RU2018114523A - Анти-tigit антитела и способы применения - Google Patents

Анти-tigit антитела и способы применения Download PDF

Info

Publication number
RU2018114523A
RU2018114523A RU2018114523A RU2018114523A RU2018114523A RU 2018114523 A RU2018114523 A RU 2018114523A RU 2018114523 A RU2018114523 A RU 2018114523A RU 2018114523 A RU2018114523 A RU 2018114523A RU 2018114523 A RU2018114523 A RU 2018114523A
Authority
RU
Russia
Prior art keywords
antibody
amino acid
seq id
acid sequence
paragraphs
Prior art date
Application number
RU2018114523A
Other languages
English (en)
Other versions
RU2018114523A3 (ru
Inventor
Джейн Л. ГРОГАН
Роберт Дж. ДЖОНСТОН
Ян Ву
Вэй-Чинг ЛЯНГ
Патрик ЛУПАРДУС
Манеш ЯДАВ
Дхайа СЕШАСАЙЕЕ
Мередит ХЭЙЗЕН
Original Assignee
Дженентек, Инк.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US201562233230P priority Critical
Priority to US62/233,230 priority
Priority to US201662369299P priority
Priority to US62/369,299 priority
Application filed by Дженентек, Инк. filed Critical Дженентек, Инк.
Priority to PCT/US2016/053368 priority patent/WO2017053748A2/en
Publication of RU2018114523A3 publication Critical patent/RU2018114523A3/ru
Publication of RU2018114523A publication Critical patent/RU2018114523A/ru

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3061Blood cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Claims (234)

1. Антитело, которое специфически связывается с TIGIT человека, причем антитело связывается с эпитопом на TIGIT человека, содержащем один или большее количество аминокислотных остатков Ser78, Ser80 и Lys82 TIGIT человека.
2. Антитело по п. 1, отличающееся тем, что указанный эпитоп содержит аминокислотные остатки Ser80 и Lys82 TIGIT человека.
3. Антитело по п. 1 или 2, отличающееся тем, что указанный эпитоп содержит аминокислотные остатки Ser78, Ser80 и Lys82 TIGIT человека.
4. Антитело по любому из пп. 1-3, отличающееся тем, что указанный эпитоп дополнительно содержит аминокислотный остаток Ala67 TIGIT человека.
5. Антитело по любому из пп. 1-4, отличающееся тем, что указанный эпитоп дополнительно содержит один или большее количество дополнительных аминокислотных остатков, выбранных из группы, состоящей из Glu60, Leu65 и Ile68 TIGIT человека.
6. Антитело по любому из пп. 1-5, отличающееся тем, что указанный эпитоп дополнительно содержит один или большее количество дополнительных аминокислотных остатков, выбранных из группы, состоящей из Gln56, Asn70, Leu73 и His111 TIGIT человека.
7. Антитело по любому из пп. 1-6, отличающееся тем, что указанный эпитоп дополнительно содержит один или большее количество дополнительных аминокислотных остатков, выбранных из группы, состоящей из Thr55, Asn58, Asp63, Gln64, His76, Ile77 и Pro79 TIGIT человека.
8. Антитело по любому из пп. 1-7, отличающееся тем, что указанный эпитоп состоит из аминокислотных остатков Thr55, Gln56, Asn58, Glu60, Asp63, Gln64, Leu65, Ala67, Ile68, Asn70, Leu73, His76, Ile77, Ser78, Pro79, Ser80, Lys82 и His111 TIGIT человека.
9. Антитело, которое специфически связывается с TIGIT человека, причем антитело связывается с эпитопом на TIGIT человека, содержащем один или большее количество аминокислотных остатков Thr55, Ser80 и Lys82 TIGIT человека.
10. Антитело по п. 9, отличающееся тем, что указанный эпитоп содержит аминокислотный остаток Lys82 TIGIT человека.
11. Антитело по п. 9 или 10, отличающееся тем, что указанный эпитоп содержит аминокислотные остатки Thr55, Ser80 и Lys82 TIGIT человека.
12. Антитело по любому из пп. 9-11, отличающееся тем, что указанный эпитоп дополнительно содержит аминокислотный остаток Gln56 TIGIT человека.
13. Антитело по любому из пп. 9-12, отличающееся тем, что указанный эпитоп дополнительно содержит аминокислотный остаток Ile77 или Pro79 TIGIT человека.
14. Антитело по п. 13, отличающееся тем, что указанный эпитоп дополнительно содержит аминокислотные остатки Ile77 и Pro79 TIGIT человека.
15. Антитело по пп. 9-14, отличающееся тем, что указанный эпитоп дополнительно содержит аминокислотные остатки Asn58 или Glu60 TIGIT человека.
16. Антитело по п. 15, отличающееся тем, что указанный эпитоп дополнительно содержит аминокислотные остатки Asn58 и Glu60 TIGIT человека.
17. Антитело по любому из пп. 9-16, отличающееся тем, что указанный эпитоп дополнительно содержит один или большее количество дополнительных аминокислотных остатков, выбранных из группы, включающей Leu65, Ile68, Leu73, His76, Ser78 и His111 TIGIT человека.
18. Антитело по п. 17, отличающееся тем, что указанный эпитоп дополнительно содержит аминокислотные остатки Leu65, Ile68, Leu73, His76, Ser78 и His111 TIGIT человека.
19. Антитело по любому из пп. 9-18, отличающееся тем, что указанный эпитоп состоит из Thr55, Gln56, Asn58, Glu60, Leu65, Ile68, Leu73, His76, Ile77, Ser78, Pro79, Ser80, Lys82 и His111 TIGIT человека.
20. Антитело, которое специфически связывается с TIGIT человека, причем антитело содержит паратоп, содержащий один или большее количество аминокислотных остатков, выбранных из группы, состоящей из аминокислотных остатков вариабельного участка тяжелой цепи Asn32, Tyr52, Arg52b, Phe53, Lys54, Tyr56, Asp58, Tyr99, Asp100, Leu100a, Leu100b и Ala100c и аминокислотных остатков вариабельного участка легкой цепи Tyr27d, Tyr92, Ser93, Thr94 и Phe96.
21. Антитело по п. 20, отличающееся тем, что указанный паратоп состоит из аминокислотных остатков вариабельного участка тяжелой цепи Asn32, Tyr52, Arg52b, Phe53, Lys54, Tyr56, Asp58, Tyr99, Asp100, Leu100a, Leu100b и Ala100c и аминокислотных остатков вариабельного участка легкой цепи Tyr27d, Tyr92, Ser93, Thr94 и Phe96.
22. Антитело, которое специфически связывается с TIGIT человека, причем антитело связывается с эпитопом на TIGIT человека, содержащим один или большее количество аминокислотных остатков, выбранных из группы, состоящей из Gln53, His111 и Tyr113 TIGIT человека.
23. Антитело по п. 22, отличающееся тем, что указанный эпитоп дополнительно содержит Gln56 TIGIT человека.
24. Антитело по п. 22 или 23, отличающееся тем, что указанный эпитоп дополнительно содержит Glu60, Leu65, Ile68, Asn70, Leu73 и His76 TIGIT человека.
25. Антитело, которое специфически связывается с TIGIT человека, причем антитело содержит следующие шесть гипервариабельных участков (ГВУ (HVR)):
HVR-H1, содержащий аминокислотную последовательность SNSAAWN (SEQ ID NO: 1);
HVR-H2, содержащий аминокислотную последовательность KTYYRFKWYSDYAVSVKG (SEQ ID NO: 2);
HVR-H3, содержащий аминокислотную последовательность ESTTYDLLAGPFDY (SEQ ID NO: 3);
HVR-L1, содержащий аминокислотную последовательность KSSQTVL YSSNNKKYLA (SEQ ID NO: 4);
HVR-L2, содержащий аминокислотную последовательность WASTRES (SEQ ID NO: 5); и
HVR-L3, содержащий аминокислотную последовательность QQYYSTPFT (SEQ ID NO: 6).
26. Антитело п. 25, отличающееся тем, что указанное антитело дополнительно содержит следующие каркасные участки (КУ) вариабельного участка легкой цепи:
FR-L1, содержащий аминокислотную последовательность DIVMTQSPDSLAVSLGERATINC (SEQ ID NO: 7);
FR-L2, содержащий аминокислотную последовательность WYQQKPGQPPNLLIY (SEQ ID NO: 8);
FR-L3, содержащий аминокислотную последовательность GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC (SEQ ID NO: 9); а также
FR-L4, содержащий аминокислотную последовательность FGPGTKVEIK (SEQ ID NO: 10).
27. Антитело по п. 25 или 26, отличающееся тем, что указанное антитело дополнительно содержит следующие КУ участки вариабельного участка тяжелой цепи:
FR-H1, содержащий аминокислотную последовательность X1VQLQQSGPGLVKPSQTLSLTCAISGDSVS (SEQ ID NO: 11), где X1 представляет собой Q или E;
FR-H2, содержащий аминокислотную последовательность WIRQSPSRGLEWLG (SEQ ID NO: 12);
FR-H3, содержащий аминокислотную последовательность RITINPDTSKNQFSLQLNSVTPEDTAVFYCTR (SEQ ID NO: 13); и
FR-H4, содержащий аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 14).
28. Антитело по п. 27, отличающееся тем, что указанное антитело дополнительно содержит следующие КУ участки вариабельного участка тяжелой цепи:
FR-H1, содержащий аминокислотную последовательность EVQLQQSGPGLVKPSQTLSLTCAISGDSVS (SEQ ID NO: 15);
FR-H2, содержащий аминокислотную последовательность WIRQSPSRGLEWLG (SEQ ID NO: 12);
FR-H3, содержащий аминокислотную последовательность RITINPDTSKNQFSLQLNSVTPEDTAVFYCTR (SEQ ID NO: 13); и
FR-H4, содержащий аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 14).
29. Антитело по п. 27, отличающееся тем, что указанное антитело дополнительно содержит следующие КУ участки вариабельного участка тяжелой цепи:
FR-H1, содержащий аминокислотную последовательность QVQLQQSGPGLVKPSQTLSLTCAISGDSVS (SEQ ID NO: 16);
FR-H2, содержащий аминокислотную последовательность WIRQSPSRGLEWLG (SEQ ID NO: 12);
FR-H3, содержащий аминокислотную последовательность RITINPDTSKNQFSLQLNSVTPEDTAVFYCTR (SEQ ID NO: 13); и
FR-H4, содержащий аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 14).
30. Антитело, которое специфически связывается с TIGIT человека, причем антитело содержит следующие шесть ГВУ (HVR):
HVR-H1, содержащий аминокислотную последовательность SYPMN (SEQ ID NO: 17);
HVR-H2, содержащий аминокислотную последовательность WINTNTGNPTYVQGFTG (SEQ ID NO: 18);
HVR-H3, содержащий аминокислотную последовательность TGGHTYDSYAFDV (SEQ ID NO: 19);
HVR-L1, содержащий аминокислотную последовательность RASQVISSSLA (SEQ ID NO: 20);
HVR-L2, содержащий аминокислотную последовательность AASTLQS (SEQ ID NO: 21); а также
HVR-L3, содержащий аминокислотную последовательность QHLHGYPX1N (SEQ ID NO: 22), где X1 представляет собой C или S.
31. Антитело по п. 30, отличающееся тем, что указанное антитело содержит следующие шесть ГВУ (HVR):
HVR-H1, содержащий аминокислотную последовательность SYPMN (SEQ ID NO: 17);
HVR-H2, содержащий аминокислотную последовательность WINTNTGNPTYVQGFTG (SEQ ID NO: 18);
HVR-H3, содержащий аминокислотную последовательность TGGHTYDSYAFDV (SEQ ID NO: 19);
HVR-L1, содержащий аминокислотную последовательность RASQVISSSLA (SEQ ID NO: 20);
HVR-L2, содержащий аминокислотную последовательность AASTLQS (SEQ ID NO: 21); и
HVR-L3, содержащий аминокислотную последовательность QHLHGYPSN (SEQ ID NO: 23).
32. Антитело по любому из п. 30 или п. 31, отличающееся тем, что указанное антитело дополнительно содержит следующие КУ участки вариабельного участка тяжелой цепи:
FR-H1, содержащий аминокислотную последовательность EVQLVQSGSDLKKPGASVRVSCKASGYTFT (SEQ ID NO: 24);
FR-H2, содержащий аминокислотную последовательность WVRQAPGHGLEWMG (SEQ ID NO: 25);
FR-H3, содержащий аминокислотную последовательность RFVFSLDTSVNTAYLQISSLKAEDTAVYFCAR (SEQ ID NO: 26); и
FR-H4, содержащий аминокислотную последовательность WGQGTMVTVSS (SEQ ID NO: 27).
33. Антитело по п. 30, отличающееся тем, что указанное антитело содержит следующие шесть ГВУ (HVR):
HVR-H1, содержащий аминокислотную последовательность SYPMN (SEQ ID NO: 17);
HVR-H2, содержащий аминокислотную последовательность WINTNTGNPTYVQGFTG (SEQ ID NO: 18);
HVR-H3, содержащий аминокислотную последовательность TGGHTYDSYAFDV (SEQ ID NO: 19);
HVR-L1, содержащий аминокислотную последовательность RASQVISSSLA (SEQ ID NO: 20);
HVR-L2, содержащий аминокислотную последовательность AASTLQS (SEQ ID NO: 21); и
HVR-L3, содержащий аминокислотную последовательность QHLHGYPCN (SEQ ID NO: 28).
34. Антитело по п. 33, отличающееся тем, что указанное антитело дополнительно содержит следующие КУ участки вариабельного участка тяжелой цепи:
FR-H1, содержащий аминокислотную последовательность QVQLVQSGSDLKKPGASVRVSCKASGYTFT (SEQ ID NO: 29);
FR-H2, содержащий аминокислотную последовательность WVRQAPGHGLEWMG (SEQ ID NO: 25);
FR-H3, содержащий аминокислотную последовательность RFVFSLDTSVNTAYLQISSLKAEDTAVYFCAR (SEQ ID NO: 26); и
FR-H4, содержащий аминокислотную последовательность WGQGTMVTVSS (SEQ ID NO: 27).
35. Антитело по любому из пп. 30-34, отличающееся тем, что указанное антитело дополнительно содержит следующие КУ участки вариабельного участка легкой цепи:
FR-L1, содержащий аминокислотную последовательность DIQLTQSPTFLSASVGDRVTITC (SEQ ID NO: 30);
FR-L2, содержащий аминокислотную последовательность WYQQNPGKAPKLLIY (SEQ ID NO: 31);
FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTEFTLTISSLQPEDFVTYYC (SEQ ID NO: 32); и
FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 33).
36. Антитело, которое специфически связывается с TIGIT человека, причем антитело содержит (а) вариабельный участок тяжелой цепи (VH), обладающий идентичностью последовательности по меньшей мере 95 % относительно аминокислотной последовательности SEQ ID NO: 34 или 35; (b) вариабельный участок легкой цепи (VL), обладающий идентичностью последовательности по меньшей мере 95 % относительно аминокислотной последовательности SEQ ID NO: 36; или (c) вариабельный участок тяжелой цепи, как в (a), и вариабельный участок легкой цепи, как в (b).
37. Антитело по п. 36, отличающееся тем, что указанное антитело содержит (а) вариабельный участок тяжелой цепи (VH), обладающий идентичностью последовательности по меньшей мере 95 % относительно аминокислотной последовательности SEQ ID NO: 34; (b) вариабельный участок легкой цепи (VL), обладающий идентичностью последовательности по меньшей мере 95 % относительно аминокислотной последовательности SEQ ID NO: 36; или (c) вариабельный участок тяжелой цепи, как в (a), и вариабельный участок легкой цепи, как в (b).
38. Антитело по п. 36, отличающееся тем, что указанное антитело содержит (а) вариабельный участок тяжелой цепи (VH), обладающий идентичностью последовательности по меньшей мере 95 % относительно аминокислотной последовательности SEQ ID NO: 35; (b) вариабельный участок легкой цепи (VL), обладающий по меньшей мере 95 % идентичностью последовательности относительно аминокислотной последовательности SEQ ID NO: 36; или (c) вариабельный участок тяжелой цепи, как в (a), и вариабельный участок легкой цепи, как в (b).
39. Антитело, которое специфически связывается с TIGIT человека, причем антитело содержит (а) вариабельный участок тяжелой цепи (VH), обладающий идентичностью последовательности по меньшей мере 95 % относительно аминокислотной последовательности SEQ ID NO: 37; (b) вариабельный участок легкой цепи (VL), обладающий идентичностью последовательности по меньшей мере 95 % относительно аминокислотной последовательности SEQ ID NO: 38; или (c) вариабельный участок тяжелой цепи, как в (a), и вариабельный участок легкой цепи, как в (b).
40. Антитело, которое специфически связывается с TIGIT человека, причем антитело содержит (а) вариабельный участок тяжелой цепи (VH), обладающий идентичностью последовательности по меньшей мере 95 % относительно аминокислотной последовательности SEQ ID NO: 39; (b) вариабельный участок легкой цепи (VL), обладающий идентичностью последовательности по меньшей мере 95 % относительно аминокислотной последовательности SEQ ID NO: 40; или (c) вариабельный участок тяжелой цепи, как в (a), и вариабельный участок легкой цепи, как в (b).
41. Антитело по любому из пп. 1-21, 25-29 и 36-38, отличающееся тем, что указанное антитело способно связываться с TIGIT кролика.
42. Антитело по любому из пп. 1-41, отличающееся тем, что указанное антитело способно связываться с TIGIT человека и TIGIT яванского макака (яванца), но не TIGIT мыши.
43. Антитело по п. 42, отличающееся тем, что указанное антитело связывается с TIGIT человека с Kd около 10 нМ или менее и с TIGIT яванца с Kd около 10 нМ или менее.
44. Антитело по п. 43, отличающееся тем, что указанное антитело связывается с TIGIT человека с Kd от около 0,1 нМ до около 1 нМ и с TIGIT яванца с Kd от около 0,5 нМ до около 1 нМ.
45. Антитело по п. 44, отличающееся тем, что указанное антитело связывается с TIGIT человека с Kd около 0,1 нМ или менее и с TIGIT яванца с Kd около 0,5 нМ или менее.
46. Антитело по любому из пп. 1-45, отличающееся тем, что указанное антитело представляет собой антагонистическое антитело.
47. Антитело по п. 46, отличающееся тем, что указанное антагонистическое антитело специфически связывается с TIGIT и ингибирует или блокирует взаимодействие TIGIT с рецептором полиовируса (ПВР (PVR)).
48. Антитело по п. 47, отличающееся тем, что указанное антагонистическое антитело ингибирует внутриклеточную передачу сигнала, опосредованную связыванием TIGIT с ПВР (PVR).
49. Антитело по пп. 46-48, отличающееся тем, что указанное антагонистическое антитело ингибирует или блокирует связывание TIGIT человека с ПВР (PVR) человека со значением IC50 10 нМ или менее.
50. Антитело по любому из пп. 46-49, отличающееся тем, что указанное антагонистическое антитело ингибирует или блокирует связывание TIGIT человека с ПВР (PVR) человека со значением IC50 от 1 нМ до около 10 нМ.
51. Антитело по любому из пп. 46-50, отличающееся тем, что указанное антагонистическое антитело ингибирует или блокируют связывание TIGIT яванца с ПВР (PVR) яванца со значением IC50 50 нМ или менее.
52. Антитело по п. 51, отличающееся тем, что указанное антагонистическое антитело ингибирует или блокирует связывание TIGIT яванца с ПВР (PVR) яванца со значением IC50 от 1 нМ до около 50 нМ.
53. Антитело по п. 52, отличающееся тем, что указанное антагонистическое антитело ингибирует или блокирует связывание TIGIT яванца с ПВР (PVR) яванца со значением IC50 от 1 нМ до около 5 нМ.
54. Антитело по любому из пп. 1-45, отличающееся тем, что указанное антитело представляет собой агонистическое антитело.
55. Антитело по п. 54, отличающееся тем, что указанное агонистическое антитело специфически связывается с TIGIT и стимулирует взаимодействие ПВР (PVR) с CD226 или CD96.
56. Антитело по п. 55, отличающееся тем, что указанное агонистическое антитело специфически связывается с TIGIT и стимулирует взаимодействие ПВР (PVR) с CD226 и CD96.
57. Антитело по п. 56, отличающееся тем, что указанное агонистическое антитело специфически связывается с TIGIT и стимулирует взаимодействие ПВР (PVR) человека с CD226 человека и CD96 человека.
58. Антитело по п.56, отличающееся тем, что указанное агонистическое антитело специфически связывается с TIGIT и стимулирует взаимодействие ПВР (PVR) яванца с CD226 яванца и CD96 яванца.
59. Выделенное антитело, которое конкурирует за связывание с TIGIT с антителом по любому из пп. 1-58.
60. Выделенное антитело, которое связывается с тем же эпитопом, что и антитело по любому из пп. 1-58.
61. Антитело по любому из пп. 1-60, отличающееся тем, что указанное антитело является моноклональным.
62. Антитело по любому из пп. 1-60, отличающееся тем, что указанное антитело является человеческим, гуманизированным или химерным.
63. Антитело по п. 62, отличающееся тем, что по меньшей мере часть каркасной последовательности представляет собой консенсусную каркасную последовательность человека.
64. Антитело по любому из пп. 1-63, отличающееся тем, что указанное антитело представляет собой полноразмерное антитело.
65. Антитело по любому из пп. 1-64, отличающееся тем, что клиренс указанного антитела после внутривенной инъекции составляет от около 3 мл/кг/день до около 10 мл/кг/день.
66. Антитело по п. 65, отличающееся тем, что клиренс указанного антитела после внутривенной инъекции составляет от около 3 мл/кг/день до около 8 мл/кг/день.
67. Антитело по любому из пп. 1-63, отличающееся тем, что указанное антитело представляет собой фрагмент антитела, который связывается с TIGIT.
68. Антитело по п. 67, отличающееся тем, что указанный фрагмент антитела выбран из группы, состоящей из фрагментов Fab, Fab', Fab'-SH, Fv, одноцепочечного вариабельного фрагмента (scFv) и фрагментов (Fab')2.
69. Антитело по любому из пп. 1-68, отличающееся тем, что указанное антитело представляет собой антитело класса IgG.
70. Антитело по п. 69, отличающееся тем, что указанное антитело класса IgG представляет собой антитело подкласса IgG1.
71. Полинуклеотид, кодирующий антитело по любому из пп. 1-70.
72. Вектор, содержащий полинуклеотид по п. 71.
73. Клетка-хозяин, содержащая вектор по п. 72.
74. Клетка-хозяин по п. 73, отличающаяся тем, что клетка-хозяин является прокариотической.
75. Клетка-хозяин по п. 74, отличающаяся тем, что клетка-хозяин представляет собой Escherichia coli.
76. Клетка-хозяин по п. 73, отличающаяся тем, что клетка-хозяин является эукариотической.
77. Клетка-хозяин по п. 76, отличающаяся тем, что клетка-хозяин представляет собой клетку 293, клетку СНО, дрожжевую клетку или растительную клетку.
78. Способ получения антитела по любому из пп. 1-70, включающий культивирование клетки-хозяина по п. 73 в питательной среде.
79. Способ по п. 78, отличающийся тем, что способ дополнительно включает выделение антитела из клетки-хозяина или питательной среды.
80. Иммуноконъюгат, содержащий антитело по любому из пп. 1-70 и цитотоксический агент.
81. Композиция, содержащая антитело по любому из пп. 1-70.
82. Композиция по п. 81, дополнительно содержащая фармацевтически приемлемый носитель, вспомогательное вещество или разбавитель.
83. Композиция по п. 82, отличающаяся тем, что композиция представляет собой фармацевтическую композицию.
84. Композиция по любому из пп. 81-83, отличающееся тем, что композиция дополнительно содержит антагонист связывания оси PD-1 или дополнительный терапевтический агент.
85. Антитело по любому из пп. 1-70 для применения в качестве лекарственного средства.
86. Антитело по любому из пп. 1-70, предназначенное для лечения или замедления прогрессирования рака у субъекта, нуждающегося в этом.
87. Антитело по п. 86, отличающееся тем, что рак выбран из группы, состоящей из немелкоклеточного рака легкого, мелкоклеточного рака легкого, рака почки, колоректального рака, рака яичника, рака молочной железы, рака поджелудочной железы, карциномы желудка, рака мочевого пузыря, рака пищевода, мезотелиомы, меланомы, рака головы и шеи, рака щитовидной железы, саркомы, рака предстательной железы, глиобластомы, рака шейки матки, карциномы тимуса, лейкоза, лимфомы, миеломы, грибовидных микозов, рака клеток Меркель и злокачественных новообразований кроветворной системы.
88. Антитело по п. 87, отличающееся тем, что миелома представляет собой множественную миелому (ММ).
89. Антитело по любому из пп. 1-70 для применения при лечении или замедлении прогрессирования связанного с иммунной системой заболевания у субъекта, нуждающегося в этом.
90. Антитело по п. 89, отличающееся тем, что связанное с иммунной системой заболевание связано с дисфункциональным расстройством Т-клеток.
91. Антитело по п. 90, отличающееся тем, что дисфункциональное расстройство Т-клеток характеризуется истощением Т-клеток.
92. Антитело по любому из пп. 89-91, отличающееся тем, что связанные с иммунной системой заболевания выбраны из группы, состоящей из неразрешенной острой инфекции, хронической инфекции и опухолевого иммунитета.
93. Антитело по любому из пп. 1-70 для применения при повышении, усилении или стимуляции иммунного ответа или функции у субъекта, нуждающегося в этом.
94. Применение антитела по любому из пп. 1-70 в производстве лекарственного средства для лечения или замедления прогрессирования рака у субъекта, нуждающегося в этом.
95. Применение по п. 94, в котором рак выбран из группы, состоящей из немелкоклеточного рака легкого, мелкоклеточного рака легкого, рака почки, колоректального рака, рака яичника, рака молочной железы, рака поджелудочной железы, карциномы желудка, рака мочевого пузыря, рака пищевода, мезотелиомы, меланомы, рака головы и шеи, рака щитовидной железы, саркомы, рака предстательной железы, глиобластомы, рака шейки матки, карциномы тимуса, лейкоза, лимфомы, миеломы, грибовидных микозов, рака клеток Меркель и злокачественных новообразований кроветворной системы.
96. Применение по п. 95, в котором миелома представляет собой ММ.
97. Применение антитела по любому из пп. 1-70 в производстве лекарственного средства для лечения или замедления прогрессирования связанного с иммунной системой заболевания у субъекта, нуждающегося в этом.
98. Применение по п. 97, в котором связанное с иммунной системой заболевание связано с дисфункциональным расстройством Т-клеток.
99. Применение по п. 98, в котором дисфункциональное расстройство Т-клеток характеризуется истощением Т-клеток.
100. Применение по любому из пп. 97-99, в котором заболевание, связанное с иммунной системой, выбрано из группы, состоящей из неразрешенной острой инфекции, хронической инфекции и опухолевого иммунитета.
101. Применение антитела по любому из пп. 1-70 в производстве лекарственного средства для повышения, усиления или стимуляции иммунного ответа или функции у субъекта, нуждающегося в этом.
102. Способ лечения или замедления прогрессирования рака у субъекта, включающий введение субъекту эффективного количества антитела по любому из пп. 1-70, с лечением или замедлением таким образом развития рака у субъекта.
103. Способ по любому из 102, отличающийся тем, что рак выбран из группы, состоящей из немелкоклеточного рака легкого, мелкоклеточного рака легкого, рака почки, колоректального рака, рака яичника, рака молочной железы, рака поджелудочной железы, карциномы желудка, рака мочевого пузыря, рака пищевода, мезотелиомы, меланомы, рака головы и шеи, рака щитовидной железы, саркомы, рака предстательной железы, глиобластомы, рака шейки матки, карциномы тимуса, лейкоза, лимфомы, миеломы, грибовидных микозов, рака клеток Меркель и злокачественных новообразований кроветворной системы.
104. Способ по п. 103, отличающийся тем, что миелома представляет собой ММ.
105. Способ лечения или замедления прогрессирования связанного с иммунной системой заболевания у субъекта, включающий введение субъекту эффективного количества антитела по любому из пп. 1-70, с лечением или замедлением таким образом развития связанного с иммунной системой заболевания у субъекта.
106. Способ по п. 105, отличающийся тем, что связанное с иммунной системой заболевание связано с дисфункциональным расстройством Т-клеток.
107. Способ по п. 106, отличающийся тем, что дисфункциональное расстройство Т-клеток характеризуется истощением Т-клеток.
108. Способ по любому из пп. 105-107, отличающийся тем, что связанное с иммунной системой заболевание выбрано из группы, состоящей из нерешенной острой инфекции, хронической инфекции, и опухолевого иммунитета.
109. Способ повышения, усиления или стимуляции иммунного ответа или функции у субъекта, включающий введение субъекту эффективного количества антитела по любому из пп. 1-70, с повышением, увеличением или стимуляцией тем самым иммунного ответа или функции у субъекта.
110. Способ по любому из пп. 102-109, дополнительно включающий введение субъекту антагониста связывания оси PD-1.
111. Способ по п. 110, отличающийся тем, что антагонист связывания оси PD-1 вводят до или после введения антитела.
112. Способ по п. 110, отличающийся тем, что антагонист связывания оси PD-1 вводят одновременно с антителом.
113. Способ по любому из пп. 110-112, отличающийся тем, что антагонист связывания оси PD-1 выбран из группы, состоящей из антагониста связывания PD-1, антагониста связывания PD-L1 и антагониста связывания PD-L2.
114. Способ по п. 113, отличающийся тем, что антагонист связывания оси PD-1 является антагонистом связывания PD-1.
115. Способ по п. 114, отличающийся тем, что антагонист связывания PD-1 ингибирует связывание PD-1 с его партнерами-лигандами по связыванию.
116. Способ по п. 115, отличающийся тем, что антагонист связывания PD-1 ингибирует связывание PD-1 с PD-L1.
117. Способ по п. 115, отличающийся тем, что антагонист связывания PD-1 ингибирует связывание PD-1 с PD-L2.
118. Способ по п. 115, отличающийся тем, что антагонист связывания PD-1 ингибирует связывание PD-1 как с PD-L1, так и с PD-L2.
119. Способ по любому из пп. 115-118, отличающийся тем, что антагонист связывания PD-1 представляет собой анти-PD-1 антитело.
120. Способ по п. 115, отличающийся тем, что антагонист связывания PD-1 выбран из группы, состоящей из MDX 1106 (ниволумаб), MK-3475 (пембролизумаб), CT-011 (пидилизумаб), MEDI-0680 (AMP-514), PDR001, REGN2810 и BGB-108.
121. Способ по п. 113, отличающийся тем, что антагонист связывания PD-1 является антагонистом связывания PD-L1.
122. Способ по п. 121, отличающийся тем, что антагонист связывания PD-L1 ингибирует связывание PD-L1 с PD-1.
123. Способ по п. 121, отличающийся тем, что антагонист связывания PD-L1 ингибирует связывание PD-L1 с B7-1.
124. Способ по п. 121, отличающийся тем, что антагонист связывания PD-L1 ингибирует связывание PD-L1 как с PD-1, так и с B7-1.
125. Способ по любому из пп. 121-124, отличающийся тем, что антагонист связывания PD-L1 представляет собой анти-PD-L1 антитело.
126. Способ по п. 125, отличающийся тем, что анти-PD-L1 антитело выбрано из группы, состоящей из: MPDL3280A (атезолизумаб), YW243.55.S70, MDX-1105, MEDI4736 (дурвалумаб) и MSB0010718C (авелумаб).
127. Способ по п. 126, отличающийся тем, что антитело представляет собой MPDL3280A.
128. Способ по п. 113, отличающийся тем, что антагонист связывания оси PD-1 является антагонистом связывания PD-L2.
129. Способ по п. 128, отличающийся тем, что антагонист связывания PD-L2 представляет собой анти-PD-L2 антитело.
130. Способ по п. 128, отличающийся тем, что антагонист связывания PD-L2 представляет собой иммуноадгезин.
131. Способ по любому из пп. 102-130, дополнительно включающий введение субъекту агониста связывания OX40.
132. Способ по п. 131, отличающийся тем, что агонист связывания OX40 вводят до или после введения антитела и/или антагониста связывания оси PD-1.
133. Способ по п. 131, отличающийся тем, что агонист связывания OX40 вводят одновременно с антителом и/или антагонистом связывания оси PD-1.
134. Способ по любому из пп. 131-133, отличающийся тем, что агонист связывания OX40 выбран из группы, состоящей из агонистического антитела против OX40, фрагмента агониста OX40L, олигомерного рецептора OX40 и иммуноадгезина OX40.
135. Способ по п. 134, отличающийся тем, что агонистическое антитело OX40 истощает клетки, которые экспрессируют OX40 человека.
136. Способ по п. 135, отличающийся тем, что клетки, которые экспрессируют OX40 человека, представляют собой CD4+ эффекторные Т-клетки.
137. Способ по п. 135, отличающийся тем, что клетки, которые экспрессируют OX40 человека, представляют собой регуляторные T-клетки (Treg).
138. Способ по любому из пп. 135-137, отличающийся тем, что истощение осуществляется по механизму АЗКЦ (ADCC) и/или фагоцитоза.
139. Способ по любому из пп. 134-138, отличающийся тем, что агонистическое антитело OX40 связывается с OX40 человека с аффинностью менее чем или равной около 1 нМ.
140. Способ по п. 139, отличающийся тем, что агонистическое антитело к OX40 связывается с OX40 человека с аффинностью менее чем или равной около 0,45 нМ.
141. Способ по п. 140, отличающийся тем, что агонистическое антитело к OX40 связывается с OX40 человека с аффинностью менее чем или равной около 0,4 нМ.
142. Способ по любому из пп. 134-141, отличающийся тем, что агонистическое антитело связывается с OX40 человека с EC50 менее чем или равной 0,3 мкг/мл.
143. Способ по п. 142, отличающийся тем, что агонистическое антитело к OX40 связывается с OX40 человека с EC50 менее чем или равной 0,2 мкг/мл.
144. Способ по любому из пп. 134-143, отличающийся тем, что агонистическое антитело к OX40 усиливает пролиферацию CD4+ эффекторных Т-клеток и/или увеличивает выработку цитокинов CD4+ эффекторными Т-клетками по сравнению с пролиферацией и/или выработкой цитокинов до начала лечения агонистическим антителом к OX40.
145. Способ по любому из пп. 134-144, отличающийся тем, что агонистическое антитело OX40 усиливает пролиферацию Т-клетки памяти и/или выработку цитокинов Т-клеткой памяти.
146. Способ по п. 144 или п. 145, отличающийся тем, что выработка цитокинов представляет собой выработку IFN-γ.
147. Способ по любому из пп. 134-146, отличающийся тем, что агонистическое антитело к OX40 подавляет функцию Treg.
148. Способ по п. 147, отличающийся тем, что агонистическое антитело к OX40 ингибирует подавление Treg эффекторной функции Т-клетки.
149. Способ по п. 148, отличающийся тем, что эффекторная функция Т-клетки представляет собой пролиферацию эффекторной Т-клетки и/или выработку цитокинов.
150. Способ по п. 148 или 149, отличающийся тем, что эффекторная Т-клетка является CD4+ эффекторной Т-клеткой.
151. Способ по любому из пп. 134-150, отличающийся тем, что агонистическое антитело к OX40 увеличивает трансдукцию сигнала OX40 в клетке-мишени, которая экспрессирует OX40.
152. Способ по п. 151, отличающийся тем, что передачу сигнала OX40 обнаруживают путем мониторинга передачи сигналов NFkB ниже в сигнальном пути.
153. Способ по любому из пп. 134-152, отличающийся тем, что агонистическое антитело к OX40 содержит вариант полипептида Fc IgG1, содержащий мутацию, которая устраняет связывание с эффекторными клетками человека, и обладает сниженной активностью по сравнению с агонистическим антителом к OX40, содержащим нативную последовательность части Fc IgG1.
154. Способ по п. 153, отличающийся тем, что агонистическое антитело OX40 содержит вариант полипептида Fc IgG1, содержащий мутацию DANA.
155. Способ по любому из пп. 134-154, отличающийся тем, что агонистическое антитело к OX40 содержит (а) домен VH, который содержит (I) а HVR-H1, содержащий аминокислотную последовательность SEQ ID NO: 278, 279, или 280, (ii) HVR-H2, содержащий аминокислотную последовательность SEQ ID NO: 281, 282, 283, 284, 285 или 286, и (iii) HVR-H3, содержащий аминокислотную последовательность, выбранную из SEQ ID NO: 287, 288 или 289; и (b) домен VL, который содержит (i) HVR-L1, содержащий аминокислотную последовательность SEQ ID NO: 290, (ii) HVR-L2, содержащий аминокислотную последовательность SEQ ID NO: 291, и (iii) HVR-L3, содержащий аминокислотную последовательность SEQ ID NO: 292, 293, 294, 295, 296, 297, 298 или 299.
156. Способ по п. 155, отличающийся тем, что агонистическое антитело OX40 содержит (a) HVR-H1, содержащий аминокислотную последовательность SEQ ID NO: 278; (b) HVR-H2, содержащий аминокислотную последовательность SEQ ID NO: 281; (c) HVR-H3, содержащий аминокислотную последовательность SEQ ID NO: 287; (d) HVR-L1, содержащий аминокислотную последовательность SEQ ID NO: 290; (e) HVR-L2, содержащий аминокислотную последовательность SEQ ID NO: 291; и (f) HVR-L3, содержащий аминокислотную последовательность, выбранную из SEQ ID NO: 292.
157. Способ по п. 155, отличающийся тем, что агонистическое антитело OX40 содержит (а) HVR-H1, содержащий аминокислотную последовательность SEQ ID NO: 278; (b) HVR-H2, содержащий аминокислотную последовательность SEQ ID NO: 281; (c) HVR-H3, содержащий аминокислотную последовательность SEQ ID NO: 287; (d) HVR-L1, содержащий аминокислотную последовательность SEQ ID NO: 290; (e) HVR-L2, содержащий аминокислотную последовательность SEQ ID NO: 291; и (f) HVR-L3, содержащий аминокислотную последовательность, выбранную из SEQ ID NO: 297.
158. Способ по п. 155, отличающийся тем, что агонистическое антитело OX40 содержит (a) HVR-H1, содержащее аминокислотную последовательность SEQ ID NO: 278; (b) HVR-H2, содержащий аминокислотную последовательность SEQ ID NO: 281; (c) HVR-H3, содержащий аминокислотную последовательность SEQ ID NO: 287; (d) HVR-L1, содержащий аминокислотную последовательность SEQ ID NO: 290; (e) HVR-L2, содержащий аминокислотную последовательность SEQ ID NO: 291; и (f) HVR-L3, содержащий аминокислотную последовательность, выбранную из SEQ ID NO: 298.
159. Способ по любому из пп. 134-158, отличающийся тем, что агонистическое антитело к OX40 содержит последовательность VH, обладающую идентичностью последовательности по меньшей мере 90 % относительно аминокислотной последовательности любой из SEQ ID NO: 300-325.
160. Способ по п. 159, отличающийся тем, что агонистическое антитело к OX40 содержит последовательность VH, обладающую идентичностью последовательности по меньшей мере 90 % относительно аминокислотной последовательности SEQ ID NO: 300.
161. Способ по п. 160, отличающийся тем, что в SEQ ID NO: 300 произведена замена, инсерция и/или делеция аминокислот общим количеством от 1 до 10.
162. Способ по любому из пп. 159-161, отличающийся тем, что агонистическое антитело OX40 содержит VH, который содержит один, два или три ГВУ (HVR), выбранные из: (a) HVR-H1, содержащего аминокислотную последовательность SEQ ID NO: 278, (b) HVR-H2, содержащего аминокислотную последовательность SEQ ID NO: 281, и (c) HVR-H3, содержащего аминокислотную последовательность SEQ ID NO: 287.
163. Способ по любому из пп. 134-162, отличающийся тем, что агонистическое антитело к OX40 содержит последовательность VL, обладающую идентичностью последовательности по меньшей мере 90 % относительно аминокислотной последовательности любой из SEQ ID NO: 326-351.
164. Способ по п. 163, отличающийся тем, что агонистическое антитело к OX40 содержит VL, обладающий идентичностью последовательности по меньшей мере 90 % относительно аминокислотной последовательности SEQ ID NO: 326.
165. Способ по п. 164, отличающийся тем, что в SEQ ID NO: 326 произведена замена, инсерция и/или делеция аминокислот общим количеством от 1 до 10.
166. Способ по любому из пп. 162-165, отличающийся тем, что агонистическое антитело к OX40 содержит VL, который содержит один, два или три ГВУ (HVR), выбранные из (а) HVR-L1, содержащего аминокислотную последовательность SEQ ID NO: 290; (b) HVR-L2, содержащего аминокислотную последовательность SEQ ID NO: 291; и (c) HVR-L3, содержащего аминокислотную последовательность SEQ ID NO: 292.
167. Способ по любому из пп. 134-166, отличающийся тем, что агонистическое антитело к OX40 содержит (а) последовательность VH из SEQ ID NO: 300; (b) последовательность VL из SEQ ID NO: 326; или (c) последовательность VH, как в (a), и последовательность VL, как в (b).
168. Способ по любому из пп. 134-166, отличающийся тем, что агонистическое антитело к OX40 содержит (а) последовательность VH из SEQ ID NO: 319; (b) последовательность VL из SEQ ID NO: 345; или (c) последовательность VH, как в (a), и последовательность VL, как в (b).
169. Способ по любому из пп. 134-166, отличающийся тем, что агонистическое антитело к OX40 содержит (а) последовательность VH из SEQ ID NO: 320; (b) последовательность VL из SEQ ID NO: 346; или (c) последовательность VH, как в (a), и последовательность VL, как в (b).
170. Способ по любому из пп. 134-154, отличающийся тем, что агонистическое антитело к OX40 является антителом L106, антителом ACT35, MEDI6469 или MEDI0562.
171. Способ по любому из пп. 134-170, отличающийся тем, что агонистическое антитело к OX40 представляет собой полноразмерное IgG1 антитело.
172. Способ по п. 134, отличающийся тем, что иммуноадгезин OX40 представляет собой тримерный белок OX40-Fc.
173. Способ по любому из пп. 102-172, дополнительно включающий введение субъекту агента, который снижает или ингибирует один или большее количество дополнительных иммунных коингибирующих рецепторов.
174. Способ по п. 173, отличающийся тем, что один или большее количество дополнительных иммунных коингибирующих рецепторов выбраны из группы, состоящей из PD-1, CTLA-4, LAG-3, TIM3, BTLA, VISTA, B7H4 и CD96.
175. Способ по любому из пп. 102-174, дополнительно включающий введение субъекту дополнительного терапевтического агента.
176. Способ по п.175, отличающийся тем, что дополнительный терапевтический агент представляет собой химиотерапевтическое средство.
177. Способ по любому из пп. 102-176, отличающийся тем, что антитело вводят подкожно, внутривенно, внутримышечно, применяют местно, перорально, трансдермально, внутрибрюшинно, внутриорбитально, путем имплантации, путем ингаляции, интратекально, интравентрикулярно или интраназально.
178. Способ по любому из пп. 102-177, отличающийся тем, что субъект является человеком.
179. Набор, содержащий антитело по любому из пп. 1-70 и листок-вкладыш в упаковку, который содержит инструкцию по применению антитела для лечения или замедления прогрессирования рака у субъекта.
180. Набор, содержащий антитело по любому из пп. 1-70 и листок-вкладыш в упаковку, который содержит инструкцию по применению антитела для лечения или замедления прогрессирования связанного с иммунной системой заболевания у субъекта.
181. Набор, содержащий антитело по любому из пп. 1-70 и листок-вкладыш в упаковку, который содержит инструкцию по повышению, усилению или стимуляции иммунного ответа или функции у субъекта.
182. Набор по любому из пп. 179-181, отличающийся тем, что субъект является человеком.
RU2018114523A 2015-09-25 2016-09-23 RU2018114523A3 (ru)

Priority Applications (5)

Application Number Priority Date Filing Date Title
US201562233230P true 2015-09-25 2015-09-25
US62/233,230 2015-09-25
US201662369299P true 2016-08-01 2016-08-01
US62/369,299 2016-08-01
PCT/US2016/053368 WO2017053748A2 (en) 2015-09-25 2016-09-23 Anti-tigit antibodies and methods of use

Related Child Applications (1)

Application Number Title Priority Date Filing Date
RU2020120073A Division RU2020120073A (ru) 2015-09-25 2016-09-23 Анти-tigit антитела и способы применения

Publications (2)

Publication Number Publication Date
RU2018114523A3 RU2018114523A3 (ru) 2019-10-25
RU2018114523A true RU2018114523A (ru) 2019-10-25

Family

ID=57045432

Family Applications (2)

Application Number Title Priority Date Filing Date
RU2018114523A RU2018114523A3 (ru) 2015-09-25 2016-09-23
RU2020120073A RU2020120073A (ru) 2015-09-25 2016-09-23 Анти-tigit антитела и способы применения

Family Applications After (1)

Application Number Title Priority Date Filing Date
RU2020120073A RU2020120073A (ru) 2015-09-25 2016-09-23 Анти-tigit антитела и способы применения

Country Status (21)

Country Link
US (3) US10017572B2 (ru)
EP (1) EP3353210A2 (ru)
JP (2) JP2018532397A (ru)
KR (2) KR20180053742A (ru)
CN (1) CN108290946A (ru)
AU (2) AU2016325610B2 (ru)
BR (1) BR112018005862A2 (ru)
CA (1) CA2994858A1 (ru)
CL (1) CL2018000744A1 (ru)
CO (1) CO2018004090A2 (ru)
CR (1) CR20180225A (ru)
HK (1) HK1258058A1 (ru)
IL (1) IL257636D0 (ru)
MX (1) MX2018003633A (ru)
NZ (1) NZ739750A (ru)
PE (1) PE20181046A1 (ru)
PH (1) PH12018500608A1 (ru)
RU (2) RU2018114523A3 (ru)
TW (1) TW201718644A (ru)
WO (1) WO2017053748A2 (ru)
ZA (1) ZA201800941B (ru)

Families Citing this family (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AT493433T (de) 2002-09-11 2011-01-15 Genentech Inc Neue zusammensetzung und verfahren zur behandlung von immunerkrankungen
US20090258013A1 (en) * 2008-04-09 2009-10-15 Genentech, Inc. Novel compositions and methods for the treatment of immune related diseases
SG11201400870WA (en) 2011-09-23 2014-04-28 Oncomed Pharm Inc Vegf/dll4 binding agents and uses thereof
BR112016000853A2 (pt) 2013-07-16 2017-12-12 Genentech Inc métodos para tratar ou retardar, reduzir ou inibir a recidiva ou a progressão do câncer e a progressão de uma doença imune-relacionada em um indivíduo, para aumentar, melhorar ou estimular uma resposta ou função imune em um indivíduo e kit
TN2017000024A1 (en) 2014-08-19 2018-07-04 Merck Sharp & Dohme Anti-tigit antibodies.
TW201718646A (zh) 2015-05-28 2017-06-01 安可美德藥物股份有限公司 Tigit結合劑和彼之用途
AU2016317915A1 (en) 2015-09-01 2018-03-01 Agenus Inc. Anti-PD-1 antibodies and methods of use thereof
WO2017053748A2 (en) 2015-09-25 2017-03-30 Genentech, Inc. Anti-tigit antibodies and methods of use
CN109476751A (zh) 2016-05-27 2019-03-15 艾吉纳斯公司 抗tim-3抗体及其使用方法
US9567399B1 (en) 2016-06-20 2017-02-14 Kymab Limited Antibodies and immunocytokines
TW201900680A (zh) 2016-06-20 2019-01-01 英商克馬伯有限公司 抗體
US10751415B2 (en) 2016-08-17 2020-08-25 Compugen Ltd. Anti-TIGIT antibodies, anti-PVRIG antibodies and combinations thereof
US20200024351A1 (en) 2017-04-03 2020-01-23 Jounce Therapeutics, Inc. Compositions and Methods for the Treatment of Cancer
CN110621341A (zh) 2017-04-26 2019-12-27 百时美施贵宝公司 使二硫键还原最小化的抗体生产方法
AU2018276140A1 (en) 2017-06-01 2019-12-19 Compugen Ltd. Triple combination antibody therapies
WO2018229163A1 (en) 2017-06-14 2018-12-20 King's College London Methods of activating v delta 2 negative gamma delta t cells
GB201709808D0 (en) * 2017-06-20 2017-08-02 Kymab Ltd Antibodies
SG11202000660QA (en) 2017-07-27 2020-02-27 Iteos Therapeutics Sa Anti-tigit antibodies
WO2019023504A1 (en) 2017-07-27 2019-01-31 Iteos Therapeutics Sa Anti-tigit antibodies
TW201915026A (zh) 2017-09-29 2019-04-16 大陸商江蘇恆瑞醫藥股份有限公司 Tigit抗體、其抗原結合片段及醫藥用途
WO2019129221A1 (en) * 2017-12-28 2019-07-04 Nanjing Legend Biotech Co., Ltd. Single-domain antibodies and variants thereof against tigit
AU2019205489A1 (en) * 2018-01-05 2020-06-25 Amgen, Inc. Anti-MCT1 antibodies and uses thereof
WO2019154415A1 (en) * 2018-02-06 2019-08-15 I-Mab Antibodies to t cell immunoreceptor with ig and itim domains (tigit) and uses thereof
WO2019191133A1 (en) 2018-03-27 2019-10-03 Bristol-Myers Squibb Company Real-time monitoring of protein concentration using ultraviolet signal
WO2019204592A1 (en) 2018-04-18 2019-10-24 Xencor, Inc. Il-15/il-15ra heterodimeric fc fusion proteins and uses thereof
US20190389933A1 (en) 2018-04-18 2019-12-26 Xencor, Inc. PD-1 TARGETED HETERODIMERIC FUSION PROTEINS CONTAINING IL-15/IL-15Ra Fc-FUSION PROTEINS AND PD-1 ANTIGEN BINDING DOMAINS AND USES THEREOF
WO2020047462A2 (en) 2018-08-30 2020-03-05 HCW Biologics, Inc. Methods of treating aging-related disorders
WO2020072821A2 (en) 2018-10-03 2020-04-09 Xencor, Inc. Il-12 heterodimeric fc-fusion proteins
US20200140512A1 (en) 2018-10-12 2020-05-07 Xencor, Inc. Pd-1 targeted il-15/il-15ralpha fc fusion proteins and uses in combination therapies thereof
WO2020092517A1 (en) * 2018-10-30 2020-05-07 Institute For Cancer Research D/B/A The Research Institute Of Fox Chase Cancer Center Combination therapies for treating cancer
US20200247862A1 (en) 2018-12-20 2020-08-06 Matthew J. Bernett Targeted heterodimeric fc fusion proteins containing il-15/il-15ra and nkg2d antigen binding domains
WO2020127377A1 (en) 2018-12-21 2020-06-25 Ose Immunotherapeutics Bifunctional anti-pd-1/il-7 molecule
WO2020144178A1 (en) 2019-01-07 2020-07-16 Iteos Therapeutics Sa Anti-tigit antibodies
WO2020163589A1 (en) 2019-02-08 2020-08-13 Genentech, Inc. Diagnostic and therapeutic methods for cancer
WO2020165374A1 (en) 2019-02-14 2020-08-20 Ose Immunotherapeutics Bifunctional molecule comprising il-15ra
WO2020172658A1 (en) 2019-02-24 2020-08-27 Bristol-Myers Squibb Company Methods of isolating a protein
WO2020176748A1 (en) 2019-02-27 2020-09-03 Genentech, Inc. Dosing for treatment with anti-tigit and anti-cd20 or anti-cd38 antibodies
CN110498856B (zh) * 2019-09-17 2020-08-11 浙江玉安康瑞生物科技有限公司 一种ctla-4单克隆抗体5h7及其用于抗肿瘤的用途
CN110818795B (zh) * 2020-01-10 2020-04-24 上海复宏汉霖生物技术股份有限公司 抗tigit抗体和使用方法

Family Cites Families (53)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5206161A (en) 1991-02-01 1993-04-27 Genentech, Inc. Human plasma carboxypeptidase B
US5989811A (en) 1994-09-29 1999-11-23 Urocor, Inc. Sextant core biopsy predictive mechanism for non-organ confined disease status
US5750345A (en) 1995-10-31 1998-05-12 Evanston Hospital Corporation Detection of human α-thalassemia mutations and their use as predictors of blood-related disorders
JP3778945B2 (ja) 1996-11-27 2006-05-24 ジェネンテック・インコーポレーテッドGenentech,Inc. ヒト化抗CD11a抗体
EP1220905A2 (en) 1999-03-08 2002-07-10 Genentech Inc. Composition and methods for the treatment of immune related diseases
US7282570B2 (en) 1999-04-20 2007-10-16 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
AU4228699A (en) 1998-06-03 1999-12-20 Northwestern University Cellular proteins which mediate herpesvirus entry
US6518033B1 (en) 1998-08-05 2003-02-11 The Research Foundation Of State University Of New York Method of detecting the presence of CD155 for diagnosis of cancer and to determine treatment
WO2000058334A1 (en) 1999-03-26 2000-10-05 Human Genome Sciences, Inc. 50 human secreted proteins
WO2001005972A1 (en) 1999-07-20 2001-01-25 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
US20080050809A1 (en) 1999-09-28 2008-02-28 Alejandro Abuin Novel human kinases and polynucleotides encoding the same
AU1220001A (en) 1999-10-20 2001-04-30 Zymogenetics Inc. Novel proteins and polynucleotides encoding them
US20040219521A1 (en) 2000-01-21 2004-11-04 Tang Y. Tom Novel nucleic acids and polypeptides
AU2002366951A1 (en) 2001-12-10 2003-07-09 Nuvelo,Inc. Novel nucleic acids and polypeptides
AU4972701A (en) 2000-03-31 2001-10-15 Genentech Inc Compositions and methods for detecting and quantifying gene expression
US6569668B2 (en) 2000-04-04 2003-05-27 Schering Corporation Isolated nucleic acids from Micromonospora rosaria plasmid pMR2 and vectors made therefrom
WO2001094413A2 (en) 2000-06-06 2001-12-13 Bristol-Myers Squibb Company B7-related nucleic acids and polypeptides and their uses for immunomodulation
WO2003068943A2 (en) 2002-02-13 2003-08-21 Incyte Corporation Secreted proteins
EP2388265A1 (en) 2002-02-22 2011-11-23 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
US7193069B2 (en) 2002-03-22 2007-03-20 Research Association For Biotechnology Full-length cDNA
US20040101876A1 (en) 2002-05-31 2004-05-27 Liat Mintz Methods and systems for annotating biomolecular sequences
DE10161767T1 (de) 2002-07-03 2018-06-07 Honjo Tasuku Immunopotenzierende Zusammensetzungen, die einen Anti-PD-L1 Antikörper enthalten
AT493433T (de) 2002-09-11 2011-01-15 Genentech Inc Neue zusammensetzung und verfahren zur behandlung von immunerkrankungen
JP2006521082A (ja) 2002-09-11 2006-09-21 ジェネンテック・インコーポレーテッドGenentech,Inc. 免疫関連疾患の治療のための新規組成物と方法
US7713705B2 (en) 2002-12-24 2010-05-11 Biosite, Inc. Markers for differential diagnosis and methods of use thereof
EP1481993A1 (en) 2003-05-28 2004-12-01 Tufts University Modulation of the poliovirus receptor function
PE20050928A1 (es) 2003-11-21 2005-11-08 Schering Corp Combinaciones terapeuticas de anticuerpo anti-igfr1
EP2343318A3 (en) 2003-11-28 2013-02-27 MedImmune Limited Antibodies binding to a C-terminal fragment of apolipoprotein E
CN101035807A (zh) 2004-06-09 2007-09-12 泰勒公司 Siglec-6相关疾病的诊断和治疗
SV2006002258A (es) 2004-10-08 2006-09-19 Wyeth Corp Inmunoterapia de trastornos autoinmunes
KR101498834B1 (ko) 2005-05-09 2015-03-05 오노 야꾸힝 고교 가부시키가이샤 예정 사멸 인자 1(pd-1)에 대한 인간 모노클로날 항체, 및 항-pd-1 항체를 단독 사용하거나 기타 면역 요법제와 병용한 암 치료 방법
US20070054360A1 (en) 2005-05-12 2007-03-08 Zeren Gao Compositions and methods for modulating immune responses
EP2007806A2 (en) 2006-04-13 2008-12-31 ZymoGenetics, Inc. Tetramerizing polypeptides and methods of use
US20100075377A1 (en) 2006-04-13 2010-03-25 West James W Tetramerizing polypeptides and methods of use
AU2007240491A1 (en) 2006-04-13 2007-11-01 Zymogenetics, Inc. Tetramerizing polypeptides and methods of use
WO2007124383A2 (en) 2006-04-19 2007-11-01 Oregon Health & Science University 1,1'-binaphthyl-based inhibitors of nad+-dependent deacetylase activity and sir2-family members
US20090258013A1 (en) * 2008-04-09 2009-10-15 Genentech, Inc. Novel compositions and methods for the treatment of immune related diseases
RU2017132160A (ru) 2008-12-09 2019-02-08 Дженентек, Инк. Антитела к pd-l1 и их применение для усиления функции t-клеток
WO2011066342A2 (en) 2009-11-24 2011-06-03 Amplimmune, Inc. Simultaneous inhibition of pd-l1/pd-l2
EP2580238A1 (en) 2010-06-09 2013-04-17 Zymogenetics, Inc. Dimeric vstm3 fusion proteins and related compositions and methods
CA2843595A1 (en) 2011-08-01 2013-02-07 Genentech, Inc. Methods of treating cancer using pd-1 axis binding antagonists and mek inhibitors
WO2013119202A1 (en) 2012-02-06 2013-08-15 Providence Health & Services - Oregon Cancer treatment and monitoring methods using ox40 agonists
EP3508215A3 (en) 2012-12-03 2019-10-02 Bristol-Myers Squibb Company Enhancing anti-cancer activity of immunomodulatory fc fusion proteins
EP2928483A4 (en) 2012-12-04 2016-06-08 Oncomed Pharm Inc Immunotherapy with binding agents
CN103073644B (zh) 2012-12-31 2014-03-12 中国科学技术大学 特异性抗小鼠tigit的单克隆抗体及其制备方法、鉴定及应用
EP2948475A2 (en) 2013-01-23 2015-12-02 AbbVie Inc. Methods and compositions for modulating an immune response
BR112016000853A2 (pt) 2013-07-16 2017-12-12 Genentech Inc métodos para tratar ou retardar, reduzir ou inibir a recidiva ou a progressão do câncer e a progressão de uma doença imune-relacionada em um indivíduo, para aumentar, melhorar ou estimular uma resposta ou função imune em um indivíduo e kit
AU2014319921A1 (en) 2013-09-11 2016-03-17 Compugen Ltd. Anti-VSTM5 antibodies and the use thereof in therapy and diagnosis
KR20160146747A (ko) 2014-03-31 2016-12-21 제넨테크, 인크. 항혈관신생제 및 ox40 결합 효능제를 포함하는 조합 요법
WO2015153513A1 (en) 2014-03-31 2015-10-08 Genentech, Inc. Anti-ox40 antibodies and methods of use
SG10201811841UA (en) 2014-07-16 2019-02-27 Genentech Inc Methods of treating cancer using tigit inhibitors and anti-cancer agents
BR112017008628A2 (pt) 2014-11-06 2018-01-30 Genentech Inc terapia de combinação compreendendo agonistas de ligação a ox40 e inibidores de tigit
WO2017053748A2 (en) 2015-09-25 2017-03-30 Genentech, Inc. Anti-tigit antibodies and methods of use

Also Published As

Publication number Publication date
US20190119376A1 (en) 2019-04-25
CA2994858A1 (en) 2017-03-30
CN108290946A (zh) 2018-07-17
US10047158B2 (en) 2018-08-14
AU2016325610A1 (en) 2018-03-01
MX2018003633A (es) 2018-08-01
AU2019246814A1 (en) 2019-10-31
PE20181046A1 (es) 2018-07-03
US10017572B2 (en) 2018-07-10
WO2017053748A3 (en) 2017-05-11
RU2020120073A (ru) 2020-07-03
JP2018532397A (ja) 2018-11-08
ZA201800941B (en) 2019-05-29
PH12018500608A1 (en) 2018-10-01
RU2018114523A3 (ru) 2019-10-25
US20170088613A1 (en) 2017-03-30
CR20180225A (es) 2018-07-09
US20180186875A1 (en) 2018-07-05
AU2016325610B2 (en) 2019-10-10
HK1258058A1 (zh) 2019-11-01
BR112018005862A2 (pt) 2018-10-16
KR20180053742A (ko) 2018-05-23
JP2020074778A (ja) 2020-05-21
CL2018000744A1 (es) 2018-07-06
CO2018004090A2 (es) 2018-11-30
TW201718644A (zh) 2017-06-01
NZ739750A (en) 2019-11-29
WO2017053748A2 (en) 2017-03-30
IL257636D0 (en) 2018-04-30
EP3353210A2 (en) 2018-08-01
KR20200087283A (ko) 2020-07-20

Similar Documents

Publication Publication Date Title
DK3259253T3 (da) Sulfonylureaer og relaterede forbindelser og brug af samme
IL254458D0 (en) Anti-pdl1 antibodies, activatable anti-pdl1 antibodies, and methods of use thereof
DK3258951T3 (da) Anti-pvrig antistoffer og fremgangsmåder for anvendelse
RU2017146349A (ru) Композиции олигонуклеотидов и способы с ними
EP3233921A4 (en) Anti-c5 antibodies and methods of use
DK3149042T3 (da) PD-L1-antistoffer og anvendelser deraf
HRP20192285T1 (hr) Anti-ox40 protutijela i postupci uporabe
RU2017107502A (ru) Антитела и конъюгаты, сконструированные введением цистеина
IL249092D0 (en) Anti-gitr antibodies and methods of use thereof
IL252280D0 (en) Anti-pd-1 antibodies and methods of use thereof
RU2016142283A (ru) Устройство для трехмерного нанесения и способ трехмерного нанесения
RU2017121326A (ru) Общие легкие цепи и способы их применения
HK1252158A1 (zh) 掩蔽抗cd3抗體和使用方法
RU2017115662A (ru) Гуманизированные антитела к ox40 и способы их применения
RU2017119853A (ru) Сложность локализации произвольных языковых материалов и ресурсов
RU2018108236A (ru) Слитые белки на основе gitrl и пути их применения
IL257281D0 (en) Anti-pd-1 antibodies and methods of use thereof
IL251868D0 (en) Anti-tim3 antibodies and methods of use
HK1253250A1 (zh) 抗-ctla-4抗體及其使用方法
RU2017133826A (ru) Терапевтические антитела и их применения
IL258257D0 (en) Anti-cd47 antibodies and methods of use
RU2018138163A (ru) Неоантигены и способы их использования
DK3097122T3 (da) Antistoffer, der binder beta-klotho-domæne 2, og fremgangsmåder til anvendelse deraf
HK1253235A1 (zh) 抗tigit抗原結合蛋白及其使用方法
RU2016145906A (ru) Модифицированные антигенсвязывающие полипептидные конструкции и их применение