RU2630974C1

RU2630974C1 - Conjugate of antitumour drugs with recombinant alpha-fetoprotein and its functional fragments and method of their producing

Info

Publication number: RU2630974C1
Application number: RU2016132353A
Authority: RU
Inventors: Елена Дмитриевна Никольская; Никита Григорьевич Яббаров; Ольга Александровна Жунина; Евгений Сергеевич Северин
Original assignee: Автономная некоммерческая организация "Институт молекулярной диагностики" (АНО "ИнМоДи")
Priority date: 2016-08-05
Filing date: 2016-08-05
Publication date: 2017-09-15

Abstract

FIELD: biotechnology.

SUBSTANCE: it is obtained as particles of copolymers of lactic and glycolic acids with antitumour cure of anthracycline series included in them by interaction of -COOH groups of particles activated with 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide and N-hydroxysuccinimide with at least 5-fold excess relative to carboxyl groups, with amino groups of the recombinant alpha-fetoprotein having sequences selected from the group: SEQ1, SEQ2, SEQ3, SEQ4, not less than equimolar amounts in relation to activated carboxyl groups, at a pH from 7.4 to 9, followed by purification on a column of Superose 12 carrier with complete separation of reaction products and separation of the desired conjugate in pure form. A method of producing the conjugate is also disclosed.

EFFECT: increase the effectiveness of the antitumour drug.

3 cl, 7 ex, 10 dwg

Description

Изобретение относится к области медицины, биологии, биотехнологии, молекулярной биологии, нанобиотехнологии и фармакологии и представляет собой конъюгаты и способы их получения, состоящие из цитостатиков, биодеградируемого полимера, поверхностно-активного вещества, криопротектора и векторных молекул для направленной доставки цитостатиков в опухолевые клетки.The invention relates to the field of medicine, biology, biotechnology, molecular biology, nanobiotechnology and pharmacology, and is a conjugate and methods for their preparation, consisting of cytostatics, biodegradable polymer, surfactant, cryoprotectant and vector molecules for targeted delivery of cytostatics to tumor cells.

В качестве цитостатических препаратов используются противоопухолевые препараты антрациклинового ряда, выбранные из группы: (доксорубицин, даунорубицин, эпирубицин, идарубицин, митоксантрон, акларубицин, зорубицин, пирарубицин, валрубицин), в качестве биодеградируемого полимера - сополимеры молочной и гликолевой кислот, в качестве поверхностно-активного вещества - поливиниловый спирт различной концентрации, в качестве криопротектора - моно- и дисахариды, в качестве векторных молекул - рекомбинантные белковые молекулы альфа-фетопротеина (АФП) с и без His- и Tag-последовательностей и/или фрагмент рекомбинантной белковой молекулы альфа-фетопротеина (АФП). Конъюгаты выполнены в виде лиофилизатов, предназначенных для внутривенного введения, и обеспечивают направленное и пролонгированное действие.Antitumor preparations of the anthracycline series are used as cytostatic preparations, selected from the group: (doxorubicin, daunorubicin, epirubicin, idarubicin, mitoxantrone, aclarubicin, zorubicin, pyrarubicin, valrubicin), as a biodegradable polymer as a copolymer as an active glycol copolymer substances - polyvinyl alcohol of various concentrations, as a cryoprotectant - mono- and disaccharides, as vector molecules - recombinant protein molecules alpha-fetoprotein a (AFP) with and without His and Tag sequences and / or a fragment of a recombinant protein molecule of alpha-fetoprotein (AFP). The conjugates are in the form of lyophilisates intended for intravenous administration and provide directed and prolonged action.

Изобретение способствует повышению таргетности в отношении опухолевых клеток, что повышает эффективность лечения и снижает общую токсичность.The invention improves targeting for tumor cells, which increases the effectiveness of treatment and reduces overall toxicity.

Способом решения вышеперечисленных проблем является разработка системы направленной (векторной) доставки химиотерапевтических препаратов в виде полимерных или липосомальных форм, связанных (конъюгированных) с векторными молекулами, обладающими специфическим сродством к поверхности опухолевых клеток.A way to solve the above problems is to develop a system of targeted (vector) delivery of chemotherapeutic drugs in the form of polymer or liposomal forms associated (conjugated) with vector molecules having a specific affinity for the surface of tumor cells.

Известна работа Farokhzad О.С. с соавторами, в которой представлена система направленной доставки противоопухолевых препаратов на основе полимерных частиц PLGA-PEG-COOH к клеткам рака предстательной железы. В качестве векторной молекулы служил аптамер А10 PSMA, селективно связывающий внеклеточный участок простатспецифического антигена [1].Famous work Farokhzad O.S. et al., which presents a system for targeted delivery of anticancer drugs based on polymer particles of PLGA-PEG-COOH to prostate cancer cells. The aptamer A10 PSMA, which selectively binds the extracellular region of the prostate-specific antigen, served as a vector molecule [1].

Известны технические решения, защищенные патентами US 20130052134, WO 2013127949, CN 103745793, СА 2648099, в которых описаны способы конъюгации с использованием различных производных карбодиимида и где использованы сополимеры, такие как PEG-PLGA-PLL, DSPE-PEG-COOH, PLGA-b-PEG и т.п.Known technical solutions protected by patents US 20130052134, WO 2013127949, CN 103745793, CA 2648099, which describe conjugation methods using various carbodiimide derivatives and where copolymers such as PEG-PLGA-PLL, DSPE-PEG-COOH, PLGA-b are used -PEG, etc.

Недостатком этих способов является относительно узкая область применения.The disadvantage of these methods is the relatively narrow scope.

Известны также технические решения, защищенные патентами CN 101744789, PT 1539976, WO 2010028217, US 7105158, US 6555110, в которых описаны способы конъюгации с применением карбодиимидов.Technical solutions are also known, protected by patents CN 101744789, PT 1539976, WO 2010028217, US 7105158, US 6555110, which describe methods of conjugation using carbodiimides.

Недостатком этих изобретений является относительно большое время протекания основной реакции.The disadvantage of these inventions is the relatively large duration of the main reaction.

Известен также способ, защищенный патентом US 7163698 B2, представляющий собой синтез полимера PLGA с использованием пептидных векторных молекул и активирующего агента EDC, при котором используют органические фазы во время реакции конъюгации для получения модифицированного полимера, после чего получают полимерные частицы.Also known is the method protected by US patent 7163698 B2, which is the synthesis of a PLGA polymer using peptide vector molecules and an activating agent EDC, in which organic phases are used during the conjugation reaction to obtain a modified polymer, after which polymer particles are obtained.

Известны также способы получения конъюгатов противоопухолевых препаратов с антителами, выступающими в качестве векторных систем [патенты WO 2016036794, WO 2014119624], в которых в качестве векторных молекул используются антитела.There are also known methods for the preparation of conjugates of antitumor drugs with antibodies acting as vector systems [patents WO 2016036794, WO 2014119624], in which antibodies are used as vector molecules.

Недостатком указанных изобретений является тот факт, что применяемые векторные молекулы не обеспечивают эффективную таргетность в отношении опухолевых клеток-мишеней, а также характеризуются относительно низкой концентрацией препарата в конечном конъюгате. Помимо этого, способы отличаются относительно высокой сложностью, вызванной необходимостью введения дополнительного линкера для получения векторной системы.The disadvantage of these inventions is the fact that the used vector molecules do not provide effective targeting against tumor target cells, and are also characterized by a relatively low concentration of the drug in the final conjugate. In addition, the methods are characterized by relatively high complexity, caused by the need to introduce an additional linker to obtain a vector system.

Известны также работы, в которых представлены результаты по применению в качестве вектора бомбезина (BBN) (Hitesh et al., 2014), система направленной доставки на основе полимерных частиц с использованием моноклональных антител (Li et al., 2011) [2, 3]. В ряде других работ в качестве векторной молекулы для доставки противоопухолевых препаратов используют белок альфа-фетопротеин (АФП) человека, т.к. он имеет рецепторы на поверхности опухолевых клеток [4]. В патентах РФ представлены данные по разработке ряда препаратов на основе АФП и способах их получения из природных источников [RU 2121350 С1, 10.11.1998; RU 2123009 С1, 10.12.1998; RU 2154468 С1, 09.11.1999; RU 2105567 С1, 27.02.1998].There are also works that present the results of the use of bombesin (BBN) as a vector (Hitesh et al., 2014), a system of targeted delivery based on polymer particles using monoclonal antibodies (Li et al., 2011) [2, 3] . In a number of other studies, human alpha-fetoprotein (AFP) protein is used as a vector molecule for the delivery of antitumor drugs, because it has receptors on the surface of tumor cells [4]. The RF patents provide data on the development of a number of AFP-based drugs and methods for their preparation from natural sources [RU 2121350 C1, 11/10/1998; RU 2123009 C1, 12/10/1998; RU 2154468 C1, 11/09/1999; RU 2105567 C1, 02.27.1998].

В патенте US 20090068115 описан способ активации карбоксильных групп полимерных частиц с использованием EDC, для чего проводят реакцию в 0.1 М буфере TEMED, pH 4.8, а также дальнейшую очистку с помощью диализа.US20090068115 describes a method for activating carboxyl groups of polymer particles using EDC, for which a reaction is carried out in 0.1 M TEMED buffer, pH 4.8, as well as further purification using dialysis.

Недостатком способа является относительно большие временные затраты.The disadvantage of this method is the relatively large time costs.

В патенте US 2010015051 описан способ конъюгации в водных средах в боратном буфере при слабокислых значениях pH, причем избыток белка трансферрина удаляют ультрацентрифугированием.US2010015051 discloses a method for conjugation in aqueous media in borate buffer at slightly acidic pH values, the excess transferrin protein being removed by ultracentrifugation.

Недостатком способа является относительно большая сложность и относительно большие временные затраты.The disadvantage of this method is the relatively large complexity and relatively large time costs.

В патенте РФ [RU 2317102 C1, А61К 38/08, 20.02.2008] описано использование в качестве векторной молекулы пептида QMTOVNOG - аналога фрагмента альфа-фетопротеина. В частности, предложено применение пептида формулы QMTOVNOG, являющегося аналогом фрагмента α-фетопротеина с 472-й по 479-ю аминокислоту, способного избирательно захватываться опухолевыми клетками, в качестве векторной молекулы для направленной доставки противоопухолевых препаратов в опухолевые клетки. Кроме того, предложен конъюгат пептида формулы QMTOVNOG с доксорубицином, в котором доксорубицин ковалентно присоединен к указанному пептиду через тиоэфирную связь, в котором ковалентная тиоэфирная связь между ними создана путем взаимодействия SH-группы производного пептида, полученного реакцией пептида с N-гидроксисукцинимидным эфиром S-ацетилтиогликолевой кислоты, и двойной связи малеимидной группы гидразона доксорубицина, полученного реакцией доксорубицина с 4-(N-малеимидометил)циклогексан-1-карбонилгидразидом. Предложена также фармацевтическая композиция для лечения онкологических заболеваний, содержащая конъюгат доксорубицина с векторной молекулой в эффективном количестве и подходящий для внутривенного введения фармацевтический носитель, отличающаяся тем, что в качестве конъюгата доксорубицина она содержит предложенный конъюгат.In the patent of the Russian Federation [RU 2317102 C1, A61K 38/08, 02/20/2008] the use of the QMTOVNOG peptide as an analogue of the alpha-fetoprotein fragment is described as a vector molecule. In particular, it is proposed the use of a peptide of the formula QMTOVNOG, which is an analogue of the fragment of α-fetoprotein from the 472th to 479th amino acids, which can be selectively captured by tumor cells, as a vector molecule for targeted delivery of antitumor drugs to tumor cells. In addition, a conjugate of a peptide of the formula QMTOVNOG with doxorubicin is proposed, in which doxorubicin is covalently attached to the indicated peptide via a thioether bond in which the covalent thioether bond between them is created by reacting the SH group of the derivative peptide obtained by the reaction of the peptide with N-hydroxysuccincimide amide acid, and a double bond of the maleimide group of hydrazone doxorubicin obtained by reaction of doxorubicin with 4- (N-maleimidomethyl) cyclohexane-1-carbonylhydrazide. Also proposed is a pharmaceutical composition for the treatment of cancer, comprising a doxorubicin conjugate with a vector molecule in an effective amount and a pharmaceutical carrier suitable for intravenous administration, characterized in that it contains the conjugate of doxorubicin conjugate.

Недостатком этого конъюгата является относительно низкая таргетность в отношении опухолевых клеток-мишеней.The disadvantage of this conjugate is its relatively low targeting for target tumor cells.

Одним из близких к предложенной системе направленной доставки является противоопухолевой пептидный препарат, созданный на основе рекомбинантного фргамента альфа-фетопротеина (АФП) человека. Препарат способен связываться с рецептором альфа-фетопротеина и ингибировать эстрадиол-индуцированный рост клеток гормонзависимых опухолей, а также выполнять функцию векторной молекулы для направленной доставки химитерапевтического препарата в опухолевые клетки [RU 2285537 C1, А61К 38/12, 20.10.2006].One of the close ones to the proposed targeted delivery system is an antitumor peptide preparation based on the recombinant human alpha-fetoprotein (AFP) fragment. The drug is able to bind to the alpha-fetoprotein receptor and inhibit estradiol-induced cell growth of hormone-dependent tumors, and also perform the function of a vector molecule for targeted delivery of a chemotherapeutic drug to tumor cells [RU 2285537 C1, AK 38/12, 10.20.2006].

Недостатком данного препарата является относительно низкая эффективность применения.The disadvantage of this drug is the relatively low efficiency of use.

Наиболее близким к предложенному препарату является противоопухолевый препарат [RU 2451509 C1, А61К 31/337, 27.05.2012], представляющий собой стабильные наночастицы и включающий цитостатик, биодеградирующий полимер, поверхностно-активное вещество, криопротектор и векторную молекулу для адресной доставки частиц в пораженные органы и ткани, при этом в качестве цитотостатика содержит паклитаксел - 0,4÷1,0 мас.%, в качестве биодеградирующего полимера - сополимер молочной и гликолевой кислот (PLGA 50:50) - 14,0÷15,0 мас.%, в качестве поверхностно-активного вещества - сукцинилированный поливиниловый спирт - 3,5÷4,0 мас.%, в качестве векторной молекулы для адресной доставки частиц в пораженные органы и ткани - C-концевой домен альфа-фетопротеина (р3дАФП) - 0,1÷0,3 мас.%, а в качестве криопротектора - D-маннит - 75,0÷80,0 мас.%.Closest to the proposed drug is an antitumor drug [RU 2451509 C1, A61K 31/337, 05/27/2012], which is a stable nanoparticle and includes a cytostatic agent, biodegradable polymer, surfactant, cryoprotectant and vector molecule for targeted delivery of particles to the affected organs and tissue, while as a cytotoxic agent contains paclitaxel - 0.4 ÷ 1.0 wt.%, as a biodegradable polymer - a copolymer of lactic and glycolic acids (PLGA 50:50) - 14.0 ÷ 15.0 wt.%, as a surfactant, su vinyl chloride polyvinyl alcohol - 3.5 ÷ 4.0 wt.%, as a vector molecule for targeted delivery of particles to the affected organs and tissues - the C-terminal domain of alpha-fetoprotein (r3dAFP) - 0.1 ÷ 0.3 wt.% and as a cryoprotectant - D-mannitol - 75.0 ÷ 80.0 wt.%.

Недостатком наиболее близкого технического решения относительно предложенного противоопухолевого препарата является относительно низкая эффективность, обусловленная относительно низкой таргетностью в отношении опухолевых клеток, что снижает эффективность лечения и повышает общую токсичность при его применении.The disadvantage of the closest technical solution regarding the proposed antitumor drug is the relatively low efficiency, due to the relatively low targeting against tumor cells, which reduces the effectiveness of the treatment and increases the overall toxicity in its application.

Наиболее близким к предложенному способу является способ получения конъюгата полимеркапсулированного противоопухолевого агента из группы таксанов с активным фрагментом АФП, описанный в том же техническом решении [RU 2451509 C1, А61К 31/337, 27.05.2012], в частности способ получение конъюгата сополимера молочной и гликолевой кислот с доксорубицином, согласно которому 150.0 мг сополимера молочной и гликолевой кислот (PLGA-COOH 50/50), содержащего свободную концевую карбоксильную группу, растворяют в 1,5 мл хлороформа, к раствору добавляют 18.0 мг дициклогексилкарбодиимида и 10.0 мг N-гидроксисукцинимида (10-кратные молярные избытки по отношению к полимеру), реакционную смесь перемешивают в течение 2 ч при комнатной температуре и отделяют от выпавшего осадка дициклогексилмочевины с помощью фильтрации, к смеси прибавляют 5.0 мкл триэтиламина и 7,5 мг доксорубицина гидрохлорида, реакционную смесь перемешивают в течение 15 ч, очистку реакционной смеси от избытка доксорубицина производят с помощью трехкратной экстракции 0.1 М водным раствором соляной кислоты, продукт реакции очищают преципитацией в ледяном метаноле, осадок собирают центрифугированием при 18 тыс.g в течение 30 мин, предварительно выпарив из раствора хлороформ под вакуумом.Closest to the proposed method is a method for producing a conjugate of a polymer-encapsulated antitumor agent from a group of taxanes with an active AFP fragment described in the same technical solution [RU 2451509 C1, A61K 31/337, 05.27.2012], in particular, a method for producing a conjugate of a milk and glycol copolymer acids with doxorubicin, according to which 150.0 mg of a copolymer of lactic and glycolic acids (PLGA-COOH 50/50) containing a free terminal carboxyl group is dissolved in 1.5 ml of chloroform, 18.0 mg of dicyclohexylcarb are added to the solution odiimide and 10.0 mg N-hydroxysuccinimide (10-fold molar excess with respect to the polymer), the reaction mixture is stirred for 2 hours at room temperature and separated from the precipitated dicyclohexylurea by filtration, 5.0 μl of triethylamine and 7.5 mg are added to the mixture doxorubicin hydrochloride, the reaction mixture is stirred for 15 hours, the reaction mixture is purified from excess doxorubicin by three times extraction with 0.1 M aqueous hydrochloric acid, the reaction product is purified by precipitation in ice-cold m ethanol, the precipitate is collected by centrifugation at 18 thousand g for 30 minutes, after having previously evaporated from a solution of chloroform under vacuum.

Недостатком наиболее близкого к предложенному способа является относительно узкая область применения, обусловленная тем, что он не может быть использован для получения противоопухолевого препарата, обладающего более высокой эффективностью, определяемой повышенной таргетностью в отношении опухолевых клеток и более низкой токсичностью при его применении.The disadvantage of the closest to the proposed method is the relatively narrow scope, due to the fact that it cannot be used to obtain an antitumor drug with higher efficacy, which is determined by increased targeting against tumor cells and lower toxicity when it is used.

Кроме того, известный способ отличается и относительно большим временем проведения реакции. Дополнительно можно отметить, что поскольку операция очистки в известном способе заключается в центрифугировании и ультрафильтрации, то полученный конъюгат возможно отделить лишь от низкомолекулярных примесей и невозможно отделить несвязавшиеся молекулы белка, что может привести к снижению эффективности препарата за счет блокировки рецепторов на поверхности опухолевых клеток, что, в свою очередь, приводит к снижению уровня связывания целевого препарата.In addition, the known method is characterized by a relatively long reaction time. Additionally, it can be noted that since the purification operation in the known method consists in centrifugation and ultrafiltration, the resulting conjugate can be separated only from low molecular weight impurities and it is impossible to separate unbound protein molecules, which can lead to a decrease in the effectiveness of the drug due to blocking of receptors on the surface of tumor cells, which in turn, leads to a decrease in the level of binding of the target drug.

Задачей, которая решается в предложенном изобретении, является разработка противоопухолевого препарата, обладающего более высокой эффективностью применения за счет повышения таргетности в отношении опухолевых клеток и снижения токсичность при его применении, а также способа его получения, обладающего более широкой областью применения, меньшим временем получения более чистого препарата.The problem that is solved in the proposed invention is the development of an antitumor drug with higher efficacy due to increased targeting against tumor cells and reduced toxicity in its use, as well as its production method, which has a wider scope, shorter time to obtain a cleaner the drug.

Техническим результатом заявленного изобретения является расширение арсенала средств с доказанной противоопухолевой активностью и способов их получения путем получения противоопухолевого препарата, обладающего более высокой эффективностью применения за счет повышения таргетности в отношении опухолевых клеток и снижения токсичность при его применении, а также способа его получения, обладающего более широкой областью применения, меньшим временем получения более чистого препарата.The technical result of the claimed invention is to expand the arsenal of drugs with proven antitumor activity and methods for their preparation by obtaining an antitumor drug with higher efficacy due to increased targeting against tumor cells and lower toxicity when it is used, as well as its production method, which has a wider scope, shorter time to obtain a cleaner product.

Поставленная задача решается, а требуемый технический результат достигается тем, что предложен конъюгат, обладающий противоопухолевой активностью, при получении которого обеспечивают взаимодействие частиц из сополимеров молочной и гликолевой кислот с включенными в них противоопухолевыми препаратами антрациклинового ряда, с -COOH группами, активированными 1-этил-3-(3-диметиламинопропила) карбодиимидом и N-гидроксисукцинимидом при их не менее 5-кратном избытке по отношению к карбоксильным группам, с аминогруппами рекомбинатнтного белка альфа-фетопротеина, имеющего последовательности, выбранные из группы: SEQ1, SEQ2, SEQ3, SEQ4, в эквимолярных количествах в отношении карбоксильных групп, при pH от 7.4 до 9, а также проводят последующую очистку на колонке с носителем Superose 12 и осуществляют разделение продуктов реакции и выделяют целевой конъюгат в чистом виде.The problem is solved, and the required technical result is achieved by the fact that the proposed conjugate with antitumor activity, upon receipt of which provide the interaction of particles from copolymers of lactic and glycolic acids with antitumor drugs included in them anthracycline series, with -COOH groups activated by 1-ethyl- 3- (3-dimethylaminopropyl) carbodiimide and N-hydroxysuccinimide with at least 5-fold excess of them in relation to carboxyl groups, with amino groups of recombinant protein a pf-fetoprotein having sequences selected from the group: SEQ1, SEQ2, SEQ3, SEQ4, in equimolar amounts with respect to carboxyl groups, at a pH of 7.4 to 9, and also carry out subsequent purification on a column with a Superose 12 carrier and carry out the separation of reaction products and isolate the target conjugate in pure form.

Кроме того, требуемый технический результат достигается тем, что, в качестве включенных в сополимеры молочной и гликолевой кислот противоопухолевых препаратов антрациклинового ряда используют или доксорубицин, или даунорубицин, или иэпирубицин, или идарубицин, или митоксантрон, или акларубицин, или зорубицин, или пирарубицин, или валрубицин.In addition, the required technical result is achieved by the fact that, as included in the copolymers of lactic and glycolic acid antitumor preparations of the anthracycline series, either doxorubicin, or daunorubicin, or ipirubicin, or idarubicin, or mitoxantrone, or aclarubicin, or zorubicin, or pira valrubicin.

Кроме того, требуемый технический результат достигается тем, что для получения конъюгата используют способ, характеризующийся тем, что COOH группы полимерных частиц активируют 1-этил-3-(3-диметиламинопропила) карбодиимидом и N-гидроксисукцинимидом при их не менее 5-кратном избытке по отношению к карбоксильным группам, добавляют не больше 2 мкл 2-меркаптоэтанола и инкубируют 10 минут, затем добавляют рекомбинантный белок не меньше, чем в эквимолярных количествах в отношении активированных карбоксильных групп, доводят pH реакционной смеси до щелочных значений (от 7.4 до 9), оставляют для перемешивания 30 минут, далее останавливают реакцию и вводят не более 2 мкл этаноламина, после чего реакционную смесь очищают на колонке с носителем Superose 12 с полным разделением продуктов реакции и выделяют целевой конъюгата в чистом виде.In addition, the required technical result is achieved by the fact that to obtain the conjugate, a method is used, characterized in that the COOH groups of polymer particles activate 1-ethyl-3- (3-dimethylaminopropyl) carbodiimide and N-hydroxysuccinimide with at least 5-fold excess of in relation to carboxyl groups, add no more than 2 μl of 2-mercaptoethanol and incubate for 10 minutes, then add recombinant protein not less than in equimolar amounts with respect to activated carboxyl groups, adjust the pH of the reaction mixture to intramural values (from 7.4 to 9), left to mix for 30 minutes, then stop the reaction and add no more than 2 μl of ethanolamine, after which the reaction mixture is purified on a Superose 12 column with a complete separation of the reaction products and the target conjugate is isolated in pure form.

На чертеже графических материалах представлены:The drawing graphic materials presented:

на фиг. 1 - уровень связывания (+4°C) и эндоцитоза (+37°C) опухолевыми клетками аденокарциномы молочной железы человека линии MCF7 после 1 ч инкубации с белками: АФП абортный и рекомбинантный АФП;in FIG. 1 - level of binding (+ 4 ° C) and endocytosis (+ 37 ° C) by tumor cells of the MCF7 human breast adenocarcinoma after 1 hour of incubation with proteins: AFP abortion and recombinant AFP;

на фиг. 2 - хроматограмма разделения продуктов реакции конъюгации полимерных частиц, содержащих противоопухолевый препарат антрациклинового ряда, и белковой векторной молекулы с использованием эксклюзионной хроматографии на смоле Superose 12;in FIG. 2 is a chromatogram for the separation of conjugation reaction products of polymer particles containing an antitumor preparation of the anthracycline series and a protein vector molecule using size exclusion chromatography on Superose 12 resin;

на фиг. 3 - уровень связывания (+4°C) и эндоцитоза (+37°C) опухолевыми клетками лимфолейкоза мыши линии Р388 после 1 ч инкубации с конъюгатом наночастиц, содержащих доксорубицин, с векторным белком (АФП-Fitc) и несвязанного векторного белка (АФП-Fitc);in FIG. 3 - level of binding (+ 4 ° C) and endocytosis (+ 37 ° C) by tumor cells of the P388 mouse lymphocytic leukemia after 1 hour of incubation with a conjugate of nanoparticles containing doxorubicin, with a vector protein (AFP-Fitc) and unbound vector protein (AFP- Fitc);

на фиг. 4 - уровень связывания (+4°C) и эндоцитоза (+37°C) опухолевыми клетками карциномы шейки матки человека линии HeLa после 1 ч инкубации с наночастицами и конъюгатом наночастиц, содержащих доксорубицин, с векторным белком (АФП3Д);in FIG. 4 - level of binding (+ 4 ° C) and endocytosis (+ 37 ° C) by HeLa human cervical carcinoma tumor cells after 1 hour of incubation with nanoparticles and conjugate of nanoparticles containing doxorubicin with vector protein (AFP3D);

на фиг. 5 - выживаемость клеток (IC50, концентрация доксорубицина мкМ) аденокарциномы молочной железы человека линии MCF-7 после инкубации с лекарственной субстанцией доксорубицина (ДР) и конъюгата полимерных частиц доксорубицина с рАФП (рАФП-нано-ДР);in FIG. 5 - cell survival (IC50, doxorubicin concentration μM) of MCF-7 human breast adenocarcinoma after incubation with the drug substance doxorubicin (DR) and the conjugate of polymer particles of doxorubicin with rAFP (rAFP-nano-DR);

на фиг. 6 - сравнение значений IC₅₀ (концентрация доксорубицина, нМ) для клеток лимфоцитов периферической крови человека после 72 ч инкубации с доксорубицином, наночастицами и конъюгатом наночастиц, содержащих доксорубицин, с векторным белком (рАФП);in FIG. 6 is a comparison of IC ₅₀ values (doxorubicin concentration, nM) for human peripheral blood lymphocyte cells after 72 hours of incubation with doxorubicin, nanoparticles and a conjugate of nanoparticles containing doxorubicin, with vector protein (rAFP);

на фиг. 7 - аминокислотная последовательность рекомбинантного АФП (SEQ1);in FIG. 7 - amino acid sequence of recombinant AFP (SEQ1);

на фиг. 8 - аминокислотная последовательность рекомбинантного фрагмента АФП (АФП3Д) (SEQ2);in FIG. 8 - amino acid sequence of a recombinant fragment of AFP (AFP3D) (SEQ2);

на фиг. 9 - аминокислотная последовательность рекомбинантного АФП с аффинной меткой his-tag (АФП-His) (SEQ3);in FIG. 9 - amino acid sequence of recombinant AFP with affinity tag his-tag (AFP-His) (SEQ3);

на фиг. 10 - аминокислотная последовательность рекомбинантного АФП с аффинной меткой FLAG-tag (подчеркнут) (АФП-Flag) (SEQ4).in FIG. 10 is the amino acid sequence of recombinant AFP affinity tag FLAG-tag (underlined) (AFP-Flag) (SEQ4).

Способ получения конъюгата противоопухолевых препаратов с рекомбинантным альфа-фетопротеином и его функциональными фрагментами осуществляется следующим образом.A method of obtaining a conjugate of antitumor drugs with recombinant alpha-fetoprotein and its functional fragments is as follows.

Получаемый предложенным способом противоопухолевый препарат обеспечивает направленную доставку противоопухолевых препаратов непосредственно в опухолевые клетки, защищая их от воздействия резистентных механизмов и обеспечивая пролонгированный эффект.Obtained by the proposed method, the antitumor drug provides targeted delivery of antitumor drugs directly to the tumor cells, protecting them from the action of resistant mechanisms and providing a prolonged effect.

Заявленный способ предназначен для получения конъюгатов полимерных частиц, содержащих цитостатические препараты, с рекомбинантным АФП и его функциональными фрагментами.The claimed method is intended to produce conjugates of polymer particles containing cytostatic preparations with recombinant AFP and its functional fragments.

Для получения конъюгатов использовали карбодиимидный способ. Этот способ отличается простотой, относительно небольшим временем проведения реакции, а также относительно приемлемыми условиями, в которых она протекает.To obtain the conjugates used carbodiimide method. This method is notable for its simplicity, relatively short reaction time, and also relatively acceptable conditions in which it proceeds.

Отметим, что, одним из способов лечения онкологических заболеваний является применение химиотерапевтических препаратов. На протяжении многих лет в качестве противоопухолевых веществ используются антибиотики антрациклинового ряда [5]. Первые антрациклины были выделены из пигментопродуцирующих бактерий Streptomyces peucetius в 1960-х годах. Данные препараты активно используются при терапии злокачественных опухолей различного происхождения, таких как различных гематологических видов онкологии, саркомы мягких тканей, карциномы и других опухолей. Спектр показаний к применению конкретного антибиотика определяется его химическим строением, индивидуальными фармакокинетическими и фармакодинамическими свойствами и степенью его изученности.Note that, one of the ways to treat cancer is the use of chemotherapeutic drugs. Over the years, anthracycline antibiotics have been used as antitumor substances [5]. The first anthracyclines were isolated from the pigment-producing bacteria Streptomyces peucetius in the 1960s. These drugs are actively used in the treatment of malignant tumors of various origins, such as various hematological types of oncology, soft tissue sarcoma, carcinoma and other tumors. The spectrum of indications for the use of a particular antibiotic is determined by its chemical structure, individual pharmacokinetic and pharmacodynamic properties and its degree of knowledge.

Механизм действия препаратов данной группы обусловлен ингибированием синтезануклеиновых кислот путем интеркаляции между парами азотистых оснований, что приводит к нарушению вторичной спирализации ДНК за счет взаимодействия с топоизомеразой II. Кроме того, происходит взаимодействие с липидами клеточных мембран, нарушая, тем самым, транспорт ионов и целый ряд других функций клетки.The mechanism of action of drugs of this group is due to the inhibition of synthesanucleic acids by intercalation between pairs of nitrogen bases, which leads to disruption of the secondary helixing of DNA due to interaction with topoisomerase II. In addition, there is an interaction with lipids of cell membranes, thereby disrupting ion transport and a number of other cell functions.

Настоящее изобретение относится к терапевтическим комбинациям, содержащим препараты антрациклинового ряда. К таковым относятся следующие препараты, не ограничивающие объема изобретения:The present invention relates to therapeutic combinations containing anthracycline drugs. These include the following drugs, not limiting the scope of the invention:

1. «Доксорубицин» - антрациклиновый антибиотик. Его применяют для лечения лимфобластного лейкоза, саркомы мягких тканей, остеогенной саркомы, саркомы Юинга, рака молочной железы, рака щитовидной железы, опухоли Вильмса, нейробластомы, рака мочевого пузыря, рака желудка, рака яичников, лимфогранулематоза, неходжкинских лимфом, трофобластических опухолей, рефрактерного рака яичника, саркомы Капоши [6-10].1. “Doxorubicin” is an anthracycline antibiotic. It is used to treat lymphoblastic leukemia, soft tissue sarcoma, osteogenic sarcoma, Ewing sarcoma, breast cancer, thyroid cancer, Wilms tumor, neuroblastoma, bladder cancer, stomach cancer, ovarian cancer, lymphogranulomatosis, non-Hodgkin’s lymphoma, trophoblastic cancer ovary, Kaposi’s sarcoma [6-10].

Механизм действия доксорубицина заключается во взаимодействии с ДНК, образовании свободных радикалов и прямом воздействии на мембраны клеток с подавлением синтеза нуклеиновых кислот. Клетки чувствительны к препарату в S- и G2-фазах. Однако, ввиду высокой токсичности доксорубицина, его применение сопряжено с рядом побочных эффектов: тромбоцитопенией, лейкопенией, анемией, кардиомиопатией, сердечная недостаточностью, аритмией, стоматитом, эзофагитом, тошнотой, рвотой, диареей, азооспермиеей, аменореей, аллергическими реакциями, алопецией, гиперурикемией, нефропатией и др.The mechanism of action of doxorubicin is the interaction with DNA, the formation of free radicals and direct effects on cell membranes with inhibition of nucleic acid synthesis. Cells are sensitive to the drug in S and G2 phases. However, due to the high toxicity of doxorubicin, its use is associated with a number of side effects: thrombocytopenia, leukopenia, anemia, cardiomyopathy, heart failure, arrhythmia, stomatitis, esophagitis, nausea, vomiting, diarrhea, azoospermia, amenorrhea, nephropathy, allergy, allergy, and allergy and etc.

2. «Даунорубицин» применяют для лечения острого лимфобластного и нелимфобластного (миелобластного, монобластного, эритробластного) лейкоза, неходжкинских лимфом, опухоли Юинга, опухоли Вильмса, бластного криза хронического миелолейкоза, лимфосаркомы, хорионэпителиомы матки, злокачественного гистоцитоза (у взрослых и детей), саркомы мягких тканей, нейробластомы (у детей). Применяют в комбинации с другими противоопухолевыми средствами в составе программ индукции ремиссии [11, 12].2. “Daunorubicin” is used for the treatment of acute lymphoblastic and non-lymphoblastic (myeloblastic, monoblastic, erythroblastic) leukemia, non-Hodgkin’s lymphomas, Ewing's tumor, Wilms’s tumor, blast crisis of chronic myelogenous leukemia, lymphosarcoma, adult uterine chorionoid cell carcinoma, soft tissues, neuroblastomas (in children). Used in combination with other antitumor agents as part of remission induction programs [11, 12].

Механизм действия даунорубицина заключается в воздействии на S-фазу митоза. Кроме того, даунорубицин блокирует матричную функцию ДНК, нарушая синтез нуклеиновых кислот и белка. Противоопухолевая активность реализуется также через взаимодействие с мембранами и образование свободных радикалов семихинонного типа.The mechanism of action of daunorubicin is the effect on the S-phase of mitosis. In addition, daunorubicin blocks the matrix function of DNA, disrupting the synthesis of nucleic acids and protein. Antitumor activity is also realized through interaction with membranes and the formation of free radicals of the semiquinone type.

Даунорубицин обладает рядом побочных эффектов, к которым можно отнести следующие: угнетение костномозгового кроветворения (анемия, лейкопения, нейтропения, тромбоцитопения), развитие или усугубление сердечной недостаточности (аритмия, одышка, отечность в области голеностопных суставов), тошноту, снижение аппетита, рвоту, диарею, изъязвление слизистой оболочки ЖКТ (язвенный стоматит, эзофагит), гиперурикемию (болезненное или затрудненное мочеиспускание, цистит), аменорею, азооспермию, аллергические реакции, головную боль, алопецию и др.Daunorubicin has a number of side effects, which include the following: inhibition of bone marrow hematopoiesis (anemia, leukopenia, neutropenia, thrombocytopenia), the development or worsening of heart failure (arrhythmia, shortness of breath, swelling in the ankle joints), nausea, and decreased appetite. ulceration of the gastrointestinal mucosa (ulcerative stomatitis, esophagitis), hyperuricemia (painful or difficult urination, cystitis), amenorrhea, azoospermia, allergic reactions, headache, alopecia, etc.

Таким образом, существенным недостатком используемых в настоящее время противоопухолевых препаратов является их высокая токсичность, которая вызывает интоксикацию организма пациента, а также множественные побочные эффекты.Thus, a significant drawback of the antitumor drugs currently used is their high toxicity, which causes intoxication of the patient's body, as well as multiple side effects.

Другим недостатком является возникновение у опухолевых клеток множественной лекарственной устойчивости (МЛУ). Механизм МЛУ связан с гиперэкспрессией трансмембранных белков семейства АВС-транспортеров, которые способны удалять химиотерапевтические агенты из опухолевой клетки [13].Another disadvantage is the occurrence of multidrug resistance (MDR) in tumor cells. The MDR mechanism is associated with the overexpression of transmembrane proteins of the ABC transporter family, which are capable of removing chemotherapeutic agents from tumor cells [13].

Изобретение может быть применено для лечения опухолевых злокачественных новообразований при наличии на поверхности опухолевых клеток рецепторов к альфа-фетопротеину (АФП), а именно: для лечения аденокарциномы молочной железы человека линий MCF 7 и сублинии MCF 7 Adr, резистентной к антрациклиновым антибиотикам; карциномы шейки матки человека линии HeLa; остеосаркомы человека линии MG 63; аденокарциномы яичника человека линии SKOV3, резистентной линии SKVLB и линии OVCAR 8; B-клеточных лимфом человека линий Raji и Namalva; Т-клеточных лимфом человека линий СЕМ, Molt-4, Jukart, QOS; эритролейкоза человека линии K562; миелолейкоза человека линий TF-1 и KG-1; аденокарциномы предстательной железы человека линий LnCaP и Du145; эпидермоидной карциномы человека А-431; нейробластомы человека линии IMR-32; гепатомы человека линии Alexander и HepG2; карциномы сигмовидной кишки человека линии Colo320; аденокарциномы ободочной кишки человека линии Caco-2; аденокарциномы 12-перстной кишки человека линии HuTu80; аденокарциномы прямой кишки человека линии SW837; немелкоклеточной карциномы легкого человека линии А549; глиомы человека линии U373MG; миеломы человека линий U266 и IM9; лейкосаркомы человека линии SK-UT-1B; карциномы глотки человека линии KB; мелкоклеточной карциномы легкого человека линии Н69; меланомы человека линий SK-MEL-1, MS и Bro В19.The invention can be applied for the treatment of tumor malignant neoplasms in the presence of alpha-fetoprotein (AFP) receptors on the surface of tumor cells, namely: for the treatment of human breast adenocarcinoma of the MCF 7 lines and subline MCF 7 Adr resistant to anthracycline antibiotics; human cervical carcinomas of the HeLa line; human osteosarcoma line MG 63; human ovarian adenocarcinomas of the SKOV3 line, resistant SKVLB line, and OVCAR 8 line; Human B-cell lymphomas of the lines Raji and Namalva; Human T-cell lymphomas of the lines CEM, Molt-4, Jukart, QOS; human erythroleukemia line K562; human myeloid leukemia of the TF-1 and KG-1 lines; human prostate adenocarcinomas of the LnCaP and Du145 lines; human epidermoid carcinoma A-431; human neuroblastoma line IMR-32; human hepatomas of the Alexander and HepG2 line; Colo320 human sigmoid colon carcinoma; Caco-2 human colon adenocarcinomas; HuTu80 human duodenal adenocarcinoma; rectal adenocarcinoma of the human line SW837; non-small cell lung carcinoma of the human line A549; human gliomas of the line U373MG; human myelomas of the lines U266 and IM9; human leukosarcoma line SK-UT-1B; human pharyngeal carcinomas of the KB line; small cell lung carcinoma of the human line H69; human melanomas of the lines SK-MEL-1, MS and Bro B19.

Термины «рак» и «злокачественная опухоль» относятся или описывают физиологическое состояние у млекопитающих, которое обычно характеризуется нерегулируемым клеточным ростом/пролиферацией.The terms "cancer" and "malignant tumor" refer to or describe the physiological condition in mammals, which is usually characterized by unregulated cell growth / proliferation.

Примеры злокачественной опухоли включают без ограничения карциному, лимфому, бластому, саркому и лейкоз. Более конкретные примеры таких злокачественных опухолей включают плоскоклеточный рак, мелкоклеточный рак легкого, немелкоклеточный рак легкого, аденокарциному легкого, плоскоклеточную карциному легкого, рак брюшины, гепатоклеточный рак, рак желудочно-кишечного тракта, рак поджелудочной железы, глиобластому, рак шейки матки, рак яичника, рак печени, рак мочевого пузыря, гепатому, рак молочной железы, рак ободочной кишки, рак прямой и ободочной кишки, карциному эндометрия или матки, карциному слюнных желез, рак почек, рак печени, рак простаты, рак вульвы, рак щитовидной железы, карциному печени и различные типы рака головы и шеи.Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More specific examples of such malignancies include squamous cell carcinoma, small cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous cell carcinoma of the lung, peritoneal cancer, hepatocellular carcinoma, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, cancer of the rectum and colon, endometrial or uterine carcinoma, salivary carcinoma, kidney cancer, liver cancer, cancer is simple you, vulvar cancer, thyroid cancer, liver carcinoma and various types of head and neck cancer.

Термин «противоопухолевая активность» означает активность конъюгата в отношении как гормоно-зависимых, так и гормоно-независимых опухолей.The term "antitumor activity" means the activity of the conjugate in relation to both hormone-dependent and hormone-independent tumors.

Термины «химиотерапевтические препараты», «противоопухолевые препараты», «цитотоксическое средство» обозначают химические соединения, пригодные для лечения онкологических заболеваний, обладающие схожим механизмом действия, структурной формулой и физико-химическими свойствами. Данные термины включают противоопухолевые антибиотики антрациклинового ряда или другие интеркалирующие агенты, отвечающие вышеуказанным требованиям (такие как: доксорубицин, даунорубицин и др., не включая дактиномицин).The terms "chemotherapeutic drugs", "antitumor drugs", "cytotoxic agent" denote chemical compounds suitable for the treatment of cancer, with a similar mechanism of action, structural formula and physico-chemical properties. These terms include antitumor antibiotics of the anthracycline series or other intercalating agents that meet the above requirements (such as: doxorubicin, daunorubicin, etc., not including dactinomycin).

«Химиотерапевтическим средством» является химическое соединение, которое можно использовать для лечения злокачественной опухоли. Примеры химиотерапевтических средств включают алкилирующие агенты, такие как тиотепа и CYTOXAN® циклофосфамид; алкилсульфонаты, такие как бусульфан, импросульфан и пипосульфан; азиридины, такие как бензодопа, карбоквон, метуредопа и уредопа; этиленимины и метилмеламины, включая алтретамин, триэтиленмеламин, триэтиленфосфорамид, триэтилентиофосфорамид и триметилмеламин; ацетогенины (в частности, буллатацин и буллатацинон); дельта-9-тетрагидроканнабинол (дронабинол, MARINOL®); бета-лапахон; лапахол; колхицины; бетулиновую кислоту; камптотецин (включая синтетический аналог топотекан (HYCAMTIN®), СРТ-11 (иринотекан, CAMPTOSAR®), ацетилкамптотецин, скополектин и 9-аминокамптотецин); бриостатин; каллистатин; СС-1065 (включая его синтетические аналоги адозелезин, карзелезин и бизелезин); подофиллотоксин; подофиллиновую кислоту; тенипозид; криптофицины (в частности, криптофицин 1 и криптофицин 8); доластатин; дуокармицин (включая синтетические аналоги KW-2189 и СВ1-ТМ1); элеутеробин; панкратистатин; саркодиктиин; спонгистатин; азотистые иприты, такие как хлорамбуцил, хлорнафазин, холофосфамид, эстрамустин, ифосфамид, мехлорэтамин, гидрохлорид оксида мехлорэтамина, мелфалан, новембихин, фенестерин, преднимустин, трофосфамид, урамустин; нитрозомочевины, такие как кармустин, хлорозотоцин, фотемустин, ломустин, нимустин и ранимустин; антибиотики, такие как энедииновые антибиотики (например, калихеамицин, в частности калихеамицин гамма II и калихеамицин омега II (смотри, например, Agnew, Chem Intl. Ed. Engl., 33: 183-186 (1994)); динемицин, включая динемицин А; эсперамицин; а также хромофор неокарциностатина и родственные хромофоры хромопротеинов - энедииновые антибиотики), аклациномизины, актиномицин, аутрамицин, азасерин, блеомицины, кактиномицин, карабицин, карминомицин, карзинофилин, хромомицин, дактиномицин, даунорубицин, деторубицин, 6-диазо-5-оксо-L-норлейцин, доксорубицин ADRIAMICIN® (включая морфолинодоксорубицин, цианоморфолинодоксорубицин, 2-пирролинодоксорубицин и дезоксидоксорубицин), эпирубицин, эзорубицин, идарубицин, марцелломицин, митомицины, такие как митомицин С, микофеноловую кислоту, ногаламицин, оливомицины, пепломицин, потфиромицин, пуромицин, квеламицин, родорубицин, стрептонигрин, стрептозоцин, туберцидин, убенимекс, зиностатин, зорубицин; антиметаболиты, такие как метотрексат и 5-фторурацил (5-FU); аналоги фолиевой кислоты, такие как деноптерин, метотрексат, птероптерин, триметрексат; аналоги пурина, такие как флударабин, 6-меркаптопурин, тиамиприн, тиогуанин; аналоги пиримидина, такие как анцитабин, азацитидин, 6-азауридин, кармофур, цитарабин, дидезоксиуридин, доксифлуридин, эноцитабин, флоксуридин; андрогены, такие как калустерон, пропионат дромостанолона, эпитиостанол, мепитиостан, тестолактон; средства, подавляющие функции надпочечников, такие как аминоглютетимид, митотан, трилостан; компенсатор фолиевой кислоты, такой как фолиновая кислота; ацеглатон; гликозид альдофосфамид; аминолевулиновую кислоту; энилурацил; амсакрин; бестрабуцил; бисантрен; эдатраксат; дефофамин; демеколцин; диазихон; элфорнитин; ацетат эллиптиния; эпотилон; этоглуцид; нитрат галлия; гидроксимочевину; лентинан; лонидаинин; мейтанзиноиды, такие как мейтанзин и ансамитоцины; митогуазон; митоксантрон; мопиданмол; нитраэрин; пентостатин; фенамет; пирарубицин; лозоксантрон; 2-этилгидразид; прокарбазин; полисахаридный комплекс PSK® (JHS Natural Products, Eugene, OR); разоксан; ризоксин; сизофиран; спирогерманий; тенуазоновая кислота; триазиквон; 2,2',2-трихлортриэтиламин; трихотецены (в частности, токсин Т-2, верракурин А, роридин А и ангуидин); уретан; виндезин (ELDISINE®, FILDESIN®); дакарбазин; манномустин; митобронитол; митолактол; пипоброман; гацитозин; арабинозид («ara-C»); тиотепа; таксоиды, например, паклитаксел TAXOL® (Bristol-Myers Squibb Oncology, Princeton, N.J.), не содержащий кремофора препарат паклитаксела на основе сконструированных связанных с альбумином наночастиц ABRAXANE ТМ (American Pharmaceutical Partners, Schaumberg, Illinois) и доксетаксел TAXOTERE® (Rhone-Poulenc Rorer, Antony, France); хлорамбуцил; гемцитабин (GEMZAR®); 6-тиогуанин; меркаптопурин; метотрексат; аналоги платины, такие как цисплатин и карбоплатин; винбластин (VELBAN®); платину; этопозид (VP-16); ифосфамид; митоксантрон; винкристин (ONCOVIN®); оксалиплатин; лейковорин; винорелбин (NAVELBINE®); новантрон; эдатрексат; дауномицин; аминоптерин; ибандронат; ингибитор топоизомеразы RFS 2000; дифторметилорнитин (DMFO); ретиноиды, такие как ретиноевая кислота; капецитабин (XELODA®); фармацевтически приемлемые соли, кислоты и производные любого агента, указанного выше; а также комбинации двух или более указанных выше средств, такие как CHOP, сокращенное название комбинированной терапии циклофосфамидом, доксорубицином, винкристином и преднизолоном, и FOLFOX, сокращенное название схемы лечения оксалиплатином (ELOXATIN ТМ) в сочетании с 5-FU и лейковорином.A “chemotherapeutic agent” is a chemical compound that can be used to treat a malignant tumor. Examples of chemotherapeutic agents include alkylating agents such as thiotepa and CYTOXAN® cyclophosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines, such as benzodopa, carboxwon, meturedopa and uredopa; ethyleneimines and methylmelamines, including altretamine, triethylene melamine, triethylene phosphoramide, triethylene thiophosphoramide and trimethyl melamine; acetogenins (in particular, bullatacin and bullatacinon); delta-9-tetrahydrocannabinol (dronabinol, MARINOL®); beta lapachone; lapachol; colchicines; betulinic acid; camptothecin (including the synthetic analogue of topotecan (HYCAMTIN®), CPT-11 (irinotecan, CAMPTOSAR®), acetyl camptothecin, scopolectin, and 9-aminocamptothecin); bryostatin; callistatin; CC-1065 (including its synthetic analogs, adozelesin, carzelesin and biselezin); podophyllotoxin; podophyllic acid; teniposide; cryptophycin (in particular, cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including synthetic analogues KW-2189 and CB1-TM1); eleutherobin; pankratistatin; sarcodiktiin; spongistatin; nitrogen mustards, such as chlorambucil, chlornaphazine, holophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembikhine, phenesterol, prednimustine, trophosphamide, uramustine; nitrosoureas, such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine and ranimustine; antibiotics such as enediin antibiotics (e.g. calicheamicin, in particular calicheamicin gamma II and calicheamicin omega II (see, for example, Agnew, Chem Intl. Ed. Engl., 33: 183-186 (1994)); dynamin, including dinemycin A ; esperamycin; as well as the neocarcinostatin chromophore and related chromophores of chromoproteins - enediin antibiotics), aclacinomisins, actinomycin, autramycin, azaserin, bleomycin, cactinomycin, carabicin, carminomycin, ocrominomycin-5, -dominocinomycin, L-norleucine, doxorubicin ADRIAMICIN® (including I am morpholinodoxorubicin, cyanomorpholinodoxorubicin, 2-pyrrolinodoxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycin C, mitomycin cytomycinomycidiricinomycinomycidiricinomycinomycinomycinphybrinomycinomycinomycinphybrinomycinomycinomycinphybrinomycinomycinomycinomycinomycin ubenimex, zinostatin, zorubicin; antimetabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimerexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, karmofur, cytarabine, dideoxyuridine, doxyfluridine, enocytabine, phloxuridine; androgens such as calusterone, dromostanolone propionate, epithiostanol, mepitiostan, testolactone; adrenal suppressants, such as aminoglutethimide, mitotane, trilostane; a folic acid compensator such as folinic acid; Aceglaton; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisanthrene; edatraxate; defofamine; demecolcin; diazikhon; elfornithine; elliptinium acetate; epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainin; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pyrarubicin; losoxantrone; 2-ethyl hydrazide; procarbazine; PSK® polysaccharide complex (JHS Natural Products, Eugene, OR); razoxane; rhizoxin; sisofiran; spiro germanium; tenuazonic acid; triaziquon; 2,2 ', 2-trichlorotriethylamine; trichotecenes (in particular, T-2 toxin, verracurin A, roridin A and anguidin); urethane; vindesine (ELDISINE®, FILDESIN®); dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacitosin; arabinoside ("ara-C"); thiotepa; taxoids, for example, paclitaxel TAXOL® (Bristol-Myers Squibb Oncology, Princeton, NJ), a cremophor-free paclitaxel preparation based on engineered albumin-linked nanoparticles ABRAXANE ™ (American Pharmaceutical Partners, Schaumberg, Illinois) and doxetaxel TAXOTERElen® (Rhone Rorer, Antony, France); chlorambucil; gemcitabine (GEMZAR®); 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine (VELBAN®); platinum; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine (ONCOVIN®); oxaliplatin; leucovorin; vinorelbine (NAVELBINE®); novantron; edatrexate; daunomycin; aminopterin; ibandronate; topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid; capecitabine (XELODA®); pharmaceutically acceptable salts, acids and derivatives of any agent specified above; as well as combinations of two or more of the above, such as CHOP, an abbreviation for combination therapy with cyclophosphamide, doxorubicin, vincristine and prednisone, and FOLFOX, an abbreviation for oxaliplatin treatment regimen (ELOXATIN ™) in combination with 5-FU and leucovorin.

Также в указанное определение включены противогормональные средства, которые действуют, регулируя, уменьшая, блокируя или ингибируя эффекты гормонов, которые могут стимулировать рост злокачественной опухоли, и часто их используют в форме системного лечения или лечения на уровне целого организма. Они сами могут являться гормонами. Примеры включают антиэстрогены и избирательные модуляторы рецепторов эстрогена (SERM), включая, например, тамоксифен (включая тамоксифен NOLVADEX®), ралоксифен EVISTA®, дролоксифен, 4-гидрокситамоксифен, триоксифен, кеоксифен, LY117018, онапристон и торемифен FARESTON®; антипрогестероны; понижающие регуляторы рецептора эстрогена (ERD); средства, которые функционируют, подавляя или прекращая работу яичников, например агонисты рилизинг-гормона лютеинизирующего гормона (LHRH), такие как ацетат лейпролида LUPRON® и ELIGARD®, ацетат гозерелина, ацетат бузерелина и триптерелин; другие антиандрогены, такие как флутамид, нилутамид и бикалутамид; и ингибиторы ароматазы, которые ингибируют фермент ароматазу, которая регулирует продукцию эстрогена в надпочечниках, такие как, например, 4(5)-имидазолы, аминоглутетимид, ацетат мегестрола MEGASE®, эксеместан AROMASIN®, форместан, фадрозол, ворозол RIVISOR®, летрозол FEMARA® и анастрозол ARIMIDEX®. Кроме того, такое определение химиотерапевтических средств включает бисфосфонаты, такие как клодронат (например, BONEFOS® или OSTAC®), этидронат DIDROCAL®, NE-58095, золедроновую кислоту/золедронат ZOMETA®, алендронат FOSAMAX®, памидронат AREDIA®, тилудронат SKELID® или ризедронат ACTONEL®; а также троксацитабин (1,3-диоксолановый нуклеозидный аналог цитозина); антисмысловые олигонуклеотиды, в частности олигонуклеотиды, которые ингибируют экспрессию генов в путях передачи сигналов, вовлеченных в аномальную пролиферацию клеток, таких как, например, PKC-альфа, Raf, H-Ras и рецептор эпидермального фактора роста (EGF-R); вакцины, такие как вакцина THERATOPE® и вакцины для генной терапии, например вакцина ALLOVECTIN®, вакцина LEUVECTLN® и вакцина VAXID®; ингибитор топоизомеразы 1 LURTOTECAN®; rmRH ABARELIX®; дитозилат лапатиниба (низкомолекулярный двойной ингибитор тирозинкиназ ErbB-2 и EGFR, также известный как GW572016); и фармацевтически приемлемые соли, кислоты или производные любого из указанных выше средств.Also included in this definition are anti-hormonal drugs that act by regulating, decreasing, blocking or inhibiting the effects of hormones that can stimulate the growth of a malignant tumor, and are often used in the form of systemic treatment or treatment at the level of the whole organism. They themselves can be hormones. Examples include antiestrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including tamoxifen NOLVADEX®), raloxifene EVISTA®, droloxifene, 4-hydroxy tamoxifen, trioxifene, keoxifen, LY117018, onapriston and TOREMEN; antiprogesterones; estrogen receptor downregulators (ERD); agents that function to suppress or stop ovarian function, for example, luteinizing hormone releasing hormone agonists (LHRH), such as LUPRON® and ELIGARD® leuprolide acetate, goserelin acetate, buserelin acetate and trypterelin; other antiandrogens such as flutamide, nilutamide and bicalutamide; and aromatase inhibitors that inhibit the aromatase enzyme, which regulates the production of estrogen in the adrenal glands, such as, for example, 4 (5) -imidazoles, aminoglutetimide, megestrol acetate MEGASE®, exemestane AROMASIN®, formestane, fadrozole, Vorozol RIVISOR®, letrozole FEM and anastrozole ARIMIDEX®. In addition, this definition of chemotherapeutic agents includes bisphosphonates such as clodronate (e.g., BONEFOS® or OSTAC®), ethidronate DIDROCAL®, NE-58095, zoledronic acid / zoledronate ZOMETA®, alendronate FOSAMAX®, pamidronate AREDIA SKELID® or tiloud risedronate ACTONEL®; as well as troxacitabine (a 1,3-dioxolane nucleoside analog of cytosine); antisense oligonucleotides, in particular oligonucleotides, which inhibit gene expression in signaling pathways involved in abnormal cell proliferation, such as, for example, PKC alpha, Raf, H-Ras and epidermal growth factor receptor (EGF-R); vaccines such as THERATOPE® vaccine and gene therapy vaccines, for example ALLOVECTIN® vaccine, LEUVECTLN® vaccine and VAXID® vaccine; LURTOTECAN® topoisomerase 1 inhibitor; rmRH ABARELIX®; lapatinib ditosylate (low molecular weight double tyrosine kinase inhibitor ErbB-2 and EGFR, also known as GW572016); and pharmaceutically acceptable salts, acids or derivatives of any of the above.

Примеры реализации предложенного изобретения.Examples of the implementation of the proposed invention.

Пример 1. Получение биомассы рекомбинантного фрагмента АФП (r3D AFP).Example 1. Obtaining biomass of a recombinant AFP fragment (r3D AFP).

Работы с бактериальными штаммами проводили под ламинаром в стерильных условиях. Для трансформации использовали компетентные клетки Bl21 (DE3) фирмы Stratogen. Пробирку с клетками (0.1 мл) размораживали на льду, добавляли 5 мкл раствора плазмиды в концентрации 20 нг/мл и инкубировали 10-15 минут на льду, после чего подвергали тепловому шоку при 42°C в течение 2 минут. Затем пробирку помещали в лед на 30 с, далее добавляли 1 мл среды LB и инкубировали 30-45 минут при 37°C при перемешивании. Затем клетки осаждали центрифугированием (2000 g, 5 минут), удаляли 1 мл супернатанта, осадок ресуспендировали в оставшейся среде и высевали на чашки Петри с агаризованной средой LB, содержащей ампициллин (100 мкг/мл). 2-3 колонии трансформантов помещали в 10 мл среды LB, содержащей ампициллин (100 мкг/мл) и инкубировали при 37°C при активном перемешивании в течение ночи. Из полученной жидкой культуры производили посев на чашку Петри с агаризованной средой LB, содержащей ампициллин (100 мкг/мл). Чашку инкубировали при 37°C в течение ночи. Из выросших колоний отбирали 6 наиболее крупных, каждую из которых помещали в 10 мл среды LB с добавлением ампициллина и инкубировали при 37°C. По достижении оптической плотности OD₆₀₀ от 0.5 до 1.2 единиц добавляют ИПТГ (изопропил-β-D-1-тиогалактопиранозида) до конечной концентрации от 0.1 до 2 мМ и инкубацию продолжают в течение 3 ч, после чего определяли уровень экспрессии целевого белка с помощью электрофореза в ПААГ. Полученную биомассу центрифугируют в течение 15 мин при 10000 RPM.Work with bacterial strains was carried out under a laminar under sterile conditions. For transformation, competent Bl21 (DE3) cells from Stratogen were used. The cell tube (0.1 ml) was thawed on ice, 5 μl of plasmid solution was added at a concentration of 20 ng / ml and incubated for 10-15 minutes on ice, after which it was subjected to heat shock at 42 ° C for 2 minutes. Then the tube was placed on ice for 30 s, then 1 ml of LB medium was added and incubated for 30-45 minutes at 37 ° C with stirring. The cells were then pelleted by centrifugation (2000 g, 5 minutes), 1 ml of supernatant was removed, the pellet was resuspended in the remaining medium and plated on Petri dishes with agarized LB medium containing ampicillin (100 μg / ml). 2-3 transformant colonies were placed in 10 ml of LB medium containing ampicillin (100 μg / ml) and incubated at 37 ° C with vigorous stirring overnight. From the obtained liquid culture, plating was performed on a Petri dish with agarized LB medium containing ampicillin (100 μg / ml). The cup was incubated at 37 ° C overnight. Of the grown colonies, 6 of the largest were selected, each of which was placed in 10 ml of LB medium with the addition of ampicillin and incubated at 37 ° C. Upon reaching an optical density of OD ₆₀₀ from 0.5 to 1.2 units, IPTG (isopropyl-β-D-1-thiogalactopyranoside) was added to a final concentration of 0.1 to 2 mM and incubation was continued for 3 hours, after which the expression level of the target protein was determined by electrophoresis in page. The resulting biomass is centrifuged for 15 minutes at 10,000 RPM.

Пример 2. Очистка и выделение рекомбинантного фрагмента АФП (r3D AFP).Example 2. Purification and isolation of a recombinant AFP fragment (r3D AFP).

Влажную биомассу (6 г) ресуспензировали в 100 мл буфера pH=8,0, содержащего 50 мМ фосфата натрия и 2 таблетки ингибиторов протеаз без ЭДТА (Roche). Далее добавляли лизоцим до концентрации 50 мг/л и инкубировали 10 мин при комнатной температуре, перемешивая стеклянной палочкой. Далее проводили ультразвуковую обработку 7 раз по 40 ударов при 0°C. Затем добавляли дезоксихолат натрия до 0,2 мас.%, и перемешивали 10 мин при комнатной температуре. Далее центрифугировали 10 мин в режиме 10000 об/мин. Собирали растворимую фракцию. Осадок несколько раз промывали фосфатным буфером и центрифугировали при 10000 об/мин. Осадок телец включения и растворимую фракцию хранили при -20°C. Осадок телец включения ресуспендировали в 10 мл солюбилизирующего буфера (150 мМ NaCl, 10 мМ KH₂PO₄, 8 М мочевина, 12 мМ меркаптоэтанол, pH 7.4) и оставляли при перемешивании при комнатной температуре на 1 час. Полученный раствор центрифугировали (10000 об/мин, 10 мин) и использовали в дальнейшем для рефолдинга супернатант. Через колонку с носителем Superose 12 предварительно пропускали 5 объемов ренатурирующего буфера (150 мМ NaCl, 10 мМ KH₂PO₄, 1 мМ GSSG, 5 мМ GSH, pH 8.5, +4°C). Затем готовили разведения солюбилизирующего буфера ренатурирующим, по 0,5 мл, до конечной концетрации мочевины в растворе 8, 6, 4, 2 и 0 М и меркаптоэтанола 12, 9, 6, 3, 0 мМ соответственно, и наносили на колонку, начиная с раствора с самой низкой концентрацией денатурирующих агентов. На подготовленную колонку наносили 2 мл солюбилизированного r3D AFP (k) (не более 20 мг), затем 0,5 мл солюбилизирующего буфера и элюировали целевой белок 3 объемами ренатурирующего буфера. Полученную фракцию диализовали против 1000-кратного объема фосфатно-солевого буфера при pH=8.5 и хранили при -70°C. Рекомбинантный белок дополнительно очищали с помощью металло-хелатной хроматографии на носителе содержащем ионы Ni²⁺ и, при необходимости, концентрировали с помощью концентрирующих ячеек.Wet biomass (6 g) was resuspended in 100 ml pH = 8.0 buffer containing 50 mM sodium phosphate and 2 tablets of protease inhibitors without EDTA (Roche). Then lysozyme was added to a concentration of 50 mg / L and incubated for 10 min at room temperature, stirring with a glass rod. Next, ultrasonic treatment was performed 7 times for 40 strokes at 0 ° C. Sodium deoxycholate was then added to 0.2 wt.%, And stirred for 10 minutes at room temperature. Then it was centrifuged for 10 min at 10,000 rpm. The soluble fraction was collected. The precipitate was washed several times with phosphate buffer and centrifuged at 10,000 rpm. The sediment of inclusion bodies and the soluble fraction were stored at -20 ° C. The sediment of inclusion bodies was resuspended in 10 ml of solubilizing buffer (150 mM NaCl, 10 mM KH ₂ PO ₄ , 8 M urea, 12 mM mercaptoethanol, pH 7.4) and left under stirring at room temperature for 1 hour. The resulting solution was centrifuged (10,000 rpm, 10 min) and the supernatant was further used for refolding. Five volumes of a renaturing buffer (150 mM NaCl, 10 mM KH ₂ PO ₄ , 1 mM GSSG, 5 mM GSH, pH 8.5, + 4 ° C) were preliminarily passed through a Superose 12-supported column. Then dilutions of the solubilizing buffer were prepared by renaturing, 0.5 ml each, to the final concentration of urea in a solution of 8, 6, 4, 2, and 0 M and mercaptoethanol 12, 9, 6, 3, 0 mM, respectively, and applied to the column, starting with a solution with the lowest concentration of denaturing agents. On the prepared column, 2 ml of solubilized r3D AFP (k) (not more than 20 mg) was applied, then 0.5 ml of solubilizing buffer, and the target protein was eluted with 3 volumes of renaturing buffer. The obtained fraction was dialyzed against a 1000-fold volume of phosphate-buffered saline at pH = 8.5 and stored at -70 ° C. The recombinant protein was further purified by metal chelate chromatography on a carrier containing Ni ^{2+ ions} and, if necessary, concentrated using concentration cells.

Пример 3. Получение биомассы рекомбинантного АФП (АФП-His, АФП-Flag, АФП).Example 3. Obtaining biomass of recombinant AFP (AFP-His, AFP-Flag, AFP).

Работы с дрожжевыми штаммами проводили под ламинаром в стерильных условиях. Для работы использовали дрожжевые штаммы Pichia Pastoris GS115 и KM 71 трансформированных генетическими конструктами на основе коммерческих плазмид pPIC9K и pPICZ А несущими нуклеотидную последовательность, кодирующую полноразмерный АФП человека, а также АФП человека с добавочными аминокислотными вставками (his-tag и flag-tag). Трансформантов высевали на чашки с агаризованной средой YPD, содержащей генитицин (в случае АФП), либо зеоцин (в случае АФП-His, АФП-Flag) в концентрации 50 мкг/мл. После трех дней инкубации при 28°C, рекомбинантные клоны перекалывали на свежие чашки с антибиотиком, подращивали и высевали в пробирки с 5 мл среды BMGY. Пробирки инкубировали на роторной качалке 16 ч при 28°C, после чего биомассу осаждали центрифугированием. Клетки промывали физиологическим раствором, затем ресуспендировали в 5 мл среды BMMY. Индуцированные клетки инкубировали на роторной качалке в течение 6 суток, при этом ежедневно добавляли метанол до концентрации 1%. Полученную биомассу центрифугировали на 3000 RPM в течение 15 мин, после чего декантируют супернатант от осадка. К полученной культуральной жидкости добавляют 0,1% азида и хранят при -70C.Work with yeast strains was carried out under a laminar under sterile conditions. We used yeast strains Pichia Pastoris GS115 and KM 71 transformed with genetic constructs based on commercial plasmids pPIC9K and pPICZ A carrying the nucleotide sequence encoding human full-length AFP, as well as human AFP with additional amino acid inserts (his-tag and flag-tag). Transformants were plated on plates with agarized YPD medium containing geniticin (in the case of AFP) or zeocin (in the case of AFP-His, AFP-Flag) at a concentration of 50 μg / ml. After three days of incubation at 28 ° C, recombinant clones were transferred to fresh antibiotic plates, grown and plated in tubes with 5 ml of BMGY medium. The tubes were incubated on a rotary shaker for 16 hours at 28 ° C, after which the biomass was precipitated by centrifugation. Cells were washed with saline, then resuspended in 5 ml of BMMY medium. The induced cells were incubated on a rotary shaker for 6 days, while methanol was added daily to a concentration of 1%. The resulting biomass was centrifuged at 3000 RPM for 15 min, after which the supernatant was decanted from the sediment. 0.1% azide was added to the resulting culture fluid and stored at -70 ° C.

Пример 4. Очистка и выделение рекомбинантного АФП (АФП-His).Example 4. Purification and isolation of recombinant AFP (AFP-His).

Культуральную жидкость АФП-His после наращивания в шейкере объемом 1 л цетрифугируют 10 мин при 3000 об/мин +4C. Супернатант декантируют, доводят pH до 7.4 10 М NaOH, после чего наблюдается выпадение солей, от которых избавляются центрифугированием в течение 10 мин при 7000 об/мин, затем супернатант аккуратно декантируют. В полученный супернатант добавляют имидазол до конечной концентрации 25 мМ. Колонка с Ni-сефарозой уравновешивается 1*PBS, после чего смола переносится в колбу с КЖ и в течение 1 ч при комнатной температуре стоит на качалке при небольшом перемешивании. Через 1 ч перемешивания КЖ со смолой переносят в пластиковые фальконы на 50 мл, после чего смолу осаждают центрифугированием в течение 2 мин при 500 об/мин при комнатной температуре. После центрифугирования всю смолу переносят в колонку. После внесения смолы в колонку ее промывают раствором (1*PBS, содержащий 25 мМ имидазол и 0,5М NaCl), затем проводят элюирование раствором (1*PBS, содержащий 0,5М имидазол и 0,5М NaCl). Очищенный белок необходимо диализовать в течение суток, после чего белок лиофилизируют с 1% Д-маннита по общему объему белка в течение суток. Полученный лиофилизат концентрируют в 10 раз, добавляют 0,1% азида и хранят при -70°C.AFP-His culture fluid, after building up in a 1 L shaker, is centrifuged for 10 min at 3000 rpm + 4C. The supernatant is decanted, the pH is adjusted to 7.4 with 10 M NaOH, after which salts are precipitated, which are disposed of by centrifugation for 10 min at 7000 rpm, then the supernatant is gently decanted. Imidazole is added to the resulting supernatant to a final concentration of 25 mM. The Ni-Sepharose column was equilibrated with 1 * PBS, after which the resin was transferred to a flask with QOL and stood for 1 hour at room temperature on a rocking chair with slight stirring. After 1 h of stirring, the QOL with the resin was transferred to 50 ml plastic Falcons, after which the resin was precipitated by centrifugation for 2 min at 500 rpm at room temperature. After centrifugation, the entire resin is transferred to a column. After adding the resin to the column, it is washed with a solution (1 * PBS containing 25 mM imidazole and 0.5 M NaCl), then elution with a solution (1 * PBS containing 0.5 M imidazole and 0.5 M NaCl) is carried out. The purified protein must be dialyzed during the day, after which the protein is lyophilized with 1% D-mannitol in the total protein volume during the day. The resulting lyophilisate was concentrated 10 times, 0.1% azide was added and stored at -70 ° C.

Пример 5. Очистка и выделение рекомбинантных АФП (АФП -Flag, АФП).Example 5. Purification and isolation of recombinant AFP (AFP-Flag, AFP).

Культуральную жидкость в объеме 1 л пропускают через колонку с носителем Br-CN-sepharose, конъюгированный с антителами к AFP, в течение суток при +4°C. Далее при комнатной температуре промывают 10 объемами 1×PBS, после чего элюируют 3M NaSCN. Очищенный белок необходимо диализовать в течение суток, после чего белок лиофилизируют с 1% Д-маннита по общему объему белка. Полученный лиофилизат концентрируют в 10 раз, добавляют 0,1% азида и хранят при -70°C.The culture fluid in a volume of 1 l is passed through a column with a carrier of Br-CN-sepharose conjugated with antibodies to AFP, during the day at + 4 ° C. Then, at room temperature, it is washed with 10 volumes of 1 × PBS, after which 3M NaSCN is eluted. The purified protein must be dialyzed during the day, after which the protein is lyophilized with 1% D-mannitol in the total protein volume. The resulting lyophilisate was concentrated 10 times, 0.1% azide was added and stored at -70 ° C.

Пример 6. Получение конъюгата полимерных частиц, содержащих цитостатический препарат, с рекомбинантными белками (АФП-His, АФП-Flag, АФП, r3D AFP).Example 6. Obtaining a conjugate of polymer particles containing a cytostatic preparation with recombinant proteins (AFP-His, AFP-Flag, AFP, r3D AFP).

К 25 мг полимерных частиц, полученных известным способом с использованием PLGA-COOH (14, 15, 16), заранее отмытых от избытка поверхностно-активного вещества, растворенных в 1*PBS, добавляют не менее 5-кратного избытка EDC и NHS по отношению к количеству карбоксильных групп (концентрация растворов 10 мг/мл в 1*PBS) и перемешивают 15 мин. После чего к реакционной смеси добавляют не больше, чем 2 мкл 2-меркаптоэтанола и инкубируют 10 мин, затем к активированным полимерным частицам добавляют рекомбинантный белок не меньше, чем в эквимолярных количествах в отношении активированных карбоксильных групп и доводят pH реакционной смеси до щелочных значений (от 7.4 до 9), затем оставляют перемешиваться еще 30 мин. Для остановки реакции вводят не больше, чем 2 мкл этаноламина (или любого аминопроизводного с аналогичными свойствами), после чего реакционную смесь очищают на колонке с носителем Superose 12 с полным разделением продуктов реакции, и тем самым, выделением целевого конъюгата в чистом виде. Очищенный конъюгат лиофилизируют с добавлением криопротектора в течение суток, после чего хранят в виде лиофилизата при -70°C.To 25 mg of polymer particles obtained in a known manner using PLGA-COOH (14, 15, 16), previously washed from excess surfactant dissolved in 1 * PBS, add at least a 5-fold excess of EDC and NHS with respect to the number of carboxyl groups (concentration of solutions 10 mg / ml in 1 * PBS) and stirred for 15 minutes After that, no more than 2 μl of 2-mercaptoethanol is added to the reaction mixture and incubated for 10 minutes, then the recombinant protein is added to the activated polymer particles at least in equimolar amounts with respect to the activated carboxyl groups and the pH of the reaction mixture is adjusted to alkaline values (from 7.4 to 9), then left to mix for another 30 minutes. To stop the reaction, no more than 2 μl of ethanolamine (or any amino derivative with similar properties) is introduced, after which the reaction mixture is purified on a Superose 12 column with a complete separation of the reaction products, and thereby, isolation of the target conjugate in pure form. The purified conjugate is lyophilized with the addition of a cryoprotectant during the day, after which it is stored as a lyophilizate at -70 ° C.

Пример 7. Определение уровней цитотоксической активности.Example 7. Determination of levels of cytotoxic activity.

Опухолевые клетки культивировали в среде DMEM, в пластиковых культуральных флаконах, содержащей 10% эмбриональной бычьей сыворотки и 50 мкг/мл гентамицина, в CO₂-инкубаторе при 37°C в увлажненной атмосфере, содержащей 5% CO₂. Клетки рассевали 2 раза в неделю с помощью раствора Версена. Мононуклеарные лейкоциты периферической крови здоровых добровольцев выделяли с помощью центрифугирования крови через градиент раствора фиколл-пак по методу

Tumor cells were cultured in DMEM medium, in plastic culture bottles containing 10% fetal bovine serum and 50 μg / ml gentamicin, in a CO ₂ incubator at 37 ° C in a humidified atmosphere containing 5% CO ₂ . Cells were scattered 2 times a week using Versen's solution. Mononuclear leukocytes of peripheral blood of healthy volunteers were isolated by centrifugation of blood through a gradient of ficoll-pack solution according to the method

Для оценки цитотоксической активности опухолевые клетки высевали в 96-луночные планшеты по 5 тысяч клеток в лунку за сутки до эксперимента. Мононуклеарные лейкоциты периферической крови здоровых добровольцев выделяли с помощью центрифугирования крови через градиент раствора фиколл-пак по методу Boyum и рассевали в 96-луночные планшеты по 270 тысяч клеток в лунку в день эксперимента. Препараты добавляли к клеткам в триплетах и инкубировали в стандартных условиях. В случае лимфоцитов культивировали в течение 1 ч, затем 2 раза отмывали PBS с pH 7.4, помещали в 200 мкл DMEM с 10% FBS (лимфоциты помещали в RPMI1640 с 10% FBS) и инкубировали в течение 72 ч. Выживаемость клеток определяли с помощью MTT-теста. За 4 ч до окончания инкубации в каждую лунку добавляли по 50 мкл раствора МТТ в концентрации 1 мг/мл в среде для культивирования клеток. После развития окраски среду удаляли, выпавшие кристаллы формазана растворяли в 100 мкл ДМСО и измеряли интенсивность окраски по поглощению при 540 нм с помощью планшетного фотометра. Выживаемость клеток оценивали в процентах от необработанного контроля. Для построения графиков выживаемости, расчета значений IC50 и статистической обработки результатов использовали программу OriginPro (OriginLab Corporation).To assess cytotoxic activity, tumor cells were seeded in 96-well plates of 5 thousand cells per well one day before the experiment. Mononuclear leukocytes of peripheral blood of healthy volunteers were isolated by centrifugation of blood through a gradient of ficoll-pack solution according to the Boyum method and scattered into 96-well plates at 270 thousand cells per well on the day of the experiment. The preparations were added to the cells in triplets and incubated under standard conditions. In the case of lymphocytes, they were cultured for 1 h, then PBS with pH 7.4 was washed 2 times, placed in 200 μl of DMEM with 10% FBS (lymphocytes were placed in RPMI1640 with 10% FBS) and incubated for 72 hours. Cell survival was determined using MTT test. 4 hours before the end of incubation, 50 μl of MTT solution at a concentration of 1 mg / ml in cell culture medium was added to each well. After color development, the medium was removed, the precipitated formazan crystals were dissolved in 100 μl DMSO, and the color intensity was measured by absorption at 540 nm using a plate photometer. Cell survival was evaluated as a percentage of the untreated control. OriginPro (OriginLab Corporation) was used to plot survival charts, calculate IC50 values, and statistically process the results.

Таким образом, в предложенном техническом решении достигается требуемый технический результат, заключающийся в расширении арсенала средств с доказанной противоопухолевой активностью и способов их получения, поскольку предложенный способ обеспечивает получение противоопухолевого препарата, обладающего более высокой эффективностью применения за счет повышения таргетности в отношении опухолевых клеток и снижения токсичность при его применении. Предложенный препарат обеспечивает направленную доставку противоопухолевых препаратов непосредственно в опухолевые клетки, защищая их от воздействия резистентных механизмов и обеспечивая пролонгированный эффект.Thus, in the proposed technical solution, the required technical result is achieved, which consists in expanding the arsenal of agents with proven antitumor activity and methods for their preparation, since the proposed method provides an antitumor drug with higher efficacy due to increased targeting against tumor cells and reducing toxicity when using it. The proposed drug provides targeted delivery of antitumor drugs directly to tumor cells, protecting them from the effects of resistant mechanisms and providing a prolonged effect.

СПИСОК ЛИТЕРАТУРЫBIBLIOGRAPHY

1. Farokhzad О.С. Targeted nanoparticle-aptamer bioconjugates for cancer chemotherapy in vivo / Farokhzad O.C., Cheng J., Teply B.A., Sherifi I., Jon S., Kantoff P.W. // Proceedings of the National Academy of Sciences - 103 (16) - 2006 - P. 6315-6320.1. Farokhzad O.S. Targeted nanoparticle-aptamer bioconjugates for cancer chemotherapy in vivo / Farokhzad O.C., Cheng J., Teply B.A., Sherifi I., Jon S., Kantoff P.W. // Proceedings of the National Academy of Sciences - 103 (16) - 2006 - P. 6315-6320.

2. Hitesh Kulhari. Peptide conjugated polymeric nanoparticles as a carrier for targeted delivery of docetaxel / Hitesh Kulhari, Deep Pooja, Shweta Shrivastava et al. // Colloids and Surfaces B: Biointerfaces 117 - 2014 - P. 166-173.2. Hitesh Kulhari. Peptide conjugated polymeric nanoparticles as a carrier for targeted delivery of docetaxel / Hitesh Kulhari, Deep Pooja, Shweta Shrivastava et al. // Colloids and Surfaces B: Biointerfaces 117 - 2014 - P. 166-173.

3. Li Wang. Monoclonal antibody targeting MUC1 and increasing sensitivity to docetaxel as a novel strategy in treating human epithelial ovarian cancer / Li Wang, Hongmin Chen, Feng Hua Liu et al. // Cancer Letters - 2011 - Volume 300 - Issue 2, 28 - P. 122-133.3. Li Wang. Monoclonal antibody targeting MUC1 and increasing sensitivity to docetaxel as a novel strategy in treating human epithelial ovarian cancer / Li Wang, Hongmin Chen, Feng Hua Liu et al. // Cancer Letters - 2011 - Volume 300 - Issue 2, 28 - P. 122-133.

4. Moro R., Tcherkassova J., Song E. et al. // IVD Technology Magazine - 2005. - Vol. 11 - №5.4. Moro R., Tcherkassova J., Song E. et al. // IVD Technology Magazine - 2005. - Vol. 11 - No. 5.

5. Weiss R. The anthracyclines: will we ever find a better doxorubicin / R. Weiss // Semin. Oncol. - 1992. - Vol. 19. - P. 670-686.5. Weiss R. The anthracyclines: will we ever find a better doxorubicin / R. Weiss // Semin. Oncol. - 1992. - Vol. 19. - P. 670-686.

6. Gruber B. The effect of new anthracycline derivatives on the induction of apoptotic processes in human neoplastic cells. / B. Gruber, E. Anuszewska, W. Priebe // Folia Histochem. Cytobiol. - 2004. - Vol. 42. - P. 127-130.6. Gruber B. The effect of new anthracycline derivatives on the induction of apoptotic processes in human neoplastic cells. / B. Gruber, E. Anuszewska, W. Priebe // Folia Histochem. Cytobiol. - 2004. - Vol. 42. - P. 127-130.

7. O'Shaughnessy J. Liposomal anthracyclines for breast cancer: overview / J. O'Shaughnessy // Oncologist. - 2003. - Vol. 8. - P. 1-2.7. O'Shaughnessy J. Liposomal anthracyclines for breast cancer: overview / J. O'Shaughnessy // Oncologist. - 2003. - Vol. 8. - P. 1-2.

8. Petrioli R. The role of doxorubicin and epirubicin in the treatment of patients with metastatic hormonerefractory prostate cancer / R. Petrioli, A. Fiaschi, E. Francini, A. Pascucci, G. Francini // Cancer Treat. Rev. - 2008. - Vol. 34. - P. 710-718.8. Petrioli R. The role of doxorubicin and epirubicin in the treatment of patients with metastatic hormonerefractory prostate cancer / R. Petrioli, A. Fiaschi, E. Francini, A. Pascucci, G. Francini // Cancer Treat. Rev. - 2008. - Vol. 34. - P. 710-718.

9. Gewirtz D. A critical evaluation of the mechanism of action proposed for the antitumor effects of the anthracycline antibiotics adriamycin and daunorubicin / D. Gewirtz // Biochem. Pharmacol. - 1999. - Vol. 57. - P. 727-741.9. Gewirtz D. A critical evaluation of the mechanism of action proposed for the antitumor effects of the anthracycline antibiotics adriamycin and daunorubicin / D. Gewirtz // Biochem. Pharmacol - 1999. - Vol. 57. - P. 727-741.

10. Breslow N. Doxorubicin for Favorable Histology, Stage II-III Wilms Tumor Results from the National Wilms Tumor Studies / N. Breslow, S. Ou, M. Beckwith, G. Haase, J. Kalapurakal, M. Ritchey, R. Shamberger, P. Thomas, G.D'Angio, D. Green // Cancer. - 2004. - Vol. 101. - P. 1072-1080.10. Breslow N. Doxorubicin for Favorable Histology, Stage II-III Wilms Tumor Results from the National Wilms Tumor Studies / N. Breslow, S. Ou, M. Beckwith, G. Haase, J. Kalapurakal, M. Ritchey, R. Shamberger, P. Thomas, G. D'Angio, D. Green // Cancer. - 2004. - Vol. 101. - P. 1072-1080.

11. Arcamone F. Doxorubicin. - London: Academic Press – 1981.11. Arcamone F. Doxorubicin. - London: Academic Press - 1981.

12. Даунорубицина гидрохлорид Daunorubicin hydrochloride // European Pharmacopoeia. Fifth Edition: монография. - 2005. - С. 1389-1390.12. Daunorubicin hydrochloride Daunorubicin hydrochloride // European Pharmacopoeia. Fifth Edition: Monograph. - 2005 .-- S. 1389-1390.

13. Северин E.C. Проблемы и перспективы современной противоопухолевой терапии / Северин Е.С., Родина А.В. // Успехи биологической химии. - 200. - Т. 46. - С. 43-64.13. Severin E.C. Problems and prospects of modern antitumor therapy / Severin E.S., Rodina A.V. // Successes in biological chemistry. - 200. - T. 46. - S. 43-64.

14. Betancourt Т., Brown В., Brannon-Peppas L. Doxorubicin-loaded PLGA nanoparticles by nanoprecipitation: preparation, characterization and in vitro evaluation. Nanomedicine (Lond). 2007. 2(2):219-32. (http//www.ncbi.nlm.nih.gov/pubmed/17716122).14. Betancourt T., Brown B., Brannon-Peppas L. Doxorubicin-loaded PLGA nanoparticles by nanoprecipitation: preparation, characterization and in vitro evaluation. Nanomedicine (Lond). 2007.2 (2): 219-32. (http // www.ncbi.nlm.nih.gov / pubmed / 17716122).

15. Chittasupho C., Lirdprapamongkol K., Kewsuwan P., Sarisuta N. Targeted delivery of doxorubicin to A549 lung cancer cells by CXCR4 antagonist conjugated PLGA nanoparticles. Eur J Pharm Biopharm. 2014. 88(2):529-38 (http://www.ncbi.nlm.nih.gov/pubmed/25119723).15. Chittasupho C., Lirdprapamongkol K., Kewsuwan P., Sarisuta N. Targeted delivery of doxorubicin to A549 lung cancer cells by CXCR4 antagonist conjugated PLGA nanoparticles. Eur J Pharm Biopharm. 2014.88 (2): 529-38 (http://www.ncbi.nlm.nih.gov/pubmed/25119723).

16. Park J, Fong PM, Lu J et al. PEGylated PLGA nanoparticles for the improved delivery of doxorubicin. Nanomedicine: nanotechnology, biology, and medicine. 2009.5(4):410-418. http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2789916/).16. Park J, Fong PM, Lu J et al. PEGylated PLGA nanoparticles for the improved delivery of doxorubicin. Nanomedicine: nanotechnology, biology, and medicine. 2009.5 (4): 410-418. http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2789916/).

MGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGVLEHHHHHHMGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGVLEHHHHHH

EAEARTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSLLNQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGVHHHHHHEAEARTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSLLNQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGVHHHHHH

EAEADYKDDDDKRTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSLLNQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGVEAEADYKDDDDKRTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSLLNQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV

Claims

1. A conjugate with antitumor activity based on a recombinant alpha-fetoprotein or its functional fragment and antitumor agent, characterized in that it is obtained in the form of particles from copolymers of lactic and glycolic acids with an antitumor agent included in them by the interaction of -COOH groups of particles activated 1-ethyl-3- (3-dimethylaminopropyl) carbodiimide and N-hydroxysuccinimide with at least 5-fold excess of them in relation to carboxyl groups, with amino groups of recombin an alpha-fetoprotein protein having sequences selected from the group: SEQ1, SEQ2, SEQ3, SEQ4, not less than in equimolar amounts with respect to activated carboxyl groups, at a pH of 7.4 to 9, followed by purification on a Superose 12 column with a complete separation of the reaction products and the isolation of the target conjugate in pure form.

2. The conjugate according to claim 1, characterized in that as an antitumor agent of the anthracycline series included in the copolymers of lactic and glycolic acids, it contains doxorubicin, daunorubicin, epirubicin, idarubicin, mitoxantrone, aclarubicin, zorubicin, pirarubicin, val.

3. The method for producing a conjugate with antitumor activity according to claim 1, characterized in that the -COOH groups of polymer particles from copolymers of lactic and glycolic acids with the antitumor agent anthracycline included in them activate 1-ethyl-3- (3-dimethylaminopropyl) carbodiimide and When N-hydroxysuccinimide is at least 5-fold in excess with respect to the carboxyl groups, no more than 2 μl of 2-mercaptoethanol is added and incubated for 10 minutes, then a recombinant alpha-fetoprotein protein having the sequences selected from the group: SEQ1, SEQ2, SEQ3, SEQ4, not less than in equimolar amounts with respect to the activated carboxyl groups, adjust the pH of the reaction mixture to alkaline values from 7.4 to 9, leave it to mix for 30 minutes, then stop the reaction by not more than 2 μl of ethanolamine, after which the reaction mixture was purified on a Superose 12 support column with complete separation of the reaction products and the target conjugate was isolated in pure form.