US10385117B2 - Process for preparation of secretory IgA and secretory IgM - Google Patents

Process for preparation of secretory IgA and secretory IgM Download PDF

Info

Publication number
US10385117B2
US10385117B2 US14/476,559 US201414476559A US10385117B2 US 10385117 B2 US10385117 B2 US 10385117B2 US 201414476559 A US201414476559 A US 201414476559A US 10385117 B2 US10385117 B2 US 10385117B2
Authority
US
United States
Prior art keywords
tag
secretory
igm
affinity
epitope
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active, expires
Application number
US14/476,559
Other versions
US20140371431A1 (en
US20170058018A2 (en
Inventor
Stephen C. Brown
Michael R. Simon
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Individual
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from EP20120158931 external-priority patent/EP2636682A1/en
Application filed by Individual filed Critical Individual
Priority to US14/476,559 priority Critical patent/US10385117B2/en
Publication of US20140371431A1 publication Critical patent/US20140371431A1/en
Publication of US20170058018A2 publication Critical patent/US20170058018A2/en
Priority to US16/401,322 priority patent/US11623948B2/en
Application granted granted Critical
Publication of US10385117B2 publication Critical patent/US10385117B2/en
Active legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/02Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70535Fc-receptors, e.g. CD16, CD32, CD64 (CD2314/705F)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/06Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies from serum
    • C07K16/065Purification, fragmentation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B01PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
    • B01DSEPARATION
    • B01D15/00Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
    • B01D15/08Selective adsorption, e.g. chromatography
    • B01D15/26Selective adsorption, e.g. chromatography characterised by the separation mechanism
    • B01D15/38Selective adsorption, e.g. chromatography characterised by the separation mechanism involving specific interaction not covered by one or more of groups B01D15/265 and B01D15/30 - B01D15/36, e.g. affinity, ligand exchange or chiral chromatography
    • B01D15/3804Affinity chromatography
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/14Extraction; Separation; Purification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/036Fusion polypeptide containing a localisation/targetting motif targeting to the medium outside of the cell, e.g. type III secretion
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/10Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/32Fusion polypeptide fusions with soluble part of a cell surface receptor, "decoy receptors"

Definitions

  • This invention relates in general to a process for the preparation of secretory IgA and secretory IgM from plasma proteins containing IgA and/or IgM, and in particular to a process that is scalable to allow the production of commercial quantities of medicaments containing the same.
  • Clostridium difficile ( C. difficile ) is a gram-positive anaerobic bacillus . Disease is associated with C. difficile infection.
  • Antibiotic associated pseudomembranous colitis results from the use of broad-spectrum antibiotic agents such as clindamycin. These antibiotics cause diarrhea in about 10% of treated patients and pseudomembranous colitis in about 1%. C. difficile causes antibiotic associated diarrhea and almost all cases of pseudomembranous colitis.
  • C. difficile associated disease Most patients with C. difficile associated disease are treated effectively with vancomycin or metronidazole.
  • Other treatment modalities include tolevemer, a toxin binding polymer (T. J. Louie et al., Clin. Infect. Dis. 2006; 43:411), and an antiparasitic medication, nitazoxanide (Med. Letter Drugs Ther. 2006; 48:89).
  • Current treatments for C. difficile associated disease use antibiotics such as metronidazole and vancomycin. These drugs result in further disruption of the intestinal flora and are associated with a 20-25% incidence of disease relapse. Therefore, there is still a need for additional treatments of Clostridium difficile associated disease in humans.
  • Immunological treatment is valuable against C. difficile .
  • Vaccination against toxins A and B stimulates active immunity against C. difficile disease in animals (Libby et al., Infect. Immun., 36:822-829).
  • Passive immunization is another immunological treatment against C. difficile .
  • Serum antibodies against C. difficile have been shown to protect hamsters against C. difficile disease after oral administration.
  • Passive immunization with bovine antibodies has been proposed as a treatment for other infectious diseases of the gastrointestinal tract, such as diseases caused by rotavirus, enteropathogenic and enterotoxigenic Escherichia coli, Vibrio cholerae , and Cryptosporidium parvum .
  • Preliminary studies indicate that such passive immunization provides protection (Boesman-Finkelstein et al., Infect. Immun., 57:1227-1234; Brussow et al., J. Clin.
  • bovine immunoglobulin G concentrate from the colostrum of cows vaccinated with C. difficile toxoid protects hamsters against antibiotic associated diarrhea. The hamsters were protected when treated before the onset of diarrhea but not after diarrhea began (Lyerly et al., Infection and Immunity, Vol. 59, No. 6, pages 2215-2218 (1991)). IgG directed against toxins A and B of C. difficile are present in the general population (Bacon and Fekety, Diagn. Microbiol. Infect. Dis., 1994; 18:205-209). Human intravenous immunoglobulin derived from plasma donors has facilitated treatment in some patients, especially patients who lack circulating antibodies to the C.
  • the isolation of secretory forms of immunoglobulins is more difficult that securing forms of a respective immunoglobulin that circulate in the blood and lack secretory component.
  • IgA and IgM therapeutics that are resistant to gastrointestinal tract degradation.
  • Human plasma derived IgA and IgM has been successfully combined with recombinant secretory component to produce secretory IgA and secretory IgM with biological activity (Longet et al 2013).
  • a process for the preparation of secretory IgA and/or secretory IgM and their separation from unwanted other substances including proteins involves the application of an IgA source, which may contain a mixture of monomers and dimers, or a plasma protein solution containing IgM, to secretory component that is modified to contain an affinity tag or an epitope tag to form secretory IgA and/or secretory IgM containing said affinity tag or epitope tag that is useful for capture by a solid phase support resin.
  • the protein solution which now contains the affinity tagged or epitope-tagged secretory IgA or affinity tagged or epitope-tagged secretory IgM is then applied to a solid phase support resin.
  • the desired product, secretory IgA or secretory IgM is then eluted from the solid phase support resin using a release agent.
  • examples of the moieties on the solid phase support resin to which the peptide binds are immobilized divalent cations or anti polyhistidine antibodies and immobilized anti-FLAG peptide antibodies.
  • a new composition of histidine tagged secretory IgA or secretory IgM is also provided.
  • FIG. 1 ELISA ⁇ colostral secretory IgA (sIgA) and ⁇ synthesized sIgA. Plate was coated with mouse anti-secretory component antibody.
  • FIG. 2 Tris acetate PAGE showing sIgA, prepared with histidine tagged secretory component eluted from nickel resin (Cube Biotech, Monheim, Germany). Lane 1: MW ladder; Lane 2: colostral secretory IgA; Lane 3 blank; Lane 4 nickel resin flow-through; Lane 5: nickel resin imidazole eluate with semisynthetic sIgA.
  • the present invention has utility for the preparation of secretory IgA or secretory IgM.
  • the IgA is derived from a mixture of monomeric and dimeric plasma IgA. or in other inventive embodiments, the preparation of secretory IgM is derived from a mixture of IgM with other plasma proteins.
  • the present invention is superior to monomeric IgA or pentameric IgM administered orally because the presence of secretory component protects the IgA or IgM from digestion in the gastrointestinal tract.
  • An affinity tag or an epitope tag that are useful for the present invention is one of: peptide tags:AviTag, a peptide allowing biotinylation by the enzyme BirA so the protein can be isolated by streptavidin; GLNDIFEAQKIEWHE (SEQ ID No. 1); calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL (SEQ ID No. 2); FLAG-tag, a peptide recognized by an antibody DYKDDDDK (SEQ ID No. 3); Hemaglutinin-tag, a peptide recognized by an antibody YPYDVPDYA (SEQ ID No.
  • V5 tag a peptide recognized by an antibody GKPIPNPLLGLDST (SEQ ID No. 12); Xpress tag DLYDDDDK (SEQ ID No. 13); Biotin Carboxyl Carrier Protein, a protein domain recognized by streptavidin; Glutathione-S-transferase-tag, a protein which binds to immobilized glutathione; Green fluorescent protein-tag, a protein which is spontaneously fluorescent and can be bound by nanobodies; Maltose binding protein-tag, a protein which binds to amylose agarose; Nus-tag; Strep-tag, a peptide which binds to streptavidin, or the modified streptavidin called streptactin Strep-tag II: WSHPQFEK (SEQ ID No. 14); Thioredoxin-tag; TC tag; or Ty tag.
  • Plasma IgA contains a mixture of monomer and dimer (Delacroix et al. 1981; Delacroix et al. 1983; Longet et al. 2013).
  • plasma dimeric IgA in the naturally occurring monomer-dimer mixture is covalently bound to recombinant peptide tagged secretory component in vitro.
  • native secretory component is covalently bonded to one or more amino acid residues through conventional synthetic techniques (Hermanson G T 1996).
  • a histidine tag As an example using a histidine tag, it is appreciated that a single histidine residue or a poly histidine having typically between 2 and 20 histidine residues is added to secretory component, regardless of whether produced by recombinant, synthetic addition, or other technique.
  • the secretory IgA is now histidine tagged by virtue of the divalent bonding of the histidine tagged secretory component to the IgA dimer,
  • the novel method of obtaining purified secretory IgA that is thus formed is to remove the secretory IgA that is now tagged by affinity binding of one of the aforementioned tags to a binding moiety immobilized on a resin a or simply by a histidine residue(s) tagged to an immobilized nickel +2 resin.
  • the resultant secretory IgA has utility, for example, as a treatment of C. difficile associated diseases such as Clostridium difficile colitis, pseudomembranous colitis and antibiotic associated diarrhea and in particular to secretory immunoglobulin A (IgA) compositions administered in the form of pharmaceutical compositions.
  • C. difficile associated diseases such as Clostridium difficile colitis, pseudomembranous colitis and antibiotic associated diarrhea
  • secretory immunoglobulin A (IgA) compositions administered in the form of pharmaceutical compositions is equally applicable to IgM to form purified secretory IgM.
  • Ethanol fractionation of pooled human plasma is a well-known process to prepare immunoglobulin G.
  • Pooled human plasma is first obtained from licensed plasmapheresis centers in the United States and tested for various pathogens including the HIV virus.
  • the first manufacturing step of most commercial immunoglobulin G preparations involves a modified cold ethanol fractionation according to Cohn to produce Cohn fraction II. In the fractionation process, many infectious viruses are eliminated from the pooled human plasma. Following fractionation, the Cohn fraction II is subjected to adsorption onto an ion exchange medium.
  • This step may selectively reduce the IgA concentration to less than 0.1%.
  • Such a step is important for producing immunoglobulin G for intravenous infusion into humans. This is because some individuals undergo an anaphylactic-like reaction if treated with intravenous IgG that contains IgA as an impurity.
  • the modified cold ethanol fractionation process according to Cohn is a series of fractionations using various levels of ethanol, pH, and temperature to produce a fraction II which is further treated to produce immunoglobulins as described above.
  • pooled human plasma is first treated to produce a cryoprecipitate and cryo-supernatant.
  • the source plasma may be autologous plasma or hyperimmune human plasma, either pooled, or from a single individual who has been immunized against a specific disease.
  • the IgA component is be prepared by hybridoma techniques to provide antigen-specific IgA.
  • Hybridoma techniques are described originally in Kohler and Milstein, Nature 1975; 256:495-497 with more recent advances summarized in Berzofsky et al., Fundamental Immunology, Third Edition, 1993, pp 455-62.
  • cryo-supernatant is subjected to a first ethanol fractionation to yield a supernatant I.
  • Supernatant I is subjected to a second ethanol fractionation to yield fraction II+III.
  • Fraction II+III is subjected to a third ethanol fractionation procedure to yield a supernatant III and Fraction III precipitate.
  • the fraction III precipitate enriched in IgA is generally discarded as an unwanted byproduct.
  • this unwanted IgA following ion exchange adsorption purification is further treated by incubation with immobilized hydrolases to inactivate viruses and vasoactive substances.
  • immobilized hydrolases to inactivate viruses and vasoactive substances.
  • Such treatment has been proven to eliminate many viruses tested including HIV, Sindbis, and vaccinia.
  • Other antiviral treatments as known to those skilled in the art, are used in combination and consist of solvent detergent processes, nanofiltration and/or heat inactivation. Usually three antiviral steps are implemented. Following incubation to remove viruses, the concentration of the active material is adjusted with sterile saline or buffered solutions to ensure a constant amount of active material per milliliter of reconstituted product. Finally, the solution with a constant amount of reconstituted product is sterilized by filtration before use.
  • ion exchange chromatography may be used to obtain the dimeric and polymeric IgA byproduct during the manufacture of intravenous immunoglobulin. From 4% to 22% of plasma IgA is dimeric and polymeric IgA (Delacroix et al. 1981; Delacroix et al. 1983). The resulting dimeric IgA-J chains are purified to form a medicament.
  • the dimeric and polymeric IgA present in the plasma IgA monomer-polymer mixture is further coupled to secretory component that is recombinantly produced to include a histidine tag or another of the aforementioned tags; or subsequently covalently bonded to a peptide tag such as histidine or poly-histine oligopeptide.
  • secretory component that is recombinantly produced to include a histidine tag or another of the aforementioned tags; or subsequently covalently bonded to a peptide tag such as histidine or poly-histine oligopeptide.
  • the coupling of IgA to secretory component is accomplished by forming disulfide bonds under mildly oxidizing conditions. (Jones R. M. L., Schweikart F., Frutiger S., Jaton J-C., Hughes G. J.
  • Thiol-disulfide redox buffers maintain a structure of immunoglobulin A that is essential for optimal in vitro binding to secretory component.
  • Dimeric and polymeric IgA containing both J chain and secretory component is purified from the mixture by immobilized metal ion affinity chromatography, as performed by those of skill in the art of protein purification.
  • the mixture of histidine tagged secretory IgA and residual monomeric IgA is buffer exchanged into a binding buffer containing low concentrations of imidazole ( ⁇ 40 mM).
  • Another release agent operative to exchange histidine tagged secretory IgA or secretory IgM illustratively includes 1) ethylene diamine tetraacetic acid (EDTA) at 10 mM and 2) an elution buffer of pH 5.5 or lower.
  • EDTA ethylene diamine tetraacetic acid
  • Typical binding buffer imidazole concentrations range from 0.1 to 100 millimolar (mM). It is appreciated that the initial binding buffer pH is somewhat variable and readily discerned for a given chemical structure of buffer and concentration through routine experimentation.
  • the chromatography medium operative herein is selected to be stable in the presence of the binding buffer and able to separate histidine tagged secretory IgA.
  • Suitable media illustratively include Exemplary of these media are nickel, cobalt and zinc immobilized on sepharose.
  • the affinity medium is washed in a wash buffer containing from 0 to 100 mM imidazole to remove unbound monomeric IgA.
  • the bound histidine tagged secretory IgA is recovered using an elution buffer of a higher imidazole concentration (e.g. 100 to 1000 mM). With successive elutions separation of monomeric from histidine tagged secretory component bound dimeric IgA is exacted.
  • inventive process is amenable to scaling to produce quantities sufficient to treat numerous subjects. It is appreciated that similar selective binding pairs is achieved between other inventive tagged secretory component containing immunoglobulin proteins and resins are convetional to the art for each of the aforementioned tags.
  • the binding and wash buffers are 50 mM NaH 2 PO 4 300 mM NaCl and 20 mM imidazole, is adjusted to pH 8.
  • the mixture of IgA monomer and secretory IgA is dissolved in that buffer.
  • the elution buffer is identical to the binding buffer with the exception that the imidazole is at a higher concentration, e.g 100 to 1000 mM.
  • the remaining histidine tagged secretory IgA is then eluted from the divalent immobilized metal resin with the elution buffer according to conventional techniques and conditions that include an exemplary basic pH of for example 8 to 10, see FIGS. 1 and 2 .
  • Purified secretory IgA containing histidine tagged secretory component is stabilized in some embodiments for example by the addition of human serum albumin to a final concentration of 5% total weight albumen.
  • the tag is removed from the recovered secretroy IgA and native secretory IgA is available for usage as a medicament.
  • native secretory IgA For a histidine tagged secretory IgA a procedure for tag removal is known to the art (Kopera E et al 2012).
  • the inventive process is the addition of tagged secretory component in either recombinatant or post expression tagging to a mixture of plasma derived IgA monomers and dimers, in which the tagged secretory component combines with the IgA dimer forming secretory IgA and allows recovery of the newly formed secretory IgA by adhesion to immobilized divalent metal ions or other solid phase moeity, and subsequent elution therefrom.
  • Plasma IgM can be recovered from the byproducts of the production of intravenous immunoglobulin.
  • An example of such a byproduct is Cohn fraction III preciptate.
  • the IgM is most easily solublized from Cohn fraction III preciptate by 20 mM socium acetate.
  • Other plasma proteins are similarly solublized along with the IgM.
  • the plasma IgM in this protein mixture is covalently bound to recombinant histidine tagged secretory component in vitro forming secretory IgM within the protein mixture.
  • the secretory IgM is now tagged by virtue of the divalent bonding of the tagged secretory component to the IgM.
  • the novel method of obtaining purified secretory IgM that is thus formed is to remove the secretory IgM that is now tagged by affinity binding of the tag to a immobilized nickel +2 or other divalent metal ion or other suitable binding moiety conventional to the art that is part of a resin column.
  • the resultant semisynthetic secretory IgM has utility, for example, as a treatment of Clostridium difficile associated diseases such as Clostridium difficile colitis, pseudomembranous colitis and antibiotic associated diarrhea and in particular to secretory immunoglobulin M compositions administered in the form of pharmaceutical compositions.
  • the tag is removed from the recovered secretory IgM and native secretory IgM is available for usage as a medicament.
  • native secretory IgM For a histidine tagged secretoty IgM a procedure for tag removal is known to the art (Kopera E et al 2012).
  • an inventive process provides the addition of peptide tagged secretory component to a mixture of plasma derived IgM and other plasma proteins, in which the peptide tagged secretory component combines with the IgM forming secretory IgM and allows recovery of the newly formed secretory IgM by adhesion to moieties on the solid phase support resin to which the peptide binds, and subsequent elution therefrom using an elution buffer.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Engineering & Computer Science (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Dermatology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

A process for synthesizing and separating secretory IgA from a mixture of IgA monomer and IgA dimer is provided. The process includes covalently binding affinity tagged or epitope tagged recombinant secretory component to the IgA dimer in the mixture and binding the affinity tagged or an epitope tagged secretory IgA to immobilized moieties on the solid phase support resin to which the affinity tag or epitope tag binds and then eluting the affinity tagged or an epitope tagged secretory IgA with release buffer. A process for synthesizing and separating secretory IgM from a mixture of IgM and other plasma proteins is also provided. The process includes covalently binding affinity tagged or an epitope tagged recombinant secretory component to the IgM in the mixture and binding the affinity tagged or an epitope tagged secretory IgM to immobilized moieties on the solid phase support resin and then eluting the peptide tagged secretory IgM with a release buffer.

Description

RELATED APPLICATIONS
This application is a continuation of U.S. patent application Ser. No. 13/935,417; filed Jul. 3, 2013; and a continuation-in-part of PCT application Serial No. PCT/EP2013/054697 filed Mar. 8, 2013 that in turn claims priority benefit of EP 12158931.1 filed Mar. 9, 2012 and EP 12168343.7 filed May 16, 2012; the contents of which are hereby incorporated by reference.
FIELD OF THE INVENTION
This invention relates in general to a process for the preparation of secretory IgA and secretory IgM from plasma proteins containing IgA and/or IgM, and in particular to a process that is scalable to allow the production of commercial quantities of medicaments containing the same.
BACKGROUND OF THE INVENTION
Clostridium difficile (C. difficile) is a gram-positive anaerobic bacillus. Disease is associated with C. difficile infection.
Antibiotic associated pseudomembranous colitis results from the use of broad-spectrum antibiotic agents such as clindamycin. These antibiotics cause diarrhea in about 10% of treated patients and pseudomembranous colitis in about 1%. C. difficile causes antibiotic associated diarrhea and almost all cases of pseudomembranous colitis.
Pseudomembranous colitis results from the production of C. difficile toxin A (MW, 308,000) and toxin B (MW, 270,000) in the colon (Barroso et al., Nucleic Acids Res., 18:4004; Dove et al., Infect. Immun., 58:480-488; Lyerly et al., Clin. Microbiol. Rev., 1:1-18). Toxin A probably causes most of the gastrointestinal symptoms because of its enterotoxic activity (Lyerly et al., Infect. Immun., 35:1147-1150; Lyerly et al., Infect. Immun., 47:349-352). The toxins may act synergistically and the initial pathology caused by toxin A allows toxin B to manifest its toxicity (Lyerly et al., Infect. Immun., 47:349-352).
Most patients with C. difficile associated disease are treated effectively with vancomycin or metronidazole. Other treatment modalities include tolevemer, a toxin binding polymer (T. J. Louie et al., Clin. Infect. Dis. 2006; 43:411), and an antiparasitic medication, nitazoxanide (Med. Letter Drugs Ther. 2006; 48:89). Current treatments for C. difficile associated disease use antibiotics such as metronidazole and vancomycin. These drugs result in further disruption of the intestinal flora and are associated with a 20-25% incidence of disease relapse. Therefore, there is still a need for additional treatments of Clostridium difficile associated disease in humans.
Immunological treatment is valuable against C. difficile. Vaccination against toxins A and B stimulates active immunity against C. difficile disease in animals (Libby et al., Infect. Immun., 36:822-829).
Passive immunization is another immunological treatment against C. difficile. Serum antibodies against C. difficile have been shown to protect hamsters against C. difficile disease after oral administration. Passive immunization with bovine antibodies has been proposed as a treatment for other infectious diseases of the gastrointestinal tract, such as diseases caused by rotavirus, enteropathogenic and enterotoxigenic Escherichia coli, Vibrio cholerae, and Cryptosporidium parvum. Preliminary studies indicate that such passive immunization provides protection (Boesman-Finkelstein et al., Infect. Immun., 57:1227-1234; Brussow et al., J. Clin. Microbiol., 25:982-986; Fayer et al., Infect. Immun., 58:2962-2965; Hilpert et al., J. Infect. Dis., 156:158-166; Mietens et al., Eur. J. Pediatr., 132:239-252; Tacket et al., N. Engl. J. Med., 318:1240-1243; Yoshiyama et al., Immunology, 61:543-547).
It has been reported that bovine immunoglobulin G (IgG) concentrate from the colostrum of cows vaccinated with C. difficile toxoid protects hamsters against antibiotic associated cecitis. The hamsters were protected when treated before the onset of diarrhea but not after diarrhea began (Lyerly et al., Infection and Immunity, Vol. 59, No. 6, pages 2215-2218 (1991)). IgG directed against toxins A and B of C. difficile are present in the general population (Bacon and Fekety, Diagn. Microbiol. Infect. Dis., 1994; 18:205-209). Human intravenous immunoglobulin derived from plasma donors has facilitated treatment in some patients, especially patients who lack circulating antibodies to the C. difficile toxins (Leung D. Y. et al., J. Pediatr. 1991 April; 118(4 (Pt 1)):633-7; Salcedo J. et al., Gut 1997; 41:366-370; Wilcox M. H., J. Antimicrob. Chemoth. 2004; 53:882-884; McPherson S. et al., Dis. Colon Rectum 2006; 49:640-645; Cone L. A. et al., Infect. Dis. Clin. Pract. 2006; 14:217-220).
In vitro experiments have demonstrated that polymeric IgA is superior to monomeric IgA and IgG in preventing C. difficile toxin damage to intestinal epithelial cell monolayers (Stubbe H. et al., J. Immunol. 2000; 164:1952-1960). Selective neutralization of C. difficile toxin by serum IgA has also been demonstrated (Johnson S. et al., Infect. Immun. 1995; 63:3166-3173).
Administration of an immunoglobulin product containing specific antibodies to C. difficile results in the elimination of C. difficile toxins and also killing of the bacteria within the colon as detailed in U.S. Pat. No. 5,773,000. Such passive immunization therefore provides an effective approach for the treatment of C. difficile associated diseases such as colitis, pseudomembranous colitis and antibiotic associated diarrhea. This is especially important for patients experiencing multiple relapses.
Oral human immunoglobulin treatment has shown efficacy in treating acute C. difficile infections. Monomeric IgA admixed with IgG (2:1) was derived from plasma (IgAbulin, Immuno, Vienna) (100 mg/mL); four mL administered orally 3 times daily for 3 weeks to a three and one-half year old child with antibiotic-associated diarrhea and C. difficile toxin A in his stools proved effective in the context of concurrent vancomycin administration. The child improved on this treatment (Tjellstrom B. et al., Lancet 1993; 341:701702). This report demonstrates the efficacy of passive immunization with IgA derived from the general population.
The isolation of secretory forms of immunoglobulins is more difficult that securing forms of a respective immunoglobulin that circulate in the blood and lack secretory component.
Thus, there exists a need for IgA and IgM therapeutics that are resistant to gastrointestinal tract degradation. There also exists a need to provide such a therapeutic in a dosing form well suited for treating an infected subject. Human plasma derived IgA and IgM has been successfully combined with recombinant secretory component to produce secretory IgA and secretory IgM with biological activity (Longet et al 2013).
SUMMARY OF THE INVENTION
A process for the preparation of secretory IgA and/or secretory IgM and their separation from unwanted other substances including proteins is provided. The process involves the application of an IgA source, which may contain a mixture of monomers and dimers, or a plasma protein solution containing IgM, to secretory component that is modified to contain an affinity tag or an epitope tag to form secretory IgA and/or secretory IgM containing said affinity tag or epitope tag that is useful for capture by a solid phase support resin. The protein solution which now contains the affinity tagged or epitope-tagged secretory IgA or affinity tagged or epitope-tagged secretory IgM is then applied to a solid phase support resin. The adherence of the affinity tagged or epitope tagged secretory IgA or secretory IgM to the resin and the unwanted components flow through and are thus removed. The desired product, secretory IgA or secretory IgM is then eluted from the solid phase support resin using a release agent.
For histidine and “FLAG” peptides, examples of the moieties on the solid phase support resin to which the peptide binds are immobilized divalent cations or anti polyhistidine antibodies and immobilized anti-FLAG peptide antibodies. A new composition of histidine tagged secretory IgA or secretory IgM is also provided.
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1. ELISA Δ colostral secretory IgA (sIgA) and □ synthesized sIgA. Plate was coated with mouse anti-secretory component antibody.
FIG. 2. Tris acetate PAGE showing sIgA, prepared with histidine tagged secretory component eluted from nickel resin (Cube Biotech, Monheim, Germany). Lane 1: MW ladder; Lane 2: colostral secretory IgA; Lane 3 blank; Lane 4 nickel resin flow-through; Lane 5: nickel resin imidazole eluate with semisynthetic sIgA.
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS
The present invention has utility for the preparation of secretory IgA or secretory IgM. In some inventive embodiments, the IgA is derived from a mixture of monomeric and dimeric plasma IgA. or in other inventive embodiments, the preparation of secretory IgM is derived from a mixture of IgM with other plasma proteins. The present invention is superior to monomeric IgA or pentameric IgM administered orally because the presence of secretory component protects the IgA or IgM from digestion in the gastrointestinal tract. Without intending to be bound to particular theory, it is believed that the increased efficacy of the present invention is achieved for secretory IgA or secretory IgM owing to the propensity of monomeric IgA and pentameric IgM to degrade in the gastrointestinal tract. The resultant dosing requirements increase treatment costs. While the present invention is further detailed principally with respect to IgA, it is appreciated that the process and medicaments that result are equally applicable to IgM and the resulting secretory IgM, regardless of whether the tag is retained or removed.
An affinity tag or an epitope tag that are efficaceous for the present invention is one of: peptide tags:AviTag, a peptide allowing biotinylation by the enzyme BirA so the protein can be isolated by streptavidin; GLNDIFEAQKIEWHE (SEQ ID No. 1); calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL (SEQ ID No. 2); FLAG-tag, a peptide recognized by an antibody DYKDDDDK (SEQ ID No. 3); Hemaglutinin-tag, a peptide recognized by an antibody YPYDVPDYA (SEQ ID No. 4); His-tag, 5-10 histidines bound by a nickel or cobalt or other divalent cation chelate HHHHHH (SEQ ID No. 6); Myc-tag, a short peptide recognized by an antibody EQKLISEEDL (SEQ ID No. 7); S-tag KETAAAKFERQHMDS (SEQ ID No. 8); SBP-tag, a peptide which binds to streptavidin MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP (SEQ ID No. 9); Softag 1, for mammalian expression SLAELLNAGLGGS (SEQ ID No. 10); Softag 3, for prokaryotic expression TQDPSRVG (SEQ ID No. 11); V5 tag, a peptide recognized by an antibody GKPIPNPLLGLDST (SEQ ID No. 12); Xpress tag DLYDDDDK (SEQ ID No. 13); Biotin Carboxyl Carrier Protein, a protein domain recognized by streptavidin; Glutathione-S-transferase-tag, a protein which binds to immobilized glutathione; Green fluorescent protein-tag, a protein which is spontaneously fluorescent and can be bound by nanobodies; Maltose binding protein-tag, a protein which binds to amylose agarose; Nus-tag; Strep-tag, a peptide which binds to streptavidin, or the modified streptavidin called streptactin Strep-tag II: WSHPQFEK (SEQ ID No. 14); Thioredoxin-tag; TC tag; or Ty tag.
Plasma IgA contains a mixture of monomer and dimer (Delacroix et al. 1981; Delacroix et al. 1983; Longet et al. 2013). In some embodiments of the present invention, plasma dimeric IgA in the naturally occurring monomer-dimer mixture is covalently bound to recombinant peptide tagged secretory component in vitro. In other inventive embodiments native secretory component is covalently bonded to one or more amino acid residues through conventional synthetic techniques (Hermanson G T 1996). As an example using a histidine tag, it is appreciated that a single histidine residue or a poly histidine having typically between 2 and 20 histidine residues is added to secretory component, regardless of whether produced by recombinant, synthetic addition, or other technique. The secretory IgA is now histidine tagged by virtue of the divalent bonding of the histidine tagged secretory component to the IgA dimer, The novel method of obtaining purified secretory IgA that is thus formed is to remove the secretory IgA that is now tagged by affinity binding of one of the aforementioned tags to a binding moiety immobilized on a resin a or simply by a histidine residue(s) tagged to an immobilized nickel+2 resin. Alternatively, other immobilized divalent metal ions such as cobalt, zinc, copper or iron can be used. Alternatively, a FLAG peptide is used in certain inventive embodiments and antibody to the FLAG peptide is immobilized on the solid support resin. FLAG tags have been detailed elsewhere as for example U.S. Pat. No. 4,703,004. The resultant secretory IgA has utility, for example, as a treatment of C. difficile associated diseases such as Clostridium difficile colitis, pseudomembranous colitis and antibiotic associated diarrhea and in particular to secretory immunoglobulin A (IgA) compositions administered in the form of pharmaceutical compositions. The above process is equally applicable to IgM to form purified secretory IgM.
A more detailed description of an exemplary isolation of an IgA component as a byproduct from pooled human plasma or hyperimmune pooled human plasma is as follows. Ethanol fractionation of pooled human plasma is a well-known process to prepare immunoglobulin G. Pooled human plasma is first obtained from licensed plasmapheresis centers in the United States and tested for various pathogens including the HIV virus. The first manufacturing step of most commercial immunoglobulin G preparations involves a modified cold ethanol fractionation according to Cohn to produce Cohn fraction II. In the fractionation process, many infectious viruses are eliminated from the pooled human plasma. Following fractionation, the Cohn fraction II is subjected to adsorption onto an ion exchange medium. This step may selectively reduce the IgA concentration to less than 0.1%. Such a step is important for producing immunoglobulin G for intravenous infusion into humans. This is because some individuals undergo an anaphylactic-like reaction if treated with intravenous IgG that contains IgA as an impurity.
The modified cold ethanol fractionation process according to Cohn is a series of fractionations using various levels of ethanol, pH, and temperature to produce a fraction II which is further treated to produce immunoglobulins as described above. In the fractionation process, pooled human plasma is first treated to produce a cryoprecipitate and cryo-supernatant. Alternatively, it is appreciated that the source plasma may be autologous plasma or hyperimmune human plasma, either pooled, or from a single individual who has been immunized against a specific disease.
In another embodiment, the IgA component is be prepared by hybridoma techniques to provide antigen-specific IgA. Hybridoma techniques are described originally in Kohler and Milstein, Nature 1975; 256:495-497 with more recent advances summarized in Berzofsky et al., Fundamental Immunology, Third Edition, 1993, pp 455-62.
Regardless of the source, the cryo-supernatant is subjected to a first ethanol fractionation to yield a supernatant I. Supernatant I is subjected to a second ethanol fractionation to yield fraction II+III. Fraction II+III is subjected to a third ethanol fractionation procedure to yield a supernatant III and Fraction III precipitate.
The fraction III precipitate enriched in IgA is generally discarded as an unwanted byproduct. According to the present invention, this unwanted IgA following ion exchange adsorption purification is further treated by incubation with immobilized hydrolases to inactivate viruses and vasoactive substances. Such treatment has been proven to eliminate many viruses tested including HIV, Sindbis, and vaccinia. Other antiviral treatments, as known to those skilled in the art, are used in combination and consist of solvent detergent processes, nanofiltration and/or heat inactivation. Usually three antiviral steps are implemented. Following incubation to remove viruses, the concentration of the active material is adjusted with sterile saline or buffered solutions to ensure a constant amount of active material per milliliter of reconstituted product. Finally, the solution with a constant amount of reconstituted product is sterilized by filtration before use.
The ethanol fractionation process according to Cohn is well known in the art and is described in Cohn et al., J. Am. Chem. Soc. 1946; 68:459-475, Oncley et al., J. Am. Chem. Soc. 1949; 71:541-550, and in most detail in pages 576-602, Kirk-Othmer Encyclopedia of Chemical Technology, Vol. 3, second edition (1963). Alternatively, ion exchange chromatography may be used to obtain the dimeric and polymeric IgA byproduct during the manufacture of intravenous immunoglobulin. From 4% to 22% of plasma IgA is dimeric and polymeric IgA (Delacroix et al. 1981; Delacroix et al. 1983). The resulting dimeric IgA-J chains are purified to form a medicament.
The dimeric and polymeric IgA present in the plasma IgA monomer-polymer mixture is further coupled to secretory component that is recombinantly produced to include a histidine tag or another of the aforementioned tags; or subsequently covalently bonded to a peptide tag such as histidine or poly-histine oligopeptide. In certain inventive embodiments, the coupling of IgA to secretory component is accomplished by forming disulfide bonds under mildly oxidizing conditions. (Jones R. M. L., Schweikart F., Frutiger S., Jaton J-C., Hughes G. J. Thiol-disulfide redox buffers maintain a structure of immunoglobulin A that is essential for optimal in vitro binding to secretory component. Biochimica et Biophysica Acta 1998; 1429:265-274.) Dimeric and polymeric IgA containing both J chain and secretory component is purified from the mixture by immobilized metal ion affinity chromatography, as performed by those of skill in the art of protein purification.
It has been previously found that it is possible to separate recombinant proteins from cell supernates by producing such proteins with histidine tails or other of the aforementioned tags and then passing the cell supernates through nickel bound solid support resins. The histidine or other tag adheres to the nickel or other suitable tag specific binding moiety and is retained while the unwanted proteins are washed through. The tagged secretory immunoglobulin protein is then recovered by eluting it with an imidazole buffer in the case of an amide-metal bond between target protein and resin (Block H et al 2009).
The mixture of histidine tagged secretory IgA and residual monomeric IgA is buffer exchanged into a binding buffer containing low concentrations of imidazole (≤40 mM). Another release agent operative to exchange histidine tagged secretory IgA or secretory IgM illustratively includes 1) ethylene diamine tetraacetic acid (EDTA) at 10 mM and 2) an elution buffer of pH 5.5 or lower. Typical binding buffer imidazole concentrations range from 0.1 to 100 millimolar (mM). It is appreciated that the initial binding buffer pH is somewhat variable and readily discerned for a given chemical structure of buffer and concentration through routine experimentation. The chromatography medium operative herein is selected to be stable in the presence of the binding buffer and able to separate histidine tagged secretory IgA. Suitable media illustratively include Exemplary of these media are nickel, cobalt and zinc immobilized on sepharose. In a preferred embodiment, the affinity medium is washed in a wash buffer containing from 0 to 100 mM imidazole to remove unbound monomeric IgA. The bound histidine tagged secretory IgA is recovered using an elution buffer of a higher imidazole concentration (e.g. 100 to 1000 mM). With succesive elutions separation of monomeric from histidine tagged secretory component bound dimeric IgA is exacted. It is appreciated thate the inventive process is amenable to scaling to produce quantities sufficient to treat numerous subjects. It is appreciated that similar selective binding pairs is achieved between other inventive tagged secretory component containing immunoglobulin proteins and resins are convetional to the art for each of the aforementioned tags.
By way of a specific example, the binding and wash buffers are 50 mM NaH2PO4 300 mM NaCl and 20 mM imidazole, is adjusted to pH 8. The mixture of IgA monomer and secretory IgA is dissolved in that buffer. The elution buffer is identical to the binding buffer with the exception that the imidazole is at a higher concentration, e.g 100 to 1000 mM.
The remaining histidine tagged secretory IgA is then eluted from the divalent immobilized metal resin with the elution buffer according to conventional techniques and conditions that include an exemplary basic pH of for example 8 to 10, see FIGS. 1 and 2.
Purified secretory IgA containing histidine tagged secretory component is stabilized in some embodiments for example by the addition of human serum albumin to a final concentration of 5% total weight albumen.
In another embodiment, the tag is removed from the recovered secretroy IgA and native secretory IgA is available for usage as a medicament. For a histidine tagged secretory IgA a procedure for tag removal is known to the art (Kopera E et al 2012).
In summary, the inventive process is the addition of tagged secretory component in either recombinatant or post expression tagging to a mixture of plasma derived IgA monomers and dimers, in which the tagged secretory component combines with the IgA dimer forming secretory IgA and allows recovery of the newly formed secretory IgA by adhesion to immobilized divalent metal ions or other solid phase moeity, and subsequent elution therefrom.
Plasma IgM can be recovered from the byproducts of the production of intravenous immunoglobulin. An example of such a byproduct is Cohn fraction III preciptate. The IgM is most easily solublized from Cohn fraction III preciptate by 20 mM socium acetate. Other plasma proteins are similarly solublized along with the IgM. The plasma IgM in this protein mixture is covalently bound to recombinant histidine tagged secretory component in vitro forming secretory IgM within the protein mixture. The secretory IgM is now tagged by virtue of the divalent bonding of the tagged secretory component to the IgM. The novel method of obtaining purified secretory IgM that is thus formed is to remove the secretory IgM that is now tagged by affinity binding of the tag to a immobilized nickel+2 or other divalent metal ion or other suitable binding moiety conventional to the art that is part of a resin column. The resultant semisynthetic secretory IgM has utility, for example, as a treatment of Clostridium difficile associated diseases such as Clostridium difficile colitis, pseudomembranous colitis and antibiotic associated diarrhea and in particular to secretory immunoglobulin M compositions administered in the form of pharmaceutical compositions.
In another embodiment, the tag is removed from the recovered secretory IgM and native secretory IgM is available for usage as a medicament. For a histidine tagged secretoty IgM a procedure for tag removal is known to the art (Kopera E et al 2012).
Thus, an inventive process provides the addition of peptide tagged secretory component to a mixture of plasma derived IgM and other plasma proteins, in which the peptide tagged secretory component combines with the IgM forming secretory IgM and allows recovery of the newly formed secretory IgM by adhesion to moieties on the solid phase support resin to which the peptide binds, and subsequent elution therefrom using an elution buffer.
REFERENCES
  • Aoyama K, Chiba J. Separation of different molecular forms of mouse IgA and IgM monoclonal antibodies by high-performance liquid chromatography on spherical hydroxyapatite beads. J Immunol Methods. 1993; 162(2):201-10.
  • Bacon A. E. 3rd, Fekety R. Immunoglobulin G directed against toxins A and B of Clostridium difficile in the general population and patients with antibiotic-associated diarrhea. Diagn. Microbiol. Infect. Dis. 1994; 18:205-209.
  • Barroso L. A., Wang S. Z., Phelps C. J., Johnson J. L., Wilkins T. D. Nucleotide sequence of Clostridium difficile toxin B gene. Nucleic Acids Res. 1990; 18:4004.
  • Berzofsky J. A., Berkower I. J., Epstein S. L., Monoclonal Antibodies in Chapter 12, Antigen-Antibody Interactions and Monoclonal Antibodies, pp. 455-465 in Fundamental Immunology, Third Edition, W. E. Paul (ed), Raven Press, NY 1993. Berzofsky et al., Fundamental Immunology, Third Edition, 1993, pp 455-462.
  • Block H, Maertens B, Spriestersbach A, Brinker N, Kubicek J, Fabis R, Labahn J, Schafer F. Immobilized-Metal Affinity Chromatography (IMAC): A Review. CHAPTER 27 in Methods in Enzymology, Volume 463, 2009.
  • Boesman-Finkelstein M., Walton N. E., Finkelstein R. A. Bovine lactogenic immunity against cholera toxin-related enterotoxins and Vibrio cholerae outer membranes. Infect. Immun. 1989; 57:1227-1234.
  • Brussow H., Hilpert H., Walther I., Sidoti J., Mietens C., Bachmann P. Bovine milk immunoglobulins for passive immunity to infantile rotavirus gastroenteritis. J. Clin. Microbiol. 1987; 25:982-986.
  • Cohn E. J., Strong L. E., Hughes W. L., Jr., Mulford D. J., Ashworth J. N., Melin M., Taylor H. L., Preparation and Properties of Serum and Plasma Proteins IV. A System for the Separation into Fractions of the Protein and Lipoprotein Components of Biological Tissues and Fluids, J. Am. Chem. Soc. 1946; 68; 459-475.
  • Cone L. A., Lopez C., Tarleton H. L., Jodoin D., Taylor M., Gade-Andavolu R., Dreisbach L. P. A durable response to relapsing Clostridium difficile colitis may require combined therapy with high-dose oral vancomycin and intravenous immune globulin. Infect. Dis. Clin. Pract. 2006; 14:217-220.
  • Corthesy B., Recombinant Secretory IgA for Immune Intervention Against Mucosal Pathogens, Biochem. Soc. Trans. 1997, 25; 471-475.
  • Corthier et al., Emergence in Gnotobiotic Mice of Nontoxinogenic Clones of clostridium difficile from a Toxinogenic One, Infection and Immunity, June 1988, pp. 1500-1504.
  • Corthier et al., Protection Against Experimental Pseudomembranous Colitis in Gnotobiotic Mice by Use of Monoclonal Antibodies Against clostridium difficile Toxin A, Infection and Immunity, March 1991, pp. 1192-1195.
  • Crottet P., Cottet S., Corthesy B., Expression, Purification and Biochemical Characterization of Recombinant Murine Secretory Component, A Novel Tool in Mucosal Immunology, Biochem. J. 1999, 341; 299-306.
  • Delacroix D. L., Hodgson H. J., McPherson A., Dive C., Vaerman J. P. Selective transport of polymeric immunoglobulin A in bile. Quantitative relationships of monomeric and polymeric immunoglobulin A, immunoglobulin M, and other proteins in serum, bile, and saliva. J. Clin. Invest. 1982 August; 70(2):230-41
  • Delacroix D. L., Elkom K. B., Geubel A. P., Hodgson H. F., Dive C., Vaerman J. P. Changes in size, subclass, and metabolic properties of serum immunoglobulin A in liver diseases and in other diseases with high serum immunoglobulin A. J. Clin. Invest. 1983 February; 71(2):358-67.
  • Dove C. H., Wang S. Z., Price S. B., Phelps C. J., Lyerly D. M., Wilkins T. D. and Johnson J. L.; Lyerly et al. Molecular characterization of the Clostridium difficile toxin A gene. Infect. Immun. 1990; 58:480-488.
  • Ehrich et al., Production of clostridium difficile Antitoxin, Infection and Immunity, June 1980, pp. 1041-1043.
  • Fayer R., Guidry A., Blagburn B. L. Immunotherapeutic efficacy of bovine colostral immunoglobulins from a hyperimmunized cow against cryptosporidiosis in neonatal mice. Infect. Immun., 1990; 58:2962-2965.
  • Gerding et al., clostridium difficile-Associated Diarrhea, Archives of Internal Medicine, vol. 146, Jan. 1986, pp. 95-100.
  • Hermanson G T. Bioconjugate Techniques. Academic Press, San Diego 1996.
  • Hilpert H., Brussow H., Mietens C., Sidoti J., Lerner L., Werchau H. Use of bovine milk concentrate containing antibody to rotavirus to treat rotavirus gastroenteritis in infants. J. Infect. Dis. 1987; 156:158-166.
  • Johnson S. et al. Infect. Immun. 1995; 63:3166-3173.
  • Jones R. M. L., Schweikart F., Frutiger S., Jaton J-C., Hughes G. J. Thiol-disulfide redox buffers maintain a structure of immunoglobulin A that is essential for optimal in vitro binding to secretory component. Biochimica et Biophysica Acta 1998; 1429:265-274.
  • Kelly et al., clostridium difficile Colitis, New England Journal of Medicine, vol. 330, January 1994, pp. 257-262.
  • Kelly et al., Human Colonic Aspirates Containing Immunoglobulin A Antibody to clostridium difficile Toxin A Inhibit Toxin A—Receptor Binding, Gastroenterology, vol. 102, No. 1, pp. 35-40.
  • Kohler G., Milstein C., Continuous Cultures of Fused Cells Secreting Antibody of Predetermined Specificity, Nature 1975; 256; 495-497.
  • Kopera E, Belczyk-Ciesielska A, Bal W. Application of Ni(II)-assisted peptide bond hydrolysis to non-enzymatic affinity tag removal. PLoS One. 2012; 7(5):e36350. doi: 10.1371/journal.pone.0036350. Epub 2012 May 4.
  • Leung D. Y., Kelly C. P., Boguniewicz M., Pothoulakis C., LaMont J. T., Flores A. Treatment with intravenously administered gamma globulin of chronic relapsing colitis induced by Clostridium difficile toxin. J. Pediatr. 1991 April; 118(4 (Pt 1)):633-637.
  • Libby J. M., Jortner B. S., Wilkins T. D. Effects of the two toxins of Clostridium difficile in antibiotic-associated cecitis in hamsters. Infect. Immun. 1982 May; 36(2):822-829.
  • Lima et al., Effects of clostridium difficile Toxins A and B in Rabbit Small and Large Intestine In Vivo and on Cultured Cells In Vitro, Infection and Immunity, March 1988, pp. 582-588.
  • Longet S, Miled S, Lotscher M, Miescher S M, Zuercher A W, Corthésy B. Human plasma-derived polymeric IgA and IgM antibodies associate with secretory component to yield biologically active secretory-like antibodies. J Biol Chem. 2013 Feb. 8; 288:4085-94.
  • Louie T. J., Peppe J., Watt C. K., Johnson D., Mohammed R., Dow G., Weiss K., Simon S., John J. F. Jr., Garber G., Chasan-Taber S., Davidson D. M.; Tolevamer Study Investigator Group. Tolevamer, a novel nonantibiotic polymer, compared with vancomycin in the treatment of mild to moderately severe Clostridium difficile-associated diarrhea. Clin. Infect. Dis. 2006; 43:411-20.
  • Luellau, E., von Stockar, U., Vogt, S., Freitag, R. Development of a downstream process for the isolation and separation of monoclonal immunoglobulin A monomers, dimers and polymers from cell culture supernatant, Journal of Chromatography A, 1998, 796:165-175.
  • Lullau E., Heyse S., Vogel H., Marison I., von Stockar U., Kraehanbuhl J-P., Corthesy B., Antigen Binding Properties of Purified Immunoglulin A Antibodies, J. Biol. Chem. 1996; 271:16300-16309.
  • Lyerly D. M., Krivan H. C., Wilkins T. D. Clostridium difficile: its disease and toxins. Clin. Microbiol. Rev. 1988; 1:1-18.
  • Lyerly D. M., Phelps C. J., Toth J., Wilkins T. D. Characterization of toxins A and B of Clostridium difficile with monoclonal antibodies. Infect. Immun. 1986; 54:70-76.
  • Lyerly D. M., Bostwick E. F., Binion S. B., Wilkins T. D. Passive immunization of hamsters against disease caused by Clostridium difficile by use of bovine immunoglobulin G concentrate. Infect. Immun. 1991; 59:2215-2218.
  • Lyerly D. M., Lockwood D. E., Richardson S. H., Wilkins T. D. Biological activities of toxins A and B of Clostridium difficile. Infect. Immun. 1982; 35:1147-1150.
  • Lyerly D. M., Saum K. E., MacDonald D. K., Wilkins T. D. Effects of Clostridium difficile toxins given intragastrically to animals. Infect. Immun. 1985; 47:349-352.
  • Mahe et al., Effect of Various Diets on Toxin Production by Two Strains of clostridium difficile in Gnotobiotic Mice, Infection and Immunity, August 1987, pp. 1801-1805.
  • Martinez et al., Purification and Characterization of clostridium sordellii Hemorrhagic Toxin and Cross-Reactivity with clostridium difficile Toxin A (Enterotoxin), Infection and Immunity, May 1988, pp. 12-15-1221.
  • McFarland et al., Nosocomial Acquisition of clostridium difficile Infection, The New England Journal of Medicine, January 1989, pp. 204-210.
  • McFarland et al., Review of clostridium difficile Associated Diseases, American Journal of Infection Control, vol. 14, No. 3, June 1986, pp. 99-104.
  • McPherson S., Rees C. J., Ellis R., Soo S. and Panter S. J. Intravenous Immunoglobulin for the Treatment of Severe, Refractory, and Recurrent Clostridium difficile Diarrhea. Diseases of the Colon & Rectum. 2006; 49(5):640-645.
  • Med. Letter Drugs Ther. 2006; 48:89-90,92.
  • Mietens C., Keinhorst H., Hilpert H., Gerber H., Amster H., Pahud J. J. Treatment of infantile E. coli gastroenteritis with specific bovine anti-E. coli milk immunoglobulins. Eur. J. Pediatr. 1979; 132:239-252.
  • Mitchell et al., Effect of Toxin A and B of clostridium difficile on Rabbit Ileum and Colon, Gut, 1986, vol. 27, pp. 78-85.
  • Morris et al., Role of Surgery in Antibiotic-Induced Pseudomembranous Enterocolitis, The American Journal of Surgery, vol. 160, November 1990, pp. 535-539.
  • Oncley J. L., Melin M., Richert D. A., Cameron J. W., Gross P. M., Jr., The Separation of the Antibodies, Isoagglutinins, Prothrombin, Plasminogen and β1-Lipoprotein into Subfractions of Human Plasma. J. Am. Chem. Soc. 1949; 71:541-550.
  • Pothoulakis C., LaMont J. T., Eglow R., Gao N., Rubins J. B., Theoharides T. C., Dickey B. F. Characterization of rabbit ileal receptors for Clostridium difficile toxin A. Evidence for a receptor-coupled G protein. J. Clin. Invest. 1991; 88:119-25.
  • Rothman et al., Differential Cytotoxic Effects of Toxins A and B Isolated from clostridium difficile, Infection and Immunity, November 1984, pp. 324-331.
  • Salcedo J. et. al. Gut 1997; 41:366-370.
  • Strong L. E., Blood Fractionation, pp. 576-602 in vol. 3, Kirk-Othmer Encyclopedia of Chemical Technology. Second Edition, H. F. Mark, J. J. McKetta, D. F. Othmer (eds), Interscience Publishers, NY 1963, pp. 576-602.
  • Stubbe H. et al. J. Immunol. 2000; 164:1952-1960.
  • Symersky J., Novak J., McPherson D. T., DeLucas L., Mestecky J. Expression of the recombinant human immunoglobulin J chain in Escherichia coli. Mol. Immunol. 2000; 37:133-140.
  • Tacket C. O., Losonsky G., Link H., Hoang Y., Guesry P., Hilpert H., Levine M. M. Protection by milk immunoglobulin concentrate against oral challenge with enterotoxigenic Escherichia coli. N. Engl. J. Med. 1988; 318:1240-3.
  • Tjellstrom B., Stenhammar L., Eriksson S., Magnusson K. E. Oral immunoglobulin A supplement in treatment of Clostridium difficile enteritis. Lancet 1993; 341(8846):701-702.
  • Triadafilopoulos et al., Differential Effects of clostridium difficile Toxins A and B on Rabbit Ileum, Gastroenterology, 1987, vol. 93, pp. 273-279.
  • Tucker et al., Toxin A of clostridium difficile Is a Potent Cytotoxin, Journal of
  • Clinical Microbiology, May 1990, pp. 869-871.
  • Weltzin R., Traina-Dorge V., Soike K., Zhang J. Y., Mack P., Soman G., Drabik G., Monath T. P., Intranasal Monoclonal IgA Antibody against Respiratory Syncytial Virus Protects Rhesus Monkeys against Upper and Lower Respiratory Tract Infection. J. Infect. Dis. 1996; 174:256-261.
  • Weltzin R., Hsu S. A., Mittler E. S., Georgakopoulas K., Monath T. P., Intranasal Monoclonal Immunoglobulin A against Respiratory Synctial Virus Protects against Upper and Lower Respiratory Tract Infections in Mice. Antimicrob. Agents Chemother. 1994; 38:2785-2791.
  • Wilcox M. H. J. Antimicrob. Chemoth. 2004; 53:882-884.
  • Yoshiyama Y., Brown W. R. Specific antibodies to cholera toxin in rabbit milk are protective against Vibrio cholerae-induced intestinal secretion. Immunology. 1987; 61:543-547.
Patent applications and publications mentioned in the specification are indicative of the levels of those skilled in the art to which the invention pertains. These applications and publications are incorporated herein by reference to the same extent as if each individual application or publication was specifically and individually incorporated herein by reference.
The foregoing description is illustrative of particular embodiments of the invention, but is not meant to be a limitation upon the practice thereof. The following claims, including all equivalents thereof, are intended to define the scope of the invention.

Claims (18)

The invention claimed is:
1. A process for synthesizing a secretory IgM therapeutic by separating a pentameric IgM including J chain and mixed with other proteins in a protein mixture comprising:
adding secretory component in solution that is tagged with an affinity or epitope tag selected from the group consisting of polyhistidine, AviTag, calmodulin-tag, FLAG-tag, hemaglutinin-tag, Myc-tag, S-tag, SBP-tag, Softag 1, Softag 3, V5 tag, Xpress tag, biotin carboxyl carrier protein, glutathione-S-transferase-tag, green fluorescent protein-tag, maltose binding protein-tag, Nus-tag; Strep-tag, thioredoxin-tag; TC tag, and Ty tag; to the protein mixture, the protein mixture containing the pentameric IgM including the J chain, facilitating the covalent binding of the affinity or epitope tagged secretory component to the pentameric IgM to produce the secretory IgM therapeutic;
exposing the protein mixture to a binding moiety immobilized on a solid phase resin under conditions that the secretory IgM therapeutic binds to the solid phase resin by interaction between the affinity or epitope tagged secretory component and the binding moiety;
washing the unbound protein mixture less the secretory IgM therapeutic from the solid phase support; and
then eluting the secretory IgM therapeutic with a release buffer from the solid phase support by the release buffer interfering with the interaction between the affinity or epitope tagged secretory component and the binding moiety.
2. The process of claim 1 wherein the secretory component is human.
3. The process of claim 1 wherein the affinity or epitope tag is removed from secretory IgM after the eluting step.
4. The process of claim 1 wherein the moiety on the solid phase support resin to which the affinity or epitope tag binds is a divalent cation.
5. The process of claim 1 wherein the secretory component is recombinant.
6. The process of claim 1 wherein the affinity or epitope tag is a polyhistidine.
7. The process of claim 1 wherein IgA has been removed from the plasma protein mixture before the epitope or affinity tagged secretory component is added.
8. The process of claim 1 further comprising stabilizing the secretory IgM therapeutic by adding human serum albumin.
9. A process for synthesizing a secretory IgM therapeutic by separating pentameric IgM including J chain and mixed with other proteins comprising:
adding secretory component in solution that is tagged with an affinity or epitope tag selected from the group consisting of polyhistidine, AviTag, calmodulin-tag, FLAG-tag, hemaglutinin-tag, Myc-tag, S-tag, SBP-tag, Softag 1, Softag 3, V5 tag, Xpress tag, biotin carboxyl carrier protein, glutathione-S-transferase-tag, green fluorescent protein-tag, maltose binding protein-tag, Nus-tag; Strep-tag, thioredoxin-tag; TC tag, and Ty tag; to the protein mixture, the protein mixture obtained from human plasma containing the pentameric IgM including the J chain, facilitating the covalent binding of the affinity or epitope tagged secretory component to the pentameric IgM containing the J chain to produce the secretory IgM therapeutic;
exposing the protein mixture to a binding moiety immobilized on a solid phase resin under conditions that the secretory IgM therapeutic binds to the solid phase resin by interaction between the affinity or epitope tagged secretory component and a binding moiety;
washing the unbound protein mixture less the secretory IgM therapeutic from the solid phase support; and
then eluting the secretory IgM therapeutic with a release buffer from the solid phase support by the release buffer interfering with the interaction between the affinity or epitope tagged secretory component and the binding moiety.
10. An improved process for synthesizing a secretory IgM therapeutic from a protein mixture of plasma proteins containing plasma derived IgM containing J chain, by adding secretory component that is tagged with an affinity or epitope tag to the protein mixture forming the secretory IgM therapeutic in the protein mixture wherein the improvement comprises: recovering the secretory IgM therapeutic from the protein mixture by adhesion to moieties on a solid phase support resin to which the affinity or epitope tag binds, and subsequent eluting the secretory IgM therapeutic using an elution buffer.
11. The improved process of claim 10 wherein the secretory component is human.
12. The improved process of claim 10 wherein the protein mixture is obtained from human plasma.
13. The improved process of claim 10 wherein the affinity or epitope tag is removed from the secretory IgM therapeutic prior to administration to a patient.
14. The improved process of claim 10 wherein the moieties on the solid phase support resin to which the affinity or epitope tag binds is a divalent cation.
15. The improved process of claim 10 further comprising washing unbound plasma proteins including unbound immunoglobulins lacking the J chain through the resin prior to the eluting the secretory IgM therapeutic.
16. The improved process of claim 10 wherein the secretory component is recombinant.
17. The improved process of claim 10 wherein the affinity or epitope is histidine or polyhistidine and is coupled to the secretory component in vitro.
18. The improved process of claim 10 wherein the plasma derived IgM containing J chain is pentameric IgM.
US14/476,559 2012-03-09 2014-09-03 Process for preparation of secretory IgA and secretory IgM Active 2034-04-24 US10385117B2 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US14/476,559 US10385117B2 (en) 2012-03-09 2014-09-03 Process for preparation of secretory IgA and secretory IgM
US16/401,322 US11623948B2 (en) 2012-03-09 2019-05-02 Process for preparation of secretory IgA and secretory IgM

Applications Claiming Priority (9)

Application Number Priority Date Filing Date Title
EP12158931.1 2012-03-09
EP20120158931 EP2636682A1 (en) 2012-03-09 2012-03-09 Compositions comprising secretory-like immunoglobulins
EP12158931 2012-03-09
EP12168343.7 2012-05-16
EP12168343 2012-05-16
EP12168343 2012-05-16
PCT/EP2013/054697 WO2013132052A1 (en) 2012-03-09 2013-03-08 Compositions comprising secretory - like immunoglobulins
US201313935417A 2013-07-03 2013-07-03
US14/476,559 US10385117B2 (en) 2012-03-09 2014-09-03 Process for preparation of secretory IgA and secretory IgM

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US201313935417A Continuation 2012-03-09 2013-07-03

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/401,322 Division US11623948B2 (en) 2012-03-09 2019-05-02 Process for preparation of secretory IgA and secretory IgM

Publications (3)

Publication Number Publication Date
US20140371431A1 US20140371431A1 (en) 2014-12-18
US20170058018A2 US20170058018A2 (en) 2017-03-02
US10385117B2 true US10385117B2 (en) 2019-08-20

Family

ID=47846003

Family Applications (3)

Application Number Title Priority Date Filing Date
US14/380,521 Active 2034-10-03 US10221233B2 (en) 2012-03-09 2013-03-08 Compositions comprising secretory-like immunoglobulins
US14/476,559 Active 2034-04-24 US10385117B2 (en) 2012-03-09 2014-09-03 Process for preparation of secretory IgA and secretory IgM
US16/401,322 Active 2036-04-12 US11623948B2 (en) 2012-03-09 2019-05-02 Process for preparation of secretory IgA and secretory IgM

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US14/380,521 Active 2034-10-03 US10221233B2 (en) 2012-03-09 2013-03-08 Compositions comprising secretory-like immunoglobulins

Family Applications After (1)

Application Number Title Priority Date Filing Date
US16/401,322 Active 2036-04-12 US11623948B2 (en) 2012-03-09 2019-05-02 Process for preparation of secretory IgA and secretory IgM

Country Status (17)

Country Link
US (3) US10221233B2 (en)
EP (1) EP2822967B1 (en)
JP (3) JP2015510875A (en)
KR (1) KR102142261B1 (en)
CN (2) CN104254542A (en)
AU (1) AU2013201393B2 (en)
BR (1) BR112014022240A2 (en)
CA (1) CA2866634C (en)
DK (1) DK2822967T3 (en)
ES (1) ES2751976T3 (en)
IL (1) IL234449B (en)
MX (1) MX360245B (en)
NZ (1) NZ629072A (en)
PL (1) PL2822967T3 (en)
RU (1) RU2644240C2 (en)
SG (1) SG11201404958SA (en)
WO (1) WO2013132052A1 (en)

Families Citing this family (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2636684A1 (en) * 2012-03-09 2013-09-11 CSL Behring AG Prevention of infection
EP2636681A1 (en) 2012-03-09 2013-09-11 CSL Behring AG Process for enriching IgA
MX360245B (en) * 2012-03-09 2018-10-26 Csl Behring Ag Compositions comprising secretory - like immunoglobulins.
US9458230B2 (en) 2013-01-04 2016-10-04 Wisconsin Alumni Research Foundation Secretory IGA compositions, methods of making and methods of use thereof
US9468674B2 (en) * 2013-09-24 2016-10-18 Wisconsin Alumni Research Foundation Methods of use of secretory IgA
RU2729546C2 (en) 2014-04-03 2020-08-07 Цсл Беринг Аг Immunoglobulin spraying
RU2599029C1 (en) * 2015-07-16 2016-10-10 Игорь Геннадьевич Ковшик Chimeric immunoglobulin preparation with specific antiviral or antibacterial effect
PL3429622T3 (en) 2016-03-14 2021-11-02 Biotest Ag Treatment of severe community acquired pneumonia
EP3558362A1 (en) 2016-12-20 2019-10-30 CSL Behring AG Methods for affecting salmonella infections
BR112020005742A2 (en) 2017-09-21 2020-10-13 Umc Utrecht Holding B.V. anti-gd2 antibody for the treatment of neuroblastoma
CN110724176B (en) * 2018-07-16 2021-10-26 北京豪思生物科技有限公司 Plasma protein isolate for treating Alzheimer's disease and preparation method and application thereof
EP3886902A1 (en) 2018-11-30 2021-10-06 CSL Behring AG Methods and compositions for preventing or treating acute exacerbations with polyclonal immunoglobulin
CN114096559B (en) 2019-03-27 2026-03-20 蒂嘉特克斯公司 Engineered IGA antibodies and their usage
US12612467B2 (en) * 2022-09-21 2026-04-28 Michael R. Simon Treatment of necrotizing enterocolitis with semisynthetic polyclonal human secretory immunoglobin A
WO2024151506A1 (en) * 2023-01-13 2024-07-18 Simon Michael R Process for preparation of secretory iga and secretory igm and use thereof for treating necrotizing enterocolitis

Citations (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4703004A (en) 1984-01-24 1987-10-27 Immunex Corporation Synthesis of protein with an identification peptide
JPH03204822A (en) 1989-08-17 1991-09-06 Biotest Pharma Gmbh Immunoglobulin containing nondenatured igm and/or iga capable of being injected intravenously and preparation thereof
EP0839915A1 (en) 1996-11-01 1998-05-06 Institut Suisse De Recherches Experimentales Sur Le Cancer Isrec Secretory immunoglobulin A as a mucosal vaccine delivery system
US5773000A (en) 1994-09-06 1998-06-30 Galagen Inc. Therapeutic treatment of clostridium difficile associated diseases
WO1998057993A1 (en) 1997-06-19 1998-12-23 The Regents Of The University Of California Secretory immunoglobulin produced by single cells and methods for making and using same
US20020110555A1 (en) 1999-11-01 2002-08-15 Muco Vax B.V. Antibody production in farm animals
WO2002076502A1 (en) 2001-03-22 2002-10-03 Simon Michael R Human medical treatment by application of immunoglobulin a
JP2005500265A (en) 2001-05-11 2005-01-06 ラボラトワール、フランセ、デュ、フラクショヌマン、エ、デ、ビオテクノロジ Method for preparing human immunoglobulin concentrates for therapeutic use
JP2005501102A (en) 2001-08-09 2005-01-13 ボ アーサー エイナー テジェルストロム、 Oral immunoglobulin treatment of inflammatory bowel disease
US7597891B2 (en) 2006-12-13 2009-10-06 Simon Michael R Synthesis of human secretory IgA for the treatment of Clostridium difficile associated diseases
US7794721B2 (en) 2006-12-13 2010-09-14 Simon Michael R Synthesis of human secretory IgM and the treatment of clostridium difficile associated diseases herewith
JP2011523410A (en) 2008-05-15 2011-08-11 ダブリュ.・ヘルス・エル.ピー. Method for producing milk fraction rich in secretory immunoglobulin
US8021645B2 (en) 2006-12-13 2011-09-20 Simon Michael R Synthesis of human secretory IgA and IgM and the formation of a medicament therefrom
WO2011131786A2 (en) 2010-04-22 2011-10-27 Biotest Ag Process for preparing an immunoglobulin composition
EP2636692A1 (en) 2010-11-02 2013-09-11 Mie University Curable urethane composition, cured product thereof, kit and curred product production method
WO2013132052A1 (en) * 2012-03-09 2013-09-12 Csl Behring Ag Compositions comprising secretory - like immunoglobulins

Family Cites Families (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SU745523A1 (en) * 1978-06-15 1980-07-05 Всесоюзный научно-исследовательский институт гриппа Method of prophilaxis and treatment of virus-etiology critical respiratory deseases
US5500345A (en) 1989-04-25 1996-03-19 Iatron Laboratories, Inc. Hybridomas producing monoclonal antibodies specific for C-reactive protein and methods for detection of C-reactive protein
US5258177A (en) 1991-12-10 1993-11-02 Alpha Therapeutic Corporation IgA preparation and process of making the same
FR2706466B1 (en) 1993-06-14 1995-08-25 Aetsrn Immunoglobulin G concentrate for therapeutic use and process for producing said concentrate.
WO1995004081A1 (en) 1993-07-30 1995-02-09 Oravax, Inc. MONOCLONAL IgA ANTIBODY AGAINST RESPIRATORY SYNCYTIAL VIRUS
DE19600939C1 (en) 1996-01-12 1997-08-28 Immuno Ag Procedure for the separation of IgG and IgA
US5886154A (en) 1997-06-20 1999-03-23 Lebing; Wytold R. Chromatographic method for high yield purification and viral inactivation of antibodies
IL140155A (en) 1998-06-09 2005-12-18 Statens Seruminstitut Process for producing immunoglobulins for intravenous administration and other immunoglobulin products
JP2000103800A (en) 1998-09-29 2000-04-11 Yoshitomi Pharmaceut Ind Ltd Method for purifying immunoglobulin A
AUPP806999A0 (en) 1999-01-08 1999-02-04 Csl Limited Process for purifying immunoglobulins
EP1068871A1 (en) 1999-07-07 2001-01-17 Jean-Paul Perraudin Novel methods and medicament for treating infections diseases involving microbial biofilms
ES2292493T3 (en) 1999-12-13 2008-03-16 Universidad Nacional Autonoma De Mexico IMMUNOENZYMATIC QUANTIFICATION METHOD.
US6696620B2 (en) 2000-05-02 2004-02-24 Epicyte Pharmaceutical, Inc. Immunoglobulin binding protein arrays in eukaryotic cells
NZ527977A (en) 2001-02-12 2005-10-28 Medarex Inc Human monoclonal antibodies to FC alpha receptor (CD89)
US20060165675A1 (en) 2002-08-02 2006-07-27 Richman-Eisenstat Janice Beth Modulation of mesenchymal cells via iga-receptors
WO2005047337A1 (en) 2003-11-13 2005-05-26 Hanmi Pharmaceutical Co., Ltd. A pharmaceutical composition comprising an immunoglobulin fc region as a carrier
US8709413B2 (en) 2006-12-13 2014-04-29 Michael R. Simon Treatment of celiac disease with IgA
US8119104B2 (en) 2006-12-13 2012-02-21 Michael R. Simon Treatment of celiac disease with IgA
US20080145420A1 (en) 2006-12-13 2008-06-19 Simon Michael R HUMAN SECRETORY IgA FOR THE TREATMENT OF CLOSTRIDIUM DIFFICILE ASSOCIATED DISEASES
US8313730B2 (en) 2006-12-13 2012-11-20 Michael R. Simon Treatment of celiac disease with IgA
EP2244735A4 (en) 2007-10-02 2011-02-23 Avaxia Biologics Inc Antibody therapy for use in the digestive tract
EP2465536A1 (en) 2010-12-14 2012-06-20 CSL Behring AG CD89 activation in therapy
BR112014004162A2 (en) 2011-08-22 2018-04-24 Cangene Corp antibodies to clostridium difficile
CN104136121B (en) 2012-02-14 2017-04-19 生物辐射实验室股份有限公司 Reducing pH Drift in Ion Exchange Chromatography
EP2636683A1 (en) 2012-03-09 2013-09-11 CSL Behring AG Treatment of mucositis with Immunoglobulin
EP2636684A1 (en) 2012-03-09 2013-09-11 CSL Behring AG Prevention of infection
EP2636681A1 (en) 2012-03-09 2013-09-11 CSL Behring AG Process for enriching IgA
WO2013158279A1 (en) 2012-04-20 2013-10-24 Abbvie Inc. Protein purification methods to reduce acidic species

Patent Citations (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4703004A (en) 1984-01-24 1987-10-27 Immunex Corporation Synthesis of protein with an identification peptide
JPH03204822A (en) 1989-08-17 1991-09-06 Biotest Pharma Gmbh Immunoglobulin containing nondenatured igm and/or iga capable of being injected intravenously and preparation thereof
US5773000A (en) 1994-09-06 1998-06-30 Galagen Inc. Therapeutic treatment of clostridium difficile associated diseases
EP0839915A1 (en) 1996-11-01 1998-05-06 Institut Suisse De Recherches Experimentales Sur Le Cancer Isrec Secretory immunoglobulin A as a mucosal vaccine delivery system
WO1998020141A1 (en) * 1996-11-01 1998-05-14 Btg International Ltd. Secretory immunoglobulin a as a mucosal vaccine delivery system
WO1998057993A1 (en) 1997-06-19 1998-12-23 The Regents Of The University Of California Secretory immunoglobulin produced by single cells and methods for making and using same
US20020110555A1 (en) 1999-11-01 2002-08-15 Muco Vax B.V. Antibody production in farm animals
WO2002076502A1 (en) 2001-03-22 2002-10-03 Simon Michael R Human medical treatment by application of immunoglobulin a
JP2005500265A (en) 2001-05-11 2005-01-06 ラボラトワール、フランセ、デュ、フラクショヌマン、エ、デ、ビオテクノロジ Method for preparing human immunoglobulin concentrates for therapeutic use
JP2005501102A (en) 2001-08-09 2005-01-13 ボ アーサー エイナー テジェルストロム、 Oral immunoglobulin treatment of inflammatory bowel disease
US7597891B2 (en) 2006-12-13 2009-10-06 Simon Michael R Synthesis of human secretory IgA for the treatment of Clostridium difficile associated diseases
US7794721B2 (en) 2006-12-13 2010-09-14 Simon Michael R Synthesis of human secretory IgM and the treatment of clostridium difficile associated diseases herewith
US8021645B2 (en) 2006-12-13 2011-09-20 Simon Michael R Synthesis of human secretory IgA and IgM and the formation of a medicament therefrom
JP2011523410A (en) 2008-05-15 2011-08-11 ダブリュ.・ヘルス・エル.ピー. Method for producing milk fraction rich in secretory immunoglobulin
WO2011131786A2 (en) 2010-04-22 2011-10-27 Biotest Ag Process for preparing an immunoglobulin composition
EP2636692A1 (en) 2010-11-02 2013-09-11 Mie University Curable urethane composition, cured product thereof, kit and curred product production method
WO2013132052A1 (en) * 2012-03-09 2013-09-12 Csl Behring Ag Compositions comprising secretory - like immunoglobulins
US20150056180A1 (en) * 2012-03-09 2015-02-26 Csl Behring Ag Compositions comprising secretory - like imunoglobulins

Non-Patent Citations (97)

* Cited by examiner, † Cited by third party
Title
"Treatment of Clostridium difficile-Associated Disease (CDAD)", The Medical Letter on Drugs and Therapeutics, Editor: Mark Abramowicz, M.D., Nov. 6, 2006, pp. 89-91, vol. 48, No. 1247, © 2006 The Medical Letter, Inc.
Aoyama, K. et al., "Separation of different molecular forms of mouse IgA and IgM monoclonal antibodies by high-performance liquid chromatography on spherical hydroxyapatite beads", Journal of Immunological Methods, 1993, pp. 201-210, vol. 162, © 1993 Elsevier Science Publishers B.V.
Arnau, J. et al., "Reprint of: Current strategies for the use of affinity tags and tag removal for the purification of recombinant proteins", Protein Expression and Purification, 2006 (Available online Dec. 28, 2005), pp. 1-13, vol. 18, Copyright © 2005 Elsevier Inc.; DOI: 10.1016/j.pep.2005.12.002.
Australian Patent Examination Report No. 2 dated Mar. 31, 2015 for Australian Application No. 2013201393 filed Mar. 8, 2013.
Bacon, III, A.E. et al., Immunoglobulin G Directed Against Toxins A and B of Clostridium difficile in the General Population and Patients with Antibiotic-Associated Diarrhea, Diagn. Microbiol. Infect. Dis., 1994, pp. 205-209, vol. 18, © 1994 Elsevier Science Inc.
Barroso, L.A. et al., "Nucleotide sequence of Clostridium difficile toxin B gene", Nucleic Acids Research, 1990, p. 4004, vol. 18, No. 13, © 1990 Oxford University Press.
Bauer, S. et al., "Proteinase 3 and CD177 are expressed on the plasma membrane of the same subset of neutrophils", Journal of Leukocyte Biology, Feb. 2007, pp. 458-464, vol. 81, © 2007 Society for Leukocyte Biology; DOI: 10.1189/jlb.0806514.
Berdoz, Jose et al., "In vitro comparison of the antigen-binding and stability properties of the various molecular forms of IgA antibodies assembled and produced in CHO cells", Proc. Natl. Acad. Sci., Mar. 1999, pp. 3029-3034, vol. 96, Issue 6; DOI: 10.1073/PNAS.96.6.3029; http://www.pnas.org/content/pnas/96/6/3029.full.pdf.
Block, H. et al., "Immobilized-Metal Affinity Chromatography (imac): a Review", Methods in Enzymology, Chapter 27, 2009, pp. 439-473, vol. 463, © 2009 Elsevier Inc.; DOI: 0.1016/S0076-6879(09)63027-5.
Boesman-Finkelstein, M. et al., "Bovine Lactogenic Immunity against Cholera Toxin-Related Enterotoxins and Vibrio cholerae Outer Membranes", Infection and Immunity, Apr. 1989, pp. 1227-1234, vol. 57, No. 4, Copyright © 1989, American Society for Microbiology.
Bonner, Alexandra et al., "Solution Structure of Human Secretory Component and Implications for Biological Function", The Journal of Biological Chemistry, Jun. 8, 2007, pp. 16969-16980, vol. 282, Issue 23, Copyright The American Society for Biochemistry and Molecular Biology, Inc. (2007); DOI: 10.1074/jbc.M701281200; http://www.jbc.org/content/282/23/16969.full.pdf.
Bonner, Alexandra et al., "Solution structure of recombinant human secretory component and its two- and three-domain fragments by scattering, ultracentrifugation and constrained modeling" (abstract), Molecular Immunology, Jan. 2007, p. 156, vol. 44, Issue 1; DOI:10.1016/j.molimm.2006.07.026.
Boullier S. et al., "Secretory IgA-Mediated Neutralization of Shigella flexneri Prevents Intestinal Tissue Destruction by Down-Regulating Inflammatory Circuits", The Journal of Immunology, 2009 (Prepublished online: Oct. 14, 2009), pp. 5879-5885, vol. 183, Copyright © 2009 by The American Association of Immunologists, Inc.; DOI: 10.4049/jimmunol.0901838.
Bouvet et al. "Secretory comonent-binding properties of normal serum IgM" Scand. J. Immunol. 31, 437-441, 1990. *
Brussow, H. et al., "Bovine Milk Immunoglobulins for Passive Immunity to Infantile Rotavirus Gastroenteritis", Journal of Clinical Microbiology, Jun. 1987, pp. 982-986, vol. 25, No. 6, Copyright © 1987, American Society for Microbiology.
Cohn, E.J. et al., "Preparation and Properties of Serum and Plasma Proteins. IV. A System for the Separation into Fractions of the Protein and Lipoprotein Components of Biological Tissues and Fluids", J. Am. Chem. Soc., Mar. 1946, pp. 459-475, vol. 68.
Cone, L.A. et al., "A Durable Response to Relapsing Clostridium difficile Colitis May Require Combined Therapy with High-dose Oral Vancomycin and Intravenous Immune Globulin", Infectious Diseases in Clinical Practice, Jul. 2006, pp. 217-220, vol. 14, No. 4, © 2006 Lippincott Williams & Wilkins.
Corthesy, B. et al., "Recombinant secretory IgA for immune intervention against mucosal pathogens", Biochemical Society Transactions, 1997, pp. 471-475, vol. 25.
Corthesy, Blaise and Phalipon, Armelle, "Molecular Definition of the Role of Secretory Component in Secretory IgA-Mediated Protection at Mucosal Surfaces" (abstract), Journal of Allergy and Clinical Immunology, Jan. 1, 2002, p. S113, vol. 109, Issue 1; DOI: 10.1016/S0091-6749(02)81452-X.
Corthesy, Blaise and Spertini, Francois, "Secretory Immunoglobulin A: from Mucosal Protection to Vaccine Development", Biological Chemistry, Nov. 1999, pp. 1251-1262, vol. 380, Issue 11, Copyright Walter de Gruyter-Berlin-NewYork (1999); DOI: https://doi.org/10.1515/BC.1999.160.
Corthesy, Blaise and Spertini, Francois, "Secretory Immunoglobulin A: from Mucosal Protection to Vaccine Development", Biological Chemistry, Nov. 1999, pp. 1251-1262, vol. 380, Issue 11, Copyright Walter de Gruyter—Berlin—NewYork (1999); DOI: https://doi.org/10.1515/BC.1999.160.
Corthesy, Blaise et al., "A Pathogen-specific Epitope Inserted into Recombinant Secretory Immunoglobulin A is Immunogenic by the Oral Route," The Journal of Biochemistry, Dec. 27, 1996, pp. 33670-33677, vol. 271, Issue 52, Copyright The American Society for Biochemistry and Molecular Biology, Inc. (1996); DOI: 10.1074/ JBC.271.52.33670; http://www.jbc.org/content/271/52/33670.full.pdf.
Corthesy, Blaise, "Recombinant Secretory Immunoglobulin A in Passive Immunotherapy: Linking Immunology and Biotechnology", Current Pharmaceutical Biotechnology (2003), pp. 51-67, vol. 4, Issue 1, Copyright Bentham Science Publishers Ltd. (2003); DOI:10.2174/1389201033378020; http://www.eurekaselect.com/63587/article.
Corthesy, Blaise, "Role of secretory immunoglobulin A and secretory component in the protection of mucosal surfaces", Future Microbiology, May 2010, pp. 817-829, vol. 5, Issue 5, Copyright Future Medicine Ltd (2010); DOI: 10.2217/FMB.10.39.
Corthey, Blaise and Rindisbacher, Lorenz, "In Vitro Assembly of Secretory Immunoglobulin A (sIGA) From IGA and Recombinant Secretory Component", J. Cell. Biochem. Suppl. 19A (1995), pp. 231-267, Keystone Symposium. Mucosal Immunity: New Strategies for Protection Against Viral and Bacterial Pathogens. Keystone, Colorado, Jan. 16-23, 1995, Abstracts, p. 244; DOI: 10.1002/jcb.240591008.
Corthier, G. et al., "Emergence in Gnotobiotic Mice of Nontoxinogenic Clones of Clostridium difficile from a Toxinogenic One", Infection and Immunity, Jun. 1988, pp. 1500-1504, vol. 56, No. 6, Copyright © 1988, American Society for Microbiology.
Corthier, G. et al., "Protection against Experimental Pseudomembranous Colitis in Gnotobiotic Mice by Use of Monoclonal Antibodies against Clostridium dificile Toxin A", Infection and Immunity, Mar. 1991, pp. 1192-1195, vol. 59, No. 3, Copyright © 1991, American Society for Microbiology.
Crottet, P. et al., "Expression, purification and biochemical characterization of recombinant murine secretory component: a novel tool in mucosal immunology", Biochem. J., 1999, pp. 299-306, vol. 341, © 1999 Biochemical Society.
Crottet, Pascal and Corthesy, Blaise, "Mapping the Interaction Between Murine IgA and Murine Secretory Component Carrying Epitope Substitutions Reveals a Role of Domains II and III in Covalent Binding to IgA", The Journal of Biological Chemistry, Oct. 29, 1999, pp. 31456-31462, vol. 274, Issue 44, Copyright The American Society for Biochemistry and Molecular Biology, Inc. (1999); DOI: 10.1074/jbc.274.44.31456; http://www.jbc.org/content/274/44/31456.full.pdf.
Crottet, Pascal and Corthesy, Blaise, "Secretory Component Delays the Conversion of Secretory IgA into Antigen-Binding Competent F(ab′)2: A Possible Implication for Mucosal Defense", The Journal of Immunology, Nov. 15, 1998, pp. 5445-5453, vol. 161, Issue 10, Copyright The American Association of Immunologists (1998); http://www.jimmunol.org/content/jimmunol/161/10/5445.full.pdf.
Delacroix, D.L. et al., "Changes in size, subclass, and metabolic properties of serum immunoglobulin A in liver diseases and in other diseases with high serum immunoglobulin A", J. Clin. Invest., Feb. 1983, pp. 358-367, vol. 71, © 1983 The American Society for Clinical Investigation, Inc.
Delacroix, D.L. et al., "Selective transport of polymeric immunoglobulin A in bile, Quantitative relationships of monomeric and polymeric immunoglobulin A, immunoglobulin M, and other proteins in serum, bile, and saliva", J. Clin. Invest., Aug. 1982, pp. 230-241, vol. 70, © 1982 The American Society for Clinical Investigation, Inc.
Dove, C.H. et al., "Molecular Characterization of the Clostridium dificile Toxin A Gene", Infection and Immunity, Feb. 1990, pp. 480-488, vol. 58, No. 2, Copyright © 1990, American Society for Microbiology.
Ehrich, M. et al., "Production of Clostridium difficile Antitoxin", Infection and Immunity, Jun. 1980, pp. 1041-1043, vol. 28, No. 3.
English translation of Japanese Notification of Reasons for Refusal dated Aug. 29, 2017 for Japanese Application No. 2014-560387 filed Mar. 8, 2013.
English translation of Japanese Notification of Reasons for Refusal dated Oct. 21, 2016 for Japanese Application No. 2014-560387 filed Mar. 8, 2013.
European Search Report dated Aug. 1, 2012 for European Application No. 12158931 filed Mar. 9, 2012 (references same as ISR dated Apr. 18, 2013).
Favre, Laurent I. et al., "Simplified procedure to recover recombinant antigenized secretory IgA to be used as a vaccine vector", Journal of Chromatography B, Mar. 25, 2003, pp. 143-151, vol. 786, Issues 1-2, Copyright Elsevier Science B.V. (2002); DOI: 10.1016/S1570-0232(02)00723-7; www.elsevier.com.
Fayer, R. et al., "Immunotherapeutic Efficacy of Bovine Colostral Immunoglobulins from a Hyperimmunized Cow against Cryptosporidiosis in Neonatal Mice", Infection and Immunity, Sep. 1990, pp. 2962-2965, vol. 58, No. 9, copyright © 1990, American Society for Microbiology.
Gerding, D.N. et al., "Clostridium difficile-Associated Diarrhea and Colitis in Adults, A Prospective CaseC,ontrolled Epidemiologic Study", Arch. Intern. Med., Jan. 1986, pp. 95-100, vol. 146.
Hendrickson, Barbara et al., "Lack of Association of Secretory Component with IgA in J Chain-Deficient Mice", The Journal of Immunology, Jul. 15, 1996, , pp. 750-754, vol. 157, Issue 2, Copyright The American Association of Immunologists (1996); http://www.jimmunol.org/content/157/2/750.long.
Hilpert, H. et al., "Use of Bovine Milk Concentrate Containing Antibody to Rotavirus to Treat Rotavirus Gastroenteritis in Infants", The Journal of Infectious Diseases, Jul. 1987, pp. 158-166, vol. 156, No. 1, © 1987 by The University of Chicago.
Johnson, S. et al., "Selective Neutralization of a Bacterial Enterotoxin by Serum Immunoglobulin A in Response to Mucosal Disease", Infection and Immunity, Aug. 1995, pp. 3166-3173, vol. 63, No. 8, Copyright © 1995, American Society for Microbiology.
Jones et al. "Purification of polymeric immunoglobulin from cell culture superntants by affintiy chromatogrpahy using secretory component" J Immunol Methods. 1987, 104(1-2): 237-43. *
Jones, R.M.L. et al., "Thiol-disulfide redox buffers maintain a structure of immunoglobulin A that is essential for optimal in vitro binding to secretory component", Biochimica et Biophysica Acta, 1998, pp. 265-274, vol. 1429, © 1998 Elsevier Science B.V.
Kelly, C.P. et al., "Clostridium difficile Colitis", The New England Journal of Medicine, Jan. 27, 1994, pp. 257-262, vol. 330, No. 4.
Kelly, C.P. et al., "Human Colonic Aspirates Containing Immunoglobulin A Antibody to Clostridium difficile Toxin A Inhibit Toxin A-Receptor Binding", Gastroenterology, Jan. 1992, pp. 35-40, vol. 102, No. 1, © 1992 by the American Gastroenterological Association.
Kohler, G. et al., "Continuous cultures of fused cells secreting antibody of predefined specificity", Nature, Aug. 1, 1975, pp. 495-497, vol. 256, No. 5517, Copyright © 1975 Macmillan Publishers Ltd.
Kopera, E. et al., "Application of Ni(II)-Assisted Peptide Bond Hydrolysis to Non-Enzymatic Affinity Tag Removal", PLoS ONE, May 4, 2012, 11 pages, vol. 7, No. 5, e36350, © 2012 Kopera et al.; DOI: 10.1371/journal.pone.0036350.
Kunisawa, J. and Kiyono, H., "A marvel of mucosal T cells and secretory antibodies for the creation of first lines of defense", Cellular and Molecular Life Sciences, Jun. 2005, pp. 1308-1321, vol. 62, Copyright Birkhäuser Verlag, Basel (2005); DOI: 10.1007/s00018-005-5035-1.
Leung, D.Y.M. et al., "Treatment with intravenously administered gamma globulin of chronic relapsing colitis induced by Clostridium difficile toxin", The Journal of Pediatrics, Apr. 1991, pp. 633-637, vol. 118, No. 4, Part 1.
Libby, J.M. et al., "Effects of theTwo Toxins of Clostridium difficile in Antibiotic-Associated Cecitis in Hamsters", Infection and Immunity, May 1982, pp. 822-829, vol. 36, No. 2.
Lima, A.A.M. et al., "Effects of Clostridium difficile Toxins A and B in Rabbit Small and Large Intestine In Vivo and on cultured Cells In Vitro", Infection and Immunity, Mar. 1988, pp. 582-588, vol. 56, No. 3, Copyright © 1988, American Society for Microbiology.
Lindh, E et al., "Binding of Secretory Component to Human Immunoglobulin M", Eur. J. Biochem., 1976, pp. 271-278, vol. 62.
Longet S. et al., "Human Plasma-derived Polymeric IgA and IgM Antibodies Associate with Secretory Component to Yield Biologically Active Secretory-like Antibodies", The Journal of Biological Chemistry, Feb. 8, 2013 (Published online: Dec. 18, 2012), pp. 4085-4094, vol. 288, No. 6, © 2013 by The American Society for Biochemistry and Molecular Biology, Inc.; DOI: 10.1074/jbc.M112.410811.
Louie, T.J. et al., "Tolevamer, a Novel Nonantibiotic Polymer, Compared with Vancomycin in the Treatment of Mild to Moderately Severe Clostridium difficile-Associated Diarrhea", Clinical Infectious Diseases, Aug. 15, 2006 (electronically published on Jul. 11, 2006), pp. 411-420, vol. 43, © 2006 by the Infectious Diseases Society of America.
Luellau, E. et al., "Development of a downstream process for the isolation and separation of monoclonal Immunoglobulin A monomers, dimers and polymers from cell culture supernatant", Journal of Chromatography A, 1998, pp. 165-175, vol. 796, © 1998 Elsevier Science B.V.
Lullau, E. et al., "Antigen Binding Properties of Purified Immunoglobulin A and Reconstituted Secretory Immunoglobulin A Antibodies", The Journal of Biological Chemistry, Jul. 5, 1996, pp. 16300-16309, vol. 271, No. 27, © 1996 by The American Society for Biochemistry and Molecular Biology, Inc.
Lullau, Elke et al., "Antigen Binding Properties of Purified Immunoglobulin A and Reconstituted Secretory Immunoglobulin A Antibodies", The Journal of Biological Chemistry, Jul. 5, 1996, pp. 16300-16309, vol. 271, Issue 27, Copyright The American Society for Biochemistry and Molecular Biology, Inc. (1996); doi: 10.1074/ jbc.271.27.16300; http://www.jbc.org/content/271/27/16300.full.pdf.
Lyerly, D.M. et al., "Biological Activities of Toxins A and B of Clostridium difficile", Infection and Immunity, Mar. 1982, pp. 1147-1150, vol. 35, No. 3.
Lyerly, D.M. et al., "Characterization of Toxins A and B of Clostridium difficile with Monoclonal Antibodies", Infection and Immunity, Oct. 1986, pp. 70-76, vol. 54, No. 1, Copyright © 1986, American Society for Microbiology.
Lyerly, D.M. et al., "Clostridium dificile: Its Disease and Toxins", Clinical Microbiology Reviews, Jan. 1988, pp. 1-18, vol. 1, No. 1, Copyright © 1988, American Society for Microbiology.
Lyerly, D.M. et al., "Effects of Clostridium difficile Toxins Given Intragastrically to Animals", Infection and Immunity, Feb. 1985, pp. 349-352, vol. 47, No. 2, Copyright © 1985, American Society for Microbiology.
Lyerly, D.M. et al., "Passive Immunization of Hamsters against Disease Caused by Clostridium difficile by Use of Bovine Immunoglobulin G Concentrate", Infection and Immunity, Jun. 1991, pp. 2215-2218, vol. 59, No. 6, Copyright © 1991, American Society for Microbiology.
Mahe, S. et al., "Effect of Various Diets on Toxin Production by Two Strains of Clostridium difficile in Gnotobiotic Mice", Infection and Immunity, Aug. 1987, pp. 1801-1805, vol. 55, No. 8, Copyright © 1987, American Society for Microbiology.
Malhotra, A., "Tagging for Protein Expression", Methods in Enzymology, Chapter 16, 2009, pp. 239-258, vol. 463, D 2009 Elsevier Inc.; DOI: 10.1016/S0076-6879(09)63016-0.
Marietta, E. et al., "A new model for dermatitis herpetiformis that uses HLA-DQ8 transgenic NOD mice", The Journal of Clinical Investigation, Oct. 2004, pp. 1090-1097, vol. 114, No. 8; DOI: 10.1172/JCI200421055.
Martinez, R.D. et al., "Purification and Characterization of Clostridium sordellii Hemorrhagic Toxin and Cross-Reactivity with Clostridium dificile Toxin A (Enterotoxin)", Infection and Immunity, May 1988, pp. 1215-1221, vol. 56, Vo. 5, Copyright © 1988, American Society for Microbiology.
Mcfarland, L.V. et al., "Nosocomial Acquisition of Clostridium Difficile Infection", The New England Journal of Medicine, 1989, pp. 204-210, vol. 320, No. 4.
Mcfarland, L.V. et al., "Review of Clostridium difficile-associated diseases", American Journal of Infection Control, Jun. 1986, pp. 99-109, vol. 14, No. 3.
Mcpherson S. et al., "Intravenous Immunoglobulin for the Treatment of Severe, Refractory, and Recurrent Clostridium difficile Diarrhea", Diseases of the Colon & Rectum, 2006 (Published online: Mar. 15, 2006), pp. 640-645, vol. 49, © 2006 The American Society of Colon and Rectal Surgeons; DOI: 10.1007/s10350-006-0511-8.
Mietens, C. et al., "Treatment of Infantile E. coli Gastroenteritis with Specific Bovine anti-E. coli Milk Immunoglobulins", Eur. J. Pediatr, 1979, pp. 239-252, vol. 132, © 1979 Springer-Verlag.
Mitchell, T.J. et al., "Effect of toxin A and B of Clostridium difficile on rabbit ileum and colon", Gut, 1986, pp. 78-85, vol. 27.
Morris, J.B. et al., "Role of Surgery in Antibiotic-Induced Pseudomembranous Enterocolitis", The American Journal of Surgery, Nov. 1990, pp. 535-539, vol. 160.
Oncley, J.L. et al., "The Separation of the Antibodies, Isoagglutinins, Prothrombin, Plasminogen and β1-Lipoprotein into Subtractions of Human Plasma", J. Am. Chem. Soc., Feb. 1949, pp. 541-550, vol. 71.
Phalipon, Armelle and Corthesy, Blaise, "Novel functions of the polymeric Ig receptor: well beyond transport of immunoglobulins", Trends in Immunology, Feb. 2003, pp. 55-58, vol. 24, Issue 2, Copyright Elsevier Science Ltd. (2002); DOI: https://doi.org/10.1016/S1471-4906(02)00031-5;www.elsevier.com.
Phalipon, Armelle et al., "Secretory Component: A New Role in Secretory IgA-Mediated Immune Exclusion In Vivo", Immunity, Jul. 2002, pp. 107-115, vol. 17, Issue 1, Copyright Cell Press (2002); DOI: https://doi.org/10.1016/S1074-7613(02)00341-2;http://www.cell.com/immunity/pdf/S1074-7613(02)00341-2.pdf.
Pothoulakis, C. et al., "Characterization of rabbit ileal receptors for Clostridium difficile toxin A, Evidence for a receptor-coupled G protein", The Journal of Clinical Investigation, Jul. 1991, pp. 119-125, vol. 88, No. 1, © The American Society for Clinical Investigation, Inc.; DOI: 10.1172/JCI115267.
Rindisbacher, Lorenz et al., "Production of Human Secretory Component with Dimeric IgA Binding Capacity Using Viral Expression Systems", The Journal of Biological Chemistry, Jun. 9, 1995, pp. 14220-14228, vol. 270, Issue 23, Copyright The American Society for Biochemistry and Molecular Biology, Inc. (1995); DOI: 10.1074/ jbc.270.23.14220.
Rothman, S.W. et al., "Differential Cytotoxic Effects of Toxins A and B Isolated from Clostridium difficile", Infection and Immunity, Nov. 1984, pp. 324-331, vol. 46, No. 2, Copyright © 1984, American Society for Microbiology.
Salcedo, J. et al., "Intravenous immunoglobulin therapy for severe Clostridium difficile colitis", Gut, 1997, pp. 366-370, vol. 41.
Scott, L.M. et al., "JAK2 Exon 12 Mutations in Polycythemia Vera and Idiopathic Erythrocytosis", The New England Journal of Medicine, Feb. 1, 2007, pp. 459-468, vol. 356, No. 5, Copyright © 2007 Massachusetts Medical Society.
Stubbe, H. et al., "Polymeric IgA is Superior to Monomeric IgA and IgG Carrying the Same Variable Domain in Preventing Clostridium difficile Toxin A Damaging of T84 Monolayers", The Journal of Immunology, 2000, pp. 1952-1960, vol. 164, Copyright © 2000 by The American Association of Immunologists; DOI: 10.4049/ immuno1.164.4.1952.
Symersky, J. et al., "Expression of the recombinant human immunoglobulin J chain in Escherichia coli", Molecular Immunology, 2000, pp. 133-140, vol. 37, © 2000 Elsevier Science Ltd.
Tacket, C.O. et al., "Protection by milk immunoglobulin concentrate against oral challenge with enterotoxigenic Escherichia coli", The New England Journal of Medicine, May 12, 1988, pp. 1240-1243, vol. 318, No. 19, Copyright © 2010 Massachusetts Medical Society.
Temerinac, S. et al., "Cloning of PRV-1, a novel member of the uPAR receptor superfamily, which is overexpressed in polycythemia rubra vera", Blood, Apr. 15, 2000, pp. 2569-2576, vol. 95, No. 8, © 2000 by The American Society of Hematology.
Tjellstrom, B. et al., "Oral immunoglobulin A supplement in treatment of Clostridium difficile enteritis", The Lancet, Mar. 13, 1993, pp. 701-702, vol. 341.
Triadafilopoulos, G. et al., "Differential Effects of Closfridium difficile Toxins A and B on Rabbit Ileum", Gastroenterology, Aug. 1987, pp. 273-279, vol. 93, No. 2, © 1987 by the American Gastroenterological Association.
Tucker, K.D. et al., "Toxin A of Clostridium difficile is a Potent Cytotoxin", Journal of Clinical Microbiology, May 1990, pp. 869-871, vol. 28, No. 5, Copyright © 1990, American Society for Microbiology.
Underdown et al. "Isolation of human secretory component by affinity chromatography on IgM-sepharose" Immunochemistry, 14, pp. 111-118, 1977. *
Weltzin, R. et al., "Intranasal Monoclonal IgA Antibody to Respiratory Syncytial Virus Protects Rhesus Monkeys against Upper and Lower Respiratory Tract Infection", The Journal of Infectious Diseases, Aug. 1996, pp. 256-261, vol. 174, © 1996 by The University of Chicago.
Weltzin, R. et al., "Intranasal Monoclonal Immunoglobulin A against Respiratory Syncytial Virus Protects against Upper and Lower Respiratory Tract Infections in Mice", Antimicrobial Agents and Chemotherapy, Dec. 1994, pp. 2785-2791, vol. 38, No. 12, Copyright © 1994, American Society for Microbiology.
Wheeler, Thomas T. et al., "Immune Components of Colostrum and Milk-A Historical Perspective", Journal of Mammary Gland Biology and Neoplasia, Dec. 2007 (Published Online: Nov. 9, 2007), pp. 237-247, vol. 12, Issue 4, Copyright Springer Science + Business Media, LLC (2007); DOI: 10.1007/s10911-007-9051-7.
Wheeler, Thomas T. et al., "Immune Components of Colostrum and Milk—A Historical Perspective", Journal of Mammary Gland Biology and Neoplasia, Dec. 2007 (Published Online: Nov. 9, 2007), pp. 237-247, vol. 12, Issue 4, Copyright Springer Science + Business Media, LLC (2007); DOI: 10.1007/s10911-007-9051-7.
Wilcox, M.H., "Descriptive study of intravenous immunoglobulin for the treatment of recurrent Clostridium difficile diarrhoea", Journal of Antimicrobial Chemotherapy, 2004 (Advance Access publication Apr. 8, 2004), pp. 882-884, vol. 53, No. 5, © The British Society for Antimicrobial Chemotherapy 2004; DOI: 10.1093/jac/dkh176.
Yoshiyama, Y. et al., "Specific antibodies to cholera toxin in rabbit milk are protective against Vibrio cholerae-induced intestinal secretion", Immunology, 1987, pp. 543-547, vol. 61.
Young, C.L. et al., "Recombinant protein expression and purification: A comprehensive review of affinity tags and microbial applications", Biotechnology Journal, 2012, pp. 620-634, vol. 7, © 2012 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim; DOI: 10.1002/biot.201100155.

Also Published As

Publication number Publication date
JP2015510875A (en) 2015-04-13
JP2021038246A (en) 2021-03-11
MX360245B (en) 2018-10-26
KR20140132770A (en) 2014-11-18
CN104254542A (en) 2014-12-31
US20140371431A1 (en) 2014-12-18
KR102142261B1 (en) 2020-08-11
US20190256577A1 (en) 2019-08-22
JP7575920B2 (en) 2024-10-30
CA2866634C (en) 2022-07-19
RU2014140744A (en) 2016-04-27
US11623948B2 (en) 2023-04-11
AU2013201393B2 (en) 2015-08-27
EP2822967A1 (en) 2015-01-14
AU2013201393A1 (en) 2013-09-26
CN111116735A (en) 2020-05-08
NZ629072A (en) 2016-03-31
EP2822967B1 (en) 2019-08-07
WO2013132052A1 (en) 2013-09-12
HK1204628A1 (en) 2015-11-27
SG11201404958SA (en) 2014-11-27
PL2822967T3 (en) 2020-01-31
IL234449B (en) 2018-07-31
MX2014010754A (en) 2014-12-05
US10221233B2 (en) 2019-03-05
US20150056180A1 (en) 2015-02-26
BR112014022240A2 (en) 2017-08-01
JP2019038834A (en) 2019-03-14
DK2822967T3 (en) 2019-10-07
RU2644240C2 (en) 2018-02-08
US20170058018A2 (en) 2017-03-02
CA2866634A1 (en) 2013-09-12
ES2751976T3 (en) 2020-04-02

Similar Documents

Publication Publication Date Title
US11623948B2 (en) Process for preparation of secretory IgA and secretory IgM
US10912955B2 (en) Treatment of celiac disease, C. difficile infection, food intolerance and food allergy with secretory IgA/IgM
AU688763B2 (en) (Clostridial) toxin disease therapy
US6365158B1 (en) Methods for producing neutralizing antitoxin to C. difficile toxin B
US7038017B2 (en) Antibody purification
US7597891B2 (en) Synthesis of human secretory IgA for the treatment of Clostridium difficile associated diseases
CN101679516B (en) Antigen binding protein targeting Staphylococcus aureus ORF0657n
US8021645B2 (en) Synthesis of human secretory IgA and IgM and the formation of a medicament therefrom
US7794721B2 (en) Synthesis of human secretory IgM and the treatment of clostridium difficile associated diseases herewith
US20080145420A1 (en) HUMAN SECRETORY IgA FOR THE TREATMENT OF CLOSTRIDIUM DIFFICILE ASSOCIATED DISEASES
NZ295998A (en) Neutralizing antitoxins against clostridium difficile and clostidium botulinum toxins
US8313730B2 (en) Treatment of celiac disease with IgA
US8119104B2 (en) Treatment of celiac disease with IgA
CN113416249B (en) Compositions against tetanus toxin
Class et al. Patent application title: PROCESS FOR PREPARATION OF SECRETORY IgA AND SECRETORY IgM
EP1079856B1 (en) Humanized antibodies that recognize verotoxin ii and cell line producing same
US20250326821A1 (en) PROCESS FOR PREPARATION OF SECRETORY IgA AND SECRETORY IgM AND USE THEREOF FOR TREATING NECROTIZING ENTEROCOLITIS
JPS63500035A (en) Protective human monoclonal antibody against Pseudomonas aeruginosa exotoxin A
US20210395343A1 (en) Ivig composition and method of treatment of antibody deficient patients
Bier Antibodies
HK1036215B (en) Humanized antibodies that recognize verotoxin ii and cell line producing same
MXPA00011434A (en) Humanized antibodies that recognize verotoxin ii and cell line producing same

Legal Events

Date Code Title Description
STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED

STCF Information on status: patent grant

Free format text: PATENTED CASE

FEPP Fee payment procedure

Free format text: MAINTENANCE FEE REMINDER MAILED (ORIGINAL EVENT CODE: REM.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

FEPP Fee payment procedure

Free format text: SURCHARGE FOR LATE PAYMENT, SMALL ENTITY (ORIGINAL EVENT CODE: M2554); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

MAFP Maintenance fee payment

Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YR, SMALL ENTITY (ORIGINAL EVENT CODE: M2551); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

Year of fee payment: 4