MX2014015825A - DESIGNED ANQUIRINE REPETITION PROTEINS THAT JOIN THE GROWTH FACTOR DERIVED FROM PLATES. - Google Patents

DESIGNED ANQUIRINE REPETITION PROTEINS THAT JOIN THE GROWTH FACTOR DERIVED FROM PLATES.

Info

Publication number
MX2014015825A
MX2014015825A MX2014015825A MX2014015825A MX2014015825A MX 2014015825 A MX2014015825 A MX 2014015825A MX 2014015825 A MX2014015825 A MX 2014015825A MX 2014015825 A MX2014015825 A MX 2014015825A MX 2014015825 A MX2014015825 A MX 2014015825A
Authority
MX
Mexico
Prior art keywords
amino acid
seq
ankyrin repeat
exchanged
repeat domain
Prior art date
Application number
MX2014015825A
Other languages
English (en)
Inventor
Michael Baumann
Original Assignee
Molecular Partners Ag
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP12174020 priority Critical
Application filed by Molecular Partners Ag filed Critical Molecular Partners Ag
Priority to PCT/EP2013/063488 priority patent/WO2014001442A1/en
Publication of MX2014015825A publication Critical patent/MX2014015825A/es

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • C07K14/49Platelet-derived growth factor [PDGF]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/001Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • A61P27/10Ophthalmic agents for accommodation disorders, e.g. myopia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/14Vasoprotectives; Antihaemorrhoidals; Drugs for varicose therapy; Capillary stabilisers
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2318/00Antibody mimetics or scaffolds
    • C07K2318/20Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics

Abstract

Se describen nuevas proteínas de repetición de anquirina diseñadas con especificidad de unión al PDGF-BB (factor de crecimiento derivado de plaquetas compuesto por dos cadenas), así como los ácidos nucleicos que codifican dichas proteínas de unión al PDGF, las composiciones farmacéuticas que comprenden estas proteínas y el uso de las proteínas para el tratamiento de enfermedades.New ankyrine repeat proteins designed with specificity of binding to PDGF-BB (platelet-derived growth factor composed of two chains) are described, as well as the nucleic acids encoding said PDGF-binding proteins, the pharmaceutical compositions comprising these proteins and the use of proteins for the treatment of diseases.

Description

PROTEÍNAS DE REPETICIÓN DE ANQUIRINA DISEÑADAS QUE SE UNEN AL FACTOR DE CRECIMIENTO DERIVADO DE PLAQUETAS Campo de la invención La presente invención está relacionada con proteínas de repetición de anquirina diseñadas con especificidad de unión hacia el factor de crecimiento derivado de plaquetas PDGF), así como ácidos nucleicos que codifican tales proteínas de unión al PDGF, composiciones farmacéuticas que comprenden tales proteínas y el uso de tales proteínas en el tratamiento de enfermedades.

Antecedentes de la invención El factor de crecimiento derivado de plaquetas (PDGF) fue identificado hace más de tres décadas como un factor de crecimiento en el suero de fibroblastos, células musculares lisas y células gliales. Su papel en fisiología y medicina está descrito extensamente en una revisión reciente (Andrae, J., Gallini, R. and Betsholtz, C., Genes Dev., 22, 1276-1312, 2008). El PDGF humano fue identificado originalmente como un dímero disulfuro enlazado de dos cadenas polipeptídicas diferentes, A (PDGF-A; el PDGF-A humano tiene el número P04085 de UniProtKB/Swiss-Prot) y B (PDGF-B; el PDGF-B humano tiene el número P01127 de UniProtKB/Swiss-Prot). De este modo, se pueden formar tres dimeros de proteínas: PDGF-AA, PDGF-AB y PDGF-BB. Recientemente se identificaron dos cadenas de polipéptidos adicionales, PDGF-C y PDGF-D. Los genes y polipéptidos del PDGF actualmente conocidos pertenecen a una familia de factores de crecimiento estructural y funcionalmente relacionados, incluyendo también los factores de crecimiento endotelial vascular (VEGF). Los factores de crecimiento PDGF/VEGF se conservan en todo el reino animal.

Los PDGF actúan a través de dos receptores de tirosina quinasa (RTK), el receptor del PDGF alfa (PDGFRalpha) y el beta (PDGFRbeta), con estructuras de dominios comunes, incluyendo cinco ciclos extracelulares de inmunoglobulina (lg) y un dominio de tirosina quinasa intracelular dividido. Los VEGF actúan a través de una subfamilia distinta pero relacionada estructuralmente con los RTK. La unión con los ligandos promueve la dimerización del receptor, que inicia con la señalización. Dependiendo de la configuración del ligando y del patrón de expresión del receptor, se pueden formar diferentes receptores de dímeros. Sin embargo, solo algunas interacciones parecen ser relevantes in vivo; es decir, aquellas de PDGF-AA y PDGF-CC vía PDGFRalpha y PDGF-BB vía PDGFRbeta.

Los PDGF tienen un papel crucial durante el desarrollo, pero existe evidencia limitada de las funciones fisiológicas normales en el adulto. Los estudios de PDGF y PDGFR en el desarrollo animal han revelado los roles de señalización del PDGFRalpha en la gastrulación y en el desarrollo de la cresta neural craneal y cardiaca, gónadas, pulmón, intestino, piel, CNS y el esqueleto. De igual forma, los roles de señalización del PDGFRbeta se han establecido en la formación de vasos sanguíneos durante la hematopoyesis temprana. La señalización del PDGF está implicada en varias enfermedades. La activación de la autocrina de las trayectorias de señalización del PDGF está involucrada en ciertos gliomas, sarcomas y leucemias. La señalización de la paracrina del PDGF es comúnmente observada en cánceres epiteliales, donde desencadena el reclutamiento del estroma y puede estar implicada en la transición epitelial-mesenquimal, por tanto, afecta el crecimiento tumoral, la angiogénesis, la invasión y la metástasis. Los PDGF conducen respuestas mesenquimales patológicas en los trastornos vasculares como aterosclerosis, restenosis, hipertensión pulmonar y enfermedades de la retina, así como en las enfermedades fibróticas, incluyendo fibrosis pulmonar, cirrosis hepática, esclerodermía, glomeruloesclerosis y fibrosis cardiaca.

Por lo tanto, el aumento en la actividad del PDGF se ha relacionado con varias enfermedades y condiciones patológicas. Se establecieron los papeles patógenos causales del PDGF para algunas enfermedades, proporcionando perspectivas de terapia utilizando antagonistas del PDGF, tales como anticuerpos específicos del PDGF. Adicionalmente, se ha sugerido que la combinación de agentes anti-VEGF y anti-PDGF ofrece beneficios terapéuticos sinérgicos para el tratamiento de ciertas enfermedades neovasculares oculares (WO 2005/020972; Jo, N., Mailhos, C., Ju, M., Cheung, E., Bradlcy, J. , Nishijima, K., Robinson, G.S., Adamis, A.P. and Shima, D.T., Am. J. Pathol., 168 (6) , 2036-2053, 2006).

Existen, además de los anticuerpos, proteínas de unión o dominios de unión nuevos que se puede utilizar para unir específicamente una molécula objetivo (por ejemplo, Binz, H.K., Amstutz, P. and Plückthun, A., Nat. Biotechnol. 23, 1257-1268, 2005) y que de esta manera actúen como un antagonista. Una de esta clase nueva de proteínas de unión o dominios de unión que no poseen un Fe están basadas en proteínas de repetición diseñadas o dominios de repetición diseñados (WO 2002/020565; Binz, H.K., Amstutz, P., Kohl, A., Stumpp, M.T., Briand, C., Forrer, P., Grütter, M.G. and Plückthun, A., Nat. Biotechnol.22, 575-582, 2004; Stumpp, M.T., Binz, H.K and Amstutz, P., Drug Discov. Today 13, 695-701, 2008). WO 2002/020565 describe como se pueden construir grandes bibliotecas de proteínas de repetición y su aplicación general. Sin embargo, WO 2002/020565 no revela la selección de dominios de repetición con especificidad de unión al PDGF-BB ni los módulos de repetición concretos o la secuencia de los motivos de los dominios de repetición que específicamente se unen al PDGF-BB. Además, WO 2002/020565 no sugiere que los dominios de repetición con especificidad de unión al PDGF-BB puedan ser utilizados para regular las trayectorias de señalización mediadas del PDGF-BB para tratar enfermedades exitosamente. Estos dominios de repetición diseñados aprovechan la naturaleza modular de las proteínas de repetición y pueden poseer módulos de limitación con N terminal y C terminal para evitar que los dominios de repetición diseñados formen agregaciones, protegiendo el núcleo hidrofóbico del dominio (Forrer, P., Stumpp, M.T., Binz, H.K. and Plückthun, A., FEBS letters 539, 2-6, 2003).

El problema téenico que subyace en la presente invención es la identificación de las proteínas de unión nuevas, tales como proteínas o dominios de repetición de anquirina, con especificidad de unión al PDGF-BB para regular las trayectorias mediadas de señalización del PDGF-BB para un tratamiento mejorado de determinados cánceres, trastornos vasculares tales como enfermedades de la retina, enfermedades fibróticas y otras condiciones patológicas. La solución a este problema téenico se logra al proporcionar las modalidades caracterizadas en las reivindicaciones.

Sumario de la invención La presente invención está relacionada con una proteina de unión recombinante que comprende por lo menos un dominio de repetición de anquirina, en donde dicho dominio de repetición de anquirina une el PDGF-BB en PBS con una Kd menor que 10-7 M.

Más particularmente, la invención se refiere a una proteina de unión recombinante que comprende por lo menos un dominio de repetición de anquirina, en donde dicho dominio de repetición de anquirina compite por la unión al PDGF-BB con un dominio de repetición de anquirina seleccionado del grupo que consiste en la SEC ID NO: 23 a 60, o en donde dicho dominio de repetición de anquirina es seleccionado del grupo que consiste en la SEC ID NO: 23 a 60, en donde falta opcionalmente una G en la posición 1 y/o una S en la posición 2 de dicho dominio de repetición de anquirina; y una L en la penúltima posición y/o N en última posición de dicho dominio de repetición de anquirina son intercambiados opcionalmente por A.

En una modalidad adicional, la invención se refiere a una proteina recombinante de unión al PDGF-BB que comprende por lo menos un dominio de repetición de anquirina, que comprende un módulo de repetición de anquirina que tiene una secuencia de aminoácidos seleccionada del grupo que consiste en la SEC ID NO: 12, 14, 15, 17, 18 y 19 y las secuencias, en donde hasta 9 aminoácidos en la SEC ID NO: 12, 14, 15, 17, 18 y 19 son intercambiados por cualquier aminoácido.

En particular, la invención se refiere a una proteina recombinante de unión al PDGF-BB que comprende un péptido de cualquiera de las secuencias SEC ID NO: 12 a 19 y 23 a 61.

La invención se refiere además a moléculas de ácidos nucleicos que codifican las proteínas de unión de la presente invención y a una composición farmacéutica que comprende una o más de las proteínas de unión o moléculas de ácidos nucleicos anteriormente mencionadas.

La invención se refiere además a un método de tratamiento de una condición patológica usando las proteínas de unión de la invención.

Breve descripción de las figuras Figura 1. Inhibición de la proliferación de fibroblastos NHI-3T3 Se muestra la inhibición de la proliferación de fibroblastos NHI-3T3 por diferentes concentraciones de un DARPin con especificidad al PDGF-BB (ejemplificado por DARPin #49) y la correspondiente curva de inhibición ajustada. A continuación, a partir de la curva de inhibición ajustada se calcula que el valor de IC50 es de 1.9 nM para DARPin #49.

OD, densidad óptica a 450 nm; C, concentración de DARPin #49 en nM; Di, DARPin #49. El eje X se muestra en escala logarítmica. Ver a continuación la definición de DARPin #49.

Figura 2. Ensayo competitivo de PDGFRbeta .

Se muestra la inhibición de la unión del PDGF-BB al PDGFRbeta a diferentes concentraciones de DARPin con especificidad al PDGF-BB y las correspondientes curvas de inhibición ajustadas para un experimento único distinto. Posteriormente se calcula que los valores de IC50 son de alrededor de 20 y 18 pM para las DARPin #50 (DI) y #28 (D2), respectivamente. OD, densidad óptica a 450 nm; C, concentración de DARPin en pM. El eje X se muestra en escala logarítmica. Ver a continuación las definiciones de DARPin #50 y 28.

Figura 3. Efectos de un DARPin anti-PDGF-BB vs vehículo en el desarrollo de neovascularización coroidea .

Diariamente se inyectaron ratones por vía intraperitoneal con el vehículo o con DARPin #61-PEG20 (es decir, DARPin #61 conjugado con PEG20 sobre sus residuos cys C terminales por métodos estándar (por ejemplo, como está descrito en el documento WO 2011/135067)) desde el día 0 hasta el día 14. En el día 2 se aplicaron quemaduras con láser en el ojo para inducir la neovascularización coroidea (CNV) y en el dia 14 se midió la extensión de la CNV. Los símbolos representan ojos individuales y cada uno representa los valores de la media de los tres puntos de CNV inducida. Las barras representan los valores de las medianas de los grupos individuales. A, área de la CNV en mm2; V, vehículo (es decir, PBS); DI, DARPin #61-PEG20 en PBS a 10 mg/kg por dosis inyectada; D2, DARPin #61-PEG20 en PBS a 1 mg/kg por dosis inyectada.

Descripción detallada de la invención La proteína o dominio de unión recombinante de acuerdo con la invención es específica hacia el PDGF-BB de mamífero. Preferiblemente, el dominio de unión recombinante de acuerdo con la invención es específico hacia un PDGF-BB de ratones, rata, perro, conejo, mono u de origen humano. Más preferiblemente, el dominio de unión recombinante de acuerdo con la invención es específico para un PDGF-BB de origen humano.

El término "proteína" se refiere a un polipéptido, en donde por lo menos parte del polipéptido tiene, o es capaz de adquirir, un arreglo tridimensional definido al formar estructuras secundaria, terciaria o cuaternaria dentro de y/o entre su (s) cadena (s) de polipéptidos. Si una proteina comprende dos o más polipéptidos, las cadenas individuales de polipéptidos pueden estar unidas de forma no covalente o covalente, por ejemplo por un enlace disulfuro entre dos polipéptidos. Una parte de una proteina, que de forma individual tiene, o es capaz de adquirir, un arreglo tridimensional definido mediante la formación de estructuras secundarias o terciarias, se nombra con el término "dominio de proteina". Dichos dominios de proteínas son muy conocidos por el téenico experto en la materia.

El término "recombínante" tal como se utiliza en proteína recombinante, dominio de proteína recombinante, proteína de unión recombinante y similares, significa que dichos polipéptidos son producidos por el uso de tecnologías de ADN recombinante, muy conocidas por el técnico experto en la materia. Por ejemplo, una molécula de ADN recombinante (por ejemplo, producida por síntesis genética) que codifica un polipéptido se puede clonar en un plásmido de expresión bacteriana (por ejemplo, pQE30, Qiagen), plásmido de expresión de levadura o plásmido de expresión de mamífero. Cuando, por ejemplo, tal plásmido de expresión bacteriana recombinante construido es insertado en una bacteria adecuada (por ejemplo, Escherichia coli) , esta bacteria puede producir el polipéptido codificado por este ADN recombinante. El polipéptido producido correspondiente se llama polipéptido recombinante.

En el contexto de la presente invención, el término "polipéptido" se refiere a una molécula que consiste en una o más cadenas de múltiples, es decir, de dos o más, aminoácidos unidos a través de enlaces peptidicos. Preferiblemente, un polipéptido consiste en más de ocho aminoácidos unidos a través de enlaces peptidicos.

El término "marcador polipéptido" se refiere a una secuencia de aminoácidos unidos a un polipéptido/proteina, en donde dicha secuencia de aminoácidos es útil para la purificación, detección u orientación hacia el blanco de dicho polipéptido/proteina, o en donde dicha secuencia de aminoácidos mejora el comportamiento fisicoquimico del polipéptido/proteina, o en donde dicha secuencia de aminoácidos posee una función efectora. Los marcadores de polipéptidos individuales, fracciones y/o dominios de una proteina de unión pueden estar conectados entre si directamente o por medio de polipéptidos enlazadores. Estos marcadores de polipéptidos son bien conocidos en la téenica y están totalmente disponibles para el técnico experto en la materia. Ejemplos de marcadores polipéptidos son secuencias pequeñas de polipéptidos, por ejemplo, His (por ejemplo, el marcador His de la SEC ID NO: 9), yc, FLAG o marcadores de Strep o fracciones como enzimas (por ejemplo, enzimas como la fosfatasa alcalina) que permiten la detección de dicho polipéptido/proteina, o fracciones que pueden ser utilizadas para la orientación hacia el blanco (tales como inmunoglobulinas o fragmentos de las mismas) y/o como moléculas efectoras.

El término "polipéptido enlazador" se refiere a una secuencia de aminoácidos que es capaz de enlazar, por ejemplo, dos dominios de proteina, un marcador polipéptido y un dominio de proteina, un dominio de proteina y una fracción de no polipéptido como polietilenglicol o dos marcadores de secuencia. Tales dominios adicionales, marcadores, fracciones de no polipéptidos y enlazadores son conocidos para el téenico en la materia relevante. Se proporciona una lista de ejemplo en la descripción de la solicitud de patente WO 2002/020565. Ejemplos particulares de tales enlazadores son enlazadores de glicina-serina y enlazadores de prolina-treonina de longitudes variables; preferiblemente dichos enlazadores tienen una longitud de entre 2 y 24 aminoácidos; más preferiblemente, dichos enlazadores tienen una longitud de entre 2 y 16 aminoácidos. Un ejemplo de un enlazador de glicina-serina se proporciona en la SEC ID NO: 10 y un ejemplo de un enlazador de prolina-treonina se proporciona en la SEC ID NO: 11. Preferiblemente, el enlazador de prolina-treonina de la SEC ID NO: 11 es precedido por un GS y/o seguido por un GS.

El término "fracción de polímero" se refiere ya sea a una fracción de polímero proteico o una fracción de polímero no proteico. Una "fracción de polímero proteico" es preferiblemente un polipéptido que no forma una estructura terciaria estable. Ejemplos de fracciones de polímeros proteicos son los polipéptidos XTEN® (una marca comercial registrada de Amunix; WO 2007/103515) o polipéptidos que comprenden residuos de prolina, alanina y serina como se describe en el documento WO 2008/155134. Tales fracciones de polímeros proteicos pueden estar unidos covalentemente, por ejemplo, un dominio de unión de la invención mediante la generación de polipéptidos genéticos de fusión, utilizando teenologías estándar de clonación de ADN, seguidas por su expresión y purificación estándar. Una "fracción de polímero no proteico" es una fracción de polímero no construido a partir de polipéptidos. Ejemplos de fracciones de polímeros no proteicos son hidroxietil-almidón (HES), polietilenglicol (PEG), polipropilenglicol o polioxialquileno. El término "PEGilado" significa que una fracción de PEG está unida covalentemente a, por ejemplo, un polipéptido de la invención. Una fracción de polímero de la invención puede variar ampliamente en cuanto al peso molecular. Preferiblemente, dicha fracción de polímero está conectada por un polipéptido enlazador a un dominio de unión.

En una modalidad específica, una fracción de PEG o cualquier otro polímero no proteico puede, por ejemplo, acoplarse a un tiol de cisteina a través de un enlazador de maleimida, donde la cisteina es acoplada a través de un enlazador peptídico al N o C terminal de un dominio de unión, como se describe en este documento.

El término "proteína de unión" se refiere a una proteína que comprende uno o más dominios de unión, uno o más compuestos bioactivos y una o más fracciones de polímero como se explica a continuación. Preferiblemente, dicha proteína de unión comprende hasta cuatro dominios de unión. Más preferiblemente, dicha proteína de unión comprende hasta dos dominios de unión. Aún más preferiblemente, dicha proteína de unión comprende solo un dominio de unión. Adicionalmente, cualquier ejemplar de dicha proteína de unión puede comprender dominios de proteínas adicionales que no sean dominios de unión, fracciones de multimerización, marcadores de polipéptidos, enlazadores de polipéptidos y/o un residuo cys individual. Ejemplos de fracciones de multimerización son regiones constantes de cadenas pesadas de inmunoglobulina que forman pares para proporcionar dominios Fe de inmunoglobulina funcionales y cerraduras de leucina o polipéptidos que comprenden un tiol libre, que forma un enlace disulfuro intermolecular entre esos dos polipéptidos. El residuo cys individual puede usarse para conjugar otras fracciones al polipéptido, por ejemplo, mediante el uso de la química de la maleimida, muy conocida para el téenico experto en la materia. Preferiblemente, dicha proteína de unión es una proteína de unión recombinante. También preferiblemente, los dominios de unión de la proteina de unión poseen diferentes especificidades hacia diferentes blancos.

El término "compuesto bioactivo" se refiere a un compuesto que es modificador de la enfermedad cuando se aplica a un mamífero que tiene dicha enfermedad. Un compuesto bioactivo puede tener propiedades antagónicas o agonistas y puede ser un compuesto bioactivo proteico o un compuesto bioactivo no proteico. Tales compuestos bioactivos proteínicos pueden estar unidos covalentemente a, por ejemplo, un dominio de unión de la invención mediante la generación de polipéptidos de fusión genéticos, utilizando tecnologías de clonación de ADN convencionales, seguida por su expresión y purificación estándar. Tales compuestos bioactivos no proteínicos pueden estar unidos covalentemente a, por ejemplo, un dominio de unión de la invención por medios químicos, por ejemplo, por acoplamiento de cisteína a un tiol a través de un enlazador de maleimida, donde la cisteína es acoplada a través de un enlazador peptídico a la N o C terminal de un dominio de unión, como se describe en el presente documento. Ejemplos de compuestos bioactivos proteicos son dominios de unión que tienen una especificidad objetivo distintiva (por ejemplo, la neutralización de un factor de crecimiento mediante la unión al mismo), citoquinas (por ejemplo, interleuquinas), factores de crecimiento (por ejemplo, hormona de crecimiento humano), anticuerpos y fragmentos de los mismos, hormonas (por ejemplo GLP-1), así como cualquier fármaco proteínico. Ejemplos de compuestos bioactivos no proteicos son toxinas (por ejemplo DM1 de ImmunoGen), pequeñas moléculas que se dirigen a los GPCR, antibióticos y cualquier fármaco posible no proteínico.

El término "dominio de unión" significa un dominio de proteína que exhibe el mismo "pliegue" (arreglo tridimensional) que una proteína de andamio y que tiene una propiedad predeterminada, tal como es definido a continuación. Tal dominio de unión puede obtenerse a través de téenicas de ingeniería racionales, o más comúnmente, técnicas combinatorias de proteínas, habilidades que son conocidas en la técnica (Binz et al., 2005, loe. cit.). Por ejemplo, un dominio de unión que tiene una propiedad predeterminada puede ser obtenido por un método que comprende las etapas de (a) proporcionar una colección diversa de dominios de proteínas que exhiben el mismo pliegue que un proteína de andamio tal como está definido más adelante; y (b) detectar dicha colección diversa y/o seleccionar a partir de dicha colección diversa para obtener por lo menos un dominio de proteína que tenga dicha propiedad predeterminada. La diversidad de la colección de los dominios de proteína puede ser proporcionada por varios métodos de acuerdo con la detección y/o sistema de selección que esté siendo utilizado, y puede comprender el uso de métodos bien conocidos para el téenico de la materia, tales como presentación en fago o presentación en ribosomas. Preferiblemente, dicho dominio de unión es un dominio de unión recombinante.

El término "proteína de andamio" significa una proteína con áreas de superficie expuestas en, las cuales, las inserciones, sustituciones o eliminaciones de aminoácidos son altamente tolerables. Ejemplos de proteínas de andamio que se pueden utilizar para generar dominios de unión de la presente invención son anticuerpos o fragmentos de los mismos, tales como Fv de cadena simple o fragmentos Fab, la proteína A de Staphylococcus aureus, la proteína de unión de Bilin de Pieris brassicae u otras lipocalinas, proteínas de repetición de anquirina u otras proteínas de repetición y la fibronectina humana. Las proteínas de andamio son conocidas para el téenico de la materia (Binz et al., 2005, loe. cit.; Binz et al., 2004, loe. cit.).

El término "blanco" se refiere a una molécula individual tal como una molécula de ácido nucleico, un polipéptido o proteína, un carbohidrato o cualquier otra molécula de origen natural, incluyendo cualquier parte de dicha molécula individual o complejos de dos o más de tales moléculas. El blanco puede ser una célula entera o una muestra de tejido, o puede ser cualquier molécula o fracción de origen no natural. Preferiblemente, el blanco es un polipéptido de origen natural o no natural o un polipéptido que contiene modificaciones químicas, por ejemplo, modificado por fosforilación natural o no natural, acetilación o metilación. En la solicitud particular de la presente invención, el blanco es PDGF-BB.

El término "propiedad predeterminada" se refiere a una propiedad como la unión con un blanco, bloqueo de un blanco, a la activación de una reacción mediada por el blanco, la actividad enzimática y a propiedades relacionadas adicionales. Dependiendo del tipo de la propiedad deseada, un técnico será capaz de identificar el formato y los pasos necesarios para llevar a cabo la detección y/o selección de un dominio de unión con la propiedad deseada. Preferiblemente, dicho propiedad predeterminada está enlazada a un objetivo.

Las definiciones a continuación para las proteínas de repetición están basadas en aquellas de la solicitud de patente WO 2002/020565. La solicitud de patente WO 2002/020565 contiene además una descripción general de las características de las proteínas de repetición, téenicas y aplicaciones.

El término "proteínas de repetición" se refiere a una proteína que comprende uno o más dominios de repetición. Preferiblemente, cada una de dichas proteínas de repetición comprende hasta cuatro dominios de repetición. Más preferiblemente, cada una de dichas proteínas de repetición comprende hasta dos dominios de repetición. Aún más preferiblemente, cada una de las proteínas de repetición comprende solo un dominio de repetición. Por otra parte, dicha proteína de repetición puede comprender dominios de proteína de no repetición adicionales, marcadores polipéptidos y/o enlazadores polipéptidos.

El término "dominio de repetición" se refiere a un dominio de proteína que comprende dos o más unidades de repetición consecutivas (módulos) como unidades estructurales, en donde dichas unidades estructurales tienen el mismo pliegue y se apilan firmemente para crear una estructura superhelicoidal que tiene un núcleo hidrofóbico conjunto. Preferiblemente, un dominio de repetición comprende además una unidad limitante N terminal y/o C terminal (o módulo). Aún más preferiblemente, dichas unidades (o módulos) limitantes N terminal y/o C terminal son repeticiones limitantes.

Los términos "proteína de repetición diseñada" y "dominio de repetición diseñado" se refieren a una proteína de repetición o dominio de repetición, respectivamente, obtenidos como resultado del procedimiento inventivo que se explica en la solicitud de patente WO 2002/020565. Las proteínas de repetición diseñadas y los dominios de repetición diseñados son sintéticos y no de origen natural. Son proteínas o dominios hechos por el hombre, respectivamente, obtenidos mediante la expresión de ácidos nucleicos diseñados correspondientemente. Preferiblemente, la expresión se realiza en células eucariotas o procariotas, tales como células bacterianas o utilizando un sistema de expresión in vitro libre de células. Por consiguiente, una proteína de repetición de anquirina diseñada (es decir, DARPin) corresponde a una proteína de unión recombinante de la invención que comprende al menos un dominio de repetición de anquirina.

El término "unidad estructural" se refiere a una parte de un polipéptido ordenada localmente, formada por interacciones tridimensionales entre dos o más segmentos de estructura secundaria, que están cerca uno de otro a lo largo de la cadena polipeptídica. Tal unidad estructural exhibe un motivo estructural. El término "motivo estructural" se refiere a un arreglo tridimensional de elementos de estructura secundaria presente en al menos una unidad estructural. Los motivos estructurales son bien conocidos por el téenico de la materia. Las unidades estructurales por si solas no son capaces de adquirir un arreglo tridimensional definido; sin embargo, su arreglo consecutivo, por ejemplo como módulos de repetición en un dominio de repetición, conduce a una estabilización mutua de las unidades vecinas, lo que resulta en una estructura superhelicoidal.

El término "unidad de repetición" se refiere a secuencias de aminoácidos que comprenden la secuencia de repetición de motivos de una o más proteínas de repetición de origen natural, en el que dichas "unidades de repetición" se encuentran en múltiples copias, y que presentan una topología de plegado definida común a todos los dichos motivos que determinan el pliegue de la proteína. Tales unidades de repetición corresponden a las "unidades estructurales de repetición (repeticiones)" de proteínas de repetición como lo describe Forrer et al., 2003, loe. cit., o las "unidades estructurales consecutivas homologas (repetición) " de las proteínas de repetición como lo describe Binz et al, 2004, loe. cit.. Tales unidades de repetición comprenden residuos de la estructura y residuos de la interacción. Ejemplos de tales unidades de repetición son las unidades de repetición de armadillo, unidades de repetición ricas en leucina, unidades de repetición de anquirina, unidades de repetición de tetratricopéptidos, unidades de repetición HEAT y unidades de repetición ricas en la variante de la leucina. Las proteínas de origen natural que contienen dos o más de tales unidades de repetición se conocen como "proteínas de repetición de origen natural". Las secuencias de aminoácidos de las unidades de repetición individuales de una proteína de repetición pueden tener un número significativo de mutaciones, sustituciones, adiciones y/o eliminaciones al compararlas entre sí, mientras que aún así conservan sustancialmente el patrón general, o motivo, de las unidades de repetición.

En consecuencia, el término "unidad de repetición de anquirina" significará una unidad de repetición, que es una repetición de anquirina, como es descrito, por ejemplo, por Forrer et al., 2003, loe. Las repeticiones de anquirina son conocidas por el téenico experto en la materia. El término "dominio de repetición de anquirina" se refiere a un dominio de repetición que comprende dos o más unidades de repetición de anquirina consecutivas (módulos) como unidades estructurales, y, preferiblemente, una unidad limitante de N terminal y/o C terminal (o módulo).

El término "residuos de la estructura" se refiere a los aminoácidos residuales de las unidades de repetición, o a los correspondientes aminoácidos residuales de los módulos de repetición, que contribuyen a la topología de plegado, es decir, que contribuyen al pliegue de dicha unidad de repetición (o módulo) o que contribuyen a la interacción con una unidad vecinal (o módulo). Tal contribución podría ser la interacción con otros residuos en la unidad de repetición (o módulo), o la influencia sobre la columna vertebral de conformación del polipéptido tal como se encuentra en las hélices a o las hojas b, o las extensiones de aminoácidos formando polipéptidos lineales o ciclos.

El término "residuos de interacción con los blancos" se refiere a los aminoácidos residuales de las unidades de repetición, o a los aminoácidos residuales correspondientes de los módulos de repetición, que contribuyen a la interacción con las sustancias blanco. Tal contribución podría ser la interacción directa con las sustancias blanco, o la influencia sobre otros residuos que interactúan directamente, por ejemplo a través de la estabilización de la conformación del polipéptido de una unidad de repetición (o módulo) para permitir o mejorar la interacción de los residuos que interactúan directamente con dichos blancos. Tales residuos de estructura y residuos de interacción con los blancos se pueden identificar mediante el análisis de los datos estructurales obtenidos por métodos fisicoquímicos, tales como cristalografía de rayos X, RMN y/o espectroscopia CD, o por comparación con la información estructural conocida y relacionada, bien conocida por los téenicos en biología estructural y/o bioinformática.

Preferiblemente, las unidades de repetición utilizadas para la deducción de la secuencia de repetición de un motivo son unidades de repetición homologas, en donde las unidades de repetición comprenden el mismo motivo estructural y en donde más del 70% de los residuos de estructura de dichas unidades de repetición son homologas entre sí. Preferiblemente, más del 80% de los residuos de dichas unidades de repetición son homologas. Aún más preferiblemente, más del 90% de los residuos de estructura de dicha unidad de repetición son homólogos. Los programas de computadora para determinar el porcentaje de homologación entre polipéptidos, tales como Fasta, Blast o Gap son conocidos para el técnico experto en la materia. Más preferiblemente, las unidades de repetición utilizadas para la deducción de la secuencia de repetición de un motivo son unidades de repetición homologas obtenidas a partir de dominios de repetición seleccionados en un blanco definido.

El término "secuencia de repetición del motivo" se refiere a una secuencia de aminoácidos, que se deduce de una o más unidades de repetición o módulos de repetición. Preferentemente, dichas unidades de repetición o módulos de repetición son dominios de repetición que tienen especificidad de unión hacia el mismo objetivo. Tales motivos de secuencias de repetición comprenden las posiciones de residuos estructurales y las posiciones de residuos de interacción con el blanco. Dichas posiciones de los residuos estructurales corresponden a las posiciones de los residuos estructurales de las unidades de repetición (o módulos). Del mismo modo, dichas posiciones de residuos de interacción con el blanco corresponden a las posiciones de los residuos de interacción con el blanco de unidades de repetición (o módulos). La secuencia de repetición de los motivos comprende posiciones fijas y posiciones aleatorias. El término "posición fija" se refiere a una posición de aminoácido en la secuencia de repetición de un motivo, en donde dicha posición es fija para un aminoácido particular. Más común, tales posiciones "fijas" corresponden a las posiciones de los residuos de la estructura y/o las posiciones de los residuos de interacción con el blanco que son específicos para un cierto objetivo. El término "posición aleatoria" se refiere a una posición de aminoácido en una secuencia de repetición de un motivo, en donde dos o más aminoácidos están permitidos en dicha posición de aminoácido, por ejemplo, en donde cualquiera de los habituales veinte aminoácidos de origen natural están permitidos, o en donde la mayor parte de los veinte aminoácidos de origen natural están permitidos, tales como aminoácidos distintos de la cisteina o aminoácidos distintos de la glicina, cisteina y prolina. Con frecuencia, tales posiciones aleatorias corresponden a las posiciones de los residuos de interacción con los blancos. Sin embargo, algunas posiciones de los residuos estructurales también pueden ser aleatorias.

El término "topología de plegado" se refiere a la estructura terciaria de dichas unidades de repetición o módulos de repetición. La topología de plegado será determinada por extensiones de aminoácidos que forman por lo menos partes de hélices a u hojas b, o tramos de aminoácidos que forman polipéptidos lineales o ciclos, o cualquier combinación de las hélices a, hojas b y/o polipéptidos lineales/ciclos. Por ejemplo, una unidad/módulo de repetición de anquirina consiste en una vuelta b, seguida de dos hélices a antiparalelas y un ciclo que llega a la vuelta de la siguiente unidad/módulo de repetición.

El término "consecutivo" se refiere a un arreglo en el que las unidades de repetición o módulos de repetición están dispuestos en tándem. En proteínas de repetición diseñadas, existen por lo menos 2, por lo general alrededor de 2 a 6, en particular al menos aproximadamente 6, con frecuencia 20 o más unidades de repetición (o módulos). En la mayoría de los casos las unidades de repetición (o módulos) de un dominio de repetición exhibirán un alto grado de identidad de la secuencia (mismos residuos de aminoácido en las posiciones correspondientes) o similitud de la secuencia (aminoácidos residuales diferentes, pero que tienen propiedades fisicoquímicas similares) y algunos de los aminoácidos residuales pueden ser residuos clave, siendo fuertemente conservados. Sin embargo, puede ser posible un alto grado de variabilidad de secuencia por inserciones y/o eliminaciones de aminoácidos, y/o sustituciones entre las diferentes unidades de repetición (o módulos) de un dominio de repetición siempre y cuando se conserve la topología de plegado común de las unidades de repetición (o módulos).

Los métodos para determinar directamente la topología de plegado de las proteínas de repetición por medios fisicoquímicos tales como la cristalografía de rayos X, RMN o espectroscopia de CD, son bien conocidos por el téenico experto en la materia. Los métodos para la identificación y la determinación de unidades de repetición o de secuencias de repetición de motivos o para la identificación de las familias de proteínas relacionadas que comprenden tales unidades de repetición o motivos, tales como búsqueda de homología (BLAST etc.), están bien establecidos en el campo de la bioinformática y son bien conocidos por el téenico de la materia. La etapa de refinamiento y el motivo inicial de la secuencia de repetición puede comprender un proceso iterativo.

El término "módulos de repetición" se refiere a las secuencias de aminoácidos repetidas de los dominios de repetición diseñados, que originalmente se derivan de las unidades de proteínas de repetición de origen natural. Cada módulo de repetición comprendido en un dominio de repetición se deriva de una o más unidades de repetición de la familia o subfamilia de proteínas de repetición de origen natural, por ejemplo la familia de proteínas de repetición de armadillo o de proteínas de repetición de anquirina. Más preferiblemente, cada módulo de repetición comprendido en un dominio de repetición comprende una de secuencia de repetición de motivo deducida a partir de unidades de repetición homologas, obtenidas de dominios de repetición seleccionados en un blanco, por ejemplo como se describe en el Ejemplo 1 y teniendo la misma especificidad hacia el blanco.

En consecuencia, el término "módulo de repetición de anquirina" significará un módulo de repetición, que originalmente es derivado de las unidades de repetición de proteínas de repetición de anquirina naturales. Las proteínas de repetición de anquirina son bien conocidas por el téenico experto en la materia.

Los "módulos de repetición" pueden comprender posiciones con aminoácidos residuales presentes en todas las copias de los módulos de repetición correspondientes ("posiciones fijas") y posiciones con aminoácidos residuales diferentes o "aleatorias" ("posiciones aleatorias").

El término "módulo de limitación" se refiere a un polipéptido fusionado con el extremo N terminal o C del módulo de repetición de un dominio de repetición, en donde dicho módulo de limitación forma interacciones terciarias cerradas (es decir, interacciones de estructura terciaria) con dicho módulo de repetición, proporcionando de este modo un límite que protege al núcleo hidrofóbico de dicho módulo de repetición, por el lado en que no está en contacto con el módulo de repetición consecutivo, del disolvente. Dicho módulo de limitación N y/o C terminal puede ser, o puede derivarse de, una unidad de limitación u otra unidad estructural en la que se encuentre la proteína de repetición de origen natural, adyacente a una unidad de repetición. El término "unidad de limitación" se refiere a un polipéptido plegado de origen natural, donde dicho polipéptido define una unidad estructural particular en la que el extremo N o C terminal está fusionado con una unidad de repetición, en donde dicho polipéptido forma interacciones de estructura terciaria ajustadas con dicha unidad de repetición, proporcionando asi una limite que protege un lado del núcleo hidrofóbico de dicha unidad de repetición, del disolvente. Preferiblemente, los módulos de limitación o las unidades de limitación son repeticiones de limitación. El término "repetición de limitación" se refiere al módulo de limitación o a la unidad de limitación que tiene un pliegue similar o el mismo que dicha unidad de repetición adyacente (o módulo) y/o similitudes de secuencia con dicha unidad de repetición adyacente (o módulo). Los módulos de limitación y las repeticiones de limitación se describen en el documento WO 2002/020565 y por Interlandi et al., 2008 (loe. cit.). Ejemplos de módulos de limitación con N terminal de anquirina (es decir, repeticiones limitantes en el extremo N terminal) son SEC ID NO: 1 a 3 y ejemplos de módulos de limitación con C terminal de anquirina (es decir, repeticiones limitantes en el extremo C terminal) son SEC ID NO: 4 a 8, 13 y 16.

Por ejemplo, el módulo de limitación de anquirina N terminal de la SEC ID NO: 49 está codificado por los aminoácidos desde la posición 1 a la 32 y el módulo de limitación con C terminal de la SEC ID NO: 49 está codificado por los aminoácidos de la posición 132 a 159.

Una proteina de unión recombinante de acuerdo con la invención comprende al menos un dominio de repetición de anquirina, en donde dicho dominio de repetición de anquirina tiene especificidad de unión hacia los PDGF-BB de mamíferos.

Los términos "tiene especificidad de unión hacia un blanco", "que se une específicamente a una blanco" o "especificidad al blanco" y similares significan que una proteína de unión o un dominio de unión se une en PBS a un blanco, con una constante de disociación menor que con una proteína no relacionada como la proteína de unión de maltosa (MBP) de E. coli . Preferiblemente, la constante de disociación en PBS del blanco es por lo menos 10, más preferiblemente por lo menos 102, incluso más preferiblemente al menos 103, o lo más preferiblemente de al menos 104 veces menor que la constante de disociación correspondiente de la MBP.

Proteínas de unión recombinantes que comprenden un dominio de repetición de anquirina con especificidad de unión al PDGF-BB se muestran en los Ejemplos.

En particular, la invención se refiere a una proteína de unión recombinante como se define aquí, que comprende un dominio de repetición de anquirina con la especificidad de unión hacia el PDGF-BB, que se une al PDGF-BB en PBS con una constante de disociación (Kd) por debajo de 106 M. Preferiblemente, dicho dominio de repetición de anquirina se une al PDGF-BB con una Kd en PBS menor que 10-7 M, más preferiblemente por debajo de 10-8 M, 10~9M, 1CT10M o más preferiblemente por debajo de 1011 M.

Los métodos para determinar las constantes de disociación de las interacciones proteína-proteína, tales como teenologías basadas en resonancia de plasmones de superficie (SPR) (por ejemplo, análisis de equilibrio SPR) o calorimetría de titulación isotérmica (ITC) son bien conocidos por el técnico experto en la materia. Los valores medidos de Kd de una interacción proteína-proteína en particular pueden variar si se miden bajo condiciones diferentes (por ejemplo, concentración de sal, pH). Por lo tanto, las mediciones de los valores de Kd son hechas preferiblemente con soluciones de proteína normalizadas y con un amortiguador estandarizado, tal como PBS.

Las proteínas de unión recombinantes que comprenden un dominio de repetición de anquirina que se unen con el PDGF-BB con una Kd en PBS por debajo de 10~6M se muestran en el Ejemplo 2.

Se prefiere una proteína de unión recombinante que comprenda un dominio de repetición de anquirina con especificidad de unión hacia el PDGF-BB humano.

Se prefiere más una proteina de unión recombinante que comprenda un dominio de repetición de anquirina que comprenda entre 70 y 300 aminoácidos, en particular entre 90 y 200 aminoácidos.

Un dominio de unión de la invención es un dominio de repetición de anquirina o un dominio de repetición de anquirina diseñado, preferiblemente como se describe en el documento WO 2002/020565. Ejemplos de dominios de repetición de anquirina diseñados con especificidad de unión hacia el PDGF-BB se muestran en los Ejemplos.

En una modalidad adicional, la invención se refiere a una proteina de unión recombinante que comprende por lo menos un dominio de repetición de anquirina con especificidad de unión hacia el PDGF-BB de mamífero, en donde el dominio de repetición de anquirina inhibe la unión del PDGF-BB con el PDGFRbeta en PBS, con un valor de IC50 por debajo de 1CT7 M. Preferentemente, dicho dominio de repetición de anquirina inhibe la unión del PDGF-BB con el PDGFRbeta en PBS con un valor de IC50 por debajo de 1CT7 M, más preferiblemente por debajo de 10-8 M, 10~9 M, 1CT10 M o más preferiblemente por debajo de 1011 M.

La concentración inhibitoria media máxima (IC50) es una medida de la eficacia de un compuesto, tal como un dominio de unión de la invención, para la inhibición de una función biológica, bioquímica o biofísica. Los métodos para determinar los valores de IC50 de inhibición de las interacciones proteína-proteína, tales como la competencia por ELISA, son bien conocidos por el téenico experto en la materia. Los valores de IC5o medidos de un inhibidor particular de una interacción proteína-proteínas pueden variar si se miden en condiciones diferentes (por ejemplo, concentración de sal, pH). Por lo tanto, las mediciones de los valores de IC50 se realizan preferiblemente con soluciones de proteína normalizadas y amortiguador normalizado, tal como PBS.

Las proteínas de unión recombinantes que comprenden un dominio de repetición de anquirina, inhibiendo la unión del PDGF-BB con el PDGFRbeta en PBS, con un valor de IC50 por debajo de 1CT7 M se muestran en el Ejemplo 4.

En una modalidad adicional, la invención se refiere a una proteína de unión recombinante que comprende al menos un dominio de repetición de anquirina, con especificidad de unión hacia el PDGF-BB, que inhibe la proliferación estimulada de PDGF-BB de fibroblastos NHI-3T3 (ATCC, número cat: CRL-1658) con un valor de IC50 por debajo de 10-6 M. Preferentemente, dicho dominio de repetición inhibe la proliferación estimulada de PDGF-BB de fibroblastos NHI-3T3 con un valor por debajo de IC50107 M, más preferiblemente por debajo de 108 M, 109 M, 1010 o más preferiblemente de 10-11 M.

Las células NHI-3T3 son sensibles al PDGF-BB para el crecimiento y, como tal, pueden ser utilizadas para medir la capacidad inhibidora funcional de los compuestos de la invención. Las células NHI-3T3 se hacen crecer en un medio de cultivo y posteriormente se privan de nutrientes durante 7 horas, antes de la adición de PDGF-BB y de una titulación de DARPin anti-PDGF-BB . Se determina una evaluación de la capacidad de los compuestos de la invención para inhibir el PDGF-BB a través de la capacidad proliferativa de las células NHI-3T3 medida por mediciones estándar, bien conocidas por el téenico experto en la materia. Proteínas de unión recombinantes que comprenden un dominio de repetición de anquirina y que inhiben la proliferación estimulada del PDGF-BB de fibroblastos NHI-3T3 con un valor de IC50 inferior a 1CT6 M se muestran en el Ejemplo 3.

La invención se refiere a una proteína de unión recombinante que comprende al menos un dominio de repetición de anquirina con especificidad de unión hacia el PDGF-BB, en donde dicha proteína de unión y/o dominio de repetición de anquirina tiene un punto medio de temperatura de desnaturalización (Tm) por encima de 40 °C, en el desplegamiento térmico en PBS y forma menos de 5% (p/p) de agregados insolubles en concentraciones de hasta 10 g/L, cuando se incuba a 37 °C durante 1 día en PBS.

El término "PBS" significa una solución acuosa amortiguadora de fosfato que contiene NaCl 137 mM, fosfato 10 mM y KC12.7 mM y que tiene un pH de 7.4.

Preferiblemente, la proteina de unión recombinante y/o el dominio de unión recombinante tienen un punto medio de temperatura de desnaturalización (Tm) por encima de 45 °C, más preferiblemente por encima de 50 °C, más preferiblemente por encima de 55 °C y lo más preferiblemente por encima de 60 °C en el desplegamiento térmico en PBS a pH 7.4. Una proteina de unión o un dominio de unión de la invención posee una estructura definida secundaria y terciaria bajo condiciones fisiológicas. El desplegamiento térmico de tal polipéptido resulta en una pérdida de su estructura terciaria y secundaria, que puede ser seguida, por ejemplo, por mediciones de dicroismo circular (CD). El punto medio de la temperatura de desnaturalización de una proteína de unión o dominio de unión en el desplegamiento térmico corresponde a la temperatura en el punto medio de la transición cooperativa en amortiguador fisiológico durante la desnaturalización térmica de dicha proteína o dominio, a través del incremento lento de la temperatura desde 10 °C hasta alrededor de 100 °C. La determinación del punto medio de una temperatura de desnaturalización en el desplegamiento térmico es bien conocida por el téenico experto en la materia. Este punto medio de temperatura de desnaturalización de una proteina de unión o dominio de unión en el desplegamiento térmico es indicativo de la estabilidad térmica de dicho polipéptido.

También se prefiere una proteina recombinante de unión y/o dominio de repetición de anquirina formando menos de 5% (p/p) de agregados insolubles en concentraciones de hasta 20 g/L, preferiblemente hasta 40 g/L, más preferiblemente hasta 60 g/L, incluso más preferiblemente hasta 80 g/L y lo más preferiblemente hasta a 100 g/L cuando se incuba durante más de 5 dias, preferiblemente por más de 10 días, más preferiblemente por más de 20 días, más preferiblemente por más de 40 días y lo más preferiblemente por más de 100 días a 37 °C en PBS. La formación de agregados insolubles puede ser detectada por la aparición visual de precipitaciones, filtración en gel o dispersión dinámica de la luz, lo que aumenta en gran medida con la formación de agregados insolubles. Los agregados insolubles pueden ser retirados de una muestra de proteínas por centrifugación a 10'000 x g durante 10 minutos. Preferiblemente, una proteina de unión recombinante y/o dominio de repetición de anquirina forma menos de 2%, más preferiblemente menos de 1%, 0.5%, 0.2%, 0.1% o más preferiblemente menos de 0.05% (p/p) de agregados insolubles bajo las condiciones de incubación mencionadas, a 37 °C en PBS. Los porcentajes de agregados insolubles pueden ser determinados por la separación de los agregados insolubles de la proteina soluble, seguida de la determinación de las cantidades de proteina en la fracción soluble e insoluble por métodos de cuantificación estándar.

También se prefiere una proteina de unión recombinante y/o dominio de repetición de anquirina que no pierda su estructura tridimensional nativa tras la incubación en PBS con ditiotreitol (DTT) 100 mM durante 1 o 10 horas a 37 °C.

En una modalidad particular, la invención se refiere a una proteina de unión recombinante que comprende un dominio de repetición de anquirina, de unión especifica al PDGF-BB y con el punto medio de temperatura de desnaturalización indicado o preferido y las propiedades de no agregación definidas anteriormente.

En una modalidad adicional, la invención se refiere a una proteina de unión recombinante que comprende por lo menos un dominio de repetición de anquirina con especificidad de unión para un PDGF-BB de mamífero, en donde el dominio de repetición de anquirina compite por la unión al PDGF-BB de mamífero con un dominio de repetición de anquirina seleccionado del grupo que consiste en la SEC ID NO: 23 a 60; preferiblemente la SEC ID NO: 24, 45 y 50, en particular, SEC ID NO: 24 y 50.

También preferiblemente dicho dominio de repetición de anquirina compite por la unión con un PDGF-BB de mamífero, con una proteína de unión seleccionada de entre el grupo de DARPin #23 a 60. Preferiblemente, dicho dominio de repetición compite por la unión a un PDGF-BB de mamífero con una proteína de unión del grupo de DARPin #24, 45 y 50. Más preferiblemente, dicho dominio de repetición de anquirina compite por la unión a un PDGF-BB de mamífero con la proteína de unión DARPin #24 o 50.

El término "competir por la unión" significa la incapacidad de los dos dominios de unión diferentes de la invención para unirse simultáneamente al mismo blanco, mientras que ambos son capaces de unirse al mismo blanco individualmente. Por lo tanto, dichos dos dominios de unión compiten por la unión con dicho blanco. Preferiblemente, dichos dos dominios de unión de competencia se unen en una superposición en el mismo epítopo de unión en dicho blanco. Métodos, como mediciones de un inmunoensayo de enzima vinculada (ELISA) competitivo o ensayo de absorción SPR competitivo (por ejemplo, mediante el uso del instrumento Proteon de BioRad) para determinar si dos dominios de unión compiten para unirse a un blanco, son bien conocidos por el téenico de la materia. Por ejemplo, el dominio de repetición de anquirina de la SEC ID No: #49 o SEC ID No: #58 compite por la unión con el PDGF humano con el dominio de repetición de anquirina de la SEC ID No: # 50.

El término "epítopo" significa el sitio especifico en la superficie de una proteina blanco, tal como PDGF-BB, en el que un dominio de unión de la invención, tal como un dominio de repetición de anquirina, se autoadhiere. Este término se define en analogía con los epitopos de anticuerpos, que son bien conocidos por el técnico experto en la materia. Si dos dominios de unión de la invención se unen al mismo epitopo, éstos van a competir por la unión con el PDGF-BB. El arreglo molecular exacto de un epitopo puede ser elucidado, por ejemplo, por cristalografía de proteínas de rayos X (un método bien conocido para el técnico experto en la materia) del dominio de unión de la invención en un complejo con el PDGF-BB.

En una modalidad adicional, la invención se refiere a una proteína de unión recombinante que comprende al menos un dominio de repetición de anquirina con especificidad de unión para un PDGF-BB de mamífero, en donde dicho dominio de repetición de anquirina comprende una secuencia de aminoácidos que tiene al menos 70% de identidad de secuencia de aminoácidos, con un dominio de repetición de anquirina seleccionado del grupo que consiste en la SEC ID NO: 23 a 60, en donde un G en la posición 1 y/o S en la posición 2 de dicho dominio de repetición de anquirina faltan opcionalmente; y L en la penúltima posición y/o N en la última posición de dicho dominio de repetición de anquirina son opcionalmente intercambiados por A.

Preferiblemente, ese dominio de repetición de anquirina en tal proteína de unión recombinante de la invención comprende una secuencia de aminoácidos que tiene por lo menos 70% de la identidad de la secuencia de aminoácidos con un dominio de repetición de anquirina, seleccionado del grupo que consiste en la SEC ID NO: 24, 45 y 50; más preferiblemente, 24 y 50.

Preferiblemente, tal dominio de repetición de anquirina en una proteína de unión recombinante de la invención comprende una secuencia de aminoácidos con por lo menos 70% de la identidad de la secuencia de aminoácidos, por ejemplo, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% o 100% de identidad de secuencia de aminoácidos con uno, dos o tres módulos de repetición de anquirina presentes entre los módulos de limitación con N terminal y C terminal, de un dominio de repetición de anquirina seleccionado del grupo que consiste en la SEC ID NO: 23 a 60.

Preferiblemente, en lugar de 70% de identidad de secuencia de aminoácidos, un dominio de repetición de anquirina o tales uno, dos o tres módulos de repetición presentes entre los módulos de limitación con N terminal y C terminal en un dominio de repetición de anquirina en una proteina de unión recombinante de la invención comprenden una secuencia de aminoácidos con al menos 75%, más preferiblemente al menos 76%, más preferiblemente al menos 80%, más preferiblemente al menos 85%, más preferiblemente al menos 90% o más preferiblemente al menos 95% de identidad de la secuencia de aminoácidos. Preferiblemente, los porcentajes mencionados de identidad de la secuencia de aminoácidos están en las posiciones de la estructura.

Preferiblemente, hasta 30 aminoácidos, por ejemplo 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 o ningún aminoácido en los dominios de repetición de la SEC ID NO: 23 a 60 se intercambian por otro aminoácido. En particular, hasta 25 aminoácidos, más preferiblemente hasta 20 aminoácidos, más preferiblemente hasta 15 aminoácidos, incluso más preferiblemente hasta 11 aminoácidos, más preferiblemente hasta 8 aminoácidos, más preferiblemente hasta 5 aminoácidos, más preferiblemente hasta 2 aminoácidos y lo más preferiblemente ningún aminoácido en la SEC ID NO: 23 a 60 se intercambia.

Preferiblemente, cuando los aminoácidos se intercambian en los módulos de limitación de la SEC ID NO: 13 o 16, los módulos de repetición de la SEC ID NO: 12, 14, 15, 17, 18 y 19 o los dominios de repetición de la SEC ID NO: 23 a 60, estos aminoácidos se seleccionan del grupo que consiste en A, D, E, F, H, I, K, L, M, N, Q, R, S, T, V, W y Y; más preferiblemente del grupo que consiste en A, D, E, H, I, K, L, Q, R, S, T, V y Y. También preferiblemente, un aminoácido se intercambia por un aminoácido homólogo; es decir, un aminoácido se intercambia por un aminoácido que tiene una cadena lateral con propiedades biofísicas similares. Por ejemplo, la carga negativa del aminoácido D puede ser reemplazada por un aminoácido E cargado negativamente, o un aminoácido hidrofóbico como L puede ser sustituido por A, I o V. Las téenicas de intercambio de un aminoácido por otro aminoácido en un polipéptido son bien conocidas por el técnico experto en la materia.

En una modalidad adicional, la invención se refiere a una proteína de unión recombinante que comprende por lo menos un dominio de repetición de anquirina con especificidad de unión al PDGF-BB de mamífero, en donde dicho dominio de repetición de anquirina se selecciona del grupo que consiste en la SEC ID NO: 23 a 60, en donde un G en la posición 1 y/o S en la posición 2 de dicho dominio de repetición de anquirina faltan opcionalmente; y L en la penúltima posición y/o N en la última posición de dicho dominio de repetición de anquirina se intercambian opcionalmente por A.

Preferiblemente, dicho dominio de repetición de anquirina se selecciona del grupo que consiste en la SEC ID NO: 24, 45 y 50; más preferiblemente, 24 y 50.

En una modalidad adicional, la invención se refiere a una proteina de unión recombinante, en donde el dominio de repetición de anquirina se une al mismo epítopo como un dominio de repetición de anquirina, seleccionado del grupo que consiste en la SEC ID NO: 23 a 60. Preferiblemente, dicho dominio de repetición de anquirina se selecciona del grupo que consiste en la SEC ID NO: 24, 45 y 50; más preferentemente, 24 y 50.

En una modalidad adicional, la invención se refiere a una proteina de unión recombinante que comprende por lo menos un dominio de repetición de anquirina con especificidad de unión a un PDGF-BB de mamífero, en donde dicho dominio de repetición de anquirina comprende un módulo de repetición de anquirina que tiene una secuencia de aminoácidos seleccionados del grupo que consiste en la SEC ID NO: 12, 14, 15, 17, 18 y 19 y secuencias, en donde hasta 9 aminoácidos en la SEC ID NO: 12, 14, 15, 17, 18 y 19 son intercambiados por cualquier aminoácido.

Preferiblemente, tal módulo de repetición de anquirina de dicho dominio de repetición de anquirina se selecciona del qrupo que consiste en la SEC ID NO: 12, 14 y 17; más preferiblemente, 12 y 17.

Preferiblemente, hasta 8 aminoácidos en los módulos de repetición de la SEC ID NO: 12, 14, 15, 17, 18 y 19 se intercambian por otro aminoácido, más preferiblemente hasta 7 aminoácidos, más preferiblemente hasta 6 aminoácidos, más preferiblemente hasta 5 aminoácidos, incluso más preferiblemente hasta 4 aminoácidos, más preferiblemente hasta 3 aminoácidos, más preferiblemente hasta 2 aminoácidos y lo más preferiblemente 1 aminoácido. Preferiblemente, los intercambios de aminoácidos mencionados se realizan en las posiciones de la estructura. En consecuencia, hasta 8 aminoácidos en las posiciones de la estructura de la SEC ID NO: 12, 14, 15, 17, 18 y 19 se intercambian por cualquier aminoácido, preferiblemente hasta 7, 6, 5, 4, 3 o 2 aminoácidos y lo más preferiblemente 1 aminoácido.

En una modalidad adicional, la invención se refiere a una proteina de unión recombinante, en donde el dominio de repetición de anquirina con especificidad de unión al PDGF-BB comprende un módulo de repetición con la secuencia de repetición de anquirina KDEEGTTPLHYAAVWGHLEIVEVLLKAGADVNA (SEC ID NO: 12) y secuencias en las que hasta 9 aminoácidos de la SEC ID NO: 11 se intercambian por cualquier aminoácido y en donde E en la posición 3 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en D, W, Q, I y Y, preferiblemente de D y W; E en la posición 4 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en T, D, Y, y S, preferiblemente de T y D; T en la posición 6 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en S y F, preferiblemente por S; Y en la posición 11 se intercambia opcionalmente por F; V en la posición 14 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en A, Y y T, de preferencia por A; y W en la posición 15 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en F, K, V, y Y, preferiblemente de F y Y.

En una modalidad adicional, la invención se refiere a una proteina de unión recombinante que comprende por lo menos un dominio de repetición de anquirina con especificidad de unión a un PDGF-BB de mamífero, en donde dicho dominio de repetición de anquirina comprende un módulo de limitación que tiene una secuencia de aminoácido seleccionada del grupo que consiste en la SEC ID NO: 13 y 16 y secuencias en donde hasta 9 aminoácidos de la SEC ID NO: 13 y 16 se intercambian por cualquier aminoácido.

Preferiblemente, hasta 8 aminoácidos en los módulos de limitación de la SEC ID NO: 13 y 16 comprendidos en dicho dominio de repetición de anquirina se intercambian por otro aminoácido, más preferiblemente hasta 7 aminoácidos, más preferiblemente hasta 6 aminoácidos, más preferiblemente hasta 5 aminoácidos, incluso más preferiblemente hasta 4 aminoácidos, más preferiblemente hasta 3 aminoácidos, más preferiblemente hasta 2 aminoácidos, más preferiblemente hasta 1 aminoácido y más preferiblemente ningún aminoácido en la SEC ID NO: 13 y 16 se intercambia.

En aún otra modalidad, la invención se refiere a una proteina de unión recombinante, en donde el dominio de repetición de anquirina con especificidad de unión al PDGF-BB comprende un módulo de limitación con C terminal con la secuencia QDIYGATPADLAALVGHEDIAEVLQKLN (SEC ID NO: 13) y secuencias, en donde hasta 9 aminoácidos de la SEC ID NO: 13 se intercambian por cualquier aminoácido en donde I en la posición 3 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en K, L, A y V, preferiblemente L, A y V; Y en la posición 4 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en W, F y S, preferiblemente, de W y F; A en la posición 6 se intercambia opcionalmente por K; L en la posición 14 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en F, Y y D, preferiblemente de F y Y; V en la posición 15 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en L, I, A y N, preferiblemente, L y I; y V en la posición 23 se cambia por un aminoácido seleccionado del grupo que consiste en I y L.

Se prefiere una proteina de unión recombinante, en donde el dominio de repetición de anquirina comprende el módulo de repetición de anquirina de la SEC ID NO: 12 y el módulo de limitación con C terminal de la SEC ID NO: 13. Preferentemente, dicho módulo de limitación con C terminal sigue directamente dicho módulo de repetición de anquirina en dicho dominio de repetición de anquirina.

En aún otra modalidad, la invención se refiere a una proteína de unión recombinante, en donde el dominio de repetición de anquirina con especificidad de unión al PDGF-BB comprende un módulo de repetición con la secuencia de repetición de anquirina KDQEGTTPLHFAASVGHLEIVEVLLKAGADVNA (SEC ID NO: 15) y secuencias en donde hasta 9 aminoácidos de la SEC ID NO: 15 se intercambian por cualquier aminoácido y en donde Q en la posición 3 se intercambia opcionalmente por A; E en la posición 4 se intercambia opcionalmente por D; T en la posición 6 se intercambia opcionalmente por E; F en la posición 11 se intercambia opcionalmente por Y; S en la posición 14 se intercambia opcionalmente por V; y V en la posición 15 se intercambia opcionalmente por W.

En aún otra modalidad, la invención se refiere a una proteina de unión recombinante, en donde el dominio de repetición de anquirina con especificidad de unión al PDGF-BB comprende un módulo de limitación con C terminal con la secuencia QDHYGATPADLAALIGHEDIAEVLQKLN (SEC ID NO: 16) y secuencias en donde hasta 9 aminoácidos de la SEC ID NO: 15 se intercambian por cualquier aminoácido y en donde H en la posición 3 se intercambia opcionalmente por I y Y en la posición 4 se intercambia opcionalmente por W.

En aún otra modalidad, la invención se refiere a una proteina de unión recombinante, en donde el dominio de repetición de anquirina con especificidad de unión al PDGF-BB comprende un módulo de repetición con la secuencia de repetición de anquirina KDLNGQTPLHLAADIGHLEIVEVLLKAGADVNA (SEC ID NO: 17) y secuencias en donde hasta 9 aminoácidos de la SEC ID NO: 17 se intercambian por cualquier aminoácido y en donde K en la posición 1 se intercambia opcionalmente por Q o I; L en la posición 3 se intercambia opcionalmente por N y A en la posición 27 se intercambia opcionalmente por H.

En aún otra realización, la invención se refiere a una proteina de unión recombinante, en la que el dominio de repetición de anquirina con especificidad de unión al PDGF-BB comprende un módulo de repetición con la secuencia de repetición anquirina KDYAGSTPLRLAAWAGHLEIVEVLLKAGADVNA (SEC ID NO: 18) y las secuencias en donde hasta 9 aminoácidos de la SEC ID NO: 18 se intercambian por cualquier aminoácido y en donde K en la posición 1 se intercambia opcionalmente por Q; W en la posición 14 se intercambia opcionalmente por H; A en la posición 15 se intercambia opcionalmente por V y A en la posición 27 se intercambia opcionalmente por N o Y.

En aún otra modalidad, la invención se refiere a una proteína de unión recombinante, en donde el dominio de repetición de anquirina con especificidad de unión al PDGF-BB comprende un módulo de repetición con la secuencia de repetición de anquirina KDYFGYTPLHLAAYFGHLEIVEVLLKAGADVNA (SEC ID NO: 19) y las secuencias, en donde hasta 9 aminoácidos de la SEC ID NO: 19 se intercambian por cualquier aminoácido y en donde K en la posición 1 se intercambia opcionalmente por N; A en la posición 12 se intercambia opcionalmente por T; A en la posición 13 se intercambia opcionalmente por T; E en la posición 22 se intercambia opcionalmente por D; A en la posición 27 se intercambia opcionalmente por H o Y.

Se prefiere adicionalmente un módulo de limitación de anquirina N terminal o C terminal que comprenda una repetición de limitación de anquirina N terminal o C terminal, respectivamente, en el que uno o más de los aminoácidos residuales en dicha repetición de limitación se sustituyan por un residuo de aminoácido que se encuentre en la posición correspondiente, en la alineación de una unidad de limitación de anquirina correspondiente o una unidad de repetición de anquirina.

La sustitución de aminoácidos puede ser por cualquiera de los 20 aminoácidos de origen natural más frecuentes, preferiblemente por los aminoácidos seleccionados del grupo que consiste en A, D, E, F, H, I, K, L, M, N, Q, R, S, T, V, W y Y; y más preferiblemente del grupo que consiste en A, D, E, H, I, K, L, Q, R, S, T, V y Y. También preferiblemente, la sustitución de aminoácidos es por un aminoácido homólogo; es decir, se sustituye un aminoácido por un aminoácido que tiene una cadena lateral con propiedades biofísicas similares. Por ejemplo, el aminoácido D cargado negativamente puede ser sustituido por el aminoácido E cargado negativamente o un aminoácido hidrofóbico como L puede ser sustituido por A, I o V. La sustitución de un aminoácido por un aminoácido homólogo es bien conocida por el téenico experto en la materia.

También se prefiere un módulo de limitación de anquirina C terminal que comprenda al aminoácido A en la posición 27 y 28 en cualquiera de los módulos de limitación con C terminal, basado en la SEC ID NO: 4 a 8, 13 a 16.

También se prefiere un módulo de limitación con C terminal que comprenda los aminoácidos desde la posición 1 hasta la 26 o desde la posición 1 hasta la 27 de cualquiera de los módulos de limitación con C terminal, basados en la SEC ID NO; 4 a 8, 13 a 16.

Aminoácidos G en la posición 1 y/o S en la posición 2 de la SEC ID NO: 1 a 3 pueden ser eliminados a partir de módulos de limitación de anquirina N terminal, sin ninguna influencia evidente en las propiedades. Estos dos aminoácidos sirven como enlazadores para conectar el dominio de repetición de anquirina a aminoácidos y proteínas adicionales. La invención también comprende tales dominios de repetición de anquirina que comprenden los módulos de limitación de anquirina N terminal en donde un G en la posición 1 y/o S en la posición 2 se eliminan. Se entiende que las posiciones de aminoácidos (por ejemplo, "posición 33") en un dominio de repetición de anquirina, como se define en este documento, se adaptan en consecuencia, lo que resulta en un desplazamiento del número, por ejemplo "la posición 33" se convertirá en "la posición 32" si un aminoácido falta, o la posición 33 "se convertirá en la posición 31" si dos aminoácidos faltan.

Un módulo de limitación de anquirina de un dominio de repetición de anquirina de la invención puede ser intercambiado por un módulo de limitación de anquirina por combinación de téenicas, como la alineación de secuencias de aminoácidos, la mutagénesis y la síntesis genética, conocidas por el téenico experto en la materia. Por ejemplo, la repetición de limitación con C terminal de la SEC ID NO: 49 puede ser reemplazada por la repetición de limitación con C terminal de la SEC ID NO: 8 por (i) determinación de la repetición de limitación con C terminal de la SEC ID NO: 49 (es decir, posición de la secuencia 132 a 159) por alineación de la secuencia con la SEC ID NO: 8, (ii) sustitución de la secuencia de la repetición de limitación con C terminal de la SEC ID NO: 49 con la secuencia de la SEC ID NO: 8, (iii) generación de un gen que codifique el dominio de repetición que codifica el módulo de limitación con C terminal intercambiado, (iv) expresar el dominio de repetición modificado en el citoplasma de E. coli y (v) purificación del dominio de repetición modificado por medios estándar. Como un ejemplo adicional, la repetición de limitación con N terminal de la SEC ID NO: 49 puede ser reemplazada por la repetición de limitación con N terminal de la SEC ID NO: 2 por (i) determinación de la repetición de limitación con N terminal de la SEC ID NO: 49 (es decir, posición de la secuencia 1 a 32) por alineación de secuencia con la SEC ID NO: 2, (ii) sustitución de la secuencia de la repetición de limitación con N terminal determinada de la SEC ID NO: 49 con la secuencia de la SEC ID NO: 2, (iii) generación de un gen que codifica el dominio de repetición que codifica el módulo de limitación con N terminal intercambiado, (iv) expresar el dominio de repetición modificado en el citoplasma de E. coli y (v) purificación del dominio de repetición modificado por medios estándar.

Además, un dominio de repetición de anquirina de la invención se puede construir genéticamente por ensamble de un módulo de limitación de anquirina N terminal (por ejemplo, la repetición de limitación con N terminal de la SEC ID NO: 2) seguida por uno o más módulos de repetición (por ejemplo los tres módulos de repetición de anquirina que comprenden los aminoácidos residuales desde la posición 33 hasta la 131 de la SEC ID NO: 49) y un módulo de limitación con C terminal (por ejemplo, la repetición de limitación con C terminal de la SEC ID NO: 8) por medio de la síntesis de genes. El gen de dominio de repetición ensamblado genéticamente puede ser entonces expresado en E. coli como se describió anteriormente.

Se prefiere adicionalmente una proteína de unión recombinante, dominio de repetición, módulo de repetición, módulo de limitación con N terminal o módulo de limitación con C terminal que tenga una secuencia de aminoácidos desprovista de aminoácidos C, M o N.

Se prefiere adicionalmente una proteína recombinante de unión, dominio de repetición, módulo de repetición, módulo de limitación con N terminal o módulo de limitación con C terminal que tenga una secuencia de aminoácidos desprovista de aminoácidos N seguidos por G.

Más preferido es una proteina de unión recombinante o dominio de repetición que comprenda cualquiera de tales módulos de limitación con N terminal o C terminal.

En una modalidad adicional preferida de una proteina de unión recombinante que comprende un dominio de repetición de anquirina de acuerdo con la presente invención, uno o más de los aminoácidos residuales del módulo de limitación N terminal de dicho dominio de repetición se intercambia por un residuo de aminoácido encontrado en la posición correspondiente en la alineación de una unidad de limitación con N terminal. Preferiblemente, hasta el 30% de los aminoácidos residuales se intercambian, más preferiblemente, hasta 20%, e incluso más preferiblemente, hasta 10% de los aminoácidos residuales se intercambian. Lo más preferiblemente, tal unidad de limitación con N terminal es una unidad de limitación con N terminal de origen natural.

En una modalidad adicional preferida de una proteina de unión recombinante que comprende un dominio de repetición de anquirina de acuerdo con la presente invención, uno o más de los aminoácidos residuales del módulo de limitación C terminal de dicho dominio de repetición se intercambia por un residuo de aminoácido encontrado en la posición correspondiente en la alineación de una unidad de limitación con C terminal. Preferiblemente, hasta el 30% de los aminoácidos residuales se intercambian, más preferiblemente, hasta 20%, e incluso más preferiblemente, hasta 10% de los aminoácidos residuales se intercambian. Lo más preferiblemente, tal unidad de limitación con C terminal es una unidad de limitación con C terminal de origen natural.

En aún otra modalidad particular, hasta el 30% de los aminoácidos residuales, más preferentemente, hasta 20%, e incluso más preferiblemente, hasta 10% de los aminoácidos residuales se intercambian con los aminoácidos que no se encuentran en las posiciones correspondientes de las unidades de repetición, unidades de limitación con N terminal o unidades de limitación con C terminal.

El término "secuencia consenso" se refiere a una secuencia de aminoácidos, en donde dicha secuencia consenso se obtiene mediante la alineación estructural y/o alineación secuencial de múltiples unidades de repetición. Usando dos o más unidades de repetición alineadas estructural y/o secuencialmente, es posible determinar el residuo de aminoácidos más frecuente en cada posición. La * secuencia consenso es aquella secuencia que comprende los aminoácidos que están representados con más frecuencia en cada posición. En caso de que dos o más aminoácidos estén representados por encima del promedio en una única posición, la secuencia consenso puede incluir un subconjunto de esos aminoácidos. Dichas dos o más unidades de repetición pueden tomarse de las unidades de repetición comprendidas en una sola proteina de repetición, o de dos o más proteínas de repetición diferentes.

Las secuencias consenso y los métodos para determinarlas son bien conocidos por los téenicos expertos en la materia.

Un "residuo de aminoácido consenso" es el aminoácido que se encuentra en cierta posición de una secuencia de consenso. Si se encuentran dos o más, por ejemplo tres, cuatro o cinco aminoácidos residuales con una probabilidad similar en dichas dos o más unidades de repetición, el aminoácido consenso puede ser uno de los aminoácidos más frecuentemente encontrados o una combinación de dichos dos o más aminoácidos residuales.

Adicionalmente se prefieren los módulos de limitación que no ocurren naturalmente, módulos de repetición, proteínas de unión o dominios de unión.

El término "de origen no natural" significa sintético o no de la naturaleza, más específicamente, el término significa hecho por la mano del hombre. El término "proteína de unión de origen no natural" o "dominio de unión de origen no natural" significa que dicha proteína de unión o dicho dominio de unión es sintético (es decir, producido por síntesis química a partir de aminoácidos) o recombinante y no de la naturaleza. "Proteína de unión de origen no natural" o "dominio de unión de origen no natural" es una proteína o dominio hecho por el hombre, respectivamente, obtenido por la expresión de ácidos nucleicos diseñados correspondientemente. Preferiblemente, la expresión se lleva a cabo en células eucariotas o bacterianas, o mediante el uso de un sistema de expresión in vitro libre de células. Además, el término significa que la secuencia de dicha proteína de unión o dicho dominio de unión no está presente como una entrada de secuencia no artificial en una base de datos de secuencia, por ejemplo en GenBank, EMBL-Bank o Swiss-Prot. Estas bases de datos y otras bases de datos de secuencias similares son bien conocidas por el téenico experto en la materia.

En una modalidad particular, la invención se refiere a una proteína de unión recombinante que comprende un dominio de repetición de anquirina que se une específicamente al PDGF-BB y adicionalmente comprende un dominio de repetición de anquirina que se une específicamente a los factores de crecimiento endotelial vascular A (VEGF-A). Ejemplos de dominios de repetición de anquirina con especificidad para el PDGF-BB están dados en este documento y ejemplos de dominios de repetición de anquirina con especificidad hacia VEGF-A se describen en el documento WO 2010/060748 (US 2011/0207668) y WO 2011/135067 (US 2013/0116197), cuyas descripciones completas se incorporan como referencia en el presente documento. Tales dos dominios de repetición pueden estar unidos por un polipeptido enlazador por medios genéticos por métodos conocidos por el téenico experto en la materia. En una modalidad de la invención, una proteina de unión recombinante que comprende un dominio de repetición de anquirina que se une específicamente con el PDGF-BB y un dominio de repetición de anquirina que se une específicamente con el VEGF-A se puede utilizar para el tratamiento de enfermedades de la retina y enfermedades neovasculares coroideas, como la degeneración macular exudativa relacionada con la edad, neovascularización coroidea polipoidal y la miopía patológica.

Otra modalidad preferida es una proteína de unión recombinante que comprenda un dominio de repetición de anquirina con especificidad de unión hacia el PDGF-BB que comprende uno, dos, tres o más módulos de repetición internos que participarán en la unión con el PDGF-BB. Preferiblemente, tal dominio de repetición de anquirina comprende un módulo de limitación con N terminal, de dos a cuatro módulos de repetición internos y un módulo de limitación con C terminal. Preferiblemente, dichos módulos de limitación son limitaciones de repetición. También preferiblemente, dichos módulos de limitaciones participarán en la unión con el PDGF-BB.

Una preferencia adicional es una proteina de unión recombinante que comprende dos o más de dichos dominios de repetición de anquirina con la especificidad de unión hacia el PDGF-BB. Preferiblemente, dicha proteina de unión comprende 2 o 3 de dichos dominios de repetición. Dichos dos o más dominios de repetición tienen la misma o diferente secuencia de aminoácidos.

En una modalidad preferida adicional de una proteina de unión recombinante que comprende un dominio de repetición de anquirina de acuerdo con la presente invención, uno o más de los aminoácidos residuales de los módulos de repetición de dicho dominio de repetición de anquirina se intercambian por un residuo de aminoácido encontrado en la posición correspondiente en la alineación de una unidad de repetición. Preferiblemente, hasta 30% de los aminoácidos residuales se intercambian, más preferiblemente, hasta 20%, e incluso más preferiblemente hasta 10% de los aminoácidos residuales se intercambian. Lo más preferible es que dicha unidad de repetición sea una unidad de repetición de origen natural.

En aún otra modalidad particular, hasta el 30% de los aminoácidos residuales, por ejemplo 29%, 28%, 27%, 26%, 25% 24%, 23%, 22%, 21%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1% o 0% de los aminoácidos residuales se intercambian con los aminoácidos que no se encuentran en las correspondientes posiciones de las unidades de repetición. Más preferiblemente, hasta 20% e incluso más preferiblemente, hasta 10% de los aminoácidos residuales se intercambian con los aminoácidos que no se encuentran en las posiciones correspondientes de las unidades de repetición.

En modalidades adicionales, cualquiera de las proteínas o dominios de unión recombinantes con PDGF-BB descritas en este documento pueden estar unidos covalentemente a una o más fracciones adicionales, incluyendo, por ejemplo, una fracción que se une a un blanco diferente para crear un agente con especificidad dual de unión, un compuesto bioactivo, una fracción marcadora (por ejemplo, un marcador fluorescente tal como fluoresceína o un trazador radiactivo), una fracción que facilita la purificación de las proteínas (por ejemplo, un marcador peptídico pequeño, tal como un marcador His o Strep), una fracción que proporciona funciones efectoras para la eficacia terapéutica mejorada (por ejemplo, la parte Fe de un anticuerpo para proporcionar citotoxicidad celular mediada dependiente de los anticuerpos, un fracción de proteina tóxica tal como Pseudomonas aerugínosa exotoxina A (ETD) o un agente molecular tóxico pequeño tales como maitansinoides o agentes alquilantes de ADN) o una fracción que proporciona una farmacocinética mejorada. La farmacocinética mejorada puede ser evaluada de acuerdo con la necesidad terapéutica percibida. Frecuentemente es deseable aumentar la biodisponibilidad y/o aumentar el tiempo entre las dosis, posiblemente incrementando el tiempo en que una proteina permanece disponible en el suero después de la dosificación. En algunos casos es deseable mejorar la continuidad de la concentración sérica de la proteina en el tiempo (por ejemplo, reducir la diferencia en la concentración sérica de la proteina entre la concentración poco después de la administración y la concentración poco antes de la siguiente administración). Las fracciones que tienden a disminuir una eliminación lenta de una proteina de la sangre incluyen hidroxietil-almidón (HES), polietilenglicol (PEG), azúcares (por ejemplo ácido siálico), fracciones de proteínas bien toleradas (por ejemplo, fragmentos Fe o albúmina sérica) y dominios de unión o péptidos con especificidad y afinidad por las proteínas séricas abundantes, tales como fragmentos de anticuerpo Fe o albúmina de suero. Ejemplos de tales dominios de unión con afinidad para la albúmina sérica están dentro del documento WO 2012/069654. La proteina de unión recombinante de la invención puede estar unida a una fracción que reduce la tasa de eliminación de polipéptidos en mamíferos (por ejemplo, en ratón, rata o humano) por más de relativamente tres veces que los polipéptidos no modificados.

En una realización adicional, la invención se refiere a moléculas de ácidos nucleicos que codifican las proteínas de unión recombinantes particulares, los dominios de repetición de anquirina particulares, los módulos de repetición de anquirina particulares y los módulos de limitación particulares. Además, se considera un vector que comprende dicha molécula de ácido nucleico.

Además, una composición farmacéutica que comprende una o más de las proteínas de unión recombinantes mencionadas anteriormente, en particular las proteínas de unión que comprenden o moléculas de ácidos nucleicos que codifican las proteínas de unión particulares y opcionalmente, se considera un portador y/o diluyente farmacéuticamente aceptable. Los portadores y/o diluyentes farmacéuticamente aceptables son conocidos por el téenico experto en la materia y se explican con más detalle a continuación. Aún más, se considera una composición de diagnóstico que comprende una o más de las proteínas de unión recombinantes anteriormente mencionadas, en particular las proteínas de unión que comprenden los dominios de repetición.

Una composición farmacéutica que comprende proteínas de unión recombinantes como se describió anteriormente y un portador, excipiente o estabilizador farmacéuticamente aceptable, por ejemplo, como lo describen en Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed.

[1980]. Los portadores, excipientes o estabilizantes adecuados conocidos para el téenico son solución salina, solución de Ringer, solución de dextrosa, solución de Hank, aceites fijos, oleato de etilo, dextrosa en solución salina al 5%, sustancias que mejoran la isotonicidad y la estabilidad química, amortiguadores y conservadores. Otros portadores adecuados incluyen cualquier portador que no induzca por sí mismo la producción de anticuerpos perjudiciales para el individuo que recibe la composición de tales como proteínas, polisacáridos, ácidos polilácticos, ácidos poliglicólicos, aminoácidos poliméricos y aminoácidos copoliméricos. Una composición farmacéutica también puede ser una formulación de combinación, que comprende un agente activo adicional, tal como un agente anti-cáncer o un agente anti-angiogénico.

Las formulaciones a utilizar para la administración in vivo deben ser asépticas o estériles.

Esto se logra fácilmente por filtración a través de membranas de filtración estériles.

La composición farmacéutica puede ser administrada por cualquier método adecuado dentro del conocimiento del téenico experto en la materia.

Además, cualquier composición farmacéutica mencionada anteriormente se considera para el tratamiento de un trastorno.

La invención además proporciona métodos de tratamiento. El método comprende la administración, a un paciente en necesidad del mismo, de una cantidad terapéuticamente eficaz de una proteina de unión recombinante de la invención, esto es, una cantidad que es suficiente para producir un efecto deseado en un paciente.

Además, se considera un método de tratamiento de una condición patológica en un mamífero, incluyendo el hombre, que comprende administrar a un paciente en necesidad del mismo, una cantidad eficaz de la composición farmacéutica antes mencionada.

Ejemplos de tales condiciones patológicas son la aterosclerosis, restenosis, hipertensión pulmonar, enfermedades oculares y de la retina y enfermedades fibróticas, incluyendo fibrosis pulmonar, cirrosis hepática, esclerodermia, glomeruloesclerosis y fibrosis cardiaca. Adicionalmente, la terapia anti-PDGF-BB es útil para condiciones oncológcias patológicas, tales como gliomas, sarcomas, leucemias, linfomas y cánceres epiteliales.

La proteina de unión recombinante o el dominio de repetición de anquirina de acuerdo con la invención puede ser obtenida y/o más evolucionada por varios métodos tales como la visualización sobre la superficie de bacteriófagos (documento WO 1990/002809, WO 2007/006665) o células bacterianas (WO 1993/010214), visualización ribosomal (WO 1998/048008), visualización en plás idos (WO 1993/008278) o mediante el uso de construcciones híbridas covalentes de ARN - proteínas de repetición (WO 2000/032823), o expresión intracelular y selección/detección tales como ensayo por complementación de proteínas (WO 1998/341120). Tales métodos son conocidos por el téenico experto en la materia.

Una biblioteca de proteínas de repetición de anquirina utilizada para la selección/detección de una proteína de unión recombinante o un dominio de repetición de anquirina de acuerdo con la invención puede obtenerse de acuerdo con protocolos conocidos por el técnico experto en la materia (documento WO 2002/020565, Binz, H.K., et al., J. Mol. Biol., 332, 489-503, 2003, and Binz et al., 2004, loe. cit). El uso de dichas bibliotecas para la selección de dominios de repetición de anquirina con especificidad hacia el PDGF-BB es ejemplificado en el Ejemplo 1. Además, los dominios de repetición de anquirina de la presente invención pueden ser ensamblados modularmente a partir de los módulos de repetición de anquirina de acuerdo con la actual invención y los módulos de limitación o repeticiones de limitación (Forrer, P., et al., FEBS letters 539, 2-6, 2003) usando teenologías estándar de ADN recombinante (por ejemplo, WO 2002/020565, Binz et al., 2003, loe. cit. y Binz et al., 2004, loe. cit).

La invención no está restringida a las modalidades particulares descritas en los Ejemplos. Otras fuentes pueden ser utilizadas y procesadas siguiendo el esquema general descrito a continuación.

Ejemplos Todos los materiales de partida y reactivos descritos a continuación son conocidos por los técnicos de la materia y están disponibles comercialmente o se pueden preparar usando técnicas bien conocidas.

Ma teriales Los productos químicos fueron adquiridos de Fluka (Suiza). Los oligonucleótidos eran de Microsynth (Suiza). A menos que se estableciera algo diferente, las polimerasas de ADN, enzimas de restricción y amortiguadores eran de New England Biolabs (EE.UU.) o Fermentas (Lituania). La cepa de clonación y de producción de proteína fue E. coli XLl-azul (Stratagene, EE.UU.) o BL21 (Novagen, EE.UU.)· Se adquirió PDGF-BB humano recombinante y de murino de Reliatech (Alemania; los números de productos son 200-055 y MIO- 125, respectivamente). El PDGF-BB biotinilado fue obtenido químicamente a través del acoplamiento de la fracción de biotina con las aminas primarias de la proteína, usando reactivos y métodos de biotinilación estándar (Pierce, EE.UU.).

Biología Molecular A menos que se indique lo contrario, los métodos se realizan de acuerdo con los protocolos descritos (Sambrook J., Fritsch E.F. and Maniatis T., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory 1989, New York).

Bibliotecas de proteínas de repetición de anquirina diseñadas Se describen los métodos para generar bibliotecas de proteínas de repetición de anquirina diseñadas (WO 2002/020565; Binz et al.2003, loe. cit.; Binz et al.2004, loe. cit.). Por tales métodos se pueden construir bibliotecas de proteínas de repetición de anquirina diseñadas con módulos de repetición de anquirina aleatorios y/o módulos de limitación aleatorios. Por ejemplo, tales bibliotecas podrían consecuentemente ser montadas sobre la base de un módulo de limitación con N terminal fija (por ejemplo, el módulo de limitación con N terminal de la SEC ID NO: 2) o un módulo de limitación con terminales N aleatorias, de acuerdo con la SEC ID NO: 64, uno o más módulos de repetición aleatorios de acuerdo con la secuencia del motivo de la SEC ID NO: 20, 62 o 63, y un módulo de limitación con C terminal fija (por ejemplo, el módulo de limitación con C terminal de la SEC ID NO: 8) o un módulo de limitación con C terminal aleatoria, de acuerdo con la SEC ID NO: 65. Preferiblemente, tales bibliotecas se ensamblan para no tener aminoácidos C, G, M, N (en frente de un residuo G) o P en posiciones aleatorias de módulos de repetición o de limitación. Adicionalmente, los módulos de repetición aleatorios, de acuerdo con la secuencia del motivo de la SEC ID NO: 20, 62 o 63, podrían ser adicionalmente aleatorizados en la posición 10 y/o la posición 17; el módulo de limitación con N terminal aleatoria, de acuerdo con la secuencia del motivo de la SEC ID NO: 64 se puede aleatorizar adicionalmente en la posición 7 y/o la posición 9; y los módulos de limitación con terminales C aleatorias de acuerdo con la secuencia del motivo de la SEC ID NO: 65, se pueden aleatorizar adicionalmente en las posiciones 10, 11 y/o 17.

Además, tales módulos aleatorizados en tales bibliotecas pueden comprender inserciones adicionales de ciclos de polipéptidos con posiciones aleatorias de aminoácidos. Ejemplos de tales inserciones de ciclos de polipéptido son bibliotecas de ciclos de la región determinante de la complementariedad (CDR) de anticuerpos o bibliotecas de péptidos nuevas generadas. Por ejemplo, tal inserción de ciclo podría ser diseñada utilizando la estructura del dominio de repetición de anquirina con N terminal de la ribonucleasa L humana (Tanaka, N., Nakanishi, M, Kusakabe, Y, Goto, Y., Kitade, Y, Nakamura, K.T., EMBO J. 23 (30) , 3929-3938, 2004) como guía. En analogía a este dominio de repetición de anquirina donde se insertan diez aminoácidos en una vuelta beta presente cerca de la frontera de dos repeticiones de anquirina, bibliotecas de proteínas de repetición de anquirina pueden contener ciclos aleatorizados (con posiciones fijas y aleatorias) de longitud variable (por ejemplo, de 1 a 20 aminoácidos) insertados en una o más vueltas beta de un dominio de repetición de anquirina.

Cualquier módulo de limitación con N terminal de una biblioteca de proteínas de repetición de anquirina preferiblemente posee el motivo RELLKA o RILKAA, en lugar del motivo RILLAA (por ejemplo, presente desde la posición 21 a 26 en la SEC ID NO: 64) y cualquier módulo de recubrimiento con C terminal, de una biblioteca de proteina de repetición de anquirina posee preferentemente el motivo KAA o KLA, en lugar del motivo KLN (por ejemplo, los últimos tres aminoácidos de la SEC ID NO: 65).

El diseño de una biblioteca de proteínas de repetición de anquirina puede ser guiado por las estructuras conocidas de un dominio de repetición de anquirina que interactúa con el blanco. Ejemplos de tales estructuras, identificadas por su Banco de Datos de Proteínas (Protein Data Bank (PDB)) con códigos de adhesión o de identificación únicos (PDB-ID), son 1WDY, 3V31, 3V30, 3V2X, 3V20, 3UXG, 3TWQ-3TWX, 1N11, 1S70 y 2ZGD.

Se describen ejemplos de bibliotecas de proteínas de repetición de anquirina diseñadas, como las bibliotecas de proteínas de repetición de anquirina diseñadas N2C y N3C (WO 2002/020565; Binz et al.2003, loe. cit.; Binz et al. 2004, loe. cit.). El dígito en N2C y N3C describe el número de módulos de repetición aleatorios presentes entre los módulos de limitación de N terminal y C terminal.

La nomenclatura utilizada para definir las posiciones dentro de las unidades de repetición y módulos está basada en Binz et al. 2004, loe. cit. con la modificación de que las fronteras de los módulos de repetición de anquirina y las unidades de repetición de anquirina se desplazaron una posición por un aminoácido. Por ejemplo, la posición 1 de un módulo de repetición de anquirina de Binz et al.2004 (loe. cit.) corresponde a la posición 2 de un módulo de repetición de anquirina de la publicación actual y en consecuencia, la posición 33 de un módulo de repetición de anquirina de Binz et al. 2004, loe. cit. corresponde a la posición 1 de un módulo de repetición de anquirina siguiente de la publicación actual.

Todas las secuencias de ADN se confirmaron por secuenciación y la el peso molecular calculado de todas las proteínas descritas se confirmó por espectrometría de masas.

Ejemplo 1: Selección de proteínas de unión que comprenden un dominio de repetición de anquirina con especificidad de unión hacia el PDGF-BB Con el uso de la visualización de ribosomas (Hanes, J. and Plückthun, A., PNAS 94, 4937-42, 1997), muchas proteínas de repetición de anquirina diseñadas (DARPin) con especificidad de unión hacia el PDGF-BB fueron seleccionadas de bibliotecas de DARPin, como es descrito por Binz et al.2004 (loe. cit.). La unión de los clones seleccionados hacia objetivos específicos (PDGF-BB) y no específicos (MBP, E. coli proteína de unión de maltosa) fue evaluada por la prueba de ELISA con extracto crudo, que indica que cientos proteínas de unión al PDGF-BB fueron seleccionadas con éxito. Por ejemplo, los dominios de repetición de anquirina de la SEC ID NO: 23 a 61 constituyen las secuencias de aminoácidos de las proteínas de unión seleccionadas, que comprenden un dominio de repetición de anquirina con especificidad de unión al PDGF-BB. Los módulos de repetición de anquirina individuales de tales dominios de repetición de anquirina con especificidad de unión al PDGF-BB se proporcionan en la SEC ID NO: 12, 14, 15, 17, 18 y 19. Los módulos de limitación individuales de tales dominios repetición de anquirina con especificidad de unión al PDGF-BB están proporcionados en la SEC ID NO: 13 y 16.

Selección de proteínas de repetición de anquirina específicas hacia el PDGF-BB por visualízacíón de ribosomas La selección de las proteínas de repetición de anquirina específicas del PDGF-BB se realizó por visualízacíón de ribosomas (Hanes and Plückthun, loe. cit.), utilizando PDGF-BB humanos y de ratón como proteínas objetivo, bibliotecas de proteínas de repetición de anquirina diseñadas, como se describió anteriormente, y protocolos establecidos (Zahnd, C., Amstutz, P. and Plückthun, A., Nat. Methods 4, 69-79, 2Q07). El número de transcripción inversa (RT)-ciclos de POR después de cada ronda de selección fue reducido constantemente de 40 a 30, ajustándose al rendimiento debido al enriquecimiento de las uniones. Las primeras cuatro rondas de selección emplearon una selección estándar de visualízacíón de ribosoma, mediante la disminución de la concentración del objetivo y el aumentando en la rigurosidad del lavado para incrementar la presión de la selección de la ronda 1 a la ronda 4 (Binz et al., 2004, loe. cit.). Para enriquecer la alta afinidad de DARPin anti-PDGF-BB, la salida de la cuarta ronda de la selección estándar de ribosomas (arriba) se sometió a una ronda de selección de disociación fuera de la tasa, con aumento de la rigurosidad de selección (Zahnd, 2007, loe. cit.). Se realizó una ronda de selección estándar final para amplificar y recuperar las proteínas de unión seleccionadas fuera de la tasa.

Clones seleccionados que se unen específicamente al PDGF-BB, como muestra la prueba de ELISA con extracto crudo Las DARPin individuales seleccionadas que se unen específicamente al PDGF-BB fueron identificadas por un ensayo por inmunoabsorción ligado a enzimas (ELISA) utilizando extractos de Escherichia coli crudo de células de expresión de DARPin, utilizando protocolos estándar. Las DARPin seleccionadas por visualización de ribosomas fueron clonadas en el vector de expresión pQE30 (Qiagen), transformadas en E. coli XLl-azul (Stratagene) y después se cultivaron durante la noche a 37 °C, en una placa de 96 pozos profundos (cada clon en un solo pozo) que contenía 1 mL de medio de crecimiento (2YT que contiene 1% de glucosa y 100 mq/ L de ampicilina). Se inoculó 1 mL de 2YT fresco que contenia 50 mq/mL de ampicilina, con 100 m? de cultivo durante la noche, en una placa de 96 pozos profundos frescos. Después de una incubación durante 2 h a 37 °C, se indujo la expresión con IPTG (concentración final 1 mM) y se continuó durante 3 h. Las células fueron recolectadas, se volvieron a suspender en 100 mL de B-PERII (Pierce) y se incubaron durante 15 min a temperatura ambiente (TA), con agitación. Entonces, 900 mE de PBS-TC (PBS complementado con 0.25% de caseína hidrolizada, 0.1% de Tween 20®, a pH de 7.4) se añadieron y los restos de las fracciones celulares se eliminaron por centrifugación. Se aplicaron 100 mE de cada clon lisiado a un pocilio de una placa MaxiSorp recubierta con neutravidina, que contiene ya sea PDGF-BB o MBP no relacionada, inmovilizada a través de su fracción de biotina; y se incubaron durante 1 h a TA. Después de un lavado exhaustivo con PBS-T (PBS complementado con 0.1% de Tween 20®, a pH 7.4) la placa se desarrolló usando procedimientos estándar de ELISA, utilizando el anticuerpo monoclonal de rábano de caballo -marcador anti-RGS (His)4 (34650, Qiagen), la unión fue detectada por el sustrato POD (Roche). El desarrollo de color se midió a 405 nm. La detección de varios cientos de clones de tal extracto celular crudo por ELISA reveló más de cien DARPin diferentes con especificidad hacia el PDGF-BB. Estas proteínas de unión se eligieron para su posterior análisis. Ejemplos de secuencias de aminoácidos de los dominios de repetición de anquirina seleccionados que se unen específicamente al PDGF-BB están proporcionados en la SEC ID NO: 23 a 61.

Estos dominios de repetición de anquirina con la especificidad de unión de PDGF-BB y el control negativo de DARPin sin especificidad de unión al PDGF-BB (es decir DARPin #21 y #22) fueron clonados en un pQE (QIAgen, Alemania) basado en el vector de expresión, proporcionando una N terminal y marcador His para facilitar la purificación simple de proteínas, como se describe a continuación. Por lo tanto, se construyeron los vectores de expresión que codifican las siguientes DARPin: DARPin #21 (SEC ID NO: 21 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #22 (SEC ID NO: 22 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #23 (SEC ID NO: 23 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #24 (SEC ID NO: 24 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #25 (SEC ID NO: 25 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #26 (SEC ID NO: 26 con un marcador His (SEC ID NO: 9) fusionado a s.u N terminal); DARPin #27 (SEC ID NO: 27 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #28 (SEC ID NO: 28 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #29 (SEC ID NO: 29 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #30 (SEC ID NO: 30 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #31 (SEC ID NO: 31 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #32 (SEC ID NO: 32 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #33 (SEC ID NO: 33 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #34 (SEC ID NO: 34 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #35 (SEC ID NO: 35 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #36 (SEC ID NO: 36 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #37 (SEC ID NO: 37 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #38 (SEC ID NO: 38 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #39 (SEC ID NO: 39 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #40 (SEC ID NO; 40 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #41 (SEC ID NO: 41 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #42 (SEC ID NO: 42 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #43 (SEC ID NO: 43 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #44 (SEC ID NO: 44 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #45 (SEC ID NO: 45 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #46 (SEC ID NO: 46 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #47 (SEC ID NO: 47 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #48 (SEC ID NO: 48 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #49 (SEC ID NO: 49 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #50 (SEC ID NO: 50 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #51 (SEC ID NO: 51 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #52 (SEC ID NO: 52 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #53 (SEC ID NO: 53 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #54 (SEC ID NO: 54 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #55 (SEC ID NO: 55 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #56 (SEC ID NO: 56 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #57 (SEC ID NO: 57 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #58 (SEC ID NO: 58 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #59 (SEC ID NO: 59 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #60 (SEC ID NO: 60 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); DARPin #61 (SEC ID NO: 61 con un marcador His (SEC ID NO: 9) fusionado a su N terminal); Expresión de DARPin de alto nivel y solubles Para un análisis más detallado, los clones seleccionados que muestran especificidad de unión hacia el PDGF-BB en el extracto celular de crudo por ELISA, como se describió anteriormente, se expresaron en células E. coli BL21 o XL1- azul y se purificaron usando su marcador His, utilizando protocolos estándar. Se utilizaron 50 mL de cultivos estacionarios durante una noche (TB, 1% de glucosa, 100 mg/L de ampicilina; 37 °C) se utilizaron para inocular 1 L de cultivos (mismo medio sin glucosa). A una absorbancia de 0.7 (1 para BL21) a 600 nm, los cultivos se indujeron con IPTG 0.5 mM y se incubaron a 37 °C durante 4-5 h. Los cultivos se centrifugaron y los sedimentos resultantes se volvieron a suspender en 40 mL de TBS500 (Tris-HCl 50 mM, NaCl 500 mM, pH 8) y se sometieron a ultrasonido. El lisado se centrifugó y se añadió glicerol (concentración final 10% (V/V)) e imidazol (concentración final 20 mM) al sobrenadante resultante. Las proteínas se purificaron sobre una columna de Ni-ácido nitrilotriacético (volumen de la columna 2.5 mL), de acuerdo con las instrucciones del fabricante (QIAgen, Alemania) . Alternativamente, las DARPin o los dominios de repetición seleccionados carentes de un marcador 6xHis fueron purificados por cromatografía de intercambio aniónico, seguida por cromatografía de exclusión de tamaño de acuerdo con las resinas estándar y los protocolos conocidos para el téenico experto en la materia. Hasta 200 mg de DARPin altamente solubles con especificidad de unión al PDGF-BB se pueden purificar a partir de un litro de cultivo de E. coli con una pureza > 95%, como es estimado por SDS- 15% PAGE.

Tales DARPin purificadas se utilizan para otras caracterizaciones.

Ejemplo 2: Caracterización de las DARPin con especificidad de unión hacia el PDGF-BB, por análisis de resonancia de plasmones superficiales Moléculas biotiniladas de PDGF-BB de humanos y de ratón fueron inmovilizadas en una celda de flujo a través de la unión con recubrimiento de estreptavidina y se analizó la interacción con diversas DARPin seleccionadas.

Análisis de resonancia de plasmones superficiales (SPR) SPR se midió usando un instrumento ProteON (BioRad) y la medición se llevó a cabo de acuerdo con los procedimientos estándares conocidos por el téenico experto en la materia. La corriente de la solución amortiguadora fue PBS, pH 7.4, que contiene 0.005% de Tween 20®. La neutravidina fue inmovilizada covalentemente en un chip GLC (BioRad) hasta un nivel de alrededor de 8000 unidades de resonancia (RU). A continuación, se realizó la inmovilización del PDGF-BB en el chip recubierto con neutravidina. Posteriormente se midió la interacción DARPin PDGF-BB mediante la inyección de 100 mB de la corriente de solución amortiguadora (PBS que contenia 0.005% de Tween®) que contenía diluciones en serie de DARPin en concentraciones de 12.5, 6.26, 3.13 y 1.67 nM (medición en la tasa), seguida por un flujo de la corriente de solución amortiguadora por entre 10 minutos y hasta 3 horas, a una velocidad de flujo constante de 30 mL/min (medición fuera de la tasa). Las señales (es decir, los valores de unidad de resonancia (RU)) de una célula de referencia sin recubrimiento y una inyección de referencia (es decir, inyección únicamente de la corriente de la solución amortiguadora) se restaron de las trazas de RU obtenidas después de la inyección de PDGF-BB (referenciación doble). A partir de las trazas obtenidas por SRP de las mediciones dentro y fuera de la tasa, correspondientemente, se puede determinar la interacción DARPin PDGF-BB.

Los resultados se resumen en la Tabla 1. Las constantes de disociación (Kd) se calcularon a partir de las estimaciones realizadas dentro y fuera de la tasa, utilizando los procedimientos estándares conocidos por el téenico experto en la materia.

Tabla 1: Constantes de disociación de las interacciones DARPin PDGF-BB (humano y de ratón) determinadas por SPR._ DARPin # Kd [M] (humano) Kd [M] (ratón 23 2 .14E-11 1.72E-11 24 3..01E-11 n.d. 25 1.47E-11 1.28E-11 26 1.77E-11 1.74E-11 28 1.71E-11 n.d. 29 1.05E-10 n.d. 30 1.10E-10 n.d. 31 1.09E-10 n.d. 32 6.38E-11 8.34E-11 33 8 .06E-11 9.04E-11 34 7.75E-11 5.92E-11 35 9.56E-11 9.81E-11 36 2.42E-11 5.30E-11 37 1.52E-10 8.28E-11 38 9.41E-11 5.83E-11 39 1.72E-10 3.82E-10 40 3.44E-11 6.08E-11 42 8.05E-11 9.74E-11 43 1.29E-06 1.51E-06 44 7.68E-11 9.02E-11 45 1.08E-10 n.d. 46 1.12E-10 n.d. 47 9.37E-11 n.d. 48 1.13E-10 1.21E-10 49 7.69E-11 1.02E-10 50 1.15E-10 n.d. 51 1.21E-10 n.d. 53 1.28E-10 n.d. 54 2.45E-10 n.d. 55 5.55E-11 n.d. 56 1.50E-10 n.d. 57 1.23E-10 n.d. 58 2.57E-10 n.d. 59 1.71E-10 n.d. n.d.: no determinado.

Ej emplo 3 : Inhibición de la proliferación de fibroblastos por DARPin con especificidad de unión al PDGF- BB Las células de fibroblastos NHI-3T3 son una linea celular estándar utilizada para los ensayos que involucran PDGF-BB. En el día 1, al 70%-80% de confluencia, las células fueron cosechadas y se sembraron en una placa para cultivo de 96 pocilios, con una densidad de 5000 células/pocillo en un medio de crecimiento, seguida por la privación de nutrientes de las células durante alrededor de 7-8 horas más tarde mediante el cambio de medio a medio de ensayo y la incubación durante 24 horas. Todas las incubaciones se realizaron bajo la condición de 37 °C, con un flujo de CO2 de 5%. Después de no alimentar las células, en el día 2 se cambió el medio por un medio de ensayo fresco que contenía la serie de diluciones del factor de crecimiento humano PDGF-BB (para el ensayo de proliferación) o una mezcla de inhibición de 20 ng/mL de PDGF-BB humano con una serie de diluciones de DARPin, de 2.5 veces (200 nM a 0.05 nM) durante el ensayo de inhibición. Las células se incubaron durante otras 48 h bajo esta condición, sobre la adición de 20 mL de reactivo WST-1 (Roche, número de producto 11644807001). Este reactivo permite un ensayo colorimétrico que analiza el número de células viables. La lectura de las señales de salida se realizó a A45o nm con un fondo de corrección a A6oo nm, a varios puntos de tiempo de 2, 4 y 6 horas después de la adición de WST-1.

Ejemplo de los resultados se resumen en la Tabla 2. Los valores de IC50 se calcularon a partir de las curvas de titulación obtenidas como se describió anteriormente, usando el software GraphPad Prism y procedimientos estándares conocidos por el téenico experto en la materia. Se da un ejemplo de curva de titulación para DARPin #49 en la Figura 1.

Tabla 2: Potencia de inhibición de varias DARPin de proliferación de celular NHI-3T3 inducida por PDGF-BB 24 1.4 28 1.6 30 3.2 49 1.9 59 2.0 Ejemplo 4 : Caracterización de DARPin con especificidad de unión al PDGF-BB por el ensayo competitivo de receptor La potencia de DARPin PEGilada anti-PDGF-BB para inhibir la unión del PDGF-BB humano con su receptor PDGFRbeta se determinó en un ensayo competitivo de receptor por ELISA (basado en PDGF-BB Quantikine, R&D Systems). PDGFRbeta/Fc quimera se recubrió previamente en una microplaca. Las DARPin se preincubaron en el diluyente del ensayo del equipo PDGF-BB Quantikine (R&D Systems), con una cantidad definida de PDGF-BB y se incubaron a temperatura ambiente durante 2 horas, con agitación de 750 rp . Estas mezclas de preincubación se transfirieron, a continuación, a los pocilios previamente recubiertos y cualquier PDGF-BB que no estuviera bloqueado por DARPin estaba unido por el receptor inmovilizado. Después de eliminar por lavado cualquier sustancia no unida, se adicionó un anticuerpo de peroxidasa de rábano de caballo unido al anticuerpo policlonal especifico del PDGF-BB en los pocilios. Después de un lavado para eliminar cualquier reactivo anticuerpo-enzima no unido, se añadió una solución de sustrato a los pocilios y el color se estaba desarrollando en proporción con la cantidad de PDGF-BB unido. El desarrollo de color se detuvo y la intensidad del color se midió a 405 nm. En este ensayo, las DARPin examinadas mostraron alta potencia de inhibición de PDGF-BB, como se resume en la Tabla 3. Se muestra un ejemplo de las curvas de titulación para un conjunto de DARPin en la Figura 2. Los valores de IC50 se calcularon a partir tales curvas de titulación, se obtuvieron, como se describió anteriormente, usando el software Graph Pad Prism y los procedimientos estándares conocidos por el téenico experto en la materia.

Tabla 3: Inhibición de la interacción de PDGF-BB con su receptor PDGFRbeta por DARPin (Se proporcionan los valores de IC50) DARPin # IC50 [pM] 23 22 24 15 28 16 29 15 30 490 31 480 34 210 37 > 400 38 85 44 130 45 160 46 150 47 140 49 66 50 32 51 8 52 68 53 36 54 210 55 14 56 170 57 204 58 470 Ejemplo 5: Inhibición de la neovascularización coroidea en ratones , inducida por láser, por DARPin con especificidad de unión al PDGF-BB El efecto sobre el crecimiento de neovasos se examinó in vivo. Se seleccionó un modelo láser de neovascularización coroidea de ratón y se realizó de acuerdo con la descripción publicada (Takahashi, K., Saishin, Y., Saishin, Y., Rcy, A.G., Levin, R. and Campochiaro, P.A., Arch. Ophthalmol. 127 (4) , 494-499, 2009).

La neovascularización coroidea (CNV) fue inducida por fotocoagulación con láser que induce la ruptura de la membrana de Bruch, como se describió previamente. En el día 2, 6 ratones adultos C57BL fueron anestesiados con clorhidrato de ketamina (100 g/kg de peso corporal) y las pupilas se dilataron con tropicamida al 1%. Se realizaron tres quemaduras de 532 nm con un láser de diodo para la fotocoagulación (tamaño del punto 75 mm, duración de 0.1 segundos, 120 mW) en cada retina, con el sistema de aplicación de láser de diodo de la lámpara de hendidura OcuLight GL, utilizando una cubreobjetos portátil como lente de contacto para ver la retina. Las quemaduras se realizaron en las posiciones de las manecillas del reloj correspondientes a 9, 12 y 3 en el polo posterior de la retina. La producción de una burbuja al momento de la aplicación del láser indica la ruptura de la membrana de Bruch, por lo que es un factor importante para obtener la neovascularización coroidea y, por lo tanto, solo aquellas quemaduras en las que se produjo una burbuja fueron incluidas en el estudio. Se administró DARPin #61-PEG20 diariamente, con una concentración de 10 o 1 mg/kg, respectivamente, como se indica en la Figura 3. En el día 14, los corazones de los ratones fueron perfundidos con un marcador con fluoresceina dextrano, se prepararon monturas planas de la retina como se fue descrito (Takahashi et al., loe. cit.) y el área de neovascularización se cuantificó por análisis de imagen. Se realizó un análisis estadístico utilizando la herramienta ANOVA de 1 vía y Dunnett posterior a la prueba para comparar todos los grupos de DARPin con el grupo de vehículo. Todas estas téenicas son conocidas por el técnico experto en la materia. Los resultados se presentan en la Figura 3.

Claims (26)

REIVINDICACIONES
1. Una poteína de unión recombinante que comprende por lo menos un dominio repetido de anquirina, en donde dicho dominio repetido de anquirina se une al PDGF-BB en PBS con una Kd inferior a 10~7 M.
2. La proteina de unión de conformidad con la reivindicación 1, en donde dicho dominio de repetición de anquirina inhibe la unión del PDGF-BB con PDGFRbeta en PBS con un valor de IC50 inferior a 10~7 M.
3. La proteina de unión de conformidad con la reivindicación 1 o 2, en donde dicho dominio de repetición de anquirina inhibe la proliferación estimulada de PDGF-BB de los fibroblastos 3T3, con un valor de IC50 menor que 107 M.
4. La proteina de unión de conformidad con cualquiera de las reivindicaciones 1 a 3, en donde dicho dominio de repetición de anquirina compite por la unión al PDGF-BB con un dominio de repetición de anquirina seleccionado del grupo que consiste en las SEC ID NO: 23 a 60.
5. La proteina de unión de conformidad con cualquiera de las reivindicaciones 1 a 4, en donde dicho dominio de repetición de anquirina comprende una secuencia de aminoácidos que tiene por lo menos 70% de identidad de la secuencia de aminoácidos, con un dominio de repetición de anquirina seleccionado del grupo que consiste en las SEC ID NO: 23 a 60, en donde G en la posición 1 y/o S en la posición 2 de dicho dominio de repetición de anquirina faltan opcionalmente; y L en la penúltima posición y/o N en la última posición de dicho dominio de repetición de anquirina se intercambian opcionalmente por A.
6. La proteína de unión de conformidad con la reivindicación 5, en donde dicho dominio de repetición de anquirina comprende una secuencia de aminoácidos que tiene por lo menos 76% de identidad de la secuencia de aminoácidos con un dominio de repetición de anquirina seleccionado del grupo que consiste en las SEC ID NO: 23 a 60, en donde G en la posición 1 y/o S en la posición 2 de dicho dominio de repetición de anquirina opcionalmente faltan; y L en la penúltima posición y/o N en la última posición de dicho dominio de repetición de anquirina se intercambian opcionalmente por A.
7. La proteina de unión de conformidad con la reivindicación 5, en donde dicho dominio de repetición de anquirina comprende una secuencia de aminoácidos que tiene por lo menos 70% de identidad de la secuencia de aminoácidos en sus posiciones estructurales, con un dominio de repetición de anquirina seleccionado del grupo que consiste en las SEC ID NO: 23 a 60, en donde G en la posición 1 y/o S en la posición 2 de dicho dominio de repetición de anquirina opcionalmente faltan; y L en la penúltima posición y/o N en la última posición de dicho dominio de repetición de anquirina opcionalmente se intercambian por A.
8. La proteina de unión de conformidad con la reivindicación 5, en donde dicho dominio de repetición de anquirina se selecciona del grupo que consiste en las SEC ID NO: 23 a 60, en donde G en la posición 1 y/o S en la posición 2 de dicho dominio de repetición de anquirina opcionalmente faltan; y L en la penúltima posición y/o N en la última posición de dicho dominio de repetición de anquirina se intercambian opcionalmente por A.
9. La proteina de unión de conformidad con cualquiera de las reivindicaciones 1 a 8, en donde dicho dominio de anquirina se une al mismo epitopo que el dominio de repetición de anquirina seleccionado del grupo que consiste en las SEC ID NO: 23 a 60.
10. La proteina de unión de conformidad con cualquiera de las reivindicaciones 1 a 7 o 9, en donde dicho dominio de repetición de anquirina comprende un módulo repetido de anquirina que tiene una secuencia de aminoácidos, seleccionada del grupo que consiste en las SEC ID NO: 12, 14, 15, 17, 18 y 19 y secuencias en donde hasta 9 aminoácidos en las SEC ID NO: 12, 14, 15, 17, 18 y 19 se intercambian por cualquier aminoácido.
11. La proteina de unión de conformidad con la reivindicación 10, en donde dicho dominio de repetición de anquirina comprende un módulo de repetición de anquirina que tiene una secuencia de aminoácidos seleccionada de un grupo que consiste en las SEC ID NO: 12, 14, 15, 17, 18 y 19 y secuencias en donde hasta 2 aminoácidos en las SEC ID NO: 12, 14, 15, 17, 18 y 19 se intercambian por cualquier aminoácido.
12. La proteina de unión de conformidad con la reivindicación 10, en donde dicho dominio de repetición de anquirina comprende un módulo de repetición de anquirina que tiene una secuencia de aminoácidos seleccionada de un grupo que consiste en las SEC ID NO: 12, 14, 15, 17, 18 y 19 y secuencias en donde hasta 8 aminoácidos en las SEC ID NO: 12, 14, 15, 17, 18 y 19 se intercambian por cualquier aminoácido.
13. La proteina de unión de conformidad con la reivindicación 10, en donde dicho módulo de repetición de anquirina tiene la secuencia de aminoácidos KDEEGTTPLHYAAVWGHLEIVEVLLKAGADVNA (SEC ID NO: 12) y secuencias, en donde hasta 9 aminoácidos en la SEC ID NO: 12 se intercambian por cualquier aminoácido y en donde E en la posición 3 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en D, W, Q, I e Y; E en la posición 4 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en T, D, Y y S; T en la posición 6 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste S y F; Y en la posición 11 se intercambia opcionalmente por F; V en la posición 14 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en A, Y y T; W en la posición 15 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en F, K, V y Y.
14. La proteina de unión de conformidad con la reivindicación 13, en donde dicho módulo de repetición de anquirina tiene la secuencia de aminoácidos KDEEGTTPLHYAAVWGHLEIVEVLLKAGADVNA (SEC ID NO: 12) en donde hasta 8 aminoácidos en la SEC ID NO: 12 se intercambian por cualquier aminoácido y en donde E en la posición 3 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en D, W, Q, l e Y; E en la posición 4 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en T, D, Y y S; T en la posición 6 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste S y F; Y en la posición 11 se intercambia opcionalmente por F; V en la posición 14 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en A, Y y T; W en la posición 15 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en F, K, V y Y.
15. La proteina de unión de conformidad con cualquiera de las reivindicaciones 1 a 14, en donde dicho dominio de repetición de anquirina comprende un módulo de limitación que tiene una secuencia de aminoácidos seleccionada del grupo que consiste en las SEC ID NO: 13 y 16 y secuencias en donde hasta 8 aminoácidos en las SEC ID NO: 13 y 16 se intercambian por cualquier aminoácido.
16. La proteina de unión de conformidad con la reivindicación 15, en donde dicho dominio de repetición de anquirina comprende un módulo de limitación que tiene una secuencia de aminoácidos seleccionada del grupo que consiste en las SEC ID NO: 13 y 16 y secuencias en donde hasta 7 aminoácidos en las posiciones estructurales de las SEC ID NO: 13 y 16 se intercambian por cualquier aminoácido.
17. La proteina de unión de conformidad con la reivindicación 15, en donde el dominio de repetición de anquirina con especificidad de unión a PDGF-BB comprende un módulo de limitación con C terminal con la secuencia de aminoácidos QDIYGATPADLAALVGHEDIAEVLQKLN (SEC ID NO: 13) y secuencias, en donde hasta 8 aminoácidos en la SEC ID NO: 13 se intercambian por cualquier aminoácido y en donde I en la posición 3 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en K, L, A y V; Y en la posición 4 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en W, F y S; A en la posición 6 se intercambia opcionalmente por K; L en la posición 14 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en F, Y y D; V en la posición 15 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en L, I, A y N; y V en la posición 23 se intercambia por un aminoácido seleccionado del grupo que consiste en I y L.
18. La proteina de unión de conformidad con la reivindicación 15, en donde el dominio de repetición de anquirina con especificidad de unión al PDGF-BB comprende un módulo de limitación C terminal con la secuencia de aminoácidos QDIYGATPADLAALVGHEDIAEVLQKLN (SEC ID NO: 13), en donde hasta 7 aminoácidos en las posiciones estructurales de la SEC ID NO: 13 se intercambian por cualquier aminoácido y en donde I en la posición 3 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en K, L, A y V; Y en la posición 4 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en W, F y S; A en la posición 6 se intercambia opcionalmente por K; L en la posición 14 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en F, Y y D; V en la posición 15 se intercambia opcionalmente por un aminoácido seleccionado del grupo que consiste en L, I, A y N; y V en la posición 23 se intercambia por un aminoácido seleccionado del grupo que consiste en I y L.
19. La proteína de unión de conformidad con cualquiera de las reivindicaciones 1 a 4, en donde el dominio de repetición de anquirina comprende el módulo de repetición de anquirina de conformidad con la reivindicación 13 y el módulo de limitación C terminal de conformidad con la reivindicación 17.
20. La proteina de unión de conformidad con la reivindicación 19, en donde dicho dominio de repetición de anquirina comprende el módulo de repetición de anquirina de la SEC ID NO: 12 directamente seguido por el módulo de limitación C terminal de la SEC ID NO: 13.
21. La proteina de unión de conformidad con una de las reivindicaciones 1 a 7 y 9 a 19, en donde uno o más de los aminoácidos residuales de los módulos de repetición de anquirina de dicho dominio de repetición de anquirina se intercambian por un aminoácido residual encontrado en la posición correspondiente en la alineación de una unidad de repetición de anquirina.
22. La proteína de unión de conformidad con cualquiera de las reivindicaciones 1 a 4, que comprende un péptido de cualquiera de las secuencias SEC ID NO: 12 a 19 y 23 a 61.
23. Un ácido nucleico que codifica a una proteina de unión de cualquiera de las reivindicaciones 1 a 22.
24. Una composición farmacéutica que comprende la proteina de unión de conformidad con cualquiera de las reivindicaciones 1 a 22 o el ácido nucleico de conformidad con la reivindicación 23 y opcionalmente un portador y/o diluyente farmacéuticamente aceptable.
25. Un método para tratar una condición seleccionada de una deqeneración macular exudativa relacionada con la edad, neovascularización coroidea polipoidal y miopía patológica, el método comprende el paso de administrar a un paciente, en necesidad de dicho tratamiento, una cantidad terapéuticamente efectiva de una proteína de unión de conformidad con cualquiera de las reivindicaciones 1 a 22.
26. Un método para tratar una condición seleccionada de una degeneración macular exudativa relacionada con la edad, neovascularización coroidea polipoidal y miopía patológica, el método comprende el paso de administrar a un paciente, en necesidad de dicho tratamiento, una cantidad terapéuticamente efectiva de una proteína de unión que comprende un dominio de repetición de anquirina que se une específicamente al PDGF-BB y un dominio de repetición de anquirina que se une específicamente al VEGF-A.
MX2014015825A 2012-06-28 2013-06-27 DESIGNED ANQUIRINE REPETITION PROTEINS THAT JOIN THE GROWTH FACTOR DERIVED FROM PLATES. MX2014015825A (es)

Priority Applications (2)

Application Number Priority Date Filing Date Title
EP12174020 2012-06-28
PCT/EP2013/063488 WO2014001442A1 (en) 2012-06-28 2013-06-27 Designed ankyrin repeat proteins binding to platelet-derived growth factor

Publications (1)

Publication Number Publication Date
MX2014015825A true MX2014015825A (es) 2015-08-10

Family

ID=48699826

Family Applications (1)

Application Number Title Priority Date Filing Date
MX2014015825A MX2014015825A (es) 2012-06-28 2013-06-27 DESIGNED ANQUIRINE REPETITION PROTEINS THAT JOIN THE GROWTH FACTOR DERIVED FROM PLATES.

Country Status (16)

Country Link
US (2) US9163070B2 (es)
EP (1) EP2867360B1 (es)
JP (1) JP2015522576A (es)
KR (1) KR20150023957A (es)
CN (1) CN104508129A (es)
AU (1) AU2013283296A1 (es)
BR (1) BR112014032316A2 (es)
CA (1) CA2877584A1 (es)
HK (1) HK1209156A1 (es)
IL (1) IL236428D0 (es)
IN (1) IN2014MN02522A (es)
MX (1) MX2014015825A (es)
RU (1) RU2014150224A (es)
SG (1) SG11201408196RA (es)
WO (1) WO2014001442A1 (es)
ZA (1) ZA201408872B (es)

Families Citing this family (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TWI510246B (zh) 2010-04-30 2015-12-01 Molecular Partners Ag Modified binding protein that inhibits VEGF-A receptor interaction
JP6173216B2 (ja) 2010-11-26 2017-08-02 モレキュラー・パートナーズ・アーゲーMolecular Partners Ag Improved capping module for engineered ankyrin repeat proteins
PL2846836T3 (pl) 2012-05-07 2020-01-31 Allergan, Inc. METHOD OF TREATMENT OF AMD IN PATIENTS RESISTANT TO ANTI-VEGF THERAPY
WO2020074469A1 (en) 2018-10-08 2020-04-16 Universität Zürich Her2-binding tetrameric polypeptides
EP2738180A1 (en) 2012-11-30 2014-06-04 Molecular Partners AG Binding proteins comprising at least two binding domains against HER2.
WO2014191574A1 (en) * 2013-05-31 2014-12-04 Molecular Partners Ag Designed ankyrin repeat proteins binding to hepatocyte growth factor
US10665324B2 (en) 2014-07-07 2020-05-26 Yeda Research And Development Co. Ltd. Method of computational protein design
US20170226158A1 (en) * 2014-08-11 2017-08-10 Medimmune Limited Intracellular antigen binding
BR112017009792A2 (pt) 2014-11-10 2018-02-27 Hoffmann La Roche anticorpos anti-pdgf-b e métodos de uso
EP3218398A1 (en) 2014-11-10 2017-09-20 F.Hoffmann-La Roche Ag Anti-ang2 antibodies and methods of use
EP3218402A1 (en) 2014-11-10 2017-09-20 F.Hoffmann-La Roche Ag Anti-il-1beta antibodies and methods of use
KR20170080584A (ko) 2014-11-10 2017-07-10 에프. 호프만-라 로슈 아게 이중특이적 항체 및 안과학에서 이의 사용 방법
CA2979602A1 (en) 2015-04-02 2016-10-06 Molecular Partners Ag Designed ankyrin repeat domains with binding specificity for serum albumin
US10283384B2 (en) * 2015-04-27 2019-05-07 Taiwan Semiconductor Manufacturing Co., Ltd. Method for etching etch layer and wafer etching apparatus
BR112019005587A2 (pt) 2016-09-22 2019-06-11 Molecular Partners Ag recombinant binding proteins and their use
US10037890B2 (en) * 2016-10-11 2018-07-31 Lam Research Corporation Method for selectively etching with reduced aspect ratio dependence
US20190256587A1 (en) 2018-02-22 2019-08-22 Universitat Zurich Ligands to GM-CSF or GM-CSF-Receptor for use in Leukemia in a Patient Having undergone Allo-HCT
CA3094176A1 (en) 2018-03-22 2019-09-26 Charite-Universitatsmedizin Berlin Crispr associated protein reactive t cell immunity
WO2019238966A1 (en) 2018-06-15 2019-12-19 Universität Bern LIGANDS TO LIGHT OR ITS RECEPTOR LTßR FOR USE IN HAEMATOLOGIC MALIGNANCIES
EP3623382A1 (en) 2018-09-14 2020-03-18 Universität Zürich Ligands to gm-csf or gm-csf-receptor for use in leukemia in a patient having undergone allo-hct
WO2020104627A1 (en) 2018-11-21 2020-05-28 Universität Zürich Photochemically induced conjugation of radiometals to small molecules, peptides and nanoparticles in a simultaneous one-pot reaction
EP3677911A3 (en) 2019-01-03 2020-07-29 Universität Basel Use of non-agonist ligands for suppression of metastasis
WO2020144378A1 (en) 2019-01-11 2020-07-16 Universitätsspital Basel Sglt-2 inhibitors or il-1r antagonists for reduction of hypoglycaemia after bariatric surgery
WO2020207771A1 (en) 2019-04-10 2020-10-15 Universität Zürich A method for determining the likelihood of a patient being responsive to cancer immunotherapy

Family Cites Families (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5094941A (en) * 1987-12-31 1992-03-10 Zymogenetics, Inc. Monoclonal antibodies to PDGF
EP1997891A1 (en) 1988-09-02 2008-12-03 Dyax Corporation Generation and selection of recombinant varied binding proteins
US5270170A (en) 1991-10-16 1993-12-14 Affymax Technologies N.V. Peptide library and screening method
US5348867A (en) 1991-11-15 1994-09-20 George Georgiou Expression of proteins on bacterial surface
CA2196496A1 (en) 1997-01-31 1998-07-31 Stephen William Watson Michnick Protein fragment complementation assay for the detection of protein-protein interactions
AT321849T (de) 1997-04-23 2006-04-15 Univ Zuerich Verfahren zur erkennung von nucleinsäuremolekülen codierend für (poly)peptide, welche mit zielmolekülen interagieren
DK1137812T3 (da) 1998-12-02 2007-05-21 Adnexus Therapeutics Inc DNA-proteinfusioner og anvendelser deraf
EP1332209B1 (en) * 2000-09-08 2009-11-11 Universität Zürich Collections of repeat proteins comprising repeat modules
CA2460587A1 (en) * 2001-09-20 2003-03-27 Alexion Pharmaceuticals, Inc. Anti-pdgf antibodies and methods for producing engineered antibodies
NZ617083A (en) * 2003-08-27 2015-04-24 Ophthotech Corp Combination therapy for the treatment of ocular neovascular disorders
EP1812026A2 (en) * 2004-11-12 2007-08-01 Shering Aktiengesellschaft Recombinant newcastle disease virus
US7875465B2 (en) * 2005-05-31 2011-01-25 Canon Kabushiki Kaisha Target substance capturing molecule
US8846577B2 (en) 2005-07-08 2014-09-30 University Of Zurich Phage display using cotranslational translocation of fusion polypeptides
EP1996937A4 (en) 2006-03-06 2009-04-08 Amunix Inc Genetic packages and uses thereof
SI2369005T1 (sl) 2007-06-21 2013-09-30 Technische Universitet Muenchen Biološko aktivni proteini, ki imajo povečano in vivo in/ali in vitro stabilnost
WO2009068649A2 (en) 2007-11-30 2009-06-04 Glaxo Group Limited Antigen-binding constructs
US20100317599A1 (en) * 2008-02-13 2010-12-16 Alrik Pieter Los Process for the production of a peptide
EP2263088A2 (en) * 2008-03-19 2010-12-22 Institut Pasteur Reagentless fluorescent biosensors comprising a designed ankyrin repeat protein module, rational design methods to create reagentless fluorescent biosensors and methods of their use
US8901076B2 (en) 2008-11-03 2014-12-02 Molecular Partner AG Binding proteins inhibiting the VEGF-A receptor interaction
TW201120210A (en) * 2009-11-05 2011-06-16 Hoffmann La Roche Glycosylated repeat-motif-molecule conjugates
TWI510246B (zh) 2010-04-30 2015-12-01 Molecular Partners Ag Modified binding protein that inhibits VEGF-A receptor interaction
JP6173216B2 (ja) 2010-11-26 2017-08-02 モレキュラー・パートナーズ・アーゲーMolecular Partners Ag Improved capping module for engineered ankyrin repeat proteins
WO2012149439A2 (en) * 2011-04-29 2012-11-01 Janssen Biotech, Inc. Il4/il13 binding repeat proteins and uses

Also Published As

Publication number Publication date
US20150368302A1 (en) 2015-12-24
KR20150023957A (ko) 2015-03-05
EP2867360A1 (en) 2015-05-06
IN2014MN02522A (es) 2015-07-17
ZA201408872B (en) 2016-05-25
EP2867360B1 (en) 2019-05-08
JP2015522576A (ja) 2015-08-06
US20140005125A1 (en) 2014-01-02
BR112014032316A2 (pt) 2017-06-27
HK1209156A1 (en) 2016-03-24
AU2013283296A1 (en) 2015-02-05
CA2877584A1 (en) 2014-01-03
CN104508129A (zh) 2015-04-08
IL236428D0 (en) 2015-02-26
US9163070B2 (en) 2015-10-20
RU2014150224A (ru) 2016-08-20
WO2014001442A1 (en) 2014-01-03
SG11201408196RA (en) 2015-03-30

Similar Documents

Publication Publication Date Title
US9714281B2 (en) Fibronectin based scaffold domain proteins that bind IL-23
US10406212B2 (en) Fibronectin based scaffold domain proteins that bind to myostatin
Peraro et al. Diversity-oriented stapling yields intrinsically cell-penetrant inducers of autophagy
JP2016000731A (ja) 二重特異性egfr/igfir結合分子
JP6041799B2 (ja) TRAILR2-specific multimeric scaffold
US10646542B2 (en) Modified binding proteins inhibiting the VEGF-A receptor interaction
Padrick et al. Physical mechanisms of signal integration by WASP family proteins
George et al. Shared as well as distinct roles of EHD proteins revealed by biochemical and functional comparisons in mammalian cells and C. elegans
Hoschuetzky et al. Beta-catenin mediates the interaction of the cadherin-catenin complex with epidermal growth factor receptor.
Slep et al. Structural determinants for EB1-mediated recruitment of APC and spectraplakins to the microtubule plus end
US9751920B2 (en) Muteins with tear lipocalin having affinity to human c-met receptor tyrosine kinase and methods for obtaining the same
JP6329503B2 (ja) Binding protein that inhibits VEGF-A receptor interaction
Take et al. Identification of nucleolin as a binding protein for midkine (MK) and heparin-binding growth associated molecule (HB-GAM)
JP4907542B2 (ja) 治療、診断およびクロマトグラフィーに使用するためのタンパク質複合体
CN100385002C (zh) 重组融合蛋白的二聚体、三聚体、四聚体或五聚体的二聚物或寡聚物
JP5608368B2 (ja) 涙リポカリンの突然変異タンパク質およびそれを得るための方法
JP2016028604A (ja) Tear lipocalin mutein that binds to IL-4Rα
Hildebrand et al. Paxillin, a tyrosine phosphorylated focal adhesion-associated protein binds to the carboxyl terminal domain of focal adhesion kinase.
Bloom et al. Fibronectin regulates assembly of actin filaments and focal contacts in cultured cells via the heparin-binding site in repeat III13
Ziarek et al. Sulfopeptide probes of the CXCR4/CXCL12 interface reveal oligomer-specific contacts and chemokine allostery
US20130143796A1 (en) Chimeric polypeptides and uses thereof
US6548630B1 (en) Stable macroscopic membranes formed by self-assembly of amphiphilic peptides and uses therefor
WO2015061361A1 (en) Mutated fibroblast growth factor (fgf) 1 and methods of use
JP6501775B2 (ja) 心不全治療用の環状ポリペプチド
RU2625882C2 (ru) Сконструированные белки повторов, которые связываются с сывороточным альбумином