RU2557971C2 - Method of influencing functional activity of cannabinoid receptor - Google Patents
Method of influencing functional activity of cannabinoid receptor Download PDFInfo
- Publication number
- RU2557971C2 RU2557971C2 RU2013135848/15A RU2013135848A RU2557971C2 RU 2557971 C2 RU2557971 C2 RU 2557971C2 RU 2013135848/15 A RU2013135848/15 A RU 2013135848/15A RU 2013135848 A RU2013135848 A RU 2013135848A RU 2557971 C2 RU2557971 C2 RU 2557971C2
- Authority
- RU
- Russia
- Prior art keywords
- cannabinoid receptor
- antibodies
- human
- activated
- potentiated form
- Prior art date
Links
Abstract
Description
Изобретение относится к области медицины и может быть использовано для повышения эффективности воздействия на функциональную активность каннабиноидного рецептора.The invention relates to medicine and can be used to increase the effectiveness of the functional activity of the cannabinoid receptor.
Из уровня техники известны каннабиноидные рецепторы человека (Ken Mackie. Cannabinoid receptors as therapeutic targets. The Annual Review of Pharmacology and Toxicology, 2006. 46: 101-122), которые присутствуют как в ЦНС, так и в периферической нервной системе, и вместе с эндоканнабиноидами представляют собой единую эндоканнабиноидную систему.The human cannabinoid receptors are known in the art (Ken Mackie. Cannabinoid receptors as therapeutic targets. The Annual Review of Pharmacology and Toxicology, 2006. 46: 101-122), which are present both in the central nervous system and in the peripheral nervous system, and together with endocannabinoids are a single endocannabinoid system.
Из уровня техники известно лекарственное средство «Римонабант» (Акомплиа), по механизму действия являющееся антагонистом каннабиноидных рецепторов (СВ 1), которое оказывает центральное действие на мозг, уменьшая аппетит (Despres JP, Golay A, Sjostrom L; Rimonabant in Obesity-Lipids Study Group. Effects of rimonabant on metabolic risk factors in overweight patients with dyslipidemia. The New England Journal of Medicine. 2005 Nov.17; 353(20): 2121-34). Однако данный препарат, который воздействует на функциональную активность каннабиноидного рецептора, обладает множественными побочными эффектами.The drug “Rimonabant” (Acomplia) is known from the prior art, by its mechanism of action it is an antagonist of cannabinoid receptors (CB 1), which has a central effect on the brain, reducing appetite (Despres JP, Golay A, Sjostrom L; Rimonabant in Obesity-Lipids Study Group. Effects of rimonabant on metabolic risk factors in overweight patients with dyslipidemia. The New England Journal of Medicine. 2005 Nov.17; 353 (20): 2121-34). However, this drug, which affects the functional activity of the cannabinoid receptor, has many side effects.
Изобретение направлено на создание эффективного способа воздействия на функциональную активность каннабиноидного рецептора, обеспечивающего коррекцию нарушений эндоканнабиноидной системы.The invention is aimed at creating an effective way of influencing the functional activity of the cannabinoid receptor, which provides correction of disorders of the endocannabinoid system.
Решение поставленной задачи обеспечивается тем, что в способе воздействия на функциональную активность каннабиноидного рецептора, согласно изобретению, в организм вводят активированную - потенцированную форму антител к каннабиноидному рецептору человека, полученную в процессе последовательного многократного разведения матричного раствора антител к каннабиноидному рецептору человека в водном или водно-спиртовом растворителе и промежуточного внешнего механического воздействия.The solution to this problem is provided by the fact that in the method of influencing the functional activity of the cannabinoid receptor according to the invention, an activated - potentiated form of antibodies to the human cannabinoid receptor is obtained, which is obtained by sequential multiple dilutions of the matrix solution of antibodies to the human cannabinoid receptor in aqueous or aqueous alcohol solvent and intermediate external mechanical stress.
При этом используют активированную - потенцированную форму антител к цельной молекуле или полипептидному фрагменту каннабиноидного рецептора I типа человека.In this case, an activated - potentiated form of antibodies to the whole molecule or polypeptide fragment of the human type I cannabinoid receptor is used.
Предпочтительно, используют водный или водно-спиртовой раствор активированной - потенцированной формы антител к каннабиноидному рецептору I типа человека, полученный путем многократного последовательного разведения - равномерного уменьшения концентрации матричного раствора аффинно очищенных антител к каннабиноидному рецептору I типа человека с концентрацией 0,5÷5,0 мг/мл и промежуточного внешнего воздействия.Preferably, an aqueous or aqueous-alcoholic solution of an activated — potentiated form of human type I cannabinoid receptor antibody is used, obtained by repeated serial dilution — uniformly reducing the concentration of the matrix solution of affinity-purified human type I cannabinoid receptor with a concentration of 0.5 ÷ 5.0 mg / ml and intermediate external exposure.
При этом используют смесь различных, преимущественно сотенных, гомеопатических разведений, полученных путем многократного последовательного равномерного уменьшения концентрации матричного раствора аффинно очищенных антител к каннабиноидному рецептору I типа человека и промежуточного внешнего воздействия.In this case, a mixture of various, mainly hundred, homeopathic dilutions obtained by repeatedly sequentially uniformly reducing the concentration of the matrix solution of affinity-purified antibodies to the cannabinoid receptor type I person and an intermediate external effect is used.
Предпочтительно используют активированную - потенцированную форму антител к цельной молекуле каннабиноидного рецептора I типа человека или полипептидному фрагменту с последовательностью, выбираемой, например, из следующей группы:It is preferable to use an activated - potentiated form of antibodies to the whole molecule of the human cannabinoid receptor type I or a polypeptide fragment with a sequence selected, for example, from the following group:
QRGTQKSIII;QRGTQKSIII;
EKLQSVCSDIFPHIDETYL;EKLQSVCSDIFPHIDETYL;
IQRGTQKSIIIHTSEDGKVQVTRPDQARM;IQRGTQKSIIIHTSEDGKVQVTRPDQARM;
KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKT;KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKT;
MSVSTDTSAEAL;MSVSTDTSAEAL;
TEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPS;TEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPS;
AQPLDNSMGDSDCLHKHAN;AQPLDNSMGDSDCLHKHAN;
GTQKSIIIHTSEDG;GTQKSIIIHTSEDG;
MTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIEC FMVLN;MTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIEC FMVLN;
VVAFCLMWTIAIVI;VVAFCLMWTIAIVI;
EFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTL;EFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTL;
NEENIQCGE;NEENIQCGE;
GSPFQEKMTAGDNPQLVPADQVNITEFYNKSL;GSPFQEKMTAGDNPQLVPADQVNITEFYNKSL;
AYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWN.AYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWN.
При этом активированную - потенцированную форму антител к каннабиноидному рецептору I типа человека используют в сверхмалой дозе, полученной сверхразведением исходного матричного раствора в 10012, 10030 и 100200 раз.In this case, the activated - potentiated form of antibodies to the human type I cannabinoid receptor is used in an ultra-low dose obtained by super-dilution of the initial matrix solution in 100 12 , 100 30 and 100 200 times.
Предложенное введение в организм активированной - потенцированной формы антител к каннабиноидному рецептору человека (т.е. формы антител к каннабиноидному рецептору человека, приготовленной по гомеопатической технологии потенцирования путем многократного последовательного разведения и промежуточного внешнего воздействия - вертикального встряхивания, которая обладает активностью в фармакологических моделях и/или клинических методах воздействия на функциональную активность каннабиноидного рецептора) обеспечивает эффективную коррекцию нарушений эндоканнабиноидной системы без каких-либо побочных явлений, что подтверждено экспериментально на адекватных моделях.The proposed introduction into the body of an activated - potentiated form of antibodies to the human cannabinoid receptor (i.e., forms of antibodies to the human cannabinoid receptor, prepared according to the homeopathic technology of potentiation by repeated serial dilution and intermediate external action - vertical shaking, which is active in pharmacological models and / or clinical methods of influencing the functional activity of the cannabinoid receptor) provides an effective core rection of disorders of the endocannabinoid system without any side effects, which is confirmed experimentally on adequate models.
Кроме того, заявленное изобретение расширяет арсенал технических средств, предназначенных для коррекции нарушений эндоканнабиноидной системы без побочных эффектов, в том числе и в составе комплексной терапии.In addition, the claimed invention expands the arsenal of technical means for correcting disorders of the endocannabinoid system without side effects, including as part of complex therapy.
Заявленный способ реализуется следующим образом.The claimed method is implemented as follows.
Для приготовления гомеопатически активированной - потенцированной формы антител к каннабиноидному рецептору человека используют моноклональные или, преимущественно, поликлональные антитела, которые могут быть получены по известным технологиям - методикам, описанным, например, в книге: Иммунологические методы, под ред. Г. Фримеля, М., «Медицина», 1987, с.9-33; или, например, в статье Laffly E., Sodoyer R. Hum. Antibodies. Monoclonal and recombinant antibodies, 30 years after. - 2005 - Vol.14. - N 1-2. P.33-55.To prepare a homeopathically activated - potentiated form of antibodies to the human cannabinoid receptor, monoclonal or, mainly, polyclonal antibodies are used, which can be obtained using known technologies - methods described, for example, in the book: Immunological methods, ed. G. Frimel, M., "Medicine", 1987, S. 9-33; or, for example, in an article by Laffly E., Sodoyer R. Hum. Antibodies. Monoclonal and recombinant antibodies, 30 years after. - 2005 - Vol.14. - N 1-2. P.33-55.
Моноклональные антитела получают, например, с помощью гибридомной технологии. Причем начальная стадия процесса включает иммунизацию, основанную на принципах, уже разработанных при приготовлении поликлональных антисывороток. Дальнейшие этапы работы предусматривают получение гибридных клеток, продуцирующих клоны одинаковых по специфичности антител. Их выделение в индивидуальном виде проводится теми же методами, что и в случае поликлональных антисывороток.Monoclonal antibodies are obtained, for example, using hybridoma technology. Moreover, the initial stage of the process includes immunization, based on the principles already developed in the preparation of polyclonal antisera. Further stages of the work include obtaining hybrid cells producing clones of antibodies of the same specificity. Their isolation in an individual form is carried out by the same methods as in the case of polyclonal antisera.
Поликлональные антитела могут быть получены активной иммунизацией животных. Для этого по специально разработанной схеме животным делают серию инъекций требуемым в соответствии с изобретением веществом - антигеном: каннабиноидным рецептором I типа человека. В результате проведения такой процедуры получают моноспецифическую антисыворотку с высоким содержанием антител, которую и используют для получения активированной - потенцированной формы. При необходимости проводят очистку антител, присутствующих в антисыворотке, например, методом аффинной хроматографии, путем применения фракционирования солевым осаждением или ионообменной хроматографии.Polyclonal antibodies can be obtained by active immunization of animals. To do this, according to a specially developed scheme, the animals are given a series of injections of the substance required by the invention, an antigen: a human type I cannabinoid receptor. As a result of such a procedure, a monospecific antiserum with a high content of antibodies is obtained, which is used to obtain an activated - potentiated form. If necessary, the antibodies present in the antiserum are purified, for example, by affinity chromatography, using fractionation by salt precipitation or ion exchange chromatography.
Для иммунизации кроликов можно использовать в качестве иммуногена (антигена) адъювант и цельную молекулу каннабиноидного рецептора I типа человека следующей последовательности:For immunization of rabbits, you can use as an immunogen (antigen) adjuvant and the whole molecule of the cannabinoid receptor type I person of the following sequence:
MKSILDGLAD TTFRTITTDL LYVGSNDIQY EDIKGDMASKMKSILDGLAD TTFRTITTDL LYVGSNDIQY EDIKGDMASK
LGYFPQKFPL TSFRGSPFQE KMTAGDNPQL VPADQVNITELGYFPQKFPL TSFRGSPFQE KMTAGDNPQL VPADQVNITE
FYNKSLSSFK ENEENIQCGE NFMDIECFMV LNPSQQLAIAFYNKSLSSFK ENEENIQCGE NFMDIECFMV LNPSQQLAIA
VLSLTLGTFT VLENLLVLCV ILHSRSLRCR PSYHFIGSLAVLSLTLGTFT VLENLLVLCV ILHSRSLRCR PSYHFIGSLA
VADLLGSVIF VYSFIDFHVF HRKDSRNVFL FKLGGVTASFVADLLGSVIF VYSFIDFHVF HRKDSRNVFL FKLGGVTASF
TASVGSLFLT AIDRYISIHR PLAYKRIVTR PKAVVAFCLMTASVGSLFLT AIDRYISIHR PLAYKRIVTR PKAVVAFCLM
WTIAIVIAVL PLLGWNCEKL QSVCSDIFPH IDETYLMFWIWTIAIVIAVL PLLGWNCEKL QSVCSDIFPH IDETYLMFWI
GVTSVLLLFI VYAYMYILWK AHSHAVRMIQ RGTQKSIIIHGVTSVLLLFI VYAYMYILWK AHSHAVRMIQ RGTQKSIIIH
TSEDGKVQVT RPDQARMDIR LAKTLVLILV VLIICWGPLLTSEDGKVQVT RPDQARMDIR LAKTLVLILV VLIICWGPLL
AIMVYDVFGK MNKLIKTVFA FCSMLCLLNS TVNPIIYALRAIMVYDVFGK MNKLIKTVFA FCSMLCLLNS TVNPIIYALR
SKDLRHAFRS MFPSCEGTAQ PLDNSMGDSD CLHKHANNAASKDLRHAFRS MFPSCEGTAQ PLDNSMGDSD CLHKHANNAA
SVHRAAESCl KSTVKIAKVT MSVSTDTSAE ALSVHRAAESCl KSTVKIAKVT MSVSTDTSAE AL
Возможно для получения поликлональных антител к каннабиноидному рецептору I типа человека использование в качестве иммуногена полипептидного фрагмента каннабиноидного рецептора I типа человека с последовательностью, выбираемой, например, из следующей группы:It is possible to obtain polyclonal antibodies to the cannabinoid receptor of human type I as the immunogen use a polypeptide fragment of the cannabinoid receptor of human type I with a sequence selected, for example, from the following group:
QRGTQKSIII;QRGTQKSIII;
EKLQSVCSDIFPHIDETYL;EKLQSVCSDIFPHIDETYL;
IQRGTQKSIIIHTSEDGKVQVTRPDQARM;IQRGTQKSIIIHTSEDGKVQVTRPDQARM;
KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKT;KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKT;
MSVSTDTSAEAL;MSVSTDTSAEAL;
TEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPS;TEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPS;
AQPLDNSMGDSDCLHKHAN;AQPLDNSMGDSDCLHKHAN;
GTQKSIIIHTSEDG;GTQKSIIIHTSEDG;
MTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIEC
FMVLN;FMVLN;
VVAFCLMWTIAIVI;VVAFCLMWTIAIVI;
EFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTL;EFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTL;
NEENIQCGE;NEENIQCGE;
GSPFQEKMTAGDNPQLVPADQVNITEFYNKSL;GSPFQEKMTAGDNPQLVPADQVNITEFYNKSL;
AYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWN
Перед отбором крови за 7-9 дней проводят 1-3 внутривенных инъекций для повышения уровня антител. В процессе иммунизации у кроликов отбирают небольшие пробы крови для оценки количества антител. Максимальный уровень иммунного ответа на введение большинства растворимых антигенов достигается через 40-60 дней после первой инъекции. После окончания первого цикла иммунизации кроликов в течение 30 дней дают восстановить здоровье и проводят реиммунизацию, включающую 1-3 внутривенные инъекции. Для получения антисыворотки из иммунизированных кроликов собирают кровь в центрифужную пробирку объемом 50 мл. С помощью деревянного шпателя удаляют со стенок пробирки образовавшиеся сгустки и помещают палочку в сгусток, образовавшийся в центре пробирки. Кровь помещают в холодильник (температура 4°C) на ночь. На следующий день удаляют сгусток, прикрепившийся к шпателю, и центрифугируют оставшуюся жидкость при 13000 g в течение 10 мин. Супернатант (надосадочная жидкость) является антисывороткой. Полученная антисыворотка должна быть желтого цвета. Добавляют к антисыворотке 20% (весовая концентрация) NaN3 до конечной концентрации 0,02% и хранят до использования в замороженном состоянии при температуре -20°C. Для выделения из антисыворотки антител к каннабиноидному рецептору I типа человека производят абсорбцию на твердой фазе в следующей последовательности:Before blood sampling for 1-3 days, 1-3 intravenous injections are performed to increase the level of antibodies. During immunization, small blood samples are taken from rabbits to evaluate the amount of antibody. The maximum level of the immune response to the administration of most soluble antigens is achieved 40-60 days after the first injection. After the end of the first cycle of immunization of rabbits for 30 days, they restore health and re-immunization, including 1-3 intravenous injections. To obtain antisera from immunized rabbits, blood is collected in a 50 ml centrifuge tube. Using a wooden spatula, the formed clots are removed from the walls of the tube and the wand is placed in the clot formed in the center of the tube. Blood is placed in a refrigerator (temperature 4 ° C) at night. The next day, the clot attached to the spatula is removed and the remaining liquid is centrifuged at 13000 g for 10 minutes. The supernatant (supernatant) is an antiserum. The resulting antiserum should be yellow. Add to the antiserum 20% (weight concentration) NaN 3 to a final concentration of 0.02% and store until use in a frozen state at a temperature of -20 ° C. To isolate antibodies to the cannabinoid receptor type I from an antiserum of a person, type 1 absorption is performed on the solid phase in the following sequence:
1) 10 мл антисыворотки кролика разбавляют в 2 раза 0,15 М NaCl, добавляют 6,26 г Na2SO4, перемешивают и инкубируют 12-16 ч при 4°C;1) 10 ml of rabbit antiserum is diluted 2 times with 0.15 M NaCl, 6.26 g of Na 2 SO 4 are added, stirred and incubated for 12-16 hours at 4 ° C;
2) выпавший осадок удаляют центрифугированием, растворяют в 10 мл фосфатного буфера и затем диализуют против того же буфера в течение ночи при комнатной температуре;2) the precipitate formed is removed by centrifugation, dissolved in 10 ml of phosphate buffer and then dialyzed against the same buffer overnight at room temperature;
3) после удаления осадка центрифугированием раствор наносят на колонку с ДЭАЭ-целлюлозой, уравновешенную фосфатным буфером;3) after removing the precipitate by centrifugation, the solution is applied to a column with DEAE-cellulose, balanced with phosphate buffer;
4) фракцию антител определяют, измеряя оптическую плотность элюата при 280 нм.4) the antibody fraction is determined by measuring the optical density of the eluate at 280 nm.
Затем производят очистку антител методом аффинной хроматографии путем прикрепления полученных антител к каннабиноидному рецептору I типа человека, который находится на нерастворимом матриксе с последующим элюированием концентрированными растворами соли.The antibodies are then purified by affinity chromatography by attaching the obtained antibodies to the human type I cannabinoid receptor, which is located on an insoluble matrix, followed by elution with concentrated salt solutions.
Полученный, таким образом, буферный раствор поликлональных кроличьих антител к каннабиноидному рецептору I типа человека, очищенных на антигене, с концентрацией 0,5÷5,0 мг/мл, предпочтительно 2,0÷3,0 мг/мл, используют в качестве матричного (первичного) раствора для последующего приготовления активированной - потенцированной формы.Thus obtained buffer solution of polyclonal rabbit antibodies to cannabinoid receptor type I human, purified on antigen, with a concentration of 0.5 ÷ 5.0 mg / ml, preferably 2.0 ÷ 3.0 mg / ml, is used as a matrix (primary) solution for the subsequent preparation of the activated - potentiated form.
Активированную - потенцированную форму действующего вещества - антител к каннабиноидному рецептору I типа человека в сверхмалой дозе готовят путем равномерного уменьшения концентрации в результате последовательного разведения 1 части упомянутого матричного раствора в 9 частях (для десятичного разведения), или в 99 частях (для сотенного разведения С), или в 999 частях (для тысячного разведения М) нейтрального водного или водно-спиртового растворителя с многократным вертикальным встряхиванием-потенцированием (или "динамизацией") каждого полученного разведения и использованием отдельных емкостей для каждого последующего разведения до получения требуемой потенции - кратности разведения по гомеопатическому методу (см., например, В.Швабе "Гомеопатические лекарственные средства", М., 1967 г., с.14-29).An activated - potentiated form of the active substance - antibodies to the human type I cannabinoid receptor in an ultra-low dose is prepared by uniformly reducing the concentration as a result of successive dilution of 1 part of the matrix solution in 9 parts (for decimal dilution), or in 99 parts (for hundredth dilution C) , or in 999 parts (for a thousandth dilution of M) of a neutral aqueous or hydroalcoholic solvent with multiple vertical shaking-potentiation (or "dynamization") of each gender chennogo dilution and using separate containers for each subsequent dilution until the required potency - the multiplicity of homeopathic dilution method (see, e.g., W. Schwabe "Homeopathic medicines", M., 1967, at s.14-29.).
Например, для приготовления 12-го сотенного разведения С 12 одну часть упомянутого матричного раствора антител к каннабиноидному рецептору I типа человека с концентрацией 3,0 мг/мл разводят в 99 частях нейтрального водного или водно-спиртового растворителя и многократно (10 и более раз) вертикально встряхивают-потенцируют полученное 1-е сотенное С1 разведение. Из 1-го сотенного С1 разведения приготовляют 2-е сотенное разведение С2. Данную операцию повторяют 11 раз, получая 12-е сотенное разведение С12. Таким образом, 12-е сотенное разведение С12 представляет собой раствор, полученный разбавлением последовательно в разных емкостях 12 раз 1-й части исходного матричного раствора антител к каннабиноидному рецептору I типа человека с концентрацией 3,0 мг/мл в 99-ти частях нейтрального растворителя, т.е. раствор, полученный сверхразведением исходного матричного раствора в 10012 раз. Аналогичные операции с соответствующей кратностью разведения проводят для получения разведений С30 и С200.For example, to prepare the 12th hundredth dilution of C 12, one part of the aforementioned matrix solution of antibodies to the cannabinoid receptor type I person with a concentration of 3.0 mg / ml is diluted in 99 parts of a neutral aqueous or aqueous-alcoholic solvent and many times (10 or more times) shake vertically-potentiate the obtained 1st hundredth C1 dilution. From the 1st hundredth C1 dilution prepare the 2nd hundredth dilution C2. This operation is repeated 11 times, obtaining the 12th hundredth dilution of C12. Thus, the 12th hundredth dilution of C12 is a solution obtained by diluting successively in different containers 12 times of the 1st part of the initial matrix solution of antibodies to human cannabinoid receptor type I with a concentration of 3.0 mg / ml in 99 parts of a neutral solvent , i.e. the solution obtained by super-dilution of the initial matrix solution in 100 to 12 times. Similar operations with the appropriate dilution ratio are carried out to obtain dilutions of C30 and C200.
При использовании смеси различных гомеопатических, преимущественно сотенных, разведений активированной - потенцированной формы антител к каннабиноидному рецептору I типа человека в сверхмалой дозе действующего вещества каждый компонент состава (например, С12, С30, С200) приготовляют раздельно по описанной выше технологии до их предпоследнего разведения (соответственно, до получения С11, С29, С199) и затем вносят в соответствии с составом смеси в одну емкость по одной части каждого компонента и смешивают с требуемым количеством растворителя (соответственно, с 97 частями для сотенного разведения). При этом получают активированную - потенцированную форму антител к каннабиноидному рецептору I типа человека в сверхмалой дозе, полученной сверхразведением исходного матричного раствора в 10012, 100, 100200 раз, что эквивалентно смеси сотенных гомеопатических разведений С12, C30, С200.When using a mixture of various homeopathic, mainly hundred, dilutions of the activated - potentiated form of antibodies to the human type I cannabinoid receptor in an ultra-low dose of the active substance, each component of the composition (for example, C12, C30, C200) is prepared separately according to the technology described above to their penultimate dilution (respectively until C11, C29, C199) and then, in accordance with the composition of the mixture, one part of each component is introduced into one container and mixed with the required amount of solvent (with Responsibly, with 97 parts for one hundred breeding). In this case, an activated - potentiated form of antibodies to the human type I cannabinoid receptor is obtained in an ultra-low dose obtained by super-dilution of the initial matrix solution 100 12 , 100, 100 200 times, which is equivalent to a mixture of hundred-percent homeopathic dilutions C12, C30, C200.
Возможно использование активированной - потенцированной формы антител к каннабиноидному рецептору I типа человека в сверхмалой дозе действующего вещества в виде смеси других различных гомеопатических разведений, например десятичных и/или сотенных (D 20, С30, С100 или С12, C30, С50 и т.д.), эффективность которых определяют экспериментально.It is possible to use an activated - potentiated form of antibodies to the human type I cannabinoid receptor in an ultra-low dose of the active substance in the form of a mixture of other various homeopathic dilutions, for example decimal and / or hundred (D 20, C30, C100 or C12, C30, C50, etc. ), the effectiveness of which is determined experimentally.
При потенцировании вместо встряхивания в процессе уменьшения концентрации также можно осуществлять внешнее воздействие ультразвуком, электромагнитным или иным физическим воздействием.When potentiating instead of shaking in the process of decreasing the concentration, it is also possible to exert external influence by ultrasound, electromagnetic or other physical effect.
Заявленный способ может быть реализован с использованием активированной - потенцированной формы антител к каннабиноидному рецептору I типа человека в сверхмалой дозе в твердой лекарственной форме, которую приготовляют таблетированием из таблеточной массы, которая, например, содержит 8÷30 масс. частей гранул лактозы с размером частиц 150÷300 мкм, орошенных в псевдоожиженном-кипящем слое водным или водно-спиртовым раствором активированной - потенцированной формы антител к каннабиноидному рецептору I типа человека, и фармацевтически приемлемые добавки, включающие 75÷95 масс. частей чистой лактозы, 8÷15 масс. частей микрокристаллической целлюлозы и 0,8÷1,2 масс. частей стеарата магния. Масса таблетки может составлять 150÷500 мг. Предпочтительно использовать таблетки массой 250÷300 мг, которые включают 3,0÷6,0 мг/табл активированной - потенцированной формы водно-спиртовых разведений субстанции - действующего вещества поликлональных кроличьих антител к каннабиноидному рецептору I типа человека, очищенных на антигене, в сверхмалой дозе, полученной сверхразведением по вышеуказанной гомеопатической технологии исходного матричного раствора в 10012, 10030, 100200 раз, эквивалентной смеси сотенных гомеопатических разведений С12, C30, С200 (сверхмалые дозы - СМД анти-КР).The claimed method can be implemented using an activated - potentiated form of antibodies to the human type I cannabinoid receptor in an ultra-low dose in solid dosage form, which is prepared by tabletting from a tablet mass, which, for example, contains 8-30 mass. parts of lactose granules with a particle size of 150–300 μm, irrigated in a fluidized bed with an aqueous or aqueous-alcoholic solution of an activated — potentiated form of antibodies to the human type I cannabinoid receptor, and pharmaceutically acceptable additives, including 75–95 wt. parts of pure lactose, 8 ÷ 15 mass. parts of microcrystalline cellulose and 0.8 ÷ 1.2 mass. parts of magnesium stearate. The weight of the tablet may be 150 ÷ 500 mg. It is preferable to use tablets weighing 250–300 mg, which include 3.0–6.0 mg / tablet of an activated — potentiated form of water-alcohol dilutions of a substance — the active substance of polyclonal rabbit antibodies to human cannabinoid receptors of type I, purified on antigen, in an ultra-low dose obtained by super-dilution according to the above homeopathic technology of the initial matrix solution 100 12 , 100 30 , 100 200 times, equivalent to a mixture of hundred-percent homeopathic dilutions C12, C30, C200 (ultra-low doses - SMD anti-KR).
Для проведения экспериментальных исследований были использованы поликлональные антитела, приготовленные по заказу специализированной фармацевтической фирмой.To conduct experimental studies, polyclonal antibodies were used, prepared by order of a specialized pharmaceutical company.
Пример 1.Example 1
Заявленная в соответствии с изобретением активированная - потенцированная форма антител к каннабиноидному рецептору I типа человека в сверхмалой дозе (по направленности действия - рецептор каннабиноидный I типа - является центральным) в связи использованием особой технологии потенцирования оказывает щадящее воздействие на рецептор, приводящее к его сенситизации и вследствие этого - повышению чувствительности к эндогенным каннабиноидам.The activated, potentiated form of antibodies to the human type I cannabinoid receptor claimed in accordance with the invention in an ultra-low dose (the direction of action is the type I cannabinoid receptor is central) in connection with the use of special potentization technology has a sparing effect on the receptor, leading to its sensitization and, as a result this is an increase in sensitivity to endogenous cannabinoids.
Данный эффект подтверждается следующим экспериментом: проведено изучение влияния препарата на основе активированной - потенцированной формы поликлональных кроличьих антител к каннабиноидному рецептору I типа человека, очищенных на антигене, в сверхмалой дозе, полученной сверхразведением исходного матричного раствора в 10012, 10030, 100200 раз, эквивалентной смеси сотенных гомеопатических разведений С12, C30, С200 (сверхмалые дозы - СМД анти-КР), на функциональное состояние каннабиноидного рецептора I типа (in vitro) в 2 этапа: в режиме агониста и в режиме антагониста.This effect is confirmed by the following experiment: a study was made of the effect of the drug on the basis of an activated - potentiated form of polyclonal rabbit antibodies to the human type I cannabinoid receptor, purified on antigen, in an ultra-low dose obtained by super-dilution of the initial matrix solution 100 12 , 100 30 , 100 200 times, the equivalent mixture of hundreds of homeopathic dilutions C12, C30, C200 (ultra-low doses - SMD anti-KR), to the functional state of type I cannabinoid receptor (in vitro) in 2 stages: in agonist mode and in mode IU antagonist.
Режим агонистаAgonist mode
Перед внесением в лунки микропланшета (96-луночный планшет, объем лунки 250 µl) клетки суспендировали в буфере HBSS (Invitrogen), содержащем 20 мМ HEPES (рН 7.4). Клетки преинкубировали в течение 10 минут при комнатной температуре вместе с добавлением 20 мкл препарата СМД анти-КР. После преинкубации в лунки добавляли активатор аденилатциклазы NKH477. Клетки инкубировали в течение 10 минут 37°C и лизировали. В лунки вносили флуоресцентный акцептор (цАМФ, меченный D2) и флуоресцентный донор (антитела к цАМФ, меченные криптатом европия).Prior to insertion into the wells of a microplate (96-well plate, well volume 250 μl), the cells were suspended in HBSS buffer (Invitrogen) containing 20 mM HEPES (pH 7.4). Cells were preincubated for 10 minutes at room temperature with the addition of 20 μl of anti-Raman SMD. After pre-incubation, NKH477 adenylate cyclase activator was added to the wells. Cells were incubated for 10 minutes at 37 ° C and lysed. A fluorescent acceptor (cAMP labeled with D2) and a fluorescent donor (antibodies to cAMP labeled with europium cryptate) were added to the wells.
В качестве базального контроля вместо препарата СМД анти-КР суспензию клеток преинкубировали в присутствии HBSS буфера (20 мкл). В качестве стимулированного контроля вместо СМД анти-КР суспензию клеток преинкубировали в присутствии референсного агониста СР 55940 (20 мкл).As a basal control, instead of the SMD anti-CR preparation, the cell suspension was preincubated in the presence of HBSS buffer (20 μl). As a stimulated control, instead of SMD anti-CR, the cell suspension was preincubated in the presence of the reference agonist CP 55940 (20 μl).
Функциональную активность (по концентрации цАМФ) оценивали методом гомогенной флуоресценции с временным разрешением (HTRF). Интенсивность флуоресценции в базальном контроле принимается за фоновую, и ее значение вычитается из интенсивностей флуоресценции в опыте (СМД анти-КР) и контроле (СР 55940):Functional activity (by cAMP concentration) was evaluated by time-resolved homogeneous fluorescence (HTRF). The fluorescence intensity in the basal control is taken as the background, and its value is subtracted from the fluorescence intensities in the experiment (SMD anti-KR) and control (CP 55940):
Измеренный специфический ответ клетки на введение СМД анти-КР вычисляется по формуле: интенсивность флуоресценции в опыте (СМД анти-КР) - интенсивность флуоресценции в базальном контроле.The measured specific response of the cell to the introduction of SMD anti-Raman is calculated by the formula: the fluorescence intensity in the experiment (SMD anti-Raman) is the fluorescence intensity in the basal control.
Измеренный специфический ответ клетки на введение референсного агониста (СР 55940) вычисляется по формуле: интенсивность флуоресценции в контроле (СР 55940) - интенсивность флуоресценции в базальном контроле.The measured specific response of the cell to the introduction of a reference agonist (CP 55940) is calculated by the formula: fluorescence intensity in the control (CP 55940) - fluorescence intensity in the basal control.
Результаты выражаются в процентах от специфического ответа клетки на введение референсного агониста в стимулированном контроле:The results are expressed as a percentage of the specific response of the cell to the introduction of a reference agonist in stimulated control:
% ответа референсного агониста = ((измеренный специфический ответ/специфический ответ в контроле на введение референсного агониста)×100%).% response of the reference agonist = ((measured specific response / specific response in the control on the introduction of the reference agonist) × 100%).
Режим антагонистаAntagonist mode
Перед внесением в лунки микропланшета (96-луночный планшет, объем лунки 250 µl) клетки суспендировали в буфере HBSS (Invitrogen), содержащем 20 мМ HEPES (рН 7.4). Клетки проинкубировали в течение 5 минут при комнатной температуре вместе с добавлением 20 мкл препарата СМД анти-КР. После добавления в лунки референсного агониста СР 55940 клетки инкубировали 10 минут при комнатной температуре. Далее в лунки добавляли активатор аденилатциклазы NKH477. Клетки инкубировали в течение 10 минут 37°C и лизировали. В лунки вносили флуоресцентный акцептор (цАМФ, меченный D2) и флуоресцентный донор (антитела к цАМФ, меченные криптатом европия).Prior to insertion into the wells of a microplate (96-well plate, well volume 250 μl), the cells were suspended in HBSS buffer (Invitrogen) containing 20 mM HEPES (pH 7.4). Cells were incubated for 5 minutes at room temperature with the addition of 20 μl of anti-Raman SMD. After adding the reference agonist of CP 55940 to the wells, the cells were incubated for 10 minutes at room temperature. Next, NKH477 adenylate cyclase activator was added to the wells. Cells were incubated for 10 minutes at 37 ° C and lysed. A fluorescent acceptor (cAMP labeled with D2) and a fluorescent donor (antibodies to cAMP labeled with europium cryptate) were added to the wells.
В качестве базального контроля вместо СМД анти-КР суспензию клеток проинкубировали в присутствии референсного антагониста AM 281 (20 мкл). В лунки с базальным контролем не добавляли референсный агонист СР 55940. В качестве стимулированного контроля суспензию клеток преинкубировали в присутствии HBSS буфера, содержащего 20 мМ HEPES (рН 7.4), и референсного агониста СР 55940 (20 мкл).As a basal control, instead of SMD anti-Raman cell suspension, the cell suspension was incubated in the presence of the reference antagonist AM 281 (20 μl). The reference agonist CP 55940 was not added to the wells with the basal control. As a stimulated control, the cell suspension was preincubated in the presence of HBSS buffer containing 20 mM HEPES (pH 7.4) and the reference agonist CP 55940 (20 μl).
Функциональную активность (по концентрации цАМФ) оценивали методом гомогенной флуоресценции с временным разрешением (HTRF). Интенсивность флуоресценции в базальном контроле принимается за фоновую и ее значение вычитается из интенсивностей флуоресценции в опыте (СМД анти-КР) и контроле (СР 55940).Functional activity (by cAMP concentration) was evaluated by time-resolved homogeneous fluorescence (HTRF). The fluorescence intensity in the basal control is taken as the background and its value is subtracted from the fluorescence intensities in the experiment (SMD anti-CR) and control (CP 55940).
Измеренный специфический ответ клетки на введение СМД анти-КР вычисляется по формуле: интенсивность флуоресценции в опыте (СМД анти-КР) - интенсивность флуоресценции в базальном контроле.The measured specific response of the cell to the introduction of SMD anti-Raman is calculated by the formula: the fluorescence intensity in the experiment (SMD anti-Raman) is the fluorescence intensity in the basal control.
Измеренный специфический ответ клетки на введение референсного агониста (СР 55940) вычисляется по формуле:The measured specific response of the cell to the introduction of a reference agonist (CP 55940) is calculated by the formula:
интенсивность флуоресценции в контроле (СР 55940) - интенсивность флуоресценции в базальном контроле.fluorescence intensity in the control (CP 55940) - fluorescence intensity in the basal control.
Результаты выражаются в процентах ингибирования специфического ответа клетки на введение референсного агониста (СР 55940) в контроле:The results are expressed as percent inhibition of the specific response of the cell to the introduction of a reference agonist (CP 55940) in the control:
% ингибирования ответа референсного агониста =100%- ((измеренный специфический ответ/специфический ответ в контроле на введение референсного агониста)×100%)% inhibition of the response of the reference agonist = 100% - ((measured specific response / specific response in the control on the introduction of the reference agonist) × 100%)
В результате исследований показано (см. таблицу 1), что СМД анти-КР изменяет функциональную активность каннабиноидного рецептора I типа, оцененную по концентрации внутриклеточной цАМФ.As a result of studies, it was shown (see Table 1) that SMD anti-Raman changes the functional activity of type I cannabinoid receptor, estimated by the concentration of intracellular cAMP.
Образец (сверхмалые дозы антител к каннабиноидному рецептору I типа (смесь гомеопатических разведений С12+C30+С200)) проявляет свойства агониста к каннабиноидному рецептору I типа, выраженность модифицирующего эффекта которого составляет 21% от эффекта стандартного агониста СР55940 (эффект стандартного агониста принимается за 100%).The sample (ultra-low doses of antibodies to the cannabinoid receptor type I (a mixture of homeopathic dilutions C12 + C30 + C200)) exhibits the properties of an agonist to the cannabinoid receptor type I, the severity of the modifying effect of which is 21% of the effect of the standard agonist CP55940 (the effect of the standard agonist is taken as 100% )
Claims (4)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
RU2013135848/15A RU2557971C2 (en) | 2013-07-31 | 2013-07-31 | Method of influencing functional activity of cannabinoid receptor |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
RU2013135848/15A RU2557971C2 (en) | 2013-07-31 | 2013-07-31 | Method of influencing functional activity of cannabinoid receptor |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
RU2010129289/15A Division RU2552221C2 (en) | 2010-07-15 | 2010-07-15 | Method of treating obesity and accompanying metabolic disorders and medication for treating obesity and accompanying metabolic disorders |
Publications (2)
Publication Number | Publication Date |
---|---|
RU2013135848A RU2013135848A (en) | 2015-02-10 |
RU2557971C2 true RU2557971C2 (en) | 2015-07-27 |
Family
ID=53281575
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
RU2013135848/15A RU2557971C2 (en) | 2013-07-31 | 2013-07-31 | Method of influencing functional activity of cannabinoid receptor |
Country Status (1)
Country | Link |
---|---|
RU (1) | RU2557971C2 (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
RU2181297C2 (en) * | 2000-06-20 | 2002-04-20 | Эпштейн Олег Ильич | Method of treatment of pathological syndrome and medicinal agent |
TW200522944A (en) * | 2003-12-23 | 2005-07-16 | Lilly Co Eli | CB1 modulator compounds |
-
2013
- 2013-07-31 RU RU2013135848/15A patent/RU2557971C2/en not_active IP Right Cessation
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
RU2181297C2 (en) * | 2000-06-20 | 2002-04-20 | Эпштейн Олег Ильич | Method of treatment of pathological syndrome and medicinal agent |
TW200522944A (en) * | 2003-12-23 | 2005-07-16 | Lilly Co Eli | CB1 modulator compounds |
Non-Patent Citations (1)
Title |
---|
ТАЛЫЗИН Т.А. и др. "Блокада эндоканнабиноидных рецепторов - новый подход к лечению основных факторов риска атеросклероза". Фарматека 2006, N8, найдено 16.04.2015, найдено из Интернет: http://www.pharmateca.ru/ru/archive/article/6535. VSLENZUELA C et al. A role for the endocannabinoid system in obesity. Rev Med Chil. 2010 May;138(5):621-9, реферат, найдено 16.04.2015, найдено из PubMed PMID:20668819 * |
Also Published As
Publication number | Publication date |
---|---|
RU2013135848A (en) | 2015-02-10 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR101901465B1 (en) | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract | |
US20130045237A1 (en) | Combination pharmaceutical composition and methods of treating and preventing the infectious diseases | |
US20130058982A1 (en) | Method of treating Alzheimer's disease | |
RU2517084C2 (en) | Method and means for inhibiting production or enhancing protein p24 elimination | |
RU2535034C2 (en) | Medication and method of preventing hiv infection, prevention and treatment of hiv-induced or hiv-associated diseases, including aids | |
MX2013000804A (en) | A combination pharmaceutical composition and methods of treating diabetes and metabolic disorders. | |
US20120258146A1 (en) | Method of treating organic diseases of nervous system, pschoorganic syndrome and encephalopathy | |
US20120321672A1 (en) | Method of treating attention deficit hyperactivity disorder | |
RU2557971C2 (en) | Method of influencing functional activity of cannabinoid receptor | |
Chgoury et al. | Effectiveness of the Androctonus australis hector nanobody Nbf12-10 antivenom to neutralize significantly the toxic effect and tissue damage provoked by fraction of Androctonus mauretanicus (Morocco) scorpion venom | |
RU2568896C2 (en) | Medication based on substance influencing endocannabinoid system | |
RU2582393C2 (en) | Method of treating obesity and associated metabolic disorders | |
RU2526153C2 (en) | Method for increase of pharmacological activity of active agent of drug preparation and pharmaceutical composition | |
RU2536232C2 (en) | Therapeutic agent for alzheimer's disease and method of treating alzheimer's disease | |
RU2542414C2 (en) | Medication for treating erectile dysfunctions and method of treating erectile dysfunctions | |
RU2565401C2 (en) | Method of treating diabetes mellitus and combined medication | |
RU2542403C2 (en) | Method for endothelial dysfunction correction | |
RU2543332C2 (en) | Therapeutic agent for endothelial dysfunction correction | |
RU2523451C2 (en) | Method of treating chronic cardiac failure and pharmaceutical composition for treating chronic cardiac failure | |
RU2528093C2 (en) | Pharmaceutical composition and method of treating acute and chronic respiratory diseases and cough syndrome | |
RU2509572C2 (en) | Drug for reducing insulin resistance and for treating diabetes, method of reducing insulin resistance, method of treating diabetes and method of treating diabetes with insulin and/or hypoglycemic preparations | |
RU2552221C2 (en) | Method of treating obesity and accompanying metabolic disorders and medication for treating obesity and accompanying metabolic disorders | |
RU2525155C2 (en) | Method of treating chronic heart failure and pharmaceutical composition for complex therapy of chronic heart failure | |
RU2541166C2 (en) | Method for endothelial dysfunction correction | |
RU2533224C2 (en) | Method of treating psychoactive substance dependence, alcohol and nicotine addiction and medication for treatment of psychoactive substance dependence, alcohol and nicotine addiction |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
MM4A | The patent is invalid due to non-payment of fees |
Effective date: 20150824 |
|
NF4A | Reinstatement of patent |
Effective date: 20170116 |
|
MM4A | The patent is invalid due to non-payment of fees |
Effective date: 20190716 |