RU2687969C1 - Antimicrobial agent - Google Patents
Antimicrobial agent Download PDFInfo
- Publication number
- RU2687969C1 RU2687969C1 RU2018107732A RU2018107732A RU2687969C1 RU 2687969 C1 RU2687969 C1 RU 2687969C1 RU 2018107732 A RU2018107732 A RU 2018107732A RU 2018107732 A RU2018107732 A RU 2018107732A RU 2687969 C1 RU2687969 C1 RU 2687969C1
- Authority
- RU
- Russia
- Prior art keywords
- ethyl
- antimicrobial agent
- lactoferrin
- antimicrobial
- dimethylamino
- Prior art date
Links
- 239000004599 antimicrobial Substances 0.000 title claims abstract description 24
- 235000021242 lactoferrin Nutrition 0.000 claims abstract description 35
- 102000010445 Lactoferrin Human genes 0.000 claims abstract description 33
- 108010063045 Lactoferrin Proteins 0.000 claims abstract description 33
- CSSYQJWUGATIHM-IKGCZBKSSA-N l-phenylalanyl-l-lysyl-l-cysteinyl-l-arginyl-l-arginyl-l-tryptophyl-l-glutaminyl-l-tryptophyl-l-arginyl-l-methionyl-l-lysyl-l-lysyl-l-leucylglycyl-l-alanyl-l-prolyl-l-seryl-l-isoleucyl-l-threonyl-l-cysteinyl-l-valyl-l-arginyl-l-arginyl-l-alanyl-l-phenylal Chemical compound C([C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 CSSYQJWUGATIHM-IKGCZBKSSA-N 0.000 claims abstract description 31
- 229940078795 lactoferrin Drugs 0.000 claims abstract description 31
- 239000000654 additive Substances 0.000 claims abstract description 5
- 150000001732 carboxylic acid derivatives Chemical group 0.000 claims abstract description 3
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 claims description 18
- -1 esters acids Chemical class 0.000 claims description 8
- 239000003937 drug carrier Substances 0.000 claims description 5
- 239000002253 acid Substances 0.000 claims description 3
- 150000001733 carboxylic acid esters Chemical class 0.000 claims description 2
- 239000000969 carrier Substances 0.000 claims description 2
- 229920003052 natural elastomer Polymers 0.000 claims description 2
- 229920001194 natural rubber Polymers 0.000 claims description 2
- 239000002562 thickening agent Substances 0.000 claims description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims 1
- 239000002904 solvent Substances 0.000 claims 1
- 229920003051 synthetic elastomer Polymers 0.000 claims 1
- 239000005061 synthetic rubber Substances 0.000 claims 1
- 229920003169 water-soluble polymer Polymers 0.000 claims 1
- 239000003814 drug Substances 0.000 abstract description 18
- 238000011282 treatment Methods 0.000 abstract description 16
- 150000002148 esters Chemical class 0.000 abstract description 12
- 230000000694 effects Effects 0.000 abstract description 7
- 230000002265 prevention Effects 0.000 abstract description 7
- 208000014151 Stomatognathic disease Diseases 0.000 abstract description 6
- 241000233866 Fungi Species 0.000 abstract description 5
- 241000894006 Bacteria Species 0.000 abstract description 4
- 239000000126 substance Substances 0.000 abstract description 4
- 150000001735 carboxylic acids Chemical class 0.000 abstract description 3
- 230000000855 fungicidal effect Effects 0.000 abstract description 3
- 210000004400 mucous membrane Anatomy 0.000 abstract description 3
- 230000002421 anti-septic effect Effects 0.000 abstract description 2
- 239000000203 mixture Substances 0.000 description 30
- 238000012360 testing method Methods 0.000 description 17
- 229940079593 drug Drugs 0.000 description 16
- 239000007864 aqueous solution Substances 0.000 description 14
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 13
- 238000000034 method Methods 0.000 description 13
- 108090000765 processed proteins & peptides Proteins 0.000 description 13
- 239000000243 solution Substances 0.000 description 12
- 102000004196 processed proteins & peptides Human genes 0.000 description 11
- 230000000845 anti-microbial effect Effects 0.000 description 10
- 229920001817 Agar Polymers 0.000 description 9
- 239000008272 agar Substances 0.000 description 9
- 230000015572 biosynthetic process Effects 0.000 description 9
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 9
- 108700042778 Antimicrobial Peptides Proteins 0.000 description 8
- 102000044503 Antimicrobial Peptides Human genes 0.000 description 8
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 8
- 210000000214 mouth Anatomy 0.000 description 8
- 238000009331 sowing Methods 0.000 description 8
- 239000001530 fumaric acid Substances 0.000 description 7
- 239000007788 liquid Substances 0.000 description 7
- 235000015097 nutrients Nutrition 0.000 description 7
- 229940034610 toothpaste Drugs 0.000 description 7
- 239000000606 toothpaste Substances 0.000 description 7
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 6
- 150000001413 amino acids Chemical class 0.000 description 6
- 230000000844 anti-bacterial effect Effects 0.000 description 6
- 238000011156 evaluation Methods 0.000 description 6
- 244000005700 microbiome Species 0.000 description 6
- 229920001184 polypeptide Polymers 0.000 description 6
- 239000000829 suppository Substances 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 239000013543 active substance Substances 0.000 description 5
- 239000003795 chemical substances by application Substances 0.000 description 5
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 239000002775 capsule Substances 0.000 description 4
- 229940112822 chewing gum Drugs 0.000 description 4
- 235000015218 chewing gum Nutrition 0.000 description 4
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 4
- 239000006072 paste Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 241000222122 Candida albicans Species 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- UEEJHVSXFDXPFK-UHFFFAOYSA-N N-dimethylaminoethanol Chemical compound CN(C)CCO UEEJHVSXFDXPFK-UHFFFAOYSA-N 0.000 description 3
- 102000004264 Osteopontin Human genes 0.000 description 3
- 108010081689 Osteopontin Proteins 0.000 description 3
- LCTONWCANYUPML-UHFFFAOYSA-N Pyruvic acid Chemical compound CC(=O)C(O)=O LCTONWCANYUPML-UHFFFAOYSA-N 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 239000003963 antioxidant agent Substances 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 238000004140 cleaning Methods 0.000 description 3
- 210000003298 dental enamel Anatomy 0.000 description 3
- 239000002552 dosage form Substances 0.000 description 3
- 150000002170 ethers Chemical class 0.000 description 3
- 235000020256 human milk Nutrition 0.000 description 3
- 210000004251 human milk Anatomy 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 239000011505 plaster Substances 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- FALRKNHUBBKYCC-UHFFFAOYSA-N 2-(chloromethyl)pyridine-3-carbonitrile Chemical compound ClCC1=NC=CC=C1C#N FALRKNHUBBKYCC-UHFFFAOYSA-N 0.000 description 2
- 208000035143 Bacterial infection Diseases 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 229920000742 Cotton Polymers 0.000 description 2
- 241000305071 Enterobacterales Species 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 206010017533 Fungal infection Diseases 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000798114 Homo sapiens Lactotransferrin Proteins 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- BJEPYKJPYRNKOW-REOHCLBHSA-N L-(-)-Malic acid Natural products OC(=O)[C@@H](O)CC(O)=O BJEPYKJPYRNKOW-REOHCLBHSA-N 0.000 description 2
- 208000031888 Mycoses Diseases 0.000 description 2
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 2
- 241000607142 Salmonella Species 0.000 description 2
- 241000607762 Shigella flexneri Species 0.000 description 2
- 241000295644 Staphylococcaceae Species 0.000 description 2
- 241000191967 Staphylococcus aureus Species 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 230000003217 anti-cancerogenic effect Effects 0.000 description 2
- 239000012871 anti-fungal composition Substances 0.000 description 2
- 230000003078 antioxidant effect Effects 0.000 description 2
- 208000022362 bacterial infectious disease Diseases 0.000 description 2
- 230000001680 brushing effect Effects 0.000 description 2
- 229940095731 candida albicans Drugs 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 208000007565 gingivitis Diseases 0.000 description 2
- 235000020251 goat milk Nutrition 0.000 description 2
- 102000050459 human LTF Human genes 0.000 description 2
- 230000002519 immonomodulatory effect Effects 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- XMGQYMWWDOXHJM-UHFFFAOYSA-N limonene Chemical compound CC(=C)C1CCC(C)=CC1 XMGQYMWWDOXHJM-UHFFFAOYSA-N 0.000 description 2
- 239000011976 maleic acid Substances 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 210000004877 mucosa Anatomy 0.000 description 2
- 238000010899 nucleation Methods 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 229940107700 pyruvic acid Drugs 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-N succinic acid Chemical compound OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 2
- 229940014800 succinic anhydride Drugs 0.000 description 2
- HHVIBTZHLRERCL-UHFFFAOYSA-N sulfonyldimethane Chemical compound CS(C)(=O)=O HHVIBTZHLRERCL-UHFFFAOYSA-N 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 210000000332 tooth crown Anatomy 0.000 description 2
- 239000000811 xylitol Substances 0.000 description 2
- 235000010447 xylitol Nutrition 0.000 description 2
- QPILHXCDZYWYLQ-UHFFFAOYSA-N 2-nonyl-1,3-dioxolane Chemical compound CCCCCCCCCC1OCCO1 QPILHXCDZYWYLQ-UHFFFAOYSA-N 0.000 description 1
- 241000208140 Acer Species 0.000 description 1
- 241000588813 Alcaligenes faecalis Species 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 241000304886 Bacilli Species 0.000 description 1
- 208000004926 Bacterial Vaginosis Diseases 0.000 description 1
- 206010007134 Candida infections Diseases 0.000 description 1
- GHXZTYHSJHQHIJ-UHFFFAOYSA-N Chlorhexidine Chemical compound C=1C=C(Cl)C=CC=1NC(N)=NC(N)=NCCCCCCN=C(N)N=C(N)NC1=CC=C(Cl)C=C1 GHXZTYHSJHQHIJ-UHFFFAOYSA-N 0.000 description 1
- 208000002064 Dental Plaque Diseases 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 241000588697 Enterobacter cloacae Species 0.000 description 1
- 206010015150 Erythema Diseases 0.000 description 1
- 208000010201 Exanthema Diseases 0.000 description 1
- 241000192125 Firmicutes Species 0.000 description 1
- 206010018286 Gingival pain Diseases 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 244000043261 Hevea brasiliensis Species 0.000 description 1
- 241000725303 Human immunodeficiency virus Species 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 241000186660 Lactobacillus Species 0.000 description 1
- 241000192132 Leuconostoc Species 0.000 description 1
- IPWKIXLWTCNBKN-UHFFFAOYSA-N Madelen Chemical compound CC1=NC=C([N+]([O-])=O)N1CC(O)CCl IPWKIXLWTCNBKN-UHFFFAOYSA-N 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- BYBLEWFAAKGYCD-UHFFFAOYSA-N Miconazole Chemical compound ClC1=CC(Cl)=CC=C1COC(C=1C(=CC(Cl)=CC=1)Cl)CN1C=NC=C1 BYBLEWFAAKGYCD-UHFFFAOYSA-N 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 208000007027 Oral Candidiasis Diseases 0.000 description 1
- 208000003251 Pruritus Diseases 0.000 description 1
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241000607715 Serratia marcescens Species 0.000 description 1
- 241000607760 Shigella sonnei Species 0.000 description 1
- YTGJWQPHMWSCST-UHFFFAOYSA-N Tiopronin Chemical compound CC(S)C(=O)NCC(O)=O YTGJWQPHMWSCST-UHFFFAOYSA-N 0.000 description 1
- 241000287411 Turdidae Species 0.000 description 1
- 208000024780 Urticaria Diseases 0.000 description 1
- 208000037009 Vaginitis bacterial Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- 229940005347 alcaligenes faecalis Drugs 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N alpha-hydroxysuccinic acid Natural products OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 150000008064 anhydrides Chemical class 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 230000000721 bacterilogical effect Effects 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid group Chemical group C(C1=CC=CC=C1)(=O)O WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 201000003984 candidiasis Diseases 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 229960003260 chlorhexidine Drugs 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 235000020247 cow milk Nutrition 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 235000013365 dairy product Nutrition 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 231100000321 erythema Toxicity 0.000 description 1
- 229940023064 escherichia coli Drugs 0.000 description 1
- 235000019441 ethanol Nutrition 0.000 description 1
- 125000004494 ethyl ester group Chemical group 0.000 description 1
- 201000005884 exanthem Diseases 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 239000010408 film Substances 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- 229960004884 fluconazole Drugs 0.000 description 1
- RFHAOTPXVQNOHP-UHFFFAOYSA-N fluconazole Chemical compound C1=NC=NN1CC(C=1C(=CC(F)=CC=1)F)(O)CN1C=NC=N1 RFHAOTPXVQNOHP-UHFFFAOYSA-N 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 208000024693 gingival disease Diseases 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 150000001261 hydroxy acids Chemical class 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 230000007803 itching Effects 0.000 description 1
- 150000004715 keto acids Chemical class 0.000 description 1
- 229940116298 l- malic acid Drugs 0.000 description 1
- 229940039696 lactobacillus Drugs 0.000 description 1
- 229940087305 limonene Drugs 0.000 description 1
- 235000001510 limonene Nutrition 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 229960002509 miconazole Drugs 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 229960002313 ornidazole Drugs 0.000 description 1
- 238000005498 polishing Methods 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 229960005205 prednisolone Drugs 0.000 description 1
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 206010037844 rash Diseases 0.000 description 1
- 238000010992 reflux Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108700022109 ropocamptide Proteins 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 229940115939 shigella sonnei Drugs 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000001384 succinic acid Substances 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 238000004506 ultrasonic cleaning Methods 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 239000000003 vaginal tablet Substances 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/21—Esters, e.g. nitroglycerine, selenocyanates
- A61K31/215—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/40—Transferrins, e.g. lactoferrins, ovotransferrins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Oncology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Chemical & Material Sciences (AREA)
- Emergency Medicine (AREA)
- Cosmetics (AREA)
- Communicable Diseases (AREA)
Abstract
Description
Область техники, к которому относится настоящее изобретениеThe technical field to which the present invention relates.
Изобретение относится к медицине и фармацевтической промышленности, а точнее к средствам для ингибирования и/или предотвращения роста микробиопленок и может быть использовано в качестве лекарственного или профилактического средства у людей, в частности в стоматологии и в лечении и профилактике состояний слизистых оболочек.The invention relates to medicine and the pharmaceutical industry, and more specifically to means for inhibiting and / or preventing the growth of microbiofilms and can be used as a drug or prophylactic agent in humans, particularly in dentistry and in the treatment and prevention of conditions of the mucous membranes.
Предшествующий уровень техники настоящего изобретенияThe prior art of the present invention
В настоящее время растет интерес к использованию новых нетрадиционных антимикробных средств и, в частности, пептидов, что привело к широкому кругу проводимых исследований в этой области в последние десятилетия. В результате было исследовано и предложено к использованию много типов антимикробных пептидов.Currently, there is a growing interest in the use of new non-traditional antimicrobial agents and, in particular, peptides, which has led to a wide range of ongoing research in this area in recent decades. As a result, many types of antimicrobial peptides have been researched and proposed for use.
Здесь следует отметить, что указанные антимикробные пептиды вырабатываются всеми формами жизни: от растений до млекопитающих и человека, и по функциональным признакам как раз предназначены самой природой для самозащиты указанных форм жизни от посторонних микроорганизмов. Антимикробные пептиды непосредственно взаимодействуют с бактериями и убивают их. Их называют антимикробными, поскольку они обладают необычайно широким спектром активности, в том числе способностью убивать или нейтрализовать грамотрицательные и грамположительные бактерии, вирусы, имеющие оболочки, такие как ВИЧ и вирус герпеса, грибки и т.д. В общем случае указанные пептиды отличаются строением и составом, начиная с 12 аминокислот, и до молекул, содержащих более 200 аминокислотных остатков. Особенно активно исследуются гликопротеины и, в частности, лактоферрины. [1]It should be noted here that the indicated antimicrobial peptides are produced by all forms of life: from plants to mammals and humans, and according to their functional characteristics, nature itself is designed to protect these forms of life from foreign microorganisms. Antimicrobial peptides directly interact with bacteria and kill them. They are called antimicrobial because they have an unusually broad spectrum of activity, including the ability to kill or neutralize gram-negative and gram-positive bacteria, viruses that have shells, such as HIV and herpes virus, fungi, etc. In the General case, these peptides differ in structure and composition, starting with 12 amino acids, and up to molecules containing more than 200 amino acid residues. Glycoproteins and, in particular, lactoferrins are being actively studied. [one]
(см. И.М. Макеева, Т.Н. Смирнова и др.: Применение лактоферринов в комплексном лечении стоматологических заболеваний (Обзор литературы). Стоматология, т. 91, 4'2012, с. 66-71.(see IM Makeeva, TN Smirnova, et al .: The use of lactoferrins in the complex treatment of dental diseases (Literature review). Dentistry, vol. 91, 4'2012, pp. 66-71.
Преимущества использования антимикробных пептидов включают в себя: биосовместимость, вовлечение компонентов в метаболизм, что обеспечивает снижение аллергических реакций на препарат. Проведенные исследования выявили существенные преимущества применения препаратов на основе антимикробных пептидов по сравнению с традиционными средствами. Также эти исследования показали, что терапия и профилактика с помощью антимикробных пептидов является несколько более дорогостоящей по сравнению с традиционными средствами из-за дополнительных затрат на получение активного вещества и сравнительно больших его потерь в лечебном или профилактическом процессе. Таким образом, создание экономичных и эффективных антимикробных композиций на основе пептидов, а также технологий получения их лекарственных форм является актуальной задачей.The advantages of using antimicrobial peptides include: biocompatibility, the involvement of components in the metabolism, which reduces allergic reactions to the drug. Studies have revealed significant advantages of the use of drugs based on antimicrobial peptides compared with traditional means. Also, these studies have shown that therapy and prophylaxis with antimicrobial peptides is somewhat more expensive compared to traditional means due to the additional cost of obtaining the active substance and its relatively large losses in the therapeutic or prophylactic process. Thus, the creation of cost-effective and effective antimicrobial compositions based on peptides, as well as technologies for their dosage forms is an important task.
Из уровня техники известна противогрибковая композиция на основе сложных среднемолекулярных пептидов, состоящих из по меньшей мере 200 аминокислотных остатков, Полипептиды по настоящему изобретению имеют предпочтительно по меньшей мере 100% антимикробную активность полипептида, состоящего из последовательности аминокислот, показанной в виде аминокислот с 1 по 40 любой из последовательностей с SEQ ID NO: 3 по SEQ ID NO: 225 или любой из последовательностей с SEQ ID NO: 226 по SEQ ID NO: 251, или любой из последовательностей с SEQ ID NO: 252 по SEQ ID NO: 274. [2] (См. патент РФ на изобретение №2415150An antifungal composition based on complex molecular weight peptides consisting of at least 200 amino acid residues is known in the art. The polypeptides of the present invention preferably have at least 100% of the antimicrobial activity of the polypeptide consisting of the amino acid sequence shown in amino acids 1 through 40 any from sequences with SEQ ID NO: 3 to SEQ ID NO: 225 or any of the sequences from SEQ ID NO: 226 to SEQ ID NO: 251, or any of the sequences from SEQ ID NO: 252 to SEQ ID NO: 274. [2 ] (See. RF patent on zobretenie №2415150
«Полипептиды, обладающие антимикробной активностью, и полинуклеотиды, кодирующие их», опубл. 2011 г)"Polypeptides with antimicrobial activity and polynucleotides encoding them", publ. 2011)
Из уровня техники известен также синтетический полипептид с антибактериальной активностью следующей формулы: U=XN, где XN- Ser или любой из остатков аминокислот Glu, Thr, Arg, Pro, Val, Leu, Asn; Arg; Leu; Phe; Lys; Ile; Gln; Gly; Ser; Ala в различных сочетаниях, где N достигает значений до 41, например пептид SE-41, являющийся ретропоследовательностью С-концевой части белка САР 18, обладающий антимикробной активностью и имеющий следующий аминокислотный состав SEQ ID NO: 1: SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLLAFRK, а также фрагменты пептида SE-41, имеющие в своем составе от 16 до 40 аминокислот. Лекарственный препарат для профилактики или лечения бактериальной инфекции человека, включает вышеуказанный полипептид, один или несколько фармацевтически приемлемых носителей, вспомогательных веществ или дополнительных противобактериальных средств. [3] (См. патент РФ на изобретение №2434880 С2 «Полипептид, имеющий антибактериальную активность и пригодный для получения лекарственных средств для лечения бактериальных инфекций человека», опубл. 2011 г.)A synthetic polypeptide with antibacterial activity of the following formula is also known in the art: U = X N , where X N is Ser or any of the amino acid residues Glu, Thr, Arg, Pro, Val, Leu, Asn; Arg; Leu; Phe; Lys; Ile; Gln; Gly; Ser; Ala in various combinations, where N reaches values up to 41, for example, the peptide SE-41, which is the retro sequence of the C-terminal part of the CAP 18 protein, has antimicrobial activity and has the following amino acid composition SEQ ID NO: 1: SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLLAFRK, and fragments 41, having in its composition from 16 to 40 amino acids. A drug for the prevention or treatment of a human bacterial infection includes the above polypeptide, one or more pharmaceutically acceptable carriers, excipients or additional antibacterial agents. [3] (See. RF patent for invention №2434880 C2 "Polypeptide having antibacterial activity and suitable for the production of medicines for the treatment of human bacterial infections, publ. 2011)
Известна также противогрибковая композиция на основе противомикробных пептидов, содержащих аргинин- и лизинсодержащий мотив общей формулы (I): ((X)I(Y)m)n, где пептид содержит от 3 до 200 аминокислот и где 1, m и п представляют собой целые числа от 0 до 10; X и Y, которые могут быть одинаковыми или разными и представляют собой катионные аминокислоты, выбранные из аргинина и лизина, в изготовленииAn antifungal composition based on antimicrobial peptides containing an arginine- and lysine-containing motif of the general formula (I) is also known: ((X) I (Y) m ) n , where the peptide contains from 3 to 200 amino acids and where 1, m and n are integers from 0 to 10; X and Y, which may be the same or different and are cationic amino acids selected from arginine and lysine, in the manufacture of
лекарственных средств для лечения грибковой инфекции. Композиция содержит фармацевтически эффективное количество одного или более пептидов или их фармацевтически приемлемых солей и фармацевтически приемлемый носитель, эксципиент или разбавитель, где эксципиент или разбавитель выбран из группы кислот: уксусной, лимонной, борной, молочной, пропионовой, фосфорной, бензойной, масляной, малоновой, яблочной, щавелевой, янтарной и винной или диметил сульфона, N-(2-меркаптопропионил) глицина, 2-н-нонил-1,3-диоксолана и этилового спирта. (См. патент РФ на изобретение №2396273 «Противомикробные пептиды, содержащие аргинин- и лизинсодержащий мотив», опубл. 2010 г.)drugs for the treatment of fungal infections. The composition contains a pharmaceutically effective amount of one or more peptides or their pharmaceutically acceptable salts and a pharmaceutically acceptable carrier, excipient or diluent, where the excipient or diluent is selected from the group of acids: acetic, citric, boric, lactic, propionic, phosphoric, benzoic, butyric, malonic, apple, oxalic, amber and tartaric or dimethyl sulfone, N- (2-mercaptopropionyl) glycine, 2-n-nonyl-1,3-dioxolane and ethyl alcohol. (See RF patent for invention №2396273 "Antimicrobial peptides containing arginine- and lysine-containing motif", published in 2010)
Из уровня техники известна также стоматологическая композиция для снижения или предотвращения роста бактериальных бляшек на зубной эмали, содержащая от примерно 100 мг до примерно 1000 мг молочного остеопонтина на 1 кг композиции. Способ предотвращения или ингибирования роста бактериальных бляшек на зубной эмали, включает введение в рот эффективного количества молочного остеопонтина. При этом стоматологическая композиция представляет собой зубной порошок, зубной гель, зубной эликсир, спрей для полости рта или жевательную резинку.[4] (См. патент РФ на изобретение №2385162 «Применение остеопонтина в стоматологических композициях», опубл. 2006 г.)The prior art also known dental composition to reduce or prevent the growth of bacterial plaques on the tooth enamel, containing from about 100 mg to about 1000 mg of dairy osteopontin per 1 kg of the composition. A method of preventing or inhibiting the growth of bacterial plaques on tooth enamel, includes the introduction into the mouth of an effective amount of milk osteopontin. In this case, the dental composition is a tooth powder, tooth gel, tooth elixir, mouth spray or chewing gum. [4] (See RF patent for invention №2385162 "The use of osteopontin in dental compositions, publ. 2006)
Известен также антибактериальный, антиоксидантный, детоксицирующий, иммуномодулирующий и антиканцерогенный препарат. Препарат содержит человеческий лактоферрин в качестве активного вещества и фармацевтически приемлемые добавки в соотношении лактоферрин/фармацевтически приемлемые добавки 10-90/90-10 и при содержании действующего вещества в лекарственных средствах от 0,01 до 1,0%. Лекарственные средства, содержащие препарат и фармацевтически приемлемые носители представляют собой растворы для внутривенного введения, для внутриполостного или внутрипузырного введения, для перорального введения, для обработки раневых поверхностей, для интраназального применения или в форме глазных капель, мази, болюсы для перорального применения, суппозитории для ректального или интравагинального применения, таблетки. [5] (См. патент РФ на изобретение №2165769 «антибактериальный, антриоксидантный, иммунномодулирующий и антиканцерогенный препарат и способ его применения», опубл. 2001 г).Also known antibacterial, antioxidant, detoxifying, immunomodulatory and anticarcinogenic drug. The drug contains human lactoferrin as an active substance and pharmaceutically acceptable additives in the ratio of lactoferrin / pharmaceutically acceptable additives 10-90 / 90-10 and with the content of the active substance in medicines from 0.01 to 1.0%. Drugs containing the drug and pharmaceutically acceptable carriers are solutions for intravenous administration, for intracavitary or intravesical administration, for oral administration, for treating wound surfaces, for intranasal use or in the form of eye drops, ointment, oral boluses, suppositories for rectal or intravaginal use tablets. [5] (See. RF patent for invention №2165769 "antibacterial, antioxidant, immunomodulating and anticarcinogenic drug and method of its use, publ. 2001).
Наиболее близким техническим решением к заявляемому антимикробному средству является антимикробное средство «гигиенический ополаскиватель «Неолактоферрин-дента» для ополаскивания полости рта, представляющий собой водный раствор ЛФ (комплекс белков ЛФ человека (90%) и ЛФ козы (10%) - получен из молока коз-продуцентов). (См. Бабина К.С. «Оценка влияния гигиенического ополаскивателя «Неолактоферрин-дента» на формирование и рост биопленки. // Материалы X международной научно-практической конференции «Современные достижения в науке», том 2, Прага, 2014, с. 65-72.)The closest technical solution to the claimed antimicrobial agent is the antimicrobial agent "hygienic rinse" Neolactoferrin-dent "for rinsing the mouth, which is an aqueous solution of LF (complex LF proteins of human LF (90%) and LF goat (10%) - derived from goat's milk -producers). (See KS Babina, “Assessment of the influence of the hygienic rinse“ Neolactoferrin-denta ”on the formation and growth of biofilm. // Proceedings of the X International Scientific and Practical Conference“ Modern Advances in Science ”, volume 2, Prague, 2014, p. 65 -72.)
Указанное средство, как это и следует из названия, предназначено и используют для снижения или предотвращения роста бактериальных бляшек на зубной эмали. Компоненты средства взяты в следующих соотношениях (мас): ЛФ 0,1 г/вода 100 г(мл).The specified tool, as the name implies, is intended and used to reduce or prevent the growth of bacterial plaques on the tooth enamel. The components of the tool are taken in the following ratios (wt): LF 0.1 g / water 100 g (ml).
Недостатки данного средства обусловлены необходимостью постоянного использования этого гигиенического средства.The disadvantages of this tool due to the need for continuous use of this hygiene product.
Постановка задачи и раскрытие изобретенияProblem statement and invention disclosure
Техническим результатом, на достижение которого направлено заявляемое изобретение, является повышение антибактериальной активности, а также увеличение ассортимента средств для лечения бактериального вагиноза и грибковых инфекций за счет расширения диапазона лечебного воздействия.The technical result, the achievement of which the invention is directed, is to increase the antibacterial activity, as well as increasing the range of products for the treatment of bacterial vaginosis and fungal infections due to the expansion of the range of therapeutic effects.
Указанный технический результат достигается тем, что антимикробное средство, содержащее лактоферрин дополнительно содержит моно[(2-диметиламино)этиловые] эфиры карбоновых кислот общей формулы R-О-(Et)-N(Me)2, где R-карбоновая кислота, выбранная из ряда: фумаровая, янтарная, малеиновая, α-кетоглутаровая, щавелевая, D,L-яблочная, пировиноградная, Et - этил и Me - метил, при этом соотношение(мас.) лактоферрин/эфиры карбоновых кислот составляет от 1/1 до 1/3. В заявляемом изобретении под лактоферрином (ЛФ) понимаются лактоферрины различного происхождения: ЛФ из молока коз-продуцентов - неолактоферрин, представляющий собой комплекс белков ЛФ человека (90%) и ЛФ козы (10%), ЛФ из коровьего молока и др.This technical result is achieved by the fact that the antimicrobial agent containing lactoferrin additionally contains mono [(2-dimethylamino) ethyl] esters of carboxylic acids of the general formula R — O— (Et) -N (Me) 2 , where R is a carboxylic acid selected from rows: fumaric, succinic, maleic, α-ketoglutaric, oxalic, D, L-malic, pyruvic, Et - ethyl and Me - methyl, while the ratio (wt.) lactoferrin / carboxylic esters is from 1/1 to 1 / 3 In the present invention, lactoferrin (LF) refers to lactoferrins of different origin: LF from goat milk producers — neolactoferrin, which is a complex of human LF proteins (90%) and LF goat (10%), LF from cow's milk, etc.
Антимикробное средство может дополнительно содержать фармацевтически приемлемые добавки, а также бионейтральные компоненты, в качестве которых используют носители, загустители, антиоксиданты, количественное содержание которых в композиции определяется лекарственной формой и способом применения средства.The antimicrobial agent may additionally contain pharmaceutically acceptable additives, as well as bioneutral components, which use carriers, thickeners, antioxidants, the amount of which in the composition is determined by the dosage form and method of use of the agent.
Лекарственная форма заявляемого антимикробного средства может быть выполнена в виде жидкого раствора, таблетки или пленки, для буккального применения, в виде жевательной резинки или в виде суппозитория для ректального или вагинального введения.Dosage form of the inventive antimicrobial agent can be made in the form of a liquid solution, tablet or film, for buccal use, as a chewing gum or as a suppository for rectal or vaginal administration.
Содержание активного вещества в заявляемом антимикробном средстве может составлять 0,01-1,0% мас. Оптимальное содержание составляет 0,05-0,15% мае, или 0,5-1,5 мг/мл или мг/г. В суппозитории для одноразового ректального или вагинального введения содержание активного вещества может составлять 5,0-10,0 мг/г в дозе 10-30 мг.The content of the active substance in the inventive antimicrobial agent can be 0.01-1.0% wt. The optimal content is 0.05-0.15% mb, or 0.5-1.5 mg / ml or mg / g. In suppositories for single rectal or vaginal administration, the content of the active substance may be 5.0-10.0 mg / g in a dose of 10-30 mg.
В качестве эфиров оксокислот используют моно[(2-диметиламино)этиловые] эфиры фумаровой, янтарной, малеиновой, α-кетоглутаровой, щавелевой, D- или L-яблочной или пировиноградной кислоты. При этом указанные эфиры могут быть использованы порознь или в различных сочетаниях (смеси). Заявляемые эфиры могут быть получены (произведены) различными путями, например взаимодействием ангидридов вышеупомянутых кислот с 2-диметиламиноэтанолом. Авторы подтверждают это примером синтеза моно[(2-диметиламино)этилового] эфира янтарной кислоты: взаимодействием янтарного ангидрида с 2-диметиламиноэтанолом в ацетоне.
К раствору 10 г (0,1 М) янтарного ангидрида в 100 мл сухого ацетона добавляют 10 г (0,11 М) 2-диметиламиноэтанола. Смесь кипятят 1 час с обратным холодильником, отфильтровывают нерастворимый осадок, упаривают и охлаждают фильтрат. Выпавшие бесцветные кристаллы рекристаллизуют из ацетона. Выход 90%, Т. пл. 74-75°С. [1Н ЯМР (500 МГц, ДМСО-d6): 2.19 (с, 6Н), 2.41-2.53 (м, 6Н), 4.09 (т, j=5.6 Гц, 2Н), 4.5 (шс). 13С ЯМР (125 МГц, ДМСО-d6): 28.77, 28.81, 44.97, 56.85, 61.54, 172.03, 173.38.]To a solution of 10 g (0.1 M) of succinic anhydride in 100 ml of dry acetone add 10 g (0.11 M) of 2-dimethylaminoethanol. The mixture is boiled for 1 hour under reflux, the insoluble precipitate is filtered off, evaporated and the filtrate is cooled. Colorless crystals precipitated are recrystallized from acetone. Yield 90%, T. pl. 74-75 ° C. [ 1 H NMR (500 MHz, DMSO-d 6 ): 2.19 (s, 6H), 2.41-2.53 (m, 6H), 4.09 (t, j = 5.6 Hz, 2H), 4.5 (bs). 13 C NMR (125 MHz, DMSO-d 6 ): 28.77, 28.81, 44.97, 56.85, 61.54, 172.03, 173.38.]
Авторы обнаружили неожиданный эффект. При добавлении в водный раствор ЛФ моно[(2-диметиламино)этиловых] эфиров карбоновых кислот в количестве от 1 до 3 масс от массы ЛФ установлено резкое возрастание бактерицидного эффекта против кишечной палочки, бацилл, сальмонелл, стрептококков, стафилококков, а также широкого круга специфических возбудителей (патогенных микроорганизмов, таких как, например, Staphylococcus aureus, Lactobacillus spp., Leuconostoc spp., и, дрожжевых грибков, например, Candida albicans.The authors found an unexpected effect. When mono [(2-dimethylamino) ethyl] esters of carboxylic acids are added to an aqueous solution of LF in an amount of 1 to 3 wt.% Of the mass of LF, a sharp increase in the bactericidal effect against E. coli, bacilli, Salmonella, streptococci, staphylococci, as well as a wide range of specific pathogens (pathogens such as, for example, Staphylococcus aureus, Lactobacillus spp., Leuconostoc spp., and yeast fungi, for example, Candida albicans.
Также следует отметить, что вышеуказанные производные оксокислот могут быть использованы порознь или в различных сочетаниях в виде смесей двух или более различных соединений рассматриваемого класса.It should also be noted that the above oxo acid derivatives can be used separately or in various combinations as mixtures of two or more different compounds of the class under consideration.
Характерной особенностью заявляемых эфиров является то, что они распадаются на вещества, представляющие собой метаболиты, экскретируемые из организма человека. Соответственно, и, следовательно, при употреблении заявляемых веществ вовнутрь они при распаде полностью и безопасно удаляются из организма. Признаки, приведенные в настоящем описании изобретения и в пунктах формулы изобретения, являются материалом для реализации настоящего изобретения в различных его формах, как отдельно, так и в любой их комбинации.A characteristic feature of the proposed esters is that they break down into substances, which are metabolites excreted from the human body. Accordingly, and, therefore, when ingested substances are ingested, they are completely and safely removed from the body during disintegration. The features given in the present description of the invention and in the claims are materials for realizing the present invention in its various forms, both separately and in any combination thereof.
Технических решений, совпадающих с совокупностью существенных признаков заявляемого изобретения, не выявлено, что позволяет сделать вывод о соответствии заявляемого изобретения такому условию патентоспособности, как «новизна».Technical solutions that coincide with the set of essential features of the claimed invention have not been identified, which allows to make a conclusion about the compliance of the claimed invention with such a condition of patentability as "novelty."
Заявляемые существенные признаки, предопределяющие получение указанного технического результата, явным образом не следуют из уровня техники, что позволяет сделать вывод о соответствии заявляемого изобретения такому условию патентоспособности, как «изобретательский уровень».The inventive essential features that determine the receipt of the specified technical result, not explicitly follow from the prior art, which allows to make a conclusion about the compliance of the claimed invention to the condition of patentability, as "inventive step".
Условие патентоспособности «промышленная применимость» подтверждено на примерах конкретного применения.The condition of patentability "industrial applicability" is confirmed by examples of specific applications.
Заявляемое изобретение может быть проиллюстрировано, но не исчерпано следующими примерами его конкретного осуществления.The claimed invention can be illustrated, but not exhausted by the following examples of its specific implementation.
Пример 1.Example 1
Методика определения влияния заявляемого антимикробного средства на формирование и рост биопленки позаимствована и результаты сопоставлены с результатами, опубликованными вThe method of determining the effect of the proposed antimicrobial agent on the formation and growth of biofilm is borrowed and the results are compared with the results published in
(Бабина К.С.Оценка влияния гигиенического ополаскивателя «Неолактоферрин-дента» на формирование и рост биопленки. // Материалы X международной научно-практической конференции «Современные достижения в науке», том 2, Прага, 2014, с. 65-72.) (в Таблицах ПР-1).(Babina KS. Evaluation of the influence of hygienic rinse "Neolactoferrin-dent" on the formation and growth of biofilm. // Proceedings of the X International Scientific and Practical Conference "Modern achievements in science", volume 2, Prague, 2014, pp. 65-72. ) (in Tables OL-1).
Примечание: При исследовании эффективности заявляемого средства в профилактике иNote: In the study of the effectiveness of the proposed drug in the prevention and
лечении стоматологических заболеваний оценку гигиенического состояния ротовой полости осуществляют по индексу Quigley-Hein в модификации Turesky (S. Tureskyetal., 1970), согласно которому по категориям:in the treatment of dental diseases, an assessment of the hygienic condition of the oral cavity is carried out using the Quigley-Hein index modified by Turesky (S. Tureskyetal., 1970), according to which by category:
- 0 категория - когда не выявлен зубной налет;- 0 category - when not detected plaque;
- 1 категория - зубной налет присутствует частично;- Category 1 - partly dental plaque;
- 2 категория - присутствует бляшка у края десны;- Category 2 - there is a plaque at the edge of the gums;
- 3 категория - окрашивается треть поверхности коронки зуба;- Category 3 - stained third of the surface of the crown of the tooth;
- 4 категория - окрашивается две трети поверхности коронки зуба;- 4 category - two thirds of the surface of the tooth crown is painted;
- 5 категория - окрашивается вся поверхность коронки зуба.- Category 5 - painted the entire surface of the tooth crown.
Готовят 3 образца ополаскивателя зубов: водный раствор моно[(2-диметиламино)этилового] эфира малеиновой кислоты (I) с концентрацией 0,1% мае, водный раствор неолактоферрина (НЛФ) с концентрацией 0,1% мас. (М) и водный раствор смеси равных количеств НЛФ и моно[(2-диметиламино)этилового] эфира малеиновой кислоты (III) с общей концентрацией 0,1%. Добровольцев-участников исследования (60 чел. без различия пола)разделяют по случайному признаку на 5 равных групп (дизайн исследования «splitmouth»):Prepare 3 samples of tooth rinse: an aqueous solution of mono [(2-dimethylamino) ethyl] ester of maleic acid (I) with a concentration of 0.1% may, an aqueous solution of neolactoferrin (NLF) with a concentration of 0.1% by weight. (M) and an aqueous solution of a mixture of equal amounts of NLF and mono [(2-dimethylamino) ethyl] ester of maleic acid (III) with a total concentration of 0.1%. The volunteers participating in the study (60 people without distinction of sex) are randomly divided into 5 equal groups (study design “splitmouth”):
1-я группа: чистка 2 и 3 квадрантов (левая верхняя и нижняя половины челюстей) зубной пастой, 1 и 4 квадранты (правая верхняя и нижняя половины челюстей) - не очищать в течение 3 дней;Group 1: brushing 2 and 3 quadrants (left upper and lower half of jaws) with toothpaste, 1st and 4th quadrants (right upper and lower half of jaws) - do not clean for 3 days;
2 группа: не использовать зубную пасту в течение 3 дней, а применять аппликации ополаскивателя (I) на 1 и 4 квадрантах;Group 2: do not use toothpaste for 3 days, but apply rinse application (I) on 1 and 4 quadrants;
3 группа: в течение 3-х дней очищать 2 и 3 квадранты зубной пастой, на 1 и 4 квадрантах - применять аппликации раствора ополаскивателя (I);Group 3: within 2 days clean the 2 and 3 quadrants with toothpaste, on the 1 and 4 quadrants - apply the application of the rinse solution (I);
4 группа: не использовать зубную пасту в течение 3 дней, на 1 и 4 квадрантах применять ватные валики, смоченные водой;Group 4: do not use toothpaste for 3 days, use cotton rolls moistened with water on 1 and 4 quadrants;
5 группа: очищать 2 и 3 квадранты зубной пастой, на 1 и 4квадрантах -применять ватные валики, смоченные водой.Group 5: clean the 2 and 3 quadrants with toothpaste, on 1 and 4 quadrants - apply cotton rollers moistened with water.
Соответственно ополаскиватели (II) и (III) испытывали аналогичным образом. Результаты испытаний представлены в Таблице 1Accordingly, the rinses (II) and (III) were tested in the same way. The test results are presented in Table 1.
Среднее отклонение в пределах ~ 0,12The average deviation in the range of ~ 0.12
Пример 2Example 2
Влияние ополаскивателя на основе заявляемого антимикробного средства на формирование и рост биопленки определяют как в Примере 1, за исключением того, что в качестве ЛФ используют ЛФ из грудного молока и в качестве эфира - моно[(2-диметиламино)этиловый] эфир фумаровой кислоты. Готовят 3 образца ополаскивателя: водный раствор моно[(2-диметиламино)этилового] эфира фумаровой кислоты (IV) с концентрацией 0,1% мае, водный раствор ЛФ из грудного молока с концентрацией 0,1% мае. (V) и водный раствор смеси равных количеств ЛФ из грудного молока и моно[(2-диметиламино)этилового] эфира фумаровой кислоты (VI) с концентрацией 0,1%.The effect of rinse on the basis of the proposed antimicrobial agent on the formation and growth of biofilms is determined as in Example 1, except that LF from breast milk is used as LF and fumaric acid mono [(2-dimethylamino) ethyl] ester is used as ether. Prepare 3 samples of the rinse: aqueous solution of mono [(2-dimethylamino) ethyl] ether of fumaric acid (IV) with a concentration of 0.1% may, an aqueous solution of LF from breast milk with a concentration of 0.1% may. (V) and an aqueous solution of a mixture of equal amounts of LF from breast milk and mono [(2-dimethylamino) ethyl] ester of fumaric acid (VI) with a concentration of 0.1%.
Результаты испытаний представлены в Таблице 2.The test results are presented in Table 2.
Среднее отклонение в пределах ~ 0,1The average deviation in the range of ~ 0.1
Пример 3Example 3
Влияние ополаскивателя на основе заявляемого антимикробного средства на формирование и рост биопленки определяют как в Примере 1, за исключением того, что готовят 3 образца ополаскивателя: водный раствор смеси моно[(2-диметиламино)этилового] эфира фумаровой кислоты и моно[(2-диметиламино)этилового] эфира янтарной кислоты вThe effect of rinse on the basis of the proposed antimicrobial agents on the formation and growth of biofilms is determined as in Example 1, except that prepare 3 samples of rinse: an aqueous solution of a mixture of fumaric acid ethyl (ethyl ester) ethyl and mono [(2-dimethylamino) a) ethyl] succinic ester in
соотношении 1/1 (VII) с концентрацией 0,1% мае, водный раствор рекомбинантного ЛФ концентрацией 0,1% мае. (VIII) и водный раствор смеси равных количеств рекомбинантного ЛФ и смеси моно[(2-диметиламино)этилового] эфира фумаровой кислоты и моно[(2-диметиламино)этилового] эфира янтарной кислоты в соотношении 1/1 (IX) с концентрацией 0,1%. Результаты испытаний представлены в Таблице 3.the ratio of 1/1 (VII) with a concentration of 0.1% may, an aqueous solution of recombinant LF concentration of 0.1% may. (VIII) and an aqueous solution of a mixture of equal amounts of recombinant LF and a mixture of mono [(2-dimethylamino) ethyl] ester of fumaric acid and mono [(2-dimethylamino) ethyl] ester of succinic acid in a ratio of 1/1 (IX) with a concentration of 0, one%. The test results are presented in Table 3.
Среднее отклонение в пределах ~ 0,1The average deviation in the range of ~ 0.1
Пример 4.Example 4
Оценку заметного антимикробного действия заявляемого средства проводят как в Примере1, за исключением того, что испытуемых разделяют на две равные группы по 12 чел., из которых 1 группа не использует зубную пасту в течение 3 дней, а применяет аппликации ополаскивателя на 1 и 4 квадрантах; 2-я группа в течение 3-х дней очищает 2 и 3 квадранты зубной пастой и на 1 и 4 квадрантах - применяет аппликации раствора ополаскивателя. При этом средство готовят в виде водного раствора с соотношением (мас.): ЛФ/эфир 1/1,5 при концентрациях водного раствора средства (% мас.): 0,01 - 0,025 - 0,05-0,075 - 0,1 - 0,15 - 0,2 и 0,25. Результаты испытаний представлены в Таблице 4.The appreciable antimicrobial effect of the proposed drug is assessed as in Example 1, except that the subjects are divided into two equal groups of 12 people, of which group 1 does not use toothpaste for 3 days, but applies rinse applications on 1 and 4 quadrants; The 2nd group cleans the 2nd and 3rd quadrants with toothpaste for 3 days and on the 1st and 4th quadrants - applies rinse solution applications. When this tool is prepared in the form of an aqueous solution with a ratio (wt.): LF / ether 1 / 1.5 at concentrations of the aqueous solution of the agent (% wt.): 0.01 - 0.025 - 0.05-0.075 - 0.1 - 0.15 - 0.2 and 0.25. The test results are presented in Table 4.
Из Таблицы 4 следует, что антимикробное действие заявляемого средства заметно проявляется при концентрации 0,05 %, достигает максимума при концентрации 0,15% и при дальнейшем увеличении концентрации (до 0,20 или 0,25% мае.) остается практически неизменным. Пример 5.From Table 4 it follows that the antimicrobial effect of the proposed drug is noticeably manifested at a concentration of 0.05%, reaches a maximum at a concentration of 0.15% and with a further increase in concentration (to 0.20 or 0.25% May) remains almost unchanged. Example 5
Оценка общего антимикробного действия композиции.Evaluation of the overall antimicrobial action of the composition.
Примечание Оценку общего антимикробного действия заявляемого антимикробного средства осуществляют при помощи классического бактериологического метода. При определении степени воздействия заявляемого антимикробного средства на микроорганизмы, культивирование последних осуществляют в соответствии с ГОСТ 26670-91 - «Методы культивирования микроорганизмов», а отбор и подготовку проб в соответствии с ГОСТ 26668-85 и ГОСТ 26669-85. При посевах тестовой культуры микроорганизмов используют глубинный метод посева в плотные среды (вкол), поверхностный посев в плотные среды, а также посев в жидкие среды. В настоящем изобретении в качестве питательных сред используют официально зарегистрированные и разрешенные к использованию питательные среды, которые разработаны, зарегистрированы по РУ ФСР и произведены Федеральным государственным учреждением науки «Государственный научный центр прикладной микробиологии и биотехнологии Федеральной Службы по надзору в сфере защиты прав потребителя и благополучия человека».Note The assessment of the overall antimicrobial activity of the proposed antimicrobial agent is carried out using the classical bacteriological method. When determining the degree of impact of the proposed antimicrobial agent on microorganisms, the cultivation of the latter is carried out in accordance with GOST 26670-91 - "Methods for the cultivation of microorganisms", and the selection and preparation of samples in accordance with GOST 26668-85 and GOST 26669-85. When sowing a test culture of microorganisms, a deep method of sowing in dense media (vcol), surface sowing in dense media, and also sowing in liquid media are used. In the present invention, nutrient media officially registered and approved for use are used as nutrient media that have been developed, registered under the RCF RU and produced by the Federal State Institution of Science "State Research Center for Applied Microbiology and Biotechnology of the Federal Service for the Supervision of Consumer Rights Protection and Human Welfare ".
Подготовка образцовSample preparation
Готовят водные растворы ЛФ + эфиры оксикислот концентрации 0,05 и 0,1% мас. При этом эфиры оксикислот используют порознь или в виде смеси в различных сочетаниях. В качестве ЛФ используют рекомбинантный человеческий лактоферрин (РЛФ) и неолактоферрин (НЛФ).Получают 3 образца антимикробного средства в виде растворов определенного состава и концентрации (см. Таблицу 5).Prepare aqueous solutions of LF + ethers of hydroxy acids concentration of 0.05 and 0.1% wt. In this case, hydroxy acid esters are used separately or as a mixture in various combinations. As LF, recombinant human lactoferrin (LF) and neolactoferrin (NLF) are used. Three samples of the antimicrobial agent are obtained in the form of solutions of a specific composition and concentration (see Table 5).
Посев тест-штаммов на агар в чашках Петри (чашки диаметром 100 мм, выстой 15 мм, ГОСТ 25336-82) ведут поверхностным способом (0,15 мл) и глубинным способом - вкол в агар (1,0 мл). Степень разведения продуктов для посева выдерживают в соответствии с ГОСТ 26670-91 как для бактерий, так и для плесеней и грибков.Sowing of test strains on agar in Petri dishes (cups with a diameter of 100 mm, height 15 mm, GOST 25336-82) are superficial method (0.15 ml) and in-depth method - vcol into agar (1.0 ml). The degree of dilution of products for planting is maintained in accordance with GOST 26670-91 for both bacteria and molds and fungi.
В качестве среды для культивирования энтеробактерий, псевдомонад, стафилококков используют «АгарХоттингера», для которого тест-штаммами являются Shigella flexneri 1а 8516, Shigella sonnei "S-form", Pseudomonas aeruginosa ATCC 27853, Serratia marcescens 1. (Среда 1).AgarHottinger is used as a medium for the cultivation of enterobacteria, pseudomonads, staphylococci, for which the test strains are Shigella flexneri 1а 8516, Shigella sonnei "S-form", Pseudomonas aeruginosa ATCC 27853, Serratia marcescens 1. (Wednesday 1).
В качестве среды для культивирования дрожжеподобных и плесневых грибов используют «агар «САБУРО-МАЛЬТОЗА», для которого тест-штаммами являются Candida albicans NCTC 885-653, Staphylococcus aureus АТСС 6538P, Enterobacter cloacae ГИСКА-186. (РУ № ФСР 2009/05625).As a medium for the cultivation of yeast-like and mold fungi use "SABURO-MALTOZA agar", for which the test strains are Candida albicans NCTC 885-653, Staphylococcus aureus ATCC 6538P, Enterobacter cloacae GISCA-186. (RU No. FSR 2009/05625).
Посев тест-штаммов на агар в чашках Петри ведут поверхностным способом (0,15 мл). (Среда 2).Sowing of test strains on agar in Petri dishes are carried out in a superficial manner (0.15 ml). (Wednesday 2).
В качестве среды для первичной идентификации энтеробактерий используют среду «РЕССЕЛЯ-ГРМ» для которой тест-штаммами являются Shigella flexneri 1а 8516, Salmonella paratifi А-225, Alcaligenesfaecalis 415, Escherichiacoli 339 (055:K 59).(РУ № ФСР 2008/02818). Посев тест-штаммов ведут в жидкую среду - до 50 мл. (Среда 3).As the medium for the primary identification of enterobacteria, the medium “RESELIA-GRM” is used for which the test strains are Shigella flexneri 1а 8516, Salmonella paratifi A-225, Alcaligenesfaecalis 415, Escherichiacoli 339 (055: K 59). (RU No. FSR 2008/02818 ). Sowing of test strains is carried out in liquid medium - up to 50 ml. (Wednesday 3).
В процессе приготовления питательных сред в них вводят раствор заявляемого антимикробного средства (Таблица 5) в количестве 0,005 - 0,008 - 0,01 - 0,015 - 0,02 - 0,05 - 0,1% по отношению к массе агара (в пересчете объемов на концентрацию средства в агаре или жидкости). При посеве в жидкую среду раствор композиции вводят в том же количестве.In the process of preparing nutrient media, they are injected with a solution of the proposed antimicrobial agent (Table 5) in an amount of 0.005 - 0.008 - 0.01 - 0.015 - 0.02 - 0.05 - 0.1% relative to the mass of agar (in terms of volumes per concentration of the agent in agar or liquid). When sown in a liquid medium solution of the composition is injected in the same amount.
Для каждой питательной среды готовят контрольные образцы с посевами тест-штаммов с ЛФ и с эфиром, которые вводят в количестве 0,005 - 0,008 - 0,01 - 0,015 - 0,02 - 0,05 - 0,1% (в пересчете объемов на концентрацию композиции в агаре или жидкости) по отношению к массе агара.For each nutrient medium, control samples are prepared with crops of test strains with LF and ether, which are administered in the amount of 0.005 - 0.008 - 0.01 - 0.015 - 0.02 - 0.05 - 0.1% (in terms of volumes to composition in agar or liquid) in relation to the mass of agar.
Одновременно, для каждой питательной среды готовят контрольные образцы с посевами тест-штаммов без ЛФ и эфиров.At the same time, for each nutrient medium, control samples are prepared with the cultures of test strains without LF and ethers.
Далее готовые образцы с посевами тест-штаммов - чашки Петри (плотная среда) и пробирки (стекло, объем 150 мл) - жидкая среда, помещают в термостат, в котором поддерживают следующие параметры: 38°С, аэробная среда, 7 суток. Обсемененность образцов микроорганизмами осуществляют путем подсчета числа колоний, выросших в чашке Петри, в жидких средах - путем определения изменения цвета (окраски) среды. Контроль роста микроорганизмов осуществляют в следующей последовательности: через 1, 3, 6 и 12 часов первых суток, и далее каждые 6 часов последующих суток. Результаты тестов представлены в Таблицах 6, 7 и 8.Next, the finished samples with crops of test strains - Petri dishes (dense medium) and test tubes (glass, volume 150 ml) - liquid medium, placed in a thermostat, in which the following parameters are maintained: 38 ° C, aerobic medium, 7 days. Seeding of samples with microorganisms is carried out by counting the number of colonies grown in a Petri dish, in liquid media — by determining the change in color (color) of the medium. Control of the growth of microorganisms is carried out in the following sequence: after 1, 3, 6 and 12 hours of the first day, and then every 6 hours the next day. The test results are presented in Tables 6, 7 and 8.
Примечание: выдержку в термостате продлили до 21 сут.Note: the shutter speed in the thermostat was extended to 21 days.
Примечание: выдержку в термостате продлили до 21 сут.Note: the shutter speed in the thermostat was extended to 21 days.
Примечание: выдержку в термостате продлили до 21 сут.Note: the shutter speed in the thermostat was extended to 21 days.
Результаты сравнительных и контрольных посевов в питательную среду 1 и среду 2(ЛФ и эфиры по отдельности) и посев в чистую питательную среду представлены в Таблицах 9-14 соответственно.The results of the comparative and control crops in nutrient medium 1 and medium 2 (LF and ethers separately) and seeding in a clean nutrient medium are presented in Tables 9-14, respectively.
Пример 6.Example 6
Оценка фунгицидного воздействия заявляемого антимикробного средства.Evaluation of the fungicidal effects of the proposed antimicrobial agent.
Пациентка М*, 36 лет, жалобы на дискомфортное состояние слизистой вагины. Посев мазка поверхностным способом на «агар«САБУРО-МАЛЬТОЗА» показал наличие грибка Candida albicans.Patient M *, 36 years old, complaints about the discomfort of the vaginal mucosa. Sowing of the smear by the surface method on the “SABURO-MALTOZA agar” showed the presence of the fungus Candida albicans.
Готовят суппозитории (вагинальные капсулы) на основе витепсола Х-19 и антимикробного средства состава (мае): РЛФ/ моно[(2-диметиламино)этиловый] эфир фумаровой кислоты - 2/5 при общем содержании композиции в суппозитории 30 мг, масса суппозитория ~4,0 г. Применяют капсулы по схеме 1 капсула ежевечерне. Побочных явлений не наблюдается. Контрольные мазки берут каждое утро. Результаты представлены в Таблице 15.Suppositories (vaginal capsules) are prepared on the basis of Witepsol X-19 and antimicrobial agent of composition (May): RLF / mono [(2-dimethylamino) ethyl] fumaric acid ester - 2/5 with a total content of the composition in the suppository 30 mg, weight of suppository ~ 4,0 g. Apply capsules according to the scheme 1 capsule every evening. Side effects are not observed. Control smears are taken every morning. The results are presented in Table 15.
Для сравнения: рекомендуемые процедуры лечения проблем слизистой вагиныFor comparison: recommended procedures for treating vaginal mucosa problems
(молочница) - вагинальные таблетки Неотризол (состав: миконазол, неомицин, орнидазол, преднизолон) по 1 табл.1 раз в сутки на ночь 8-16 дней или Флуконазол по 150 мг внутрь на 1, 4, 7 день, далее по 1 капсуле в неделю в течение 6 мес.Отмечено, что указанные средства могут и вызывают крапивницу, сыпь, эритему, жжение, зуд, местное раздражение. (Взято из Интернета - ru.wikipedia.org/wiki/Кандидоз) Пример 7.(thrush) - Neotrizol vaginal tablets (composition: miconazole, neomycin, ornidazole, prednisolone) on 1 table.1 once a day for 8-16 days at night or 150 mg of fluconazole orally for 1, 4, 7 days, then 1 capsule per week for 6 months. It is noted that these drugs can and do cause urticaria, rash, erythema, burning, itching, local irritation. (Taken from the Internet - ru.wikipedia.org/wiki/Candiasis) Example 7.
Оценка лечебного воздействия заявляемого антимикробного средства при стоматологических заболеваниях.Evaluation of the therapeutic effects of the proposed antimicrobial agent for dental diseases.
Пациент Ф**, 41 год, жалоба на боль десен, воспаление десен. Осмотр полости рта подтвердил наличие воспаления десен. Диагноз - гингивит. Предложено лечение - жевательная резинка (состав НЛФ/моно[(2-диметиламино)этиловый] эфир пировиноградной кислоты - 1/3 при общем содержании средства в жевательной резинке 25 мг, масса пластинки резинки - 2,5 г. Состав 30% мас. натурального каучука, 50% ксилита (Е967), 19,5% кленового сиропа и 0,5% ароматизатора (лимонен). Схема применения: 1 резинка утром и 1 вечером. Ежедневный контроль состояния полости рта установил: на четвертый день отек краевой части десны и межзубных сосочков исчез, на пятый день воспаления не наблюдалось, болевые ощущения отсутствовали.Patient F **, 41 years old, complaining of gum pain, gum disease. Examination of the oral cavity confirmed the presence of inflammation of the gums. The diagnosis is gingivitis. The proposed treatment is chewing gum (composition of NLF / mono [(2-dimethylamino) ethyl] pyruvic acid ester - 1/3 with a total content of 25 mg in the chewing gum, the weight of the gum plate is 2.5 g. Composition 30% by weight. Natural rubber, 50% xylitol (E967), 19.5% maple syrup and 0.5% flavoring (limonene). Application: 1 gum in the morning and 1 in the evening. Daily monitoring of the oral cavity revealed: on the fourth day, swelling of the marginal part of the gums and interdental papillae disappeared, no inflammation was observed on the fifth day, pain was absent and.
Для сравнения: Лечение гингивита - полоскания 0,05% раствором хлоргексидина аппликации «Холисал-гелем» Курс лечения составляет 10 дней; обработка десен проводится 2 раза в день - утром и на ночь перед сном.(взято из Интернета 24stoma.ru)For comparison: Treatment of gingivitis - rinsing with a 0.05% chlorhexidine solution of Cholisal-gel application. The course of treatment is 10 days; gum treatment is carried out 2 times a day - in the morning and at night before bed. (taken from the Internet 24stoma.ru)
Пример 8.Example 8
Оценка лечебного воздействия заявляемой антимикробной композиции при стоматологических заболеваниях (формирование и рост биопленки на зубах - профилактика и лечение).Evaluation of the therapeutic effects of the claimed antimicrobial composition for dental diseases (the formation and growth of biofilms on the teeth - prevention and treatment).
Готовят лечебную водорастворимую пленку-подложку (пластырь) для буккального применения в полости рта. Основа пластыря - поливинилпирролидон, лечебное вещество (композиция) - РЛФ/моно[(2-диметиламино)этиловый] эфир фумаровой кислоты 2/5 при общем содержании средства в пластыре 12-15 мг, масса пластыря ~1,0 г, габариты - 7X35 мм, толщина 2 мм. Пленка растворяется в воде при Т=36-37°С в течение ~3,5-4,0 ч. Применение: пластырь наклеивают на зубы правой и левой стороны со стороны щек верхней челюсти перед сном. Определяют формирование и рост биопленки на зубах как результат профилактики и лечения. (См. Пример 1) Исследуют четыре группы пациентов по 10 чел. Подготовка пациентов: ультразвуковая очистка зубов от налета и отложений, полировка зубов.Preparing a therapeutic water-soluble substrate film (patch) for buccal application in the oral cavity. The basis of the patch is polyvinylpyrrolidone, a therapeutic substance (composition) - RLF / mono [(2-dimethylamino) ethyl] fumaric acid ester 2/5 with a total content of agent in the patch of 12-15 mg, the mass of the patch is ~ 1.0 g, dimensions - 7X35 mm, thickness 2 mm. The film dissolves in water at T = 36-37 ° C for ~ 3.5-4.0 hours. Application: apply a plaster on the teeth of the right and left side of the upper jaw cheeks before going to bed. The formation and growth of a biofilm on teeth is determined as a result of prevention and treatment. (See Example 1) Four groups of patients, 10 people in each, are examined. Patient preparation: ultrasonic cleaning of teeth from plaque and deposits, teeth polishing.
Первая группа - ежедневная чистка зубов пастой и применение пластыря (ежедневно течение 4 дней, далее на каждый третий день) по вышеприведенной схеме.The first group is the daily cleaning of the teeth with a paste and the use of a plaster (daily for 4 days, then every third day) according to the above scheme.
Вторая группа - ежедневная чистка зубов пастой без применения пластыря.The second group is the daily cleaning of the teeth with a paste without the use of a patch.
Третья группа - применение пластыря (ежедневно течение 4 дней, далее на каждый третий день) по вышеприведенной схеме без чистки зубов пастой.The third group - the use of the patch (daily for 4 days, then every third day) according to the above scheme without brushing the teeth with a paste.
Четвертая группа - зубы без ухода: ни чистки зубов пастой, ни применения пластыря.The fourth group is teeth without care: neither cleaning the teeth with a paste, nor applying a plaster.
Результаты представлены в Таблице 16.The results are presented in Table 16.
Таким образом, анализ конкретных примеров использования антимикробного средства по заявляемому техническому решению, а также сопоставление результатов тестов с таковыми у известных технических решений, позволяет утверждать, что заявляемое антимикробное средство обладает высокими антисептическими свойствами в отношении подавляющего большинства грамположительных и грамотрицательных бактерий, фунгицидными свойствами в отношении грибов и обеспечивает эффективную профилактику и лечение заболеваний слизистой оболочки рта и других стоматологических заболеваний. Также заявляемое антимикробное средство является достаточно доступным по экономическим соображениям.Thus, the analysis of specific examples of the use of antimicrobial agents by the claimed technical solution, as well as a comparison of test results with those of known technical solutions, suggests that the claimed antimicrobial agent has high antiseptic properties against the vast majority of gram-positive and gram-negative bacteria, fungicidal properties against fungi and provides effective prevention and treatment of diseases of the mucous membrane of the mouth and others with omatologicheskih diseases. Also claimed antimicrobial agent is quite affordable for economic reasons.
Источники информации, принятые во внимание при составлении заявки.Sources of information taken into account in the preparation of the application.
1. И.М. Макеева, Т.Н. Смирнова и др.: Применение лактоферринов в комплексном лечении стоматологических заболеваний (Обзор литературы). Стоматология, т. 91, 4'2012, с. 66-71.1. I.M. Makeeva, T.N. Smirnova et al .: The use of lactoferrins in the complex treatment of dental diseases (Literature review). Dentistry, t. 91, 4'2012, p. 66-71.
2. Патент РФ на изобретение №2415150, опубл. 2011 г2. RF patent for the invention №2415150, publ. 2011
3. Патент РФ на изобретение №2434880 С2, опубл. 2011 г.3. RF patent for invention №2434880 C2, publ. 2011
4 Патент РФ на изобретение №2385162, опубл. 2006 г.4 RF patent for the invention №2385162, publ. 2006
5. Патент РФ на изобретение №2165769, опубл. 2001 г.5. RF patent for the invention №2165769, publ. 2001
6. Патент РФ на изобретение №2396273, опубл. 2010 г.6. RF patent for the invention №2396273, publ. 2010
7. Патент РФ на изобретение №2579661, опубл. 2015 г.7. RF patent for the invention №2579661, publ. 2015
8. Бабина К.С. «Оценка влияния гигиенического ополаскивателя «Неолактоферрин-дента» на формирование и рост биопленки. // Материалы X международной научно-практической конференции «Современные достижения в науке», том 2, Прага, 2014, с. 65-72 - прототип.8. Babina K.S. “Evaluation of the influence of the hygienic rinse“ Neolactoferrin-dent ”on the formation and growth of biofilm. // Proceedings of the X International Scientific and Practical Conference "Modern achievements in science", volume 2, Prague, 2014, p. 65-72 is a prototype.
9. Взято из Интернета - ru.wikipedia.org/wiki/Кандидоз.9. Taken from the Internet - en.wikipedia.org/wiki/Candiasis.
10. Взято из Интернета 24stoma.ru.10. Taken from the Internet 24stoma.ru.
Claims (2)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| RU2018107732A RU2687969C1 (en) | 2018-03-02 | 2018-03-02 | Antimicrobial agent |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| RU2018107732A RU2687969C1 (en) | 2018-03-02 | 2018-03-02 | Antimicrobial agent |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| RU2687969C1 true RU2687969C1 (en) | 2019-05-17 |
Family
ID=66578974
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| RU2018107732A RU2687969C1 (en) | 2018-03-02 | 2018-03-02 | Antimicrobial agent |
Country Status (1)
| Country | Link |
|---|---|
| RU (1) | RU2687969C1 (en) |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2165769C1 (en) * | 2000-07-13 | 2001-04-27 | Якубовская Раиса Ивановна | Antibacterial, antioxidant, immunomodulating and anticancer preparation and method of its embodiment |
| RU2631903C2 (en) * | 2015-08-06 | 2017-09-28 | Федеральное государственное бюджетное учреждение науки "Научный центр биомедицинских технологий Федерального медико-биологического агентства" (ФГБУН НЦБТМ ФМБА России) | Method for preservation of food products |
| CN107496971A (en) * | 2017-07-27 | 2017-12-22 | 东华大学 | A kind of bacteria cellulose/lactoferrin antiseptic dressing and preparation method thereof |
-
2018
- 2018-03-02 RU RU2018107732A patent/RU2687969C1/en active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2165769C1 (en) * | 2000-07-13 | 2001-04-27 | Якубовская Раиса Ивановна | Antibacterial, antioxidant, immunomodulating and anticancer preparation and method of its embodiment |
| RU2631903C2 (en) * | 2015-08-06 | 2017-09-28 | Федеральное государственное бюджетное учреждение науки "Научный центр биомедицинских технологий Федерального медико-биологического агентства" (ФГБУН НЦБТМ ФМБА России) | Method for preservation of food products |
| CN107496971A (en) * | 2017-07-27 | 2017-12-22 | 东华大学 | A kind of bacteria cellulose/lactoferrin antiseptic dressing and preparation method thereof |
Non-Patent Citations (2)
| Title |
|---|
| БАБИНА К.С. Оценка влияния гигиенического ополаскивателя "Неолактоферрин-дента" на формирование и рост биопленки. Материалы X международной научно-практической конференции "Современные достижения в науке", Прага, 2004, том 2, с. 65-72. * |
| МАКЕЕВА И.М. и др. Применение лактоферрина в комплексном лечении стоматологических заболеваний. Стоматология, 2012, т.91, no.4, с.66-71. * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CA2821032C (en) | A composition comprising an antibiotic and a dispersant or an anti -adhesive agent | |
| JP5852007B2 (en) | Chalcones as enhancers of antimicrobial agents | |
| JP7526849B2 (en) | Composition containing a copper compound, a zinc compound, and L-menthol | |
| US20220153789A1 (en) | Novel antimicrobial peptide derived from pseudin-2 peptide and uses thereof | |
| JP6162341B2 (en) | Antifungal composition containing antifungal peptide and terpene alcohol | |
| TWI383798B (en) | Lactobacillus fermentum sg-a95 for improving oral bacterial groups and health care compositions thereof | |
| RU2687969C1 (en) | Antimicrobial agent | |
| EP1519951B1 (en) | Cationic linear peptides having antifungal properties | |
| US20210052696A1 (en) | Novel antimicrobial peptide derived from ll37 peptide and uses thereof | |
| CN113336826B (en) | Antibacterial peptide and application thereof | |
| JP2001507708A (en) | Use of dichlorobenzyl alcohol for preparing formulations for topical treatment of inflammation and formulations containing dichlorobenzyl alcohol | |
| RU2751810C1 (en) | Method for treatment of chronic periodontitis | |
| CN108210385A (en) | A kind of g., jelly-like mouthwash with preventing decayed tooth antibacterial and strong root permanent tooth | |
| US11117931B2 (en) | Antimicrobial peptide derived from Hp1404 peptide and uses thereof | |
| KR20220141946A (en) | Antibacterial peptide derived from Crassostrea gigas and its use | |
| JP5457554B2 (en) | Oral health maintenance and improvement composition | |
| KR102608336B1 (en) | Novel peptide derived from pep27 peptide and uses thereof | |
| CN113143904B (en) | Application of houttuynin analogue in preparation of streptococcus mutans growth and biofilm inhibitor | |
| KR102603281B1 (en) | Novel peptide derived from Hylin a1 peptide and uses thereof | |
| RU2817976C1 (en) | Dental gel with antibacterial effect | |
| CN112194588B (en) | Application of naphthalene ring compound in preparation of products for preventing and treating oral bacteria | |
| KR20240067539A (en) | Composition for treating of dental caries comprising Magnolia flower extract | |
| CN118453566A (en) | Application of sulforaphane in preparing anticarious or/and anticarious products | |
| KR20230040578A (en) | Composition for Inhibiting Biofilm Formation and for Preventing or Treating Dental Disease | |
| CN112174943A (en) | Application of indole-2-ketone compound in preparation of oral bacteria prevention and treatment product |