invention may have a wild-type or naturally occurring sequence.
- a lysosomal enzyme suitable for the invention may have a modified sequence having substantial homology or identify to the wild-type or naturally-occurring sequence (e.g., having at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% sequence identity to the wild-type or naturally-occurring sequence).
- a lysosomal targeting moiety refers to any agent that can facilitate lysosomal delivery via binding to a protein other than the CI-M6PR receptor.
- the lysosomal targeting moiety is able to bind, directly or indirectly, to one or more membrane proteins via a cis-his rich domain (CHRD) to form a protein complex.
- CHRD cis-his rich domain
- the lysosomal targeting moiety binds, directly or indirectly, to one or more secondary binding proteins selected from the group consisting of the low density lipoprotein receptor (LDLR), amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8), or combinations thereof.
- LDLR low density lipoprotein receptor
- APLP2 amyloid precursor-like protein 2
- APP amyloid precursor protein
- ARH autosomal recessive hypercholesterolemia
- Lrp8 low density lipoprotein receptor-related protein 8
- the lysosomal targeting moiety comprises a proprotein convertase, or fragment thereof.
- the proprotein convertase is a mammalian proprotein convertase.
- Mammalian proprotein convertases are members of a secretory serine protease family composed of nine members related to bacterial subtilisin and yeast kexin.
- the catalytic domains of seven members of this family (PC1/3; PC2; Furin; PC4; PC5/6; PACE4 and PC7) exhibit homology to the catalytic domain of yeast kexin, and they are known to cleave after basic residues in target proteins.
- the eighth member, SKI-1/S1P shows strong homology to bacterial pyrolysin and, similar to the other 7 family members, is known to cleave after basic residues in target proteins.
- PCSK9 shows homology to fungal proteinase K and undergoes autoproteolytic cleavage at the (V/I)FAQ motif in the endoplasmic reticulum.
- these proprotein convertases are synthesized as inactive zymogens that carry an N-terminal propeptide. It is thought that this propeptide facilitates proper folding of the convertase, and that it functions as a natural inhibitor of the enzyme until it is cleaved off.
- PCSK9 Several PCs (Furin, PC5/6; PACE4, SKI-1/S1P and PCSK9) have been shown to play a central role in regulating sterols and/or lipid metabolism. This is especially true for PCSK9, whose over-activity/gain-of-function results in Familial Hypercholesterolemia (FH).
- FH Familial Hypercholesterolemia
- PCSK9 is highly expressed in the liver and produced as a preprotein that undergoes autoproteolytic cleavage during passage through the secretory pathyway. During this process, the C-terminus of the N-terminal propeptide occupies PCSK9's catalytic pocket, inhibiting its proteolytic activity and blocking access to other exogenous substrates.
- PCSK9 binds to the EGF-A domain of the LDL receptor through part of its catalytic domain to form a non-covalent protein complex, which is internalized by endocytosis and targeted for degradation in the acidic compartment of the lysosome.
- PCSK9-LDLR complex is necessary for LDL receptor (LDLR) recycling and removal of LDL from the extracellular space, it is not required for PCSK9 endocytosis to the lysosome.
- LDLR LDL receptor
- lysosomal targeting and function of PCSK9 relies on its C-terminal Cys-His-rich domain (CHRD), a region which allows for non-covalent binding with various membrane bound protein such as: amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A2 (LoSurdo et al., EMBO 12:1300-1305 (2011); Ni et al., J. Biol. Chem. 285:12882-12891 (2010); Saavedra et al., J. Biol. Chem.
- CHRD C-terminal Cys-His-rich domain
- a suitable lysosomal targeting moiety may be any proprotein convertase molecule, fragment or portion thereof (e.g., a motif or domain) capable of endocytosis to the lysosome.
- the proprotein convertase molecule or fragment thereof comprises a CHRD motif.
- the proprotein convertase is a mammalian proprotein convertase.
- the proprotein convertase is selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9. In some specific embodiments, the proprotein convertase is PCSK9.
- a suitable lysosomal targeting moiety may be any proprotein convertase molecule, fragment or portion thereof (e.g. a motif or domain) capable of binding, directly or indirectly, to the LDL receptor (LDLR).
- the proprotein convertase molecule or fragment thereof is capable of binding, directly or indirectly, to a secondary binding protein selected from the group consisting of amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A.
- binding to LDLR or secondary binding protein typically refers to a physiologically meaningful binding.
- a physiologically meaningful binding typically has a dissociation constant (Kd) no greater than 10 ⁇ 7 under physiological conditions (e.g., pH 6-8, and in particular, pH 7.4).
- the lysosomal targeting moiety comprises the PCSK9 preprotein (including the PCSK9 signal peptide ⁇ N-terminal 30 amino acids ⁇ and propeptide ⁇ N-terminal amino acids from position 31 to 122 ⁇ ) (SEQ ID NO:6).
- the lysosomal targeting moiety comprises the PCSK9 protein without the N-terminal signal and propeptide, i.e., PCSK9 Mature Protein (SEQ ID NO:7).
- a lysosomal targeting moiety is a peptide fragment derived from human PCSK9 preprotein (SEQ ID NO:6).
- the amino acid sequences of a typical wild-type or naturally-occurring human PCSK9 preprotein and an auto-proteolytically cleaved human mature PCSK9 protein are shown in Table 4 below.
- a lysosomal targeting moiety has a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the sequence of the PCSK9 preprotein (SEQ ID NO:6). In some embodiments, a lysosomal targeting moiety has a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the sequence of PCSK9 Mature Protein (SEQ ID NO:7). In some embodiments, a lysosomal targeting moiety is a fragment of human PCSK9 Preprotein.
- a lysosomal targeting moiety contains one or more N-terminal, C-terminal or internal deletions, or combinations thereof, in the sequence of human PCSK9 Preprotein (SEQ ID NO:6). In some embodiments, a lysosomal targeting moiety contains one or more N-terminal, C-terminal or internal deletions, or combinations thereof, in the sequence of the human PCSK9 Mature Protein (SEQ ID NO:7).
- a lysosomal targeting moiety is a modified human PCSK9 sequence (preprotein or mature form) containing amino acid substitutions, insertions or deletions.
- the lysosomal targeting moiety has one or more amino acid substitutions, deletions or insertions within the catalytic domain of the preprotein or mature form of PCSK9.
- the lysosomal targeting moiety has one or more mutations within the PCSK9 catalytic domain that diminish or enhance auto proteolytic cleavage.
- the one more mutations within the catalytic domain comprise a S386A substitution.
- the lysosomal targeting moiety has one or more mutations (amino acid substitutions, insertions or deletions) within the LDLR binding region that diminish or enhance binding to the LDL receptor.
- the mutation within the LDLR binding region comprises a F379A substitution.
- the lysosomal targeting moiety has one or more mutations (amino acid substitutions, insertions or deletions) within the CHRD region of the protein. In some embodiments, the lysosomal targeting moiety has one or more mutations within the CHRD region that enhance binding to one or more secondary binding proteins selected from the group consisting of amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A.
- APLP2 amyloid precursor-like protein 2
- APP amyloid precursor protein
- ARH autosomal recessive hypercholesterolemia
- Lrp8 low density lipoprotein receptor-related protein 8
- the lysosomal targeting moiety has one or more mutations, substitutions, deletions or insertions within a region selected from the group consisting of the catalytic domain, propeptide, CHRD region, LDLR binding region and combinations thereof.
- the one or more mutations are selected from the group consisting of S386A, F379A and combinations thereof.
- the one or more mutations are selected from the group consisting of amino acid substitutions at positions R194 (elimination of LDL receptor binding), D186 and/or H226 (both elimination of protease activity); the substitution in these three cases may be A, as well as other amino acids such as L, G, V, and others.
- a suitable lysosomal targeting moiety is a protein complex comprising a proprotein convertase, or fragment thereof, and one or more auxiliary proteins.
- auxiliary protein is used to describe a protein (i.e., full length, fragment, peptide or motif) non-covalently bound to the catalytic domain of a proprotein convertase, or fragment thereof, which is capable of inhibiting enzyme activity and/or of enhancing cellular uptake of the proprotein convertase.
- a suitable lysosomal targeting moiety is a protein complex comprising human PCSK9 and one or more auxiliary proteins.
- the auxiliary protein comprises a protein (i.e., full length, fragment, peptide or motif) which binds within the catalytic domain of a human proprotein convertase.
- the auxiliary protein partially occludes the catalytic site of PCSK9 or any other proprotein convertase when bound.
- the auxiliary protein completely occludes the catalytic site of PCSK9 when bound.
- the auxiliary protein binds within the catalytic domain of PCSK9 or any other proprotein convertase and reduces enzyme activity by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95%. In some embodiments, the auxiliary protein completely blocks enzyme activity when bound within the catalytic site of PCSK9 or any other proprotein convertase.
- the auxiliary protein binds the LDLR receptor binding site within the catalytic domain of PCSK9 or any other proprotein convertase.
- the auxiliary protein reduces binding between PCSK9, or any other proprotein convertase, and LDLR by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95%. In some embodiments, the auxiliary protein completely reduces binding of PCSK9, or any other proprotein convertase, to LDLR.
- the auxiliary protein enhances cellular uptake of PCSK9, or any other proprotein convertase, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95%.
- an auxiliary protein comprises a proprotein convertase propeptide, or fragment thereof.
- the propeptide or fragment thereof is derived from a proprotein convertase protein selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9.
- the propeptide or fragment thereof is derived from PCSK9.
- the propeptide is derived from the PCSK9 preprotein (SEQ ID NO:6). In some embodiments, the propeptide comprises an amino acid sequence at least 50%, 60%, 70%, 80%, 85%, 90% or 95% identical SEQ ID NO:8. In some embodiments, the propeptide is identical to SEQ ID NO:8.
- the amino acid sequences of a propeptide derived from a typical wild-type or naturally-occurring human PCSK9 preprotein is shown in Table 5 below.
- a lysosomal enzyme and a targeting moiety can be associated, directly or indirectly.
- a lysosomal enzyme and a targeting moiety are non-covalently associated. The association is typically stable at or about pH 7.4.
- a targeting moiety can be biotinylated and bind avidin associated with a lysosomal enzyme.
- a targeting moiety and a lysosomal enzyme are crosslinked to each other (e.g., using a chemical crosslinking agent).
- a targeting moiety is fused to a lysosomal enzyme as a fusion protein.
- the targeting moiety can be at the amino-terminus of the fusion protein, the carboxy-terminus, or can be inserted within the sequence of the lysosomal enzyme at a position where the presence of the targeting moiety does not unduly interfere with the therapeutic activity of the enzyme.
- a lysosomal enzyme is a heteromeric protein, one or more of the subunits can be associated with a targeting moeity.
- a lysosomal targeting moiety can be fused to the N-terminus or C-terminus of a lysosomal enzyme polypeptide, or inserted internally.
- the lysosomal targeting moiety can be fused directly to the lysosomal enzyme polypeptide or can be separated from the lysosomal enzyme polypeptide by a linker or a spacer.
- An amino acid linker or spacer is generally designed to be flexible or to interpose a structure, such as an alpha-helix, between two protein moieties.
- a linker or spacer can be relatively short, such as a “GGG” or a poly “GAG” sequence GGGGGAAAAAGGGGG (SEQ ID NO:9), a “GAP” sequence of GAP (SEQ ID NO:10), a “PolyGP” sequence of GGGGGP (SEQ ID NO:11), or can be longer, such as, for example, 10-50 (e.g., 10-20, 10-25, 10-30, 10-35, 10-40, 10-45, 10-50) amino acids in length.
- various short linker sequences can be present in tandem repeats.
- a suitable linker may contain the “GAG” amino acid sequence of GGGGGAAAAAGGGGG (SEQ ID NO:9) present in tandem repeats.
- such a linker may further contain one or more “GAP” sequences, that frame the “GAG” sequence of GGGGGAAAAAGGGGG (SEQ ID NO:9).
- GAP GAG2 linker
- a GAG2 linker may be used, which contains two tandem “GAG” repeats, each framed by a “GAP” sequence, such as GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAP (SEQ ID NO:12).
- a GAG3 linker may be used, which contains three tandem “GAG” repeats, each framed by two “GAP” sequences, such as GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGG GAP (SEQ ID NO:13).
- a suitable linker or spacer may contain a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to any of the linker sequences described herein, including, but not limited to, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, or SEQ ID NO:13.
- linkers or spacers suitable for the invention are known in the art including those described in WO 2012122042, entitled “PEPTIDE LINKERS FOR POLYPEPTIDE COMPOSITIONS AND METHODS FOR USING SAME”, which is incorporated by reference in its entirety.
- the association between a lysosomal enzyme and a lysosomal targeting moiety according to the present invention does not substantially alter enzyme activity.
- the targeted therapeutic has an enzyme activity that is substantially similar or enhanced when compared to the corresponding native enzyme.
- the enzyme activity of a targeted therapeutic retains at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% enzymatic activity as compared to the native enzyme.
- the enzyme activity of a targeted therapeutic is enhanced by at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 70%, 80%, 90% or 100% compared to the native enzyme.
- a targeted therapeutic of the present invention comprises a GAA or Naglu protein fused to a lysosomal targeting moiety.
- the GAA or Naglu protein has a Km for a known substrate of at least about 0.10 nM (e.g., at least about 0.15 nM, 0.20 nM, 0.25 nM, 0.30 nM, or 0.35 nM).
- the targeted therapeutic of the present invention permits substantial binding between the lysosomal targeting moiety and a secondary binding protein, such as, but not limited to, amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8), LDLR and Annexin A.
- APLP2 amyloid precursor-like protein 2
- APP amyloid precursor protein
- ARH autosomal recessive hypercholesterolemia
- Lrp8 low density lipoprotein receptor-related protein 8
- LDLR low density lipoprotein receptor-related protein 8
- the targeted therapeutic of the present invention may be engineered to permit substantial binding between the lysosomal targeting moiety and a secondary binding protein, such as, but not limited to amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A, but shows a reduction or complete block in LDLR binding.
- APLP2 amyloid precursor-like protein 2
- APP amyloid precursor protein
- ARH autosomal recessive hypercholesterolemia
- Lrp8 low density lipoprotein receptor-related protein 8
- Annexin A but shows a reduction or complete block in LDLR binding.
- the level of LDLR or secondary binding protein binding of the targeted therapeutic may be tested using any of a variety of well-known binding assays, such as, but not limited to, radiolabeled run on assay, radiolabeled binding assay, ELISA, Surface Plasmone Resonance and Isothermal Titration calorimetry.
- the level of LDLR or secondary binding protein binding of the targeted therapeutics of the invention may be evaluated by cellular uptake studies.
- the cellular uptake of a targeted therapeutic according to the present invention has a Kd of at least about 1.0e+2 nM (e.g., at least about 1.0e+3 nM, 1.0e+4 nM, or 1.0e+5 nM).
- Targeted therapeutics may be produced via various methods known in the art.
- a targeted therapeutic is a fusion protein comprising a lysosomal targeting moiety and a therapeutic protein (e.g., a lysosomal enzyme).
- the fusion protein further comprises one or more auxiliary proteins. It is contemplated in accordance with the invention, that the targeted therapeutic, alone or further comprising an auxiliary binding protein, may be produced recombinantly.
- a fusion protein according to the invention may be engineered using standard recombinant technology and produced using a cell culture system.
- auxiliary protein may be achieved by co-expression of each component (fusion protein and auxiliary binding protein) to facilitate formation of the protein complex in vivo.
- the auxiliary protein and the fusion protein may be recombinantely produced separately and brought together in vitro (e.g., following purification) to facilitate formation of the protein complex.
- a fusion protein is engineered and expressed that comprises a lysosomal targeting moiety (e.g., PCSK9) and a therapeutic protein (e.g., GAA) and at the N-terminus, separated by a proteolytic cleavage site (e.g., for Furin), a signal peptide and propeptide of a proprotein convertases (e.g., PCSK9).
- a lysosomal targeting moiety e.g., PCSK9
- a therapeutic protein e.g., GAA
- GAA proteolytic cleavage site
- signal peptide and propeptide of a proprotein convertases e.g., PCSK9
- This proteolytic site will be cleaved intracellularly and the fusion comprising a lysosomal targeting moiety (e.g., PCSK9) and a therapeutic protein (e.g., GAA) will form a complex with the released propeptide (from which the signal peptide is removed within the ER).
- a lysosomal targeting moiety e.g., PCSK9
- a therapeutic protein e.g., GAA
- prokaryotic and eukaryotic cells may be used for producing fusion proteins including, without limitation, cell lines derived from bacteria strains, yeast strains, insect cells, animal cells, mammalian cells and human cells.
- aspects of the present invention also provide for expression constructs and the generation of recombinant stable cell lines useful for expressing fusion proteins which are disclosed in the present specification.
- aspects of the present invention also provide methods for producing cell lines that express fusion proteins using the disclosed nucleic acid sequences of the present specification.
- nucleic acid molecules are provided comprising nucleic acid sequences encoding for a recombinant fusion protein (herein referred to as a transgene), such as GAA and Naglu fusion proteins described in various embodiments herein.
- a transgene recombinant fusion protein
- the nucleic acid encoding a transgene may be modified to provide increased expression of the fusion protein, which is also referred to as codon optimization.
- the nucleic acid encoding a transgene can be modified by altering the open reading frame for the coding sequence.
- the term “open reading frame” is synonymous with “ORF” and means any nucleotide sequence that is potentially able to encode a protein, or a portion of a protein.
- An open reading frame usually begins with a start codon (represented as, e.g. AUG for an RNA molecule and ATG in a DNA molecule in the standard code) and is read in codon-triplets until the frame ends with a STOP codon (represented as, e.g. UAA, UGA or UAG for an RNA molecule and TAA, TGA or TAG in a DNA molecule in the standard code).
- start codon represented as, e.g. AUG for an RNA molecule and ATG in a DNA molecule in the standard code
- STOP codon represented as, e.g. UAA, UGA or UAG for an RNA molecule and TAA, TGA or TAG in a DNA molecule in the standard code.
- codon means a sequence of three nucleotides in a nucleic acid molecule that specifies a particular amino acid during protein synthesis; also called a triplet or codon-triplet.
- codons For example, of the 64 possible codons in the standard genetic code, two codons, GAA and GAG encode the amino acid Glutamine whereas the codons AAA and AAG specify the amino acid Lysine. In the standard genetic code three codons are stop codons, which do not specify an amino acid.
- sequence As used herein, the term “synonymous codon” means any and all of the codons that code for a single amino acid. Except for Methionine and Tryptophan, amino acids are coded by two to six synonymous codons.
- the four synonymous codons that code for the amino acid Alanine are GCA, GCC, GCG and GCU
- the two synonymous codons that specify Glutamine are GAA and GAG
- the two synonymous codons that encode Lysine are AAA and AAG.
- a nucleic acid encoding the open reading frame of fusion protein may be modified using standard codon optimization methods.
- codon optimization Various commercial algorithms for codon optimization are available and can be used to practice the present invention.
- codon optimization does not alter the encoded amino acid sequences.
- codon optimization may lead to amino acids alteration such as substitution, deletion or insertion. Typically, such amino acid alteration does not substantially alter the protein activity.
- Exemplary nucleic acid sequences encoding PCSK9-GAA, Naglu-PCSK9 and the PCSK9 propeptide are each respectively shown in SEQ ID NO:14, 15 and 16 below.
- SEQ ID NO:14 Exemplary nucleic acid sequence encoding PCSK9-GAA.
- nucleotide sequence encoding PCSK9 Mature Protein (except nucleotide sequences encoding mutations F379A and S386A, which are underlined) is not underlined, bold or in italics.
- the nucleotide sequence encoding the amino acid sequence of the GlyGlyGly linker is underlined.
- nucleotide sequence encoding Mature Form GAA Protein amino acid sequence (aa70-952) is bold and in italics.
- SEQ ID NO:15 Exemplary nucleic acid sequence encoding Naglu-PCSK9.
- nucleotide sequence encoding Mature Form of Naglu is not underlined, bold or in italics.
- the nucleotide sequence encoding the amino acid sequence of the GlyGlyGly linker is underlined.
- nucleotide sequence encoding PCSK9 Mature Protein is in italics.
- SEQ ID NO:16 Exemplary nucleic acid sequence encoding PCSK9 propeptide and PCSK9 N-terminal signal peptide.
- a nucleotide change may alter a synonymous codon within the open reading frame in order to agree with the endogenous codon usage found in a particular heterologous cell selected for expression.
- a nucleotide change may alter the G+C content within the open reading frame to better match the average G+C content of open reading frames found in endogenous nucleic acid sequence present in the heterologous host cell.
- a nucleotide change may also alter a polymononucleotide region or an internal regulatory or structural site found within a protein sequence.
- nucleic acid sequences providing increased expression of a fusion protein in a prokaryotic cell; yeast cell; insect cell; and in a mammalian cell.
- a nucleic acid encoding a PCSK9-GAA fusion protein suitable for the present invention comprises a nucleotide sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:14.
- a nucleic acid encoding a Naglu-PCSK9 fusion protein suitable for the present invention comprises a nucleotide sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:15.
- a nucleic acid encoding a PCSK9 propeptided suitable for the present invention comprises a nucleotide sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:16.
- a modified nucleic acid may or may not result in amino acid sequence alterations in a fusion protein. In the event there is amino acid alteration, such alteration typically does not substantially alter the biological activity of the protein.
- a nucleic acid sequence encoding a fusion protein or auxiliary binding protein as described in the present application can be molecularly cloned (inserted) into a suitable vector for propagation or expression in a host cell.
- a wide variety of expression vectors can be used to practice the present invention, including, without limitation, a prokaryotic expression vector; a yeast expression vector; an insect expression vector and a mammalian expression vector.
- Exemplary vectors suitable for the present invention include, but are not limited to, viral based vectors (e.g., AAV based vectors, retrovirus based vectors, plasmid based vectors).
- a nucleic acid encoding a fusion protein is operably linked to various regulatory sequences or elements.
- regulatory sequences or elements may be incorporated in an expression vector suitable for the present invention.
- exemplary regulatory sequences or elements include, but are not limited to, promoters, enhancers, repressors or suppressors, 5′ untranslated (or non-coding) sequences, introns, 3′ untranslated (or non-coding) sequences.
- a “Promoter” or “Promoter sequence” is a DNA regulatory region capable of binding an RNA polymerase in a cell (e.g., directly or through other promoter bound proteins or substances) and initiating transcription of a coding sequence.
- a promoter sequence is, in general, bound at its 3′ terminus by the transcription initiation site and extends upstream (5′ direction) to include the minimum number of bases or elements necessary to initiate transcription at any level.
- the promoter may be operably associated with or operably linked to the expression control sequences, including enhancer and repressor sequences or with a nucleic acid to be expressed.
- the promoter may be inducible.
- the inducible promoter may be unidirectional or bio-directional.
- the promoter may be a constitutive promoter.
- the promoter can be a hybrid promoter, in which the sequence containing the transcriptional regulatory region is obtained from one source and the sequence containing the transcription initiation region is obtained from a second source.
- Systems for linking control elements to coding sequence within a transgene are well known in the art (general molecular biological and recombinant DNA techniques are described in Sambrook, Fritsch, and Maniatis, Molecular Cloning: A Laboratory Manual , Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989, which is incorporated herein by reference).
- Commercial vectors suitable for inserting a transgene for expression in various host cells under a variety of growth and induction conditions are also well known in the art.
- a specific promoter may be used to control expression of the transgene in a mammalian host cell such as, but are not limited to, SR ⁇ -promoter (Takebe et al., Molec. and Cell. Bio.
- the human CMV immediate early promoter Boshart et al., Cell 41:521-530 (1985); Foecking et al., Gene 45:101-105 (1986)
- human CMV promoter the human CMV5 promoter
- the murine CMV immediate early promoter the EF1- ⁇ -promoter
- a hybrid CMV promoter for liver specific expression e.g., made by conjugating CMV immediate early promoter with the transcriptional promoter elements of either human ⁇ -1-antitrypsin (HAT) or albumin (HAL) promoter
- promoters for hepatoma specific expression e.g., wherein the transcriptional promoter elements of either human albumin (HAL; about 1000 bp) or human ⁇ -1-antitrypsin (HAT, about 2000 bp) are combined with a 145 long enhancer element of human ⁇ -1-microglobulin and bikunin precursor gene (AMBP); HAL-AMBP and HAT-
- the mammalian promoter is a constitutive promoter such as, but not limited to, the hypoxanthine phosphoribosyl transferase (HPTR) promoter, the adenosine deaminase promoter, the pyruvate kinase promoter, the beta-actin promoter as well as other constitutive promoters known to those of ordinary skill in the art.
- HPTR hypoxanthine phosphoribosyl transferase
- the adenosine deaminase promoter the pyruvate kinase promoter
- beta-actin promoter as well as other constitutive promoters known to those of ordinary skill in the art.
- a specific promoter may be used to control expression of a transgene in a prokaryotic host cell such as, but are not limited to, the ⁇ -lactamase promoter (Villa- Komaroff et al., Proc. Natl. Acad. Sci. USA 75:3727-3731 (1978)); the tac promoter (DeBoer et al., Proc. Natl. Acad. Sci.
- the T7 promoter, the T3 promoter, the M13 promoter or the M16 promoter in a yeast host cell such as, but are not limited to, the GAL1, GAL4 or GAL10 promoter, the ADH (alcohol dehydrogenase) promoter, PGK (phosphoglycerol kinase) promoter, alkaline phosphatase promoter, glyceraldehyde-3-phosphate dehydrogenase III (TDH3) promoter, glyceraldehyde-3-phosphate dehydrogenase II (TDH2) promoter, glyceraldehyde-3-phosphate dehydrogenase I (TDH1) promoter, pyruvate kinase (PYK), enolase (ENO), or triose phosphate isomerase (TPI).
- GAL1, GAL4 or GAL10 promoter in a yeast host cell
- ADH alcohol dehydrogenase
- PGK
- the promoter may be a viral promoter, many of which are able to regulate expression of a transgene in several host cell types, including mammalian cells.
- Viral promoters that have been shown to drive constitutive expression of coding sequences in eukaryotic cells include, for example, simian virus promoters, herpes simplex virus promoters, papilloma virus promoters, adenovirus promoters, human immunodeficiency virus (HIV) promoters, Rous sarcoma virus promoters, cytomegalovirus (CMV) promoters, the long terminal repeats (LTRs) of Moloney murine leukemia virus and other retroviruses, the thymidine kinase promoter of herpes simplex virus as well as other viral promoters known to those of ordinary skill in the art.
- simian virus promoters include, for example, simian virus promoters, herpes simplex virus promoters, papill
- the gene control elements of an expression vector may also include 5′ non-transcribing and 5′ non-translating sequences involved with the initiation of transcription and translation, respectively, such as a TATA box, capping sequence, CAAT sequence, Kozak sequence and the like.
- Enhancer elements can optionally be used to increase expression levels of a polypeptide or protein to be expressed. Examples of enhancer elements that have been shown to function in mammalian cells include the SV40 early gene enhancer, as described in Dijkema et al., EMBO J.
- LTR long terminal repeat
- RSV Rous Sarcoma Virus
- Genetic control elements of an expression vector will also include 3′ non-transcribing and 3′non-translating sequences involved with the termination of transcription and translation. Respectively, such as a poly polyadenylation (polyA) signal for stabilization and processing of the 3′ end of an mRNA transcribed from the promoter.
- Poly A signals included, for example, the rabbit beta globin polyA signal, bovine growth hormone polyA signal, chicken beta globin terminator/polyA signal, or SV40 late polyA region.
- Expression vectors will preferably but optionally include at least one selectable marker.
- the selectable maker is a nucleic acid sequence encoding a resistance gene operably linked to one or more genetic regulatory elements, to bestow upon the host cell the ability to maintain viability when grown in the presence of a cyctotoxic chemical and/or drug.
- a selectable agent may be used to maintain retention of the expression vector within the host cell.
- the selectable agent is may be used to prevent modification (i.e. methylation) and/or silencing of the transgene sequence within the expression vector.
- a selectable agent is used to maintain episomal expression of the vector within the host cell.
- an agent and/or resistance gene may include, but is not limited to, methotrexate (MTX), dihydrofolate reductase (DHFR, U.S. Pat. Nos. 4,399,216; 4,634,665; 4,656,134; 4,956,288; 5,149,636; 5,179,017, ampicillin, neomycin (G418), zeomycin, mycophenolic acid, or glutamine synthetase (GS, U.S. Pat. Nos.
- Expression vectors may be transfected, transformed or transduced into a host cell.
- the terms “transfection,” “transformation” and “transduction” all refer to the introduction of an exogenous nucleic acid sequence into a host cell.
- expression vectors containing nucleic acid sequences encoding a fusion therapeutic glycoprotein is transfected, transformed or transduced into a host cell.
- one or more expression vectors containing nucleic acid sequences encoding a fusion therapeutic glycoprotein are transfected, transformed or transduced into a host cell sequentially.
- a vector encoding a first fusion therapeutic glycoprotein protein may be transfected, transformed or transduced into a host cell, followed by the transfection, transformation or transduction of a vector encoding a second fusion therapeutic glycoprotein, and vice versa.
- transformation, transfection and transduction methods examples include liposome delivery, i.e., LipofectamineTM (Gibco BRL) Method of Hawley-Nelson, Focus 15:73 (1193), electroporation, CaPO 4 delivery method of Graham and van der Erb, Virology, 52:456-457 (1978), DEAE-Dextran medicated delivery, microinjection, biolistic particle delivery, polybrene mediated delivery, cationic mediated lipid delivery, transduction, and viral infection, such as, e.g., retrovirus, lentivirus, adenovirus adeno-associated virus and Baculovirus (Insect cells).
- liposome delivery i.e., LipofectamineTM (Gibco BRL) Method of Hawley-Nelson, Focus 15:73 (1193), electroporation, CaPO 4 delivery method of Graham and van der Erb, Virology, 52:456-457 (1978), DEAE-Dextran medicated delivery, microinjection, bio
- expression vectors may be integrated stably in the genome or exist as extra-chromosomal constructs. Vectors may also be amplified and multiple copies may exist or be integrated in the genome.
- cells of the invention may contain 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more copies of nucleic acids encoding a fusion therapeutic glycoprotein.
- cells of the invention may contain multiple copies (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more) of nucleic acids encoding one or more fusion therapeutic glycoproteins.
- Any mammalian cell or cell type susceptible to cell culture, and to expression of polypeptides, may be utilized in accordance with the present invention as a host cell.
- mammalian cells that may be used in accordance with the present invention include HT1080 cells (Rasheed S, Nelson-Rees W A, Toth E M, Arnstein P, Gardner M B. Characterization of a newly derived human sarcoma cell line (HT1080).
- mice sertoli cells TM4, Mather, Biol. Reprod., 23:243-251 (1980)); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1 587); human cervical carcinoma cells (HeLa, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N.Y. Acad.
- a suitable mammalian cell is not a endosomal acidification-deficient cell.
- hybridoma cell lines that express polypeptides or proteins may be utilized in accordance with the present invention.
- hybridoma cell lines might have different nutrition requirements and/or might require different culture conditions for optimal growth and polypeptide or protein expression, and will be able to modify conditions as needed.
- Non-limiting examples of non-mammalian host cells and cell lines that may be used in accordance with the present invention include cells and cell lines derived from Pichia pastoris, Pichia methanolica, Pichia angusta, Schizosacccharomyces pombe, Saccharomyces cerevisiae , and Yarrowia lipolytica for yeast; Sodoptera frugiperda, Trichoplusis ni, Drosophila melangoster and Manduca sexta for insects; and Escherichia coli, Salmonella typhimurium, Bacillus subtilis, Bacillus lichenifonnis, Bacteroides fragilis, Clostridia perfringens, Clostridia difficile for bacteria; and Xenopus Laevis from amphibian.
- transgenic nonhuman mammals have been shown to produce therapeutic glycoproteins (e.g., lysosomal enzymes) in their milk.
- Such transgenic nonhuman mammals may include mice, rabbits, goats, sheep, porcines or bovines. See U.S. Pat. Nos. 6,118,045 and 7,351,410, each of which are hereby incorporated by reference in their entirety.
- Any and all methods suitable for producing recombinant protein can be used to produce therapeutic protein of the present invention.
- the present invention further provides pharmaceutical compositions containing targeted therapeutics according to the present invention.
- suitable pharmaceutical compositions contain at least one pharmaceutically acceptable excipient and are formulated for administration to humans.
- compositions provided herein may be provided in a sterile injectable form (e.g., a form that is suitable for subcutaneous, intravenous, or intrathecal injection).
- a sterile injectable form e.g., a form that is suitable for subcutaneous, intravenous, or intrathecal injection.
- pharmaceutical compositions are provided in a liquid dosage form that is suitable for injection.
- pharmaceutical compositions are provided as powders (e.g., lyophilized and/or sterilized), optionally under vacuum, which are reconstituted with an aqueous diluent (e.g., water, buffer, salt solution, etc.) prior to injection.
- an aqueous diluent e.g., water, buffer, salt solution, etc.
- compositions are diluted and/or reconstituted in water, sodium chloride solution, sodium acetate solution, benzyl alcohol solution, phosphate buffered saline, etc.
- powder should be mixed gently with the aqueous diluent (e.g., not shaken).
- provided pharmaceutical compositions comprise one or more pharmaceutically acceptable excipients (e.g., preservative, inert diluent, dispersing agent, surface active agent and/or emulsifier, buffering agent, etc.).
- pharmaceutical compositions comprise one or more preservatives.
- pharmaceutical compositions comprise no preservative.
- compositions of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology.
- such preparatory methods include the step of bringing active ingredient into association with one or more excipients and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping and/or packaging the product into a desired single- or multi-dose unit.
- a pharmaceutical composition in accordance with the invention may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
- a “unit dose” is discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
- the amount of the active ingredient is generally equal to a dose which would be administered to a subject and/or a convenient fraction of such a dose such as, for example, one-half or one-third of such a dose.
- Relative amounts of active ingredient, pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition in accordance with the invention may vary, depending upon the identity, size, and/or condition of the subject treated and/or depending upon the route by which the composition is to be administered.
- the composition may comprise between 0.1% and 100% (w/w) active ingredient.
- compositions of the present invention may additionally comprise a pharmaceutically acceptable excipient, which, as used herein, may be or comprise solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
- a pharmaceutically acceptable excipient which, as used herein, may be or comprise solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
- Remington's The Science and Practice of Pharmacy, 21st Edition, A. R. Gennaro, discloses various excipients used in formulating pharmaceutical compositions and known techniques for the preparation thereof.
- Targeted therapeutics described herein can be administered by any appropriate route generally known in the art.
- a targeted therapeutic or a pharmaceutical composition containing the same is administered systemically.
- Systemic administration may be intravenous, intramuscular, intradermal, by inhalation, transdermal (topical), intraocular, subcutaneous, oral and/or transmucosal.
- a targeted therapeutics or a pharmaceutical composition containing the same is administered by intramuscular injection.
- a targeted therapeutics or a pharmaceutical composition containing the same is administered subcutaneously.
- Administration may be performed by injecting a composition into areas including, but not limited to, the thigh region, abdominal region, gluteal region, or scapular region.
- a targeted therapeutics or a pharmaceutical composition containing the same is administered intravenously.
- a targeted therapeutics or a pharmaceutical composition containing the same is administered orally. More than one route can be used concurrently, if desired. All of the administration routes disclosed herein are generally known in the art, and the skilled artisan would know how to administer targeted therapeutics of the present invention by these routes.
- compositions according to the present invention can be used for CNS delivery via various techniques and routes including, but not limited to, intraparenchymal, intracerebral, intravetricular cerebral (ICV), intrathecal (e.g., IT-Lumbar, IT-cisterna magna) administrations and any other techniques and routes for injection directly or indirectly to the CNS and/or CSF.
- intraparenchymal intracerebral
- intrathecal e.g., IT-Lumbar, IT-cisterna magna
- compositions according to the present invention can be used for intrathecal administration.
- intrathecal administration also referred to as intrathecal injection or intrathecal delivery
- intrathecal injection or intrathecal delivery refers to an injection into the spinal canal (intrathecal space surrounding the spinal cord).
- Various formulations for intrathecal administration are described in WO/2011/163652, the contents of which are incorporated herein by reference.
- a pharmaceutical composition containing a targeted therapeutics may be injected at any region surrounding the spinal canal.
- a pharmaceutical composition containing a targeted therapeutics is injected into the lumbar area or the cisterna magna or intraventricularly into a cerebral ventricle space.
- the term “lumbar region” or “lumbar area” refers to the area between the third and fourth lumbar (lower back) vertebrae and, more inclusively, the L2-S1 region of the spine.
- intrathecal injection via the lumbar region or lumber area is also referred to as “lumbar IT delivery” or “lumbar IT administration.”
- a device for intrathecal administration contains a fluid access port (e.g., injectable port); a hollow body (e.g., catheter) having a first flow orifice in fluid communication with the fluid access port and a second flow orifice configured for insertion into spinal cord; and a securing mechanism for securing the insertion of the hollow body in the spinal cord.
- a suitable securing mechanism contains one or more nobs mounted on the surface of the hollow body and a sutured ring adjustable over the one or more nobs to prevent the hollow body (e.g., catheter) from slipping out of the spinal cord.
- the fluid access port comprises a reservoir.
- the fluid access port comprises a mechanical pump (e.g., an infusion pump).
- an implanted catheter is connected to either a reservoir (e.g., for bolus delivery), or an infusion pump.
- the fluid access port may be implanted or external
- intrathecal administration may be performed by either lumbar puncture (i.e., slow bolus) or via a port-catheter delivery system (i.e., infusion or bolus).
- the catheter is inserted between the laminae of the lumbar vertebrae and the tip is threaded up the thecal space to the desired level (generally L3-L4).
- formulations of the invention can be formulated in liquid solutions.
- the enzyme may be formulated in solid form and re-dissolved or suspended immediately prior to use. Lyophilized forms are also included.
- the injection can be, for example, in the form of a bolus injection or continuous infusion (e.g., using infusion pumps) of the enzyme.
- the present invention may be used to effectively treat Pompe Disease, Sanfilippo Syndrome Type B and other lysosomal storage diseases.
- Pompe disease or Glycogen Storage Disease Type II, is an autosomal recessive metabolic disorder resulting from a deficiency or dysfunction of the lysosomal hydrolase acid alpha-glucosidase (GAA).
- GAA lysosomal hydrolase acid alpha-glucosidase
- GAA is localized to lysosomes and plays an important role in the catabolism of glycogen into glucose. In the absence of the enzyme, these glycogen accumulates within the cells, ultimately causing engorgement, followed by cellular death and tissue destruction. Due the widespread expression of the enzyme, multiple cell types and organ systems are affected in Pompe patients.
- Pompe disease is characterized by a degeneration within the peripheral tissues of the body.
- glycogen build-up results in progressive muscle weakness (myopathy) throughout the body, specifically affecting the tissues of the heart, skeletal muscles, as well as liver and kidneys.
- Typical findings are those of enlarged heart with non-specific conduction defects, along with several indicators of kidney disease, such as high levels of serum creatine kinase, aldolase, aspartate transaminase and lactic dehydrogenase.
- the disease typically manifests itself in the first several month of life, with cardiomegaly, hypotonia, cardiomyopathy, respiratory distress and muscle weakness.
- Some affected individuals experience a progressive loss of skeletal muscle, cardiac or kidney function, with most affected individuals dying of disease-associated complications in their first or second decade.
- Sanfilippo Syndrome Type B (San B), or Mucopolysaccharidosis III B (MPS III B)
- MGS III B Mucopolysaccharidosis III B
- Naglu is localized to lysosomes and plays an important role in the catabolism of glycosaminoglycans (GAGs) heparan- and dermatan-sulfate. In the absence of enzyme, these substrates accumulate within cells, ultimately causing engorgement, followed by cellular death and tissue destruction. Due to the widespread expression of Naglu, multiple cell types and organ systems are affected in MPS III B patients.
- a defining clinical feature of San B is central nervous system (CNS) degeneration, however, which typically results in cognitive impairment (e.g., decrease in IQ).
- CNS central nervous system
- MRI scans of affected individuals have revealed white matter lesions, dilated perivascular spaces in the brain parenchyma, ganglia, corpus callosum, and brainstem; atrophy; and ventriculomegaly (Wang et al. Molecular Genetics and Metabolism, 2009).
- the disease typically manifests itself in the first years of life with organomegaly and skeletal abnormalities. Some affected individuals experience a progressive loss of cognitive function, with most affected individuals dying of disease-associated complications in their first or second decade.
- compositions and methods of the present invention may be used to effectively treat individuals suffering from or susceptible to Pompe Disease or San B.
- treat or “treatment,” as used herein, refer to amelioration of one or more symptoms associated with the disease, prevention or delay of the onset of one or more symptoms of the disease, and/or lessening of the severity or frequency of one or more symptoms of the disease.
- treatment refers to partial or complete alleviation, amelioration, relief, inhibition, delay of onset, reduction of severity and/or incidence of impairment in a Pompe Disease or San B patient.
- the term “impairment” includes various symptoms in various organ systems commonly associated with Pompe Disease and/or San B (e.g., in the brain and spinal cord or skeletal or heart muscle).
- Symptoms of neurological impairment may include, for example, e.g., cognitive impairment; white matter lesions; dilated perivascular spaces in the brain parenchyma, ganglia, corpus callosum, and/or brainstem; atrophy; and/or ventriculomegaly, among others.
- Symptoms often associated with Pompe Disease include, for example, weakness of skeletal muscle and heart failure and respiratory weakness.
- a suitable control is a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control individual (or multiple control individuals) in the absence of the treatment described herein.
- a “control individual” is an individual afflicted with a lysosomal storage disease (e.g., San B, Pompe Disease), who is about the same age and/or gender as the individual suffering from the same lysosmal storage disease, who is being treated (to ensure that the stages of the disease in the treated individual and the control individual(s) are comparable).
- a lysosomal storage disease e.g., San B, Pompe Disease
- the individual (also referred to as “patient” or “subject”) being treated is an individual (fetus, infant, child, adolescent, or adult human) having a lysosomal storage disease or having the potential to develop a lysosmal storage disease.
- the lysosmal storage disease is Pompe Disease or Sanfilippo Syndrome.
- the lysosomal storage disease is San B.
- the individual can have residual endogenous GAA or Naglu expression and/or activity, or no measurable activity.
- the individual having Pompe Disease may have GAA expression levels that are less than about 30-50%, less than about 25-30%, less than about 20-25%, less than about 15-20%, less than about 10-15%, less than about 5-10%, less than about 0.1-5% of normal GAA expression levels.
- the individual having San B may have Naglu expression levels that are less than about 30-50%, less than about 25-30%, less than about 20-25%, less than about 15-20%, less than about 10-15%, less than about 5-10%, less than about 0.1-5% of normal Naglu expression levels.
- the individual is an individual who has been recently diagnosed with the disease.
- early treatment treatment commencing as soon as possible after diagnosis
- the present invention provides, among other things, methods and compositions for lysosomal targeting of a therapeutic protein (e.g. a lysosmal enzyme) based on a lysosomal targeting moiety.
- a therapeutic protein e.g. a lysosmal enzyme
- the current example discloses a general method for producing one or more targeted therapeutic proteins, by generating a translational fusion protein between a lysosmal enzyme and a lysosomal targeting moiety.
- one or more auxiliary proteins may also be produced to form a protein complex with the lysosmal targeting moiety.
- lysosomal enzymes acid alpha-glucosidase (GAA) and N-acetylglucosaminidase (Naglu) were chosen as candidate proteins, since it has been demonstrated that deficiency of each individual protein plays a central role in the development of Pompe disease and Sanpfilippo Syndrome (Mucopolysaccharidosis III) Type B, respectively.
- GAA acid alpha-glucosidase
- Naglu N-acetylglucosaminidase
- suitable fusion therapeutics of the current invention facilitate cellular uptake and lysosomal targeting and have an enzyme activity substantially similar to the native enzyme.
- a lysosomal targeting moiety may be associated with a suitable therapeutic enzyme (e.g., lysosomal enzyme) covalently or non-covalently.
- a lysosomal targeting moiety may be chemically conjugated to a therapeutic enzyme.
- a lysosomal targeting moiety may be fused to a therapeutic enzyme as a fusion protein.
- a lysosomal targeting moiety (lysosomal targeting moiety) may be coupled, and or bound, to an auxiliary protein, to form a protein complex.
- a series of two constructs was created, each designed to express GAA or Naglu, fused to PCSK9.
- PCSK9 is used as the representative lysosomal targeting moiety
- any lysosomal targeting moiety such as, PC proteins, proteins with a CHRD domain, proteins capable of binding to low density lipoprotein receptor (LDLR), amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, or low density lipoprotein receptor-related protein 8 (Lrp8)) or fragment thereof, may be used.
- LDLR low density lipoprotein receptor
- APLP2 amyloid precursor-like protein 2
- APP amyloid precursor protein
- ARH autosomal recessive hypercholesterolemia
- Lrp8 low density lipoprotein receptor-related protein 8
- An exemplary PCSK9-GAA fusion protein comprising S386A and F379A point mutations was created by connecting a nucleid acid encoding PCSK9 comprising S386A and F379A point mutations to a nucleic acid encoding GAA via an intervening GlyGlyGly-encoding linker (SEQ ID NO:14).
- the amino acid sequence resulting from the ranslation of (SEQ ID NO:14) is shown below (SEQ ID NO:17).
- An exemplary Naglu-PCSK9 fusion protein comprising S386A and F379A point mutations was created by connecting a nucleic acid encoding Naglu to a nucleic acid encoding PCSK9 comprising S386A and F379A point mutations via an intervening GlyGlyGly-encoding linker (SEQ ID NO:15).
- SEQ ID NO:15 The amino acid sequence resulting from the translation of (SEQ ID NO:15) is shown below (SEQ ID NO:18).
- auxiliary protein was created by generating a nucleic acid encoding PCSK9 signal peptide and PCSK9 propeptide (SEQ ID NO:16).
- SEQ ID NO:16 The amino acid sequence resulting from the translation of (SEQ ID NO:16) is shown below (SEQ ID NO:19).
- An exemplary Sig/Pro-PCSK9-GAA fusion protein comprising S386A and F379A point mutations was created by connecting a nucleic acid encoding PCSK9 comprising S386A and F379A point mutations to a nucleic acid encoding GAA via an intervening GlyGlyGly-encoding linker.
- the amino acid sequence resulting from the translation of this DNA is shown below (SEQ ID NO:20).
- PCSK9 propeptide is in italics.
- the amino acid sequence of a Furin proteolytic cleavage site is bolded and underlined.
- the amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold) is not underlined, bold or in italics.
- the amino acid sequence of the GlyGlyGly linker is underlined.
- the amino acid sequence of Mature Form GAA Protein (aa70-952) is bold and in italics.
- Nucleic acids encoding a fusion protein and an auxiliary protein can be individually subcloned into mammalian expression vectors of choice. These expression constructs may then be transfected into a human cell line, and the cell line may be screened to generate over-expressing cell clones. To produce functional targeted therapeutics, a fusion protein is co-espressed with an auxiliary protein, for example PCSK9 propeptide, to ensure proper association between the two, which ensures endocytosis of the complex.
- an auxiliary protein for example PCSK9 propeptide
- SEQ ID NO:17-19 are amino acid sequences which still contain the amino acids of PCSK9 or Naglu N-terminal signal peptides. These signal peptides are typically removed during intracellular processing and and are typically not present in the final targeted therapeutic drug product. Below are depitcted the amino acid sequences of targeted therapeutics resulting from, in order, expression of proteins defined by SEQ ID NO:17-19:
- SEQ ID NO:20 is an amino acid sequences which still contains the amino acids of the PCSK9 N-terminal signal peptide and propeptide. It is envisioned that the signal peptide is typically removed during intracellular processing and is typically not present in the final targeted therapeutic drug product.
- the Furin proteolytic cleavage site will be cleaved intracellularly and the fusion comprising PCSK9 and GAA will form a complex with the released propeptide.
- recombinant protein may be produced in a wave bioreactor, using a mammalian cell culture expressing system. Following expression, protein/protein complexes may be purified using conventional protein purification methods.
- each fusion protein can be evaluated for proper function, by examining its specific activity and enzyme kinetics using a well-defined cleavable substrate. Based on this analysis, PSK9-GAA- and Naglu-PCSK9 binding constants and specificity for the enzyme substrate can be compared to each respective wildtype lysosomal enzyme, to ensure enzyme function is similar to the native protein.
- SPR surface plasmone resonance
- the binding protein (such as, but not limited to this listed in Table 6 below) serving as “ligand” are diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system.
- the PCSK9-GAA or Naglu-PCSK9 protein, serving as “ligand” are diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system.
- a solution containing the binding proteins (such as, but not limited to this listed in Table 6 below), serving as the “analyte,” is then injected into the device.
- a solution containing PCSK9-GAA or Naglu-PCSK9, serving as the “ligand” is injected into the microflow system and run over surface to bind the antibody to form a “capture complex.”
- a solution containing binding protein, serving as the “analyte,” is then injected into the device.
- a “capturing molecule,” such as anti-binding protein antibody, is diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system.
- a solution containing recombinant “binding protein” (such as, but not limited to, those listed in Table 6 below), serving as the “ligand,” is injected into the microflow system and run over surface to bind the antibody to form a “capture complex.”
- a solution containing purified PCSK9-GAA or Naglu-PCSK9 protein, serving as the “analyte,” is then injected into the device.
- the analyte binds to the ligant and/or capture complex, and an increase in SPR signal (expressed in response units, RU) is observed.
- a solution without the analyte is injected into the microfluidic device, resulting in dissociation of the interaction between analyte and ligant and/or capture complex, inn turn resulting in a decrease in SPR signal.
- LDLR Low Density Lipoprotein Receptor
- APLP Amyloid Precursor-like Protein 2
- APP Dynamin Amyloid Precursor Protein
- ARH Autosomal Recessive Hypercholesterolemia
- a competitive inhibition study may also be performed using a SPR assay.
- a purified protein comprising one or more human CHRD domains referred to as an “inhibitor protein”
- an antibody that binds to the PCSK9 binding site on the human LDLR referred to as an “LDLR blocker”
- LDLR blocker an antibody that binds to the PCSK9 binding site on the human LDLR
- anti-binding protein antibody the “capturing molecule” is diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system.
- a solution containing recombinant protein such as, but not limited to, amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, and low density lipoprotein receptor-related protein 8 (Lrp8)
- LDLR low density lipoprotein receptor-related protein 8
- a solution containing purified Naglu-PCSK9 or PCSK9-GAA protein with or without 20 ⁇ M inhibitor protein is injected into the device and analyzed for binding.
- a solution without the analyte is injected into the microfluidic device, dissociating any possible interaction between the analyte and the capture complex, and resulting in a decrease in SPR signal.
- the experimental conditions used for the assay are described in Table 8 below.
- the inverse study can also be performed to evaluate competitive inhibition of Naglu-PCSK9 and PCSK9-GAA by an inhibitor protein or LDLR blocker (an antibody that blocks PCSK9 binding to the LDLR), in which the concentration of each PCSK9 fusion protein is held constant and assayed against varying concentrations of inhibitor protein or LDLR blocker.
- inhibitor protein or LDLR blocker an antibody that blocks PCSK9 binding to the LDLR
- anti-binding protein antibody “capturing molecule” is diluted in immobilization buffer and bound on the dextran surface of a SPR sensor chip housed in a microfluidic system.
- a solution containing recombinant protein, serving as the “ligand,” is injected into the microflow system and run over surface to bind the antibody to form a “capture complex.”
- a solution containing each purified PCSK9 fusion protein at 20 nM, along with 0-1.5 uM of inhibitor protein or LDLR blocker, is injected into the device and analyzed for binding.
- a solution without the analyte is injected into the microfluidic device, dissociating any possible interaction between the analyte and the capture complex, and resulting in a decrease in SPR signal.
- the experimental conditions for use in performing the assay are described in Table 9 below.
- Example 4 teaches a general assay method that may be used to evaluate any lysosomal targeted therapeutic in accordance with the teachings of the instant application.
- the cell line of choice for this assay is C2C12 cell, which is a mouse myoblast cell lines (Yaffe D.
- C2C12 cell lines as described above, are treated with or without recombinant Naglu-PCSK9 or PCSK9-GAA which has been complexed with PPP. Following treatment, the cells are fixed and prepared for staining. Both control and treated cells are stained using antibodies specific for each lysosomal protein (GAA or Naglu) along with Lamp-1, a lysosome specific protein biomarker. Cells are assayed for cellular internalization of each fusion protein by immunofluroescent microscopy.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- General Health & Medical Sciences (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Medicinal Chemistry (AREA)
- Microbiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Plant Pathology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Enzymes And Modification Thereof (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
| TABLE 1 |
| Mature and Precursor GAA Protein |
| Mature Form GAA | AHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMG |
| Protein | QPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETEN |
| RLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVL | |
| LNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAP | |
| TPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDV | |
| YIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTR | |
| AHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAIS | |
| SSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDFTNPTALAWWED | |
| MVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAA | |
| TICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRY | |
| AGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQ | |
| LGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAH | |
| VAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGT | |
| WYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIP | |
| LQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFL | |
| ARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTK | |
| VLDICVSLLMGEQFLVSWC (SEQ ID NO: 1) | |
| Precursor Form | GHILLHDFLLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQAHPGRPRAVPTQ |
| GAA Protein | CDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPS |
| YKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANR | |
| RYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFAD | |
| QFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPF | |
| YLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVV | |
| QQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDL | |
| DYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYD | |
| EGLRRGVFITNETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFD | |
| GMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATICASSHQFLST | |
| HYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSW | |
| EQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHN | |
| SLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFL | |
| EFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEAL | |
| GSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESR | |
| QQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVR | |
| VTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGE | |
| QFLVSWC (SEQ ID NO: 2) | |
| Full-Length GAA | MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHP |
| Protein | AHQQGASRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGC |
| CYIPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPK | |
| DILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEE | |
| PFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLS | |
| TSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQP | |
| SPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGY | |
| SSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELH | |
| QGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTA | |
| FPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELEN | |
| PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEALASHRALVKARGTR | |
| PFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCG | |
| FLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLR | |
| YALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVL | |
| QAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAP | |
| LDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGES | |
| LEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLS | |
| NGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC (SEQ ID NO: 3) | |
| TABLE 2 |
| Mature and Precursor Naglu Protein |
| Mature Form of | DEAREAAAVRALVARLLGPGPAADFSVSVERALAAKPGLDTYSLGGGGAARVRV |
| Naglu | RGSTGVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPAVPGELTEATPNRYRY |
| YQNVCTQSYSFVWWDWARWEREIDWMALNGINLALAWSGQEAIWQRVYLALGLT | |
| QAEINEFFTGPAFLAWGRMGNLHTWDGPLPPSWHIKQLYLQHRVLDQMRSFGMT | |
| PVLPAFAGHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPIFPIIGS | |
| LFLRELIKEFGTDHIYGADTFNEMQPPSSEPSYLAAATTAVYEAMTAVDTEAVW | |
| LLQGWLFQHQPQFWGPAQIRAVLGAVPRGRLLVLDLFAESQPVYTRTASFQGQP | |
| FIWCMLHNFGGNHGLFGALEAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVY | |
| SLMAELGWRKDPVPDLAAWVTSFAARRYGVSHPDAGAAWRLLLRSVYNCSGEAC | |
| RGHNRSPLVRRPSLQMNTSIWYNRSDVFEAWRLLLTSAPSLATSPAFRYDLLDL | |
| TRQAVQELVSLYYEEARSAYLSKELASLLRAGGVLAYELLPALDEVLASDSRFL | |
| LGSWLEQARAAAVSEAEADFYEQNSRYQLTLWGPEGNILDYANKQLAGLVANYY | |
| TPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVD | |
| LAKKIFLKYYPRWVAGSW (SEQ ID NO: 4) | |
| Full-Length | MEAVAVAAAVGVLLLAGAGGAAGDEAREAAAVRALVARLLGPGPAADFSVSVER |
| Precursor/Full- | ALAAKPGLDTYSLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWSGSQL |
| Length Naglu | RLPRPLPAVPGELTEATPNRYRYYQNVCTQSYSFVWWDWARWEREIDWMALNGI |
| Protein | NLALAWSGQEAIWQRVYLALGLTQAEINEFFTGPAFLAWGRMGNLHTWDGPLPP |
| SWHIKQLYLQHRVLDQMRSFGMTPVLPAFAGHVPEAVTRVFPQVNVTKMGSWGH | |
| FNCSYSCSFLLAPEDPIFPIIGSLFLRELIKEFGTDHIYGADTFNEMQPPSSEP | |
| SYLAAATTAVYEAMTAVDTEAVWLLQGWLFQHQPQFWGPAQIRAVLGAVPRGRL | |
| LVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGGNHGLFGALEAVNGGPEAARL | |
| FPNSTMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPDLAAWVTSFAARRYGVS | |
| HPDAGAAWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTSIWYNRSDVFEAW | |
| RLLLTSAPSLATSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELASLLRA | |
| GGVLAYELLPALDEVLASDSRFLLGSWLEQARAAAVSEAEADFYEQNSRYQLTL | |
| WGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVF | |
| QLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPRWVAGSW | |
| (SEQ ID NO: 5) | |
| TABLE 3 |
| Enzymes Associated With Lysosomal Storage Disease |
| Disease Name | Enzyme Deficiency | Substance Stored |
| Pompe Disease | Acid-a1, 4-Glucosidase | Glycogen α-1-4 linked |
| Oligosaccharides | ||
| GM1 Gangliodsidosis | β-Galactosidase | GM1 Gangliosides |
| Tay-Sachs Disease | β-Hexosaminidase A | GM2 Ganglioside |
| GM2 Gangliosidosis: AB | GM2 Activator Protein | GM2 Ganglioside |
| Variant | ||
| Sandhoff Disease | β-Hexosaminidase A&B | GM2 Ganglioside |
| Fabry Disease | α-Galactosidase A | Globosides |
| Gaucher Disease | Glucocerebrosidase | Glucosylceramide |
| Metachromatic | Arylsulfatase A | Sulphatides |
| Leukodystrophy | ||
| Krabbe Disease | Galactosylceramidase | Galactocerebroside |
| Niemann Pick, Types A & B | Acid Sphingomyelinase | Sphingomyelin |
| Niemann-Pick, Type C | Cholesterol Esterification | Sphingomyelin |
| Defect | ||
| Niemann-Pick, Type D | Unknown | Sphingomyelin |
| Farber Disease | Acid Ceramidase | Ceramide |
| Wolman Disease | Acid Lipase | Cholesteryl Esters |
| Hurler Syndrome | α-L-Iduronidase | Heparan & Dermatan |
| (MPS IH) | Sulfates | |
| Scheie Syndrome | α-L-Iduronidase | Heparan & Dermatan, Sulfates |
| (MPS IS) | ||
| Hurler-Scheie | α-L-Iduronidase | Heparan & Dermatan |
| (MPS IH/S) | Sulfates | |
| Hunter Syndrome | Iduronate Sulfatase | Heparan & Dermatan |
| (MPS II) | Sulfates | |
| Sanfilippo A | Heparan N-Sulfatase | Heparan Sulfate |
| (MPS IIIA) | ||
| Sanfilippo B | α-N- | Heparan Sulfate |
| (MPS IIIB) | Acetylglucosaminidase | |
| Sanfilippo C | Acetyl-CoA- | Heparan Sulfate |
| (MPS IIIC) | Glucosaminide | |
| Acetyltransferase | ||
| Sanfilippo D | N-Acetylglucosamine-6- | Heparan Sulfate |
| (MPS IIID) | Sulfatase | |
| Morquio B | β-Galactosidase | Keratan Sulfate |
| (MPS IVB) | ||
| Maroteaux-Lamy | Arylsulfatase B | Dermatan Sulfate |
| (MPS VI) | ||
| Sly Syndrome | β-Glucuronidase | |
| (MPS VII) | ||
| α -Mannosidosis | α-Mannosidase | Mannose/Oligosaccharides |
| β -Mannosidosis | β-Mannosidase | Mannose/Oligosaccharides |
| Fucosidosis | α-L-Fucosidase | Fucosyl/Oligosaccharides |
| Aspartylglucosaminuria | N-Aspartyl-β- | Aspartylglucosamine |
| Glucosaminidase | Asparagines | |
| Sialidosis (Mucolipidosis I) | α-Neuraminidase | Sialyloligosaccharides |
| Galactosialidosis | Lysosomal Protective | Sialyloligosaccharides |
| (Goldberg Syndrome) | Protein Deficiency | |
| Schindler Disease | α -N-Acetyl- | |
| Galactosaminidase | ||
| Mucolipidosis II (I-Cell | N-Acetylglucosamine-1- | Heparan Sulfate |
| Disease) | Phosphotransferase | |
| Mucolipidosis III (Pseudo- | Same as ML II | |
| Hurler Polydystrophy) | ||
| Cystinosis | Cystine Transport Protein | Free Cystine |
| Salla Disease | Sialic Acid Transport | Free Sialic Acid and Glucuronic |
| Protein | Acid | |
| Infantile Sialic Acid | Sialic Acid Transport | Free Sialic Acid and Glucuronic |
| Storage Disease | Protein | Acid |
| Infantile Neuronal Ceroid | Palmitoyl-Protein | Lipofuscins |
| Lipofuscinosis | Thioesterase | |
| Mucolipidosis IV | Unknown | Gangliosides & Hyaluronic Acid |
| Prosaposin | Saposins A, B, C or D | |
In some embodiments, a suitable lysosomal enzyme may be a naturally occurring lysosomal enzyme. In some embodiments, a suitable lysosomal enzyme may be a recombinant version of a naturally occurring lysosomal enzyme.
| TABLE 4 |
| Human PCSK9 Sequences |
| PCSK9 | MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAE |
| Preprotein | APEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYL |
| TKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERIT | |
| PPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRF | |
| HRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEF | |
| IRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACL | |
| YSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTC | |
| FVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPED | |
| QRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSC | |
| SSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAP | |
| PAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREA | |
| SIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAY | |
| AVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ | |
| (SEQ ID NO: 6) | |
| PCSK9 Mature | SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFE |
| Protein | NVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGT |
| VSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTA | |
| AGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDI | |
| IGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKD | |
| VINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVAR | |
| CAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLP | |
| QANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQ | |
| PNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSAL | |
| PGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ | |
| (SEQ ID NO: 7) | |
| TABLE 5 |
| Human PCSK9 Propeptide Sequence |
| PCSK9 | QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKD |
| Pro- | PWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTK |
| peptide | ILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVF |
| AQ (SEQ ID NO: 8) | |
Association Between Lysosomal Enzyme and Lysosomal Targeting Moiety
| ATGGGCACCGTCAGCTCCAGGCGGTCCTGGTGGCCGCTGCCACTGCTGCT |
| GCTGCTGCTGCTGCTCCTGGGTCCCGCGGGCGCCCGTGCGAGCATCCCGT |
| GGAACCTGGAGCGGATTACCCCTCCACGGTACCGGGCGGATGAATACCAG |
| CCCCCCGACGGAGGCAGCCTGGTGGAGGTGTATCTCCTAGACACCAGCAT |
| ACAGAGTGACCACCGGGAAATCGAGGGCAGGGTCATGGTCACCGACTTCG |
| AGAATGTGCCCGAGGAGGACGGGACCCGCTTCCACAGACAGGCCAGCAAG |
| TGTGACAGTCATGGCACCCACCTGGCAGGGGTGGTCAGCGGCCGGGATGC |
| CGGCGTGGCCAAGGGTGCCAGCATGCGCAGCCTGCGCGTGCTCAACTGCC |
| AAGGGAAGGGCACGGTTAGCGGCACCCTCATAGGCCTGGAGTTTATTCGG |
| AAAAGCCAGCTGGTCCAGCCTGTGGGGCCACTGGTGGTGCTGCTGCCCCT |
| GGCGGGTGGGTACAGCCGCGTCCTCAACGCCGCCTGCCAGCGCCTGGCGA |
| GGGCTGGGGTCGTGCTGGTCACCGCTGCCGGCAACTTCCGGGACGATGCC |
| TGCCTCTACTCCCCAGCCTCAGCTCCCGAGGTCATCACAGTTGGGGCCAC |
| CAATGCCCAAGACCAGCCGGTGACCCTGGGGACTTTGGGGACCAACTTTG |
| GCCGCTGTGTGGACCTCTTTGCCCCAGGGGAGGACATCATTGGTGCCTCC |
| AGCGACTGCAGCACCTGCGCTGTGTCACAGAGTGGGACAGCACAGGCTGC |
| TGCCCACGTGGCTGGCATTGCAGCCATGATGCTGTCTGCCGAGCCGGAGC |
| TCACCCTGGCCGAGTTGAGGCAGAGACTGATCCACTTCTCTGCCAAAGAT |
| GTCATCAATGAGGCCTGGTTCCCTGAGGACCAGCGGGTACTGACCCCCAA |
| CCTGGTGGCCGCCCTGCCCCCCAGCACCCATGGGGCAGGTTGGCAGCTGT |
| TTTGCAGGACTGTATGGTCAGCACACTCGGGGCCTACACGGATGGCCACA |
| GCCGTCGCCCGCTGCGCCCCAGATGAGGAGCTGCTGAGCTGCTCCAGTTT |
| CTCCAGGAGTGGGAAGCGGCGGGGCGAGCGCATGGAGGCCCAAGGGGGCA |
| AGCTGGTCTGCCGGGCCCACAACGCTTTTGGGGGTGAGGGTGTCTACGCC |
| ATTGCCAGGTGCTGCCTGCTACCCCAGGCCAACTGCAGCGTCCACACAGC |
| TCCACCAGCTGAGGCCAGCATGGGGACCCGTGTCCACTGCCACCAACAGG |
| GCCACGTCCTCACAGGCTGCAGCTCCCACTGGGAGGTGGAGGACCTTGGC |
| ACCCACAAGCCGCCTGTGCTGAGGCCACGAGGTCAGCCCAACCAGTGCGT |
| GGGCCACAGGGAGGCCAGCATCCACGCTTCCTGCTGCCATGCCCCAGGTC |
| TGGAATGCAAAGTCAAGGAGCATGGAATCCCGGCCCCTCAGGAGCAGGTG |
| ACCGTGGCCTGCGAGGAGGGCTGGACCCTGACTGGCTGCAGTGCCCTCCC |
| TGGGACCTCCCACGTCCTGGGGGCCTACGCCGTAGACAACACGTGTGTAG |
| TCAGGAGCCGGGACGTCAGCACTACAGGCAGCACCAGCGAAGGGGCCGTG |
| ACAGCCGTTGCCATCTGCTGCCGGAGCCGGCACCTGGCGCAGGCCTCCCA |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
| |
(1) The nucleotide sequence encoding PCSK9 signal peptide is underlined.
(2) The nucleotide sequence encoding PCSK9 Mature Protein (except nucleotide sequences encoding mutations F379A and S386A, which are underlined) is not underlined, bold or in italics.
(3) The nucleotide sequence encoding the amino acid sequence of the GlyGlyGly linker is underlined.
(4) The nucleotide sequence encoding Mature Form GAA Protein amino acid sequence (aa70-952) is bold and in italics.
| ATGGAGGCGGTGGCGGTGGCCGCGGCGGTGGGGGTCCTTCTCCTGGCCGG |
| GGCCGGGGGCGCGGCAGGCGACGAGGCCCGGGAGGCGGCGGCCGTGCGGG |
| CGCTCGTGGCCCGGCTGCTGGGGCCAGGCCCCGCGGCCGACTTCTCCGTG |
| TCGGTGGAGCGCGCTCTGGCTGCCAAGCCGGGCTTGGACACCTACAGCCT |
| GGGCGGCGGCGGCGCGGCGCGCGTGCGGGTGCGCGGCTCCACGGGCGTGG |
| CGGCCGCCGCGGGGCTGCACCGCTACCTGCGCGACTTCTGTGGCTGCCAC |
| GTGGCCTGGTCCGGCTCTCAGCTGCGCCTGCCGCGGCCACTGCCAGCCGT |
| GCCGGGGGAGCTGACCGAGGCCACGCCCAACAGGTACCGCTATTACCAGA |
| ATGTGTGCACGCAAAGCTACTCCTTCGTGTGGTGGGACTGGGCCCGCTGG |
| GAGCGAGAGATAGACTGGATGGCGCTGAATGGCATCAACCTGGCACTGGC |
| CTGGAGCGGCCAGGAGGCCATCTGGCAGCGGGTGTACCTGGCCTTGGGCC |
| TGACCCAGGCAGAGATCAATGAGTTCTTTACTGGTCCTGCCTTCCTGGCC |
| TGGGGGCGAATGGGCAACCTGCACACCTGGGATGGCCCCCTGCCCCCCTC |
| CTGGCACATCAAGCAGCTTTACCTGCAGCACCGGGTCCTGGACCAGATGC |
| GCTCCTTCGGCATGACCCCAGTGCTGCCTGCATTCGCGGGGCATGTTCCC |
| GAGGCTGTCACCAGGGTGTTCCCTCAGGTCAATGTCACGAAGATGGGCAG |
| TTGGGGCCACTTTAACTGTTCCTACTCCTGCTCCTTCCTTCTGGCTCCGG |
| AAGACCCCATATTCCCCATCATCGGGAGCCTCTTCCTGCGAGAGCTGATC |
| AAAGAGTTTGGCACAGACCACATCTATGGGGCCGACACTTTCAATGAGAT |
| GCAGCCACCTTCCTCAGAGCCCTCCTACCTTGCCGCAGCCACCACTGCCG |
| TCTATGAGGCCATGACTGCAGTGGATACTGAGGCTGTGTGGCTGCTCCAA |
| GGCTGGCTCTTCCAGCACCAGCCGCAGTTCTGGGGGCCCGCCCAGATCAG |
| GGCTGTGCTGGGAGCTGTGCCCCGTGGCCGCCTCCTGGTTCTGGACCTGT |
| TTGCTGAGAGCCAGCCTGTGTATACCCGCACTGCCTCCTTCCAGGGCCAG |
| CCCTTCATCTGGTGCATGCTGCACAACTTTGGGGGAAACCATGGTCTTTT |
| TGGAGCCCTAGAGGCTGTGAACGGAGGCCCAGAAGCTGCCCGCCTCTTCC |
| CCAACTCCACCATGGTAGGCACGGGCATGGCCCCCGAGGGCATCAGCCAG |
| AACGAAGTGGTCTATTCCCTCATGGCTGAGCTGGGCTGGCGAAAGGACCC |
| AGTGCCAGATTTGGCAGCCTGGGTGACCAGCTTTGCCGCCCGGCGGTATG |
| GGGTCTCCCACCCGGACGCAGGGGCAGCGTGGAGGCTACTGCTCCGGAGT |
| GTGTACAACTGCTCCGGGGAGGCCTGCAGGGGCCACAATCGTAGCCCGCT |
| GGTCAGGCGGCCGTCCCTACAGATGAATACCAGCATCTGGTACAACCGAT |
| CTGATGTGTTTGAGGCCTGGCGGCTGCTGCTCACATCTGCTCCCTCCCTG |
| GCCACCAGCCCCGCCTTCCGCTACGACCTGCTGGACCTCACTCGGCAGGC |
| AGTGCAGGAGCTGGTCAGCTTGTACTATGAGGAGGCAAGAAGCGCCTACC |
| TGAGCAAGGAGCTGGCCTCCCTGTTGAGGGCTGGAGGCGTCCTGGCCTAT |
| GAGCTGCTGCCGGCACTGGACGAGGTGCTGGCTAGTGACAGCCGCTTCTT |
| GCTGGGCAGCTGGCTAGAGCAGGCCCGAGCAGCGGCAGTCAGTGAGGCCG |
| AGGCCGATTTCTACGAGCAGAACAGCCGCTACCAGCTGACCTTGTGGGGG |
| CCAGAAGGCAACATCCTGGACTATGCCAACAAGCAGCTGGCGGGGTTGGT |
| GGCCAACTACTACACCCCTCGCTGGCGGCTTTTCCTGGAGGCGCTGGTTG |
| ACAGTGTGGCCCAGGGCATCCCTTTCCAACAGCACCAGTTTGACAAAAAT |
| GTCTTCCAACTGGAGCAGGCCTTCGTTCTCAGCAAGCAGAGGTACCCCAG |
| CCAGCCGCGAGGAGACACTGTGGACCTGGCCAAGAAGATCTTCCTCAAAT |
| ATTACCCCCGCTGGGTGGCCGGCTCTTGGGGAGGTGGA AGCATCCCGTGG |
| AACCTGGAGCGGATTACCCCTCCACGGTACCGGGCGGATGAATACCAGCC |
| CCCCGACGGAGGCAGCCTGGTGGAGGTGTATCTCCTAGACACCAGCATAC |
| AGAGTGACCACCGGGAAATCGAGGGCAGGGTCATGGTCACCGACTTCGAG |
| AATGTGCCCGAGGAGGACGGGACCCGCTTCCACAGACAGGCCAGCAAGTG |
| TGACAGTCATGGCACCCACCTGGCAGGGGTGGTCAGCGGCCGGGATGCCG |
| GCGTGGCCAAGGGTGCCAGCATGCGCAGCCTGCGCGTGCTCAACTGCCAA |
| GGGAAGGGCACGGTTAGCGGCACCCTCATAGGCCTGGAGTTTATTCGGAA |
| AAGCCAGCTGGTCCAGCCTGTGGGGCCACTGGTGGTGCTGCTGCCCCTGG |
| CGGGTGGGTACAGCCGCGTCCTCAACGCCGCCTGCCAGCGCCTGGCGAGG |
| GCTGGGGTCGTGCTGGTCACCGCTGCCGGCAACTTCCGGGACGATGCCTG |
| CCTCTACTCCCCAGCCTCAGCTCCCGAGGTCATCACAGTTGGGGCCACCA |
| ATGCCCAAGACCAGCCGGTGACCCTGGGGACTTTGGGGACCAACTTTGGC |
| CGCTGTGTGGACCTCTTTGCCCCAGGGGAGGACATCATTGGTGCCTCCAG |
| CGACTGCAGCACCTGC GCT GTGTCACAGAGTGGGACA GCA CAGGCTGCTG |
| CCCACGTGGCTGGCATTGCAGCCATGATGCTGTCTGCCGAGCCGGAGCTC |
| ACCCTGGCCGAGTTGAGGCAGAGACTGATCCACTTCTCTGCCAAAGATGT |
| CATCAATGAGGCCTGGTTCCCTGAGGACCAGCGGGTACTGACCCCCAACC |
| TGGTGGCCGCCCTGCCCCCCAGCACCCATGGGGCAGGTTGGCAGCTGTTT |
| TGCAGGACTGTATGGTCAGCACACTCGGGGCCTACACGGATGGCCACAGC |
| CGTCGCCCGCTGCGCCCCAGATGAGGAGCTGCTGAGCTGCTCCAGTTTCT |
| CCAGGAGTGGGAAGCGGCGGGGCGAGCGCATGGAGGCCCAAGGGGGCAAG |
| CTGGTCTGCCGGGCCCACAACGCTTTTGGGGGTGAGGGTGTCTACGCCAT |
| TGCCAGGTGCTGCCTGCTACCCCAGGCCAACTGCAGCGTCCACACAGCTC |
| CACCAGCTGAGGCCAGCATGGGGACCCGTGTCCACTGCCACCAACAGGGC |
| CACGTCCTCACAGGCTGCAGCTCCCACTGGGAGGTGGAGGACCTTGGCAC |
| CCACAAGCCGCCTGTGCTGAGGCCACGAGGTCAGCCCAACCAGTGCGTGG |
| GCCACAGGGAGGCCAGCATCCACGCTTCCTGCTGCCATGCCCCAGGTCTG |
| GAATGCAAAGTCAAGGAGCATGGAATCCCGGCCCCTCAGGAGCAGGTGAC |
| CGTGGCCTGCGAGGAGGGCTGGACCCTGACTGGCTGCAGTGCCCTCCCTG |
| GGACCTCCCACGTCCTGGGGGCCTACGCCGTAGACAACACGTGTGTAGTC |
| AGGAGCCGGGACGTCAGCACTACAGGCAGCACCAGCGAAGGGGCCGTGAC |
| AGCCGTTGCCATCTGCTGCCGGAGCCGGCACCTGGCGCAGGCCTCCCAGG |
| AGCTCCAGTAG |
(1) The nucleotide sequence encoding Naglu signal peptide is underlined.
(2) The nucleotide sequence encoding Mature Form of Naglu is not underlined, bold or in italics.
(3) The nucleotide sequence encoding the amino acid sequence of the GlyGlyGly linker is underlined.
(4) The nucleotide sequence encoding PCSK9 Mature Protein (except the nucleotide sequences encoding mutations F379A and S386A, which are additionally underlined) is in italics.
| ATGGGCACCGTCAGCTCCAGGCGGTCCTGGTGGCCGCTGCCACTGCTGCT |
| GCTGCTGCTGCTGCTCCTGGGTCCCGCGGGCGCCCGTGCG CAGGAGGACG |
| AGGACGGCGACTACGAGGAGCTGGTGCTAGCCTTGCGTTCCGAGGAGGAC |
| GGCCTGGCCGAAGCACCCGAGCACGGAACCACAGCCACCTTCCACCGCTG |
| CGCCAAGGATCCGTGGAGGTTGCCTGGCACCTACGTGGTGGTGCTGAAGG |
| AGGAGACCCACCTCTCGCAGTCAGAGCGCACTGCCCGCCGCCTGCAGGCC |
| CAGGCTGCCCGCCGGGGATACCTCACCAAGATCCTGCATGTCTTCCATGG |
| CCTTCTTCCTGGCTTCCTGGTGAAGATGAGTGGCGACCTGCTGGAGCTGG |
| CCTTGAAGTTGCCCCATGTCGACTACATCGAGGAGGACTCCTCTGTCTTT |
| GCCCAGTGA |
(1) The nucleotide sequence encoding PCSK9 signal peptide is underlined.
(2) The nucleotide sequence encoding PCSK9 propeptide is in italics.
| (SEQ ID NO: 17) | |
| MGTVSSRRSWWPLPLLLLLLLLLGPAGARASIPWNLERITPPRYRADEYQPPDGGSLVEV | |
| YLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGV | |
| AKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAA | |
| CQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCV | |
| DLFAPGEDIIGASSDCSTC A VSQSGT A QAAAHVAGIAAMMLSAEPELTLAELRQRLIHFS | |
| AKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCA | |
| PDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVH | |
| TAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASI | |
| HASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCV | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| |
(1) The amino acid sequence of PCSK9 signal peptide is underlined.
(2) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold) is not underlined, bold or in italics.
(3) The amino acid sequence of the GlyGlyGly linker is underlined.
(4) The amino acid sequence of Mature Form GAA Protein (aa70-952) is bold and in italics.
Naglu-PCSK9
| (SEQ ID NO: 18) | |
| MEAVAVAAAVGVLLLAGAGGAAGDEAREAAAVRALVARLLGPGPAADFSVSVERALAA | |
| KPGLDTYSLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPA | |
| VPGELTEATPNRYRYYQNVCTQSYSFVWWDWARWEREIDWMALNGINLALAWSGQEA | |
| IWQRVYLALGLTQAEINEFFTGPAFLAWGRMGNLHTWDGPLPPSWHIKQLYLQHRVLDQ | |
| MRSFGMTPVLPAFAGHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPIFPIIGS | |
| LFLRELIKEFGTDHIYGADTFNEMQPPSSEPSYLAAATTAVYEAMTAVDTEAVWLLQGW | |
| LFQHQPQFWGPAQIRAVLGAVPRGRLLVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGG | |
| NHGLFGALEAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPD | |
| LAAWVTSFAARRYGVSHPDAGAAWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTS | |
| IWYNRSDVFEAWRLLLTSAPSLATSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELA | |
| SLLRAGGVLAYELLPALDEVLASDSRFLLGSWLEQARAAAVSEAEADFYEQNSRYQLTL | |
| WGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQ | |
| AFVLSKQRYPSQPRGDTVDLAKKIFLKYYPRWVAGSWGGG SIPWNLERITPPRYRADEYQ | |
| PPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVV | |
| SGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVL | |
| NAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVD | |
| | |
| EAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSS | |
| FSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRV | |
| HCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKV | |
| KEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTA | |
| VAICCRSRHLAQASQELQ |
(1) The amino acid sequence of Naglu signal peptide is underlined.
(2) The amino acid sequence of Mature Form of Naglu is not underlined, bold or in italics.
(3) The amino acid sequence of the GlyGlyGly linker is underlined.
(4) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold as well) is in italics.
PCSK9-Propeptide (PPP)
| (SEQ ID NO: 19) |
| MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEED |
| GLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQA |
| QAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVF |
| AQ |
The amino acid sequence of PCSK9 signal peptide is underlined.
Sig/Pro-PCSK9-GAA
| MGTVSSRRSWWPLPLLLLLLLLLGPAGARA QEDEDGDYEELVLALRSEEDGLAEAPEHGT | |
| TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFL | |
| VKMSGDLLELALKLPHVDYIEEDSSVFAQ RRRRR SIPWNLERITPPRYRADEYQPPDGGSLV | |
| EVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDA | |
| GVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLN | |
| AACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGR | |
| CVDLFAPGEDIIGASSDCSTC A VSQSGT A QAAAHVAGIAAMMLSAEPELTLAELRQRLIH | |
| FSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVAR | |
| CAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCS | |
| VHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHRE | |
| ASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNT | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| |
(1) The amino acid sequence of PCSK9 signal peptide is underlined.
(2) The amino acid sequence of PCSK9 propeptide is in italics.
(3) The amino acid sequence of a Furin proteolytic cleavage site is bolded and underlined.
(4) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold) is not underlined, bold or in italics.
(5) The amino acid sequence of the GlyGlyGly linker is underlined.
(6) The amino acid sequence of Mature Form GAA Protein (aa70-952) is bold and in italics.
| (SEQ ID NO: 21) | |
| SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDG | |
| TRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIR | |
| KSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAP | |
| EVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTC A VSQSGT A QAAAH | |
| VAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGA | |
| GWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVC | |
| RAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWE | |
| VEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVAC | |
| EEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQ | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| | |
| |
(1) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold) is not underlined, bold or in italics.
(2) The amino acid sequence of the GlyGlyGly linker is underlined.
(3) The amino acid sequence of Mature Form GAA Protein (aa70-952) is bold and in italics.
Naglu-PCSK9
| (SEQ ID NO: 22) | |
| DEAREAAAVRALVARLLGPGPAADFSVSVERALAAKPGLDTYSLGGGGAARVRVRGST | |
| GVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPAVPGELTEATPNRYRYYQNVCTQSY | |
| SFVWWDWARWEREIDWMALNGINLALAWSGQEAIWQRVYLALGLTQAEINEFFTGPAF | |
| LAWGRMGNLHTWDGPLPPSWHIKQLYLQHRVLDQMRSFGMTPVLPAFAGHVPEAVTRV | |
| FPQVNVTKMGSWGHFNCSYSCSFLLAPEDPIFPIIGSLFLRELIKEFGTDHIYGADTFNEM | |
| QPPSSEPSYLAAATTAVYEAMTAVDTEAVWLLQGWLFQHQPQFWGPAQIRAVLGAVPRG | |
| RLLVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGGNHGLFGALEAVNGGPEAARLFPN | |
| STMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPDLAAWVTSFAARRYGVSHPDAGA | |
| AWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTSIWYNRSDVFEAWRLLLTSAPSLA | |
| TSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELASLLRAGGVLAYELLPALDEVLA | |
| SDSRFLLGSWLEQARAAAVSEAEADFYEQNSRYQLTLWGPEGNILDYANKQLAGLVANY | |
| YTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVDLAKK | |
| IFLKYYPRWVAGSWGGG SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEG | |
| RVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKG | |
| TVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDAC | |
| | |
| AAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGA | |
| GWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHN | |
| AFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTH | |
| KPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCS | |
| ALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ |
(1) The amino acid sequence of Mature Form of Naglu is not underlined, bold or in italics.
(2) The amino acid sequence of the GlyGlyGly linker is underlined.
(3) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold as well) is in italics.
PCSK9-Propeptide (PPP)
| (SEQ ID NO: 23) |
| QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVV |
| VLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDL |
| LELALKLPHVDYIEEDSSVFAQ |
| TABLE 6 |
| Potential PCSK9 Secondary Binding Proteins |
| Low Density Lipoprotein Receptor (LDLR) | ||
| Amyloid Precursor-like Protein 2 (APLP2) | ||
| Dynamin | ||
| Amyloid Precursor Protein (APP) | ||
| Autosomal Recessive Hypercholesterolemia (ARH) | ||
| TABLE 7 |
| Experimental Design For Exemplary Surface Plasmone Resonance Assay (Scenario 4) |
| Capturing | Analyte | Flow | Association | Dissociation | ||
| Molecule | Ligand | Analyte | Conc. | Rate | Time | Time |
| anti- | Protein | Naglu-PCSK9 | 0 nM | 30 μl/min | 300 sec | 300 sec |
| binding | from | Naglu-PCSK9 | 0.625 nM | |||
| protein | Table 6 | Naglu-PCSK9 | 1.25 nM | |||
| antibody | Naglu-PCSK9 | 2.5 nM | ||||
| Naglu-PCSK9 | 5 nM | |||||
| Naglu-PCSK9 | 10 nM | |||||
| Naglu-PCSK9 | 20 nM | |||||
| anti- | Protein | PCSK9-GAA- | 0 nM | 30 μl/min | 300 sec | 300 sec |
| binding | from | PCSK9-GAA | 0.625 nM | |||
| protein | Table 6 | PCSK9-GAA | 1.25 nM | |||
| antibody | PCSK9-GAA | 2.5 nM | ||||
| PCSK9-GAA | 5 nM | |||||
| PCSK9-GAA | 10 nM | |||||
| PCSK9-GAA | 20 nM | |||||
| TABLE 8 |
| Experimental Design For Exemplary Surface Plasmone Resonance Assay |
| Capturing | Analyte | Inhibitor | Flow | Assoc. | Dissoc. | ||
| Molecule | Ligand | Analyte | (Conc.) | (Conc.) | Rate | Time | Time |
| anti- | protein | Naglu-PCSK9 | 0.0 nM | 0.0 μM | 30 μl/ | 300 sec | 300 sec |
| binding | from | Naglu-PCSK9 | 0.0 nM | 20 μM | min | ||
| protein | table 6 | Naglu-PCSK9 | 0.625 nM | 20 μM | |||
| antibody | Naglu-PCSK9 | 1.25 nM | 20 μM | ||||
| Naglu-PCSK9 | 2.5 nM | 20 μM | |||||
| Naglu-PCSK9 | 5 nM | 20 μM | |||||
| Naglu-PCSK9 | 10 nM | 20 μM | |||||
| Naglu-PCSK9 | 20 nM | 20 μM | |||||
| anti- | protein | PCSK9-GAA | 0.0 nM | 0.0 μM | 30 μl/ | 300 sec | 300 sec |
| binding | from | PCSK9-GAA | 0.0 nM | 20 μM | min | ||
| protein | table 6 | PCSK9-GAA | 0.625 nM | 20 μM | |||
| antibody | PCSK9-GAA | 1.25 nM | 20 μM | ||||
| PCSK9-GAA | 2.5 nM | 20 μM | |||||
| PCSK9-GAA | 5 nM | 20 μM | |||||
| PCSK9-GAA | 10 nM | 20 μM | |||||
| PCSK9-GAA | 20 nM | 20 μM | |||||
| TABLE 9 |
| Experimental Design For Exemplary Surface Plasmone Resonance Assay |
| Capturing | Analyte | Inhibitor | Flow | Assoc. | Dissoc. | ||
| Molecule | Ligand | Analyte | (Conc.) | (Conc.) | Rate | Time | Time |
| anti- | protein | Naglu-PCSK9 | 20 nM | 0.0 | nM | 30 μl/ | 300 sec | 300 sec |
| binding | from | Naglu-PCSK9 | 20 nM | 25 | nM | min | ||
| protein | table 6 | Naglu-PCSK9 | 20 nM | 50 | nM | |||
| Naglu-PCSK9 | 20 nM | 100 | nM | |||||
| Naglu-PCSK9 | 20 nM | 200 | nM | |||||
| Naglu-PCSK9 | 20 nM | 400 | nM | |||||
| Naglu-PCSK9 | 20 nM | 600 | nM | |||||
| Naglu-PCSK9 | 20 nM | 1.0 | μM | |||||
| Naglu-PCSK9 | 20 nM | 1.5 | μM | |||||
| anti- | protein | PCSK9-GAA | 20 nM | 0.0 | nM | 30 μl/ | 300 sec | 300 sec |
| binding | from | PCSK9-GAA | 20 nM | 25 | nM | min | ||
| protein | table 6 | PCSK9-GAA | 20 nM | 50 | nM | |||
| PCSK9-GAA | 20 nM | 100 | nM | |||||
| PCSK9-GAA | 20 nM | 200 | nM | |||||
| PCSK9-GAA | 20 nM | 400 | nM | |||||
| PCSK9-GAA | 20 nM | 600 | nM | |||||
| PCSK9-GAA | 20 nM | 1.0 | μM | |||||
| PCSK9-GAA | 20 nM | 1.5 | μM | |||||
Claims (5)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/521,130 US10556015B2 (en) | 2014-10-24 | 2015-10-23 | Lysosomal targeting of enzymes, and uses thereof |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462068033P | 2014-10-24 | 2014-10-24 | |
| PCT/US2015/057214 WO2016065319A1 (en) | 2014-10-24 | 2015-10-23 | Lysosomal targeting of enzymes, and uses thereof |
| US15/521,130 US10556015B2 (en) | 2014-10-24 | 2015-10-23 | Lysosomal targeting of enzymes, and uses thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20170333569A1 US20170333569A1 (en) | 2017-11-23 |
| US10556015B2 true US10556015B2 (en) | 2020-02-11 |
Family
ID=54478975
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/521,130 Active US10556015B2 (en) | 2014-10-24 | 2015-10-23 | Lysosomal targeting of enzymes, and uses thereof |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US10556015B2 (en) |
| EP (1) | EP3220958A1 (en) |
| MA (1) | MA40791A (en) |
| WO (1) | WO2016065319A1 (en) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11208458B2 (en) | 2017-06-07 | 2021-12-28 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for internalizing enzymes |
| US20220133863A1 (en) * | 2010-06-25 | 2022-05-05 | Shire Human Genetic Therapies, Inc. | Treatment of sanfilippo syndrome type b |
| US11421211B2 (en) * | 2016-09-12 | 2022-08-23 | Genethon | Acid-alpha glucosidase variants and uses thereof |
| US12168041B2 (en) | 2010-06-25 | 2024-12-17 | Takeda Pharmaceutical Company Limited | Methods and compositions for CNS delivery of arylsulfatase A |
| US12252544B2 (en) | 2018-05-17 | 2025-03-18 | Regeneron Pharmaceuticals, Inc. | Anti-CD63 antibodies, conjugates, and uses thereof |
| US12258597B2 (en) | 2018-02-07 | 2025-03-25 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for therapeutic protein delivery |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IL287019B2 (en) * | 2015-12-08 | 2025-10-01 | Regeneron Pharma | Compositions and methods for internalizing enzymes |
| IL299325B2 (en) | 2016-09-12 | 2025-08-01 | Inst Nat Sante Rech Med | Variants of acid alpha-glucosidase and their uses |
| EP3293203A1 (en) * | 2016-09-12 | 2018-03-14 | Genethon | Acid-alpha glucosidase variants and uses thereof |
| WO2019051297A1 (en) * | 2017-09-08 | 2019-03-14 | The Nemours Foundation | An agent, a device and a blood-circulation system for treating lysosomal storage diseases, and a method for treating lysosomal storage diseases |
| IL278244B2 (en) | 2018-04-30 | 2026-01-01 | Regeneron Pharma | Antibodies, and bispecific antigen-binding molecules that bind her2 and/or aplp2, conjugates, and uses thereof |
| EP4714496A2 (en) * | 2018-05-01 | 2026-03-25 | OrfoNeuro ApS | Treatment of neuronal ceroid lipofuscinosis |
| WO2024151982A1 (en) * | 2023-01-13 | 2024-07-18 | Amicus Therapeutics, Inc. | Gene therapy constructs for the treatment of pompe disease |
Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003102583A1 (en) | 2002-05-29 | 2003-12-11 | Symbiontics, Inc. | Targeted therapeutic proteins |
| WO2005078077A2 (en) | 2004-02-10 | 2005-08-25 | Zystor Therapeutics, Inc. | Acid alpha-glucosidase and fragments thereof |
| US20050281805A1 (en) | 2002-05-29 | 2005-12-22 | Symbiontics, Inc. | Targeted therapeutic proteins |
| WO2009137721A2 (en) | 2008-05-07 | 2009-11-12 | Zystor Therapeutics, Inc. | Lysosomal targeting peptides and uses thereof |
| WO2010148253A2 (en) | 2009-06-17 | 2010-12-23 | Zystor Therapeutics, Inc. | Formulations for lysosomal enzymes |
| US20110003315A1 (en) * | 2006-05-08 | 2011-01-06 | Institut De Recherches Cliniques De Montreal | Chimeric pcsk9 proteins, cells comprising same, and assays using same |
| WO2011163652A2 (en) | 2010-06-25 | 2011-12-29 | Shire Human Genetic Therapies, Inc. | Treatment of sanfilippo syndrome type b |
| EP2471929A1 (en) * | 2010-12-29 | 2012-07-04 | Algenics | Production of high mannose glycosylated proteins stored in the plastid of microalgae |
| WO2014085621A1 (en) | 2012-11-27 | 2014-06-05 | Biomarin Pharmaceutical Inc. | Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof |
-
2015
- 2015-10-23 EP EP15791835.0A patent/EP3220958A1/en not_active Withdrawn
- 2015-10-23 WO PCT/US2015/057214 patent/WO2016065319A1/en not_active Ceased
- 2015-10-23 MA MA040791A patent/MA40791A/en unknown
- 2015-10-23 US US15/521,130 patent/US10556015B2/en active Active
Patent Citations (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003102583A1 (en) | 2002-05-29 | 2003-12-11 | Symbiontics, Inc. | Targeted therapeutic proteins |
| US20050281805A1 (en) | 2002-05-29 | 2005-12-22 | Symbiontics, Inc. | Targeted therapeutic proteins |
| WO2005078077A2 (en) | 2004-02-10 | 2005-08-25 | Zystor Therapeutics, Inc. | Acid alpha-glucosidase and fragments thereof |
| US20110003315A1 (en) * | 2006-05-08 | 2011-01-06 | Institut De Recherches Cliniques De Montreal | Chimeric pcsk9 proteins, cells comprising same, and assays using same |
| WO2009137721A2 (en) | 2008-05-07 | 2009-11-12 | Zystor Therapeutics, Inc. | Lysosomal targeting peptides and uses thereof |
| US20110223147A1 (en) * | 2008-05-07 | 2011-09-15 | Zystor Therapeutics, Inc. | Lysosomal targeting peptides and uses thereof |
| WO2010148253A2 (en) | 2009-06-17 | 2010-12-23 | Zystor Therapeutics, Inc. | Formulations for lysosomal enzymes |
| WO2011163652A2 (en) | 2010-06-25 | 2011-12-29 | Shire Human Genetic Therapies, Inc. | Treatment of sanfilippo syndrome type b |
| US20110318327A1 (en) * | 2010-06-25 | 2011-12-29 | Shire Human Genetic Therapies, Inc. | Treatment of sanfilippo syndrome type b |
| EP2471929A1 (en) * | 2010-12-29 | 2012-07-04 | Algenics | Production of high mannose glycosylated proteins stored in the plastid of microalgae |
| WO2014085621A1 (en) | 2012-11-27 | 2014-06-05 | Biomarin Pharmaceutical Inc. | Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof |
Non-Patent Citations (6)
| Title |
|---|
| Bosshart, H. et al., "The cytoplasmic domain mediates localization of furin to the trans-Golgi network en route to the endosomal/lysosomal system", J Cell Biol., 126(5): 1157-1172 (1994). |
| Desnick et al., Enzyme Replacement Therapy for Lysosomal Diseases: Lessons from 20 Years of Experience and Remaining Challenges, Annu. Rev. Genom. Human Genet., 2012, 13:307-335. * |
| DeVay, R. M. et al., "Characterization of Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) Trafficking Reveals a Novel Lysosomal Targeting Mechanism via Amyloid Precursor-like Protein 2 (APLP2)", J Biol Chem., 288(15): 10805-18 (2013). |
| Kourimate et al., Cellular and secreted pro-protein convertase subtilisin/kexin type 9 catalytic activity in hepatocytes, Atherosclerosis, 206 (2009), pp. 134-140. * |
| Wolins N. et al., "Aggregation as a Determinant of Protein Fate in Post-Golgi Compartments: Role of the Luminal Domain of Furin in Lysosomal Targeting", J Cell Biol, 139(7): 1735-1745 (2007). |
| Wolins N. et al., "The luminal domain of furin mediates in aggregation in the trans-Golgi network and targeting to lysosomes", Molecular Biology of the Cell, & 37th Annual Meeting of the American Society for Cell Biology; Washington, D.C., USA; Dec. 13-17, vol. 8, Suppl., p. 422a (1997). |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20220133863A1 (en) * | 2010-06-25 | 2022-05-05 | Shire Human Genetic Therapies, Inc. | Treatment of sanfilippo syndrome type b |
| US12168041B2 (en) | 2010-06-25 | 2024-12-17 | Takeda Pharmaceutical Company Limited | Methods and compositions for CNS delivery of arylsulfatase A |
| US11421211B2 (en) * | 2016-09-12 | 2022-08-23 | Genethon | Acid-alpha glucosidase variants and uses thereof |
| US11208458B2 (en) | 2017-06-07 | 2021-12-28 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for internalizing enzymes |
| US12215138B2 (en) | 2017-06-07 | 2025-02-04 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for internalizing enzymes |
| US12258597B2 (en) | 2018-02-07 | 2025-03-25 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for therapeutic protein delivery |
| US12252544B2 (en) | 2018-05-17 | 2025-03-18 | Regeneron Pharmaceuticals, Inc. | Anti-CD63 antibodies, conjugates, and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| US20170333569A1 (en) | 2017-11-23 |
| EP3220958A1 (en) | 2017-09-27 |
| WO2016065319A1 (en) | 2016-04-28 |
| MA40791A (en) | 2017-09-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10556015B2 (en) | Lysosomal targeting of enzymes, and uses thereof | |
| US10603364B2 (en) | Lysosomal targeting and uses thereof | |
| EP1981546B1 (en) | Enzyme replacement therapy for treating lysosomal storage diseases | |
| EP3782639B1 (en) | Compositions and methods for internalizing enzymes | |
| US20180009904A1 (en) | Lysosomal targeting and uses thereof | |
| EP2925776B1 (en) | Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof | |
| US20200376095A1 (en) | Mannose-6-phosphate bearing peptides fused to lysosomal enzymes | |
| US20240091321A1 (en) | Variant igf2 constructs | |
| KR20140033155A (en) | Methods for coupling targeting peptides onto recombinant lysosomal enzymes for improved treatments of lysosomal storage diseases | |
| AU2012322811A1 (en) | Recombinant human NaGlu protein and uses thereof | |
| RS55669B1 (en) | PRODUCTION OF ACTIVE HIGHLY PHOSPHORILIZED HUMAN N-ACETYLGLAKTOSAMINE-6-SULFATASE AND ITS APPLICATIONS | |
| AU2019202865B2 (en) | Peptide linkers for polypeptide compositions and methods for using same | |
| US20240167007A1 (en) | Mutated arylsulfatase a with increased stability | |
| CA3228179A1 (en) | Targeted delivery of therapeutic enzymes | |
| HK40104659A (en) | Targeted delivery of therapeutic enzymes | |
| HK40046813B (en) | Compositions and methods for internalizing enzymes | |
| HK1216026B (en) | Targeted therapeutic lysosomal enzyme fusion proteins and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: SHIRE HUMAN GENETIC THERAPIES, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:ZHANG, BOHONG;CONCINO, MICHAEL F.;SIGNING DATES FROM 20151214 TO 20160120;REEL/FRAME:044153/0839 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE AFTER FINAL ACTION FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED |
|
| STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
| CC | Certificate of correction | ||
| AS | Assignment |
Owner name: TAKEDA PHARMACEUTICAL COMPANY LIMITED, JAPAN Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:SHIRE HUMAN GENETIC THERAPIES, INC.;REEL/FRAME:056420/0964 Effective date: 20210226 |
|
| MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1551); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY Year of fee payment: 4 |

























