KR20150134322A - Cdh19 및 cd3에 대한 항체 작제물 - Google Patents

Cdh19 및 cd3에 대한 항체 작제물 Download PDF

Info

Publication number
KR20150134322A
KR20150134322A KR1020157022936A KR20157022936A KR20150134322A KR 20150134322 A KR20150134322 A KR 20150134322A KR 1020157022936 A KR1020157022936 A KR 1020157022936A KR 20157022936 A KR20157022936 A KR 20157022936A KR 20150134322 A KR20150134322 A KR 20150134322A
Authority
KR
South Korea
Prior art keywords
seq id
cdr
set out
h3
h1
Prior art date
Application number
KR1020157022936A
Other languages
English (en)
Inventor
쇼우후아 시아오
정 판
디넬리 위크라마싱헤
엠. 숀 제프리스
채드윅 테렌스 킹
브라이언 밍퉁 찬
피터 쿠퍼
랄프 루터부에즈
토비아스 라움
패트릭 호프만
도리스 라우
로만 키셸
브라이언 레몬
홀저 베쉐
Original Assignee
암젠 리서치 (뮌헨) 게엠베하
암젠 인크
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US201361756991P priority Critical
Priority to US61/756,991 priority
Priority to US201361785147P priority
Priority to US61/785,147 priority
Application filed by 암젠 리서치 (뮌헨) 게엠베하, 암젠 인크 filed Critical 암젠 리서치 (뮌헨) 게엠베하
Priority to PCT/EP2014/051550 priority patent/WO2014114800A1/en
Publication of KR20150134322A publication Critical patent/KR20150134322A/ko

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • A61K47/48215
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3053Skin, nerves, brain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/468Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/626Diabody or triabody
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77Internalization into the cell
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Abstract

본 발명은 표적 세포의 표면 상의 인간 CDH19에 결합할 수 있는 제1 인간 결합 도메인 및 T 세포의 표면 상의 인간 CD3에 결합할 수 있는 제2 도메인을 포함하는 항체 작제물을 제공한다. 더욱이, 본 발명은 상기 항체 작제물을 코딩하는 핵산 서열, 상기 핵산 서열을 포함하는 벡터, 및 상기 벡터로 형질전환 또는 형질감염된 숙주 세포에 관한 것이다. 추가로, 본 발명은 본 발명의 항체 작제물의 생성 방법, 상기 항체 작제물의 의학적 용도, 및 상기 항체 작제물을 포함하는 키트에 관한 것이다.

Description

CDH19 및 CD3에 대한 항체 작제물 {ANTIBODY CONSTRUCTS FOR CDH19 AND CD3}

관련 출원

본 출원은 본 출원과 동일자로 출원된 2013년 3월 15일자로 출원된 "흑색종을 위한 CDH19를 표적화하는 항체"란 명칭의 미국 가출원에 관한 것이다. 이 관련 출원은 이의 전체가 참조로서 도입된다.

본 발명의 분야

본 발명은 표적 세포의 표면 상의 인간 CDH19에 결합할 수 있는 제1 인간 결합 도메인 및 T 세포의 표면 상의 인간 CD3에 결합할 수 있는 제2 도메인을 포함하는 항체 작제물을 제공한다. 더욱이, 본 발명은 상기 항체 작제물을 코딩하는 핵산 서열, 상기 핵산 서열을 포함하는 벡터, 및 상기 벡터로 형질전환 또는 형질감염된 숙주 세포에 관한 것이다. 추가로, 본 발명은 본 발명의 항체 작제물의 생성 방법, 상기 항체 작제물의 의학적 용도, 및 상기 항체 작제물을 포함하는 키트에 관한 것이다.

흑색종은 피부 색소 생성 세포인 멜라닌세포의 발암성 형질전환에 의해 유발되는 피부 암이다. 2009년 이래, 흑색종은 미국에서만 870,000 사례 이상의 유병률을 갖고 있었다(미국 국립 보건연구소). 매년, 흑색종의 75,000 초과의 새로운 사례가 미국에서 진단되고, 환자의 대략 25%가 진단시에 질환으로 진행되어 왔다. 원발성 흑색종의 사례는, 이들이 충분히 조기에 검출되는 경우, 수술에 의해 치유될 수 있다는 사실에도 불구하고, 흑색종은 미국에서 연간 약 10,000명의 사망에 관련되는 것으로서, 미국 내의 피부 질환에 의한 주요 사망 원인이다. 질환이 확산되고 전이성으로 되는 경우, 예후는 5년간 15%의 상대 생존률로 불량한다.

흑색종에는 4개 기본형이 있다. 3개 유형은 피부의 최상층에서 발견되고, 4번째 유형은 침습성이고 피부 내로 보다 깊숙히 침투하며 신체의 다른 영역으로 확산될 수 있다.

표재 확산 흑색종은 모든 사례의 약 70%를 점유하는 흑색종의 가장 일반적 유형이다. 이는 보다 깊숙히 침투하기 전에 상당히 긴 시간 동안 피부의 최상층을 따라 성장한다. 이는 먼저 불규칙 경계를 갖고 형태가 다소 비대칭적일 수 있는 평탄하거나 약간 융기한 변색 패치로서 나타난다. 색상은 변화하고, 황갈색, 갈색, 흑색, 적색, 청색 또는 백색의 영역을 나타낼 수 있다. 이러한 유형의 흑색종은 이전에 양성 점에서 발생할 수 있고, 청소년에서 가장 빈번하게 발견되고 있다.

악성 흑자는, 이것이 매우 짧은 시간 동안 피부 표면에 근접하여 존재하고 통상은 평탄하거나 약간 상승된 반점 황갈색, 갈색 또는 담갈색 변색으로 나타나기 때문에, 표재 확산성 유형과 유사하다. 이는 고령자 중에서 가장 빈번하게 발견되고 있다. 이러한 암이 침습성으로 되는 경우에는 악성 흑자 흑색종으로 지칭된다.

말단성 흑자성 흑색종은 또한 보다 깊숙히 침투하기 전에 표면적으로 확산한다. 이는 통상 손톱 아래에서 또는 발가락 또는 손바닥 위에서 흑색 또는 갈색 변색으로 나타나기 때문에, 이는 다른 것과는 전혀 상이하다. 이러한 유형의 흑색종은 종종 흑색 피부의 사람에서 발견되고, 종종 표재 확산성 흑색종 및 악성 흑자보다도 더욱 신속하게 진행할 수 있다.

결절성 흑색종은 최초로 진단되는 시간에서 통상 침습성이다. 악성종양은 범프로 될 때에 인식된다. 이는 통상 흑색이지만, 경우에 따라 청색, 회색, 백색, 갈색, 황갈색, 적색 또는 피부색이다. 이는 가장 침습성의 흑색종이고, 10 내지 15%의 사례에서 발견된다.

전이성 흑색종에 대한 일반적 치료는 화학요법, 적격 환자를 위한 표적 요법(예: BRAF 돌연변이를 갖는 환자에 대한 BRAF 억제제 치료) 및 면역요법을 포함한다. 전이성 흑색종은, 면역요법이 질환 진행을 지연시킬 뿐만 아니라 후기 환자에서 치유를 유도하는 것으로 입증된 종양 유형이다. 인터류킨-2는 1998년 전이성 흑색종에서 사용이 승인되었고, 2011년에, 새로운 세대의 면역 체크포인트 억제제의 구성원인 CLTA4가 FAD에 의한 승인을 획득했다.

CDH19는 미지 기능의 유형 II 캐드헤린 막관통 단백질이다. 인간 유전자는 CDH7에 대한 이의 서열 유사성에 기초하여 2000년에 클로닝되었다[참조: Kools, P. et al. Genomics. 2000]. CDH19에 대한 발현된 서열 태그(ESTs)는 멜라닌세포 cDNA 라이브러리로부터 분리되었고, 이는 CDH19의 발현이 신경능 기원의 세포로 한정될 수 있음을 나타낸다[참조: Kools, P. et al. Genomics. 2000]. 이러한 개념의 지지로서, 랫트 CDH19는 랫트 배아 발생 동안 신경절 및 슈완 세포에서 주로 발현되는 것으로 밝혀졌다[참조: Takahashi, M. and Osumi, O. Devl Dynamics. 2005].

웨스턴 블롯, 면역조직화학 또는 유동 세포분석에서 CDH19를 검출하는 진단 항체는 당해 기술분야에 공지되어 있고, 시판되고 있다. 이들 항체는 동물 숙주에서 생성된 폴리클로날 및 모노클로날 항체를 포함한다.

본 발명은 표적 세포의 표면 상의 인간 CDH19에 결합할 수 있는 제1 인간 결합 도메인 및 T 세포의 표면 상의 인간 CD3에 결합할 수 있는 제2 도메인을 포함하는 분리된 다중특이적 항체 작제물을 제공한다.

본 발명의 항체 작제물의 한 가지 실시형태에서, 제1 결합 도메인은

(a) 서열번호 52에 제시된 CDR-H1, 서열번호 53에 제시된 CDR-H2, 서열번호 54에 제시된 CDR-H3, 서열번호 220에 제시된 CDR-L1, 서열번호 221에 제시된 CDR-L2 및 서열번호 22에 제시된 CDR-L3,

서열번호 82에 제시된 CDR-H1, 서열번호 83에 제시된 CDR-H2, 서열번호 84에 제시된 CDR-H3, 서열번호 250에 제시된 CDR-L1, 서열번호 251에 제시된 CDR-L2 및 서열번호 252에 제시된 CDR-L3,

서열번호 82에 제시된 CDR-H1, 서열번호 83에 제시된 CDR-H2, 서열번호 84에 제시된 CDR-H3, 서열번호 250에 제시된 CDR-L1, 서열번호 251에 제시된 CDR-L2 및 서열번호 927에 제시된 CDR-L3,

서열번호 82에 제시된 CDR-H1, 서열번호 83에 제시된 CDR-H2, 서열번호 909에 제시된 CDR-H3, 서열번호 250에 제시된 CDR-L1, 서열번호 251에 제시된 CDR-L2 및 서열번호 927에 제시된 CDR-L3,

서열번호 52에 제시된 CDR-H1, 서열번호 53에 제시된 CDR-H2, 서열번호 54에 제시된 CDR-H3, 서열번호 220에 제시된 CDR-L1, 서열번호 221에 제시된 CDR-L2 및 서열번호 926에 제시된 CDR-L3,

서열번호 52에 제시된 CDR-H1, 서열번호 53에 제시된 CDR-H2, 서열번호 904에 제시된 CDR-H3, 서열번호 220에 제시된 CDR-L1, 서열번호 221에 제시된 CDR-L2 및 서열번호 926에 제시된 CDR-L3,

서열번호 1126에 제시된 CDR-H1, 서열번호 1127에 제시된 CDR-H2, 서열번호 1128에 제시된 CDR-H3, 서열번호 1129에 제시된 CDR-L1, 서열번호 1130에 제시된 CDR-L2 및 서열번호 1131에 제시된 CDR-L3,

서열번호 1165에 제시된 CDR-H1, 서열번호 1166에 제시된 CDR-H2, 서열번호 1167에 제시된 CDR-H3, 서열번호 1168에 제시된 CDR-L1, 서열번호 1169에 제시된 CDR-L2 및 서열번호 1170에 제시된 CDR-L3,

서열번호 1334에 제시된 CDR-H1, 서열번호 1335에 제시된 CDR-H2, 서열번호 1336에 제시된 CDR-H3, 서열번호 1337에 제시된 CDR-L1, 서열번호 1338에 제시된 CDR-L2 및 서열번호 1339에 제시된 CDR-L3,

서열번호 1347에 제시된 CDR-H1, 서열번호 1348에 제시된 CDR-H2, 서열번호 1349에 제시된 CDR-H3, 서열번호 1350에 제시된 CDR-L1, 서열번호 1351에 제시된 CDR-L2 및 서열번호 1352에 제시된 CDR-L3,

서열번호 1360에 제시된 CDR-H1, 서열번호 1361에 제시된 CDR-H2, 서열번호 1362에 제시된 CDR-H3, 서열번호 1363에 제시된 CDR-L1, 서열번호 1364에 제시된 CDR-L2 및 서열번호 1365에 제시된 CDR-L3,

서열번호 1425에 제시된 CDR-H1, 서열번호 1426에 제시된 CDR-H2, 서열번호 1427에 제시된 CDR-H3, 서열번호 1428에 제시된 CDR-L1, 서열번호 1429에 제시된 CDR-L2 및 서열번호 1430에 제시된 CDR-L3,

서열번호 1438에 제시된 CDR-H1, 서열번호 1439에 제시된 CDR-H2, 서열번호 1440에 제시된 CDR-H3, 서열번호 1441에 제시된 CDR-L1, 서열번호 1442에 제시된 CDR-L2 및 서열번호 1443에 제시된 CDR-L3,

서열번호 2167에 제시된 CDR-H1, 서열번호 2168에 제시된 CDR-H2, 서열번호 2169에 제시된 CDR-H3, 서열번호 2170에 제시된 CDR-L1, 서열번호 2171에 제시된 CDR-L2 및 서열번호 2172에 제시된 CDR-L3;

(b) 서열번호 124에 제시된 CDR-H1, 서열번호 125에 제시된 CDR-H2, 서열번호 126에 제시된 CDR-H3, 서열번호 292에 제시된 CDR-L1, 서열번호 293에 제시된 CDR-L2 및 서열번호 294에 제시된 CDR-L3,

서열번호 130에 제시된 CDR-H1, 서열번호 131에 제시된 CDR-H2, 서열번호 132에 제시된 CDR-H3, 서열번호 298에 제시된 CDR-L1, 서열번호 299에 제시된 CDR-L2 및 서열번호 300에 제시된 CDR-L3,

서열번호 136에 제시된 CDR-H1, 서열번호 137에 제시된 CDR-H2, 서열번호 138에 제시된 CDR-H3, 서열번호 304에 제시된 CDR-L1, 서열번호 305에 제시된 CDR-L2 및 서열번호 306에 제시된 CDR-L3,

서열번호 142에 제시된 CDR-H1, 서열번호 143에 제시된 CDR-H2, 서열번호 144에 제시된 CDR-H3, 서열번호 310에 제시된 CDR-L1, 서열번호 311에 제시된 CDR-L2 및 서열번호 312에 제시된 CDR-L3,

서열번호 148에 제시된 CDR-H1, 서열번호 149에 제시된 CDR-H2, 서열번호 150에 제시된 CDR-H3, 서열번호 316에 제시된 CDR-L1, 서열번호 317에 제시된 CDR-L2 및 서열번호 318에 제시된 CDR-L3,

서열번호 166에 제시된 CHR-H1, 서열번호 167에 제시된 CDR-H2, 서열번호 168에 제시된 CDR-H3, 서열번호 334에 제시된 CDR-L1, 서열번호 335에 제시된 CDR-L2 및 서열번호 336에 제시된 CDR-L3,

서열번호 124에 제시된 CDR-H1, 서열번호 125에 제시된 CDR-H2, 서열번호 915에 제시된 CDR-H3, 서열번호 292에 제시된 CDR-L1, 서열번호 293에 제시된 CDR-L2 및 서열번호 294에 제시된 CDR-L3,

서열번호 124에 제시된 CDR-H1, 서열번호 125에 제시된 CDR-H2, 서열번호 915에 제시된 CDR-H3, 서열번호 292에 제시된 CDR-L1, 서열번호 293에 제시된 CDR-L2 및 서열번호 928에 제시된 CDR-L3,

서열번호 124에 제시된 CDR-H1, 서열번호 125에 제시된 CDR-H2, 서열번호 915에 제시된 CDR-H3, 서열번호 292에 제시된 CDR-L1, 서열번호 293에 제시된 CDR-L2 및 서열번호 929에 제시된 CDR-L3,

서열번호 166에 제시된 CDR-H1, 서열번호 167에 제시된 CDR-H2, 서열번호 168에 제시된 CDR-H3, 서열번호 334에 제시된 CDR-L1, 서열번호 335에 제시된 CDR-L2 및 서열번호 336에 제시된 CDR-L3,

서열번호 166에 제시된 CDR-H1, 서열번호 167에 제시된 CDR-H2, 서열번호 168에 제시된 CDR-H3, 서열번호 334에 제시된 CDR-L1, 서열번호 335에 제시된 CDR-L2 및 서열번호 942에 제시된 CDR-L3,

서열번호 166에 제시된 CDR-H1, 서열번호 167에 제시된 CDR-H2, 서열번호 168에 제시된 CDR-H3, 서여번호 334에 제시된 CDR-L1, 서열번호 335에 제시된 CDR-L2 및 서열번호 943에 제시된 CDR-L3,

서열번호 148에 제시된 CDR-H1, 서열번호 149에 제시된 CDR-H2, 서열번호 150에 제시된 CDR-H3, 서열번호 316에 제시된 CDR-L1, 서열번호 317에 제시된 CDR-L2 및 서열번호 318에 제시된 CDR-L3,

서열번호 148에 제시된 CDR-H1, 서열번호 149에 제시된 CDR-H2, 서열번호 150에 제시된 CDR-H3, 서열번호 316에 제시된 CDR-L1, 서열번호 317에 제시된 CDR-L2 및 서열번호 937에 제시된 CDR-L3,

서열번호 148에 제시된 CDR-H1, 서열번호 149에 제시된 CDR-H2, 서열번호 150에 제시된 CDR-H3, 서열번호 316에 제시된 CDR-L1, 서열번호 317에 제시된 CDR-L2 및 서열번호 938에 제시된 CDR-L3,

서열번호 148에 제시된 CDR-H1, 서열번호 149에 제시된 CDR-H2, 서열번호 919에 제시된 CDR-H3, 서열번호 316에 제시된 CDR-L1, 서열번호 317에 제시된 CDR-L2 및 서열번호 938에 제시된 CDR-L3,

서열번호 142에 제시된 CDR-H1, 서열번호 143에 제시된 CDR-H2, 서열번호 144에 제시된 CDR-H3, 서열번호 310에 제시된 CDR-L1, 서열번호 311에 제시된 CDR-L2 및 서열번호 935에 제시된 CDR-L3,

서열번호 142에 제시된 CDR-H1, 서열번호 143에 제시된 CDR-H2, 서열번호 918에 제시된 CDR-H3, 서열번호 310에 제시된 CDR-L1, 서열번호 311에 제시된 CDR-L2 및 서열번호 935에 제시된 CDR-L3,

서열번호 142에 제시된 CDR-H1, 서열번호 143에 제시된 CDR-H2, 서열번호 918에 제시된 CDR-H3, 서열번호 310에 제시된 CDR-L1, 서열번호 311에 제시된 CDR-L2 및 서열번호 936에 제시된 CDR-L3,

서열번호 136에 제시된 CDR-H1, 서열번호 137에 제시된 CDR-H2, 서열번호 138에 제시된 CDR-H3, 서열번호 304에 제시된 CDR-L1, 서열번호 305에 제시된 CDR-L2 및 서열번호 933에 제시된 CDR-L3,

서열번호 136에 제시된 CDR-H1, 서열번호 137에 제시된 CDR-H2, 서열번호 917에 제시된 CDR-H3, 서열번호 304에 제시된 CDR-L1, 서열번호 305에 제시된 CDR-L2 및 서열번호 934에 제시된 CDR-L3,

서열번호 130에 제시된 CDR-H1, 서열번호 131에 제시된 CDR-H2, 서열번호 132에 제시된 CDR-H3, 서열번호 298에 제시된 CDR-L1, 서열번호 299에 제시된 CDR-L2 및 서열번호 930에 제시된 CDR-L3,

서열번호 130에 제시된 CDR-H1, 서열번호 131에 제시된 CDR-H2, 서열번호 916에 제시된 CDR-H3, 서열번호 298에 제시된 CDR-L1, 서열번호 299에 제시된 CDR-L2 및 서열번호 931에 제시된 CDR-L3,

서열번호 130에 제시된 CDR-H1, 서열번호 131에 제시된 CDR-H2, 서열번호 916에 제시된 CDR-H3, 서열번호 298에 제시된 CDR-L1, 서열번호 299에 제시된 CDR-L2 및 서열번호 932에 제시된 CDR-L3,

서열번호 1009에 제시된 CDR-H1, 서열번호 1010에 제시된 CDR-H2, 서열번호 1011에 제시된 CDR-H3, 서열번호 1012에 제시된 CDR-L1, 서열번호 1013에 제시된 CDR-L2 및 서열번호 1014에 제시된 CDR-L3,

서열번호 1022에 제시된 CDR-H1, 서열번호 1023에 제시된 CDR-H2, 서열번호 1024에 제시된 CDR-H3, 서열번호 1025에 제시된 CDR-L1, 서열번호 1026에 제시된 CDR-L2 및 서열번호 1027에 제시된 CDR-L3,

서열번호 1035에 제시된 CDR-H1, 서열번호 1036에 제시된 CDR-H2, 서열번호 1037에 제시된 CDR-H3, 서열번호 1038에 제시된 CDR-L1, 서열번호 1039에 제시된 CDR-L2 및 서열번호 1040에 제시된 CDR-L3,

서열번호 1074에 제시된 CDR-H1, 서열번호 1075에 제시된 CDR-H2, 서열번호 1076에 제시된 CDR-H3, 서열번호 1077에 제시된 CDR-L1, 서열번호 1078에 제시된 CDR-L2 및 서열번호 1079에 제시된 CDR-L3,

서열번호 1100에 제시된 CDR-H1, 서열번호 1101에 제시된 CDR-H2, 서열번호 1102에 제시된 CDR-H3, 서열번호 1103에 제시된 CDR-L1, 서열번호 1104에 제시된 CDR-L2 및 성열번호 1105에 제시된 CDR-L3,

서열번호 1113에 제시된 CDR-H1, 서열번호 1114에 제시된 CDR-H2, 서열번호 1115에 제시된 CDR-H3, 서열번호 1116에 제시된 CDR-L1, 서열번호 1117에 제시된 CDR-L2 및 서열번호 1118에 제시된 CDR-L3,

서열번호 1243에 제시된 CDR-H1, 서열번호 1244에 제시된 CDR-H2, 서열번호 1245에 제시된 CDR-H3, 서열번호 1246에 제시된 CDR-L1, 서열번호 1247에 제시된 CDR-L2 및 서열번호 1248에 제시된 CDR-L3,

서열번호 1256에 제시된 CDR-H1, 서열번호 1257에 제시된 CDR-H2, 서열번호 1258에 제시된 CDR-H3, 서열번호 1259에 제시된 CDR-L1, 서열번호 1260에 제시된 CDR-L2 및 서열번호 1261에 제시된 CDR-L3,

서열번호 1269에 제시된 CDR-H1, 서열번호 1270에 제시된 CDR-H2, 서열번호 1271에 제시된 CDR-H3, 서열번호 1272에 제시된 CDR-L1, 서열번호 1273에 제시된 CDR-L2 및 서열번호 1274에 제시된 CDR-L3,

서열번호 1282에 제시된 CDR-H1, 서열번호 1283에 제시된 CDR-H2, 서열번호 1284에 제시된 CDR-H3, 서열번호 1285에 제시된 CDR-L1, 서열번호 1286에 제시된 CDR-L2 및 서열번호 1287에 제시된 CDR-L3,

서열번호 1295에 제시된 CDR-H1, 서열번호 1296에 제시된 CDR-H2, 서열번호 1297에 제시된 CDR-H3, 서열번호 1298에 제시된 CDR-L1, 서열번호 1299에 제시된 CDR-L2 및 서열번호 1300에 제시된 CDR-L3,

서열번호 1647에 제시된 CDR-H1, 서열번호 1648에 제시된 CDR-H2, 서열번호 1649에 제시된 CDR-H3, 서열번호 1650에 제시된 CDR-L1, 서열번호 1651에 제시된 CDR-L2 및 서열번호 1652에 제시된 CDR-L3,

서열번호 1660에 제시된 CDR-H1, 서열번호 1661에 제시된 CDR-H2, 서열번호 1662에 제시된 CDR-H3, 서열번호 1663에 제시된 CDR-L1, 서열번호 1664에 제시된 CDR-L2 및 서열번호 1665에 제시된 CDR-L3,

서열번호 1894에 제시된 CDR-H1, 서열번호 1895에 제시된 CDR-H2, 서열번호 1896에 제시된 CDR-H3, 서열번호 1897에 제시된 CDR-L1, 서열번호 1898에 제시된 CDR-L2 및 서열번호 1899에 제시된 CDR-L3,

서열번호 1907에 제시된 CDR-H1, 서열번호 1908에 제시된 CDR-H2, 서열번호 1909에 제시된 CDR-H3, 서열번호 1910에 제시된 CDR-L1, 서열번호 1911에 제시된 CDR-L2, 서열번호 1912에 제시된 CDR-L3,

서열번호 1933에 제시된 CDR-H1, 서열번호 1934에 제시된 CDR-H2, 서열번호 1935에 제시된 CDR-H3, 서열번호 1936에 제시된 CDR-L1, 서열번호 1937에 제시된 CDR-L2 및 서열번호 1938에 제시된 CDR-L3,

서열번호 1946에 제시된 CDR-H1, 서열번호 1947에 제시된 CDR-H2, 서열번호 1948에 제시된 CDR-H3, 서열번호 1949에 제시된 CDR-L1, 서열번호 1950에 제시된 CDR-L2 및 서열번호 1951에 제시된 CDR-L3,

서열번호 1959에 제시된 CDR-H1, 서열번호 1960에 제시된 CDR-H2, 서열번호 1961에 제시된 CDR-H3, 서열번호 1962에 제시된 CDR-L1, 서열번호 1963에 제시된 CDR-L2 및 서열번호 1964에 제시된 CDR-L3,

서열번호 1972에 제시된 CDR-H1, 서열번호 1973에 제시된 CDR-H2, 서열번호 1974에 제시된 CDR-H3, 서열번호 1975에 제시된 CDR-L1, 서열번호 1976에 제시된 CDR-L2 및 서열번호 1977에 제시된 CDR-L3,

서열번호 1985에 제시된 CDR-H1, 서열번호 1986에 제시된 CDR-H2, 서열번호 1987에 제시된 CDR-H3, 서열번호 1988에 제시된 CDR-L1, 서열번호 1989에 제시된 CDR-L2 및 서열번호 1990에 제시된 CDR-L3 ,

서열번호 1998에 제시된 CDR-H1, 서열번호 1999에 제시된 CDR-H2, 서열번호 2000에 제시된 CDR-H3, 서열번호 2001에 제시된 CDR-L1, 서열번호 2002에 제시된 CDR-L2 및 서열번호 2003에 제시된 CDR-L3,

서열번호 2011에 제시된 CDR-H1, 서열번호 2012에 제시된 CDR-H2, 서열번호 2013에 제시된 CDR-H3, 서열번호 2014에 제시된 CDR-L1, 서열번호 2015에 제시된 CDR-L2 및 서열번호 2016에 제시된 CDR-L3,

서열번호 2024에 제시된 CDR-H1, 서열번호 2025에 제시된 CDR-H2, 서열번호 2026에 제시된 CDR-H3, 서열번호 2027에 제시된 CDR-L1, 서열번호 2028에 제시된 CDR-L2 및 서열번호 2029에 제시된 CDR-L3,

서열번호 2037에 제시된 CDR-H1, 서열번호 2038에 제시된 CDR-H2, 서열번호 2039에 제시된 CDR-H3, 서열번호 2040에 제시된 CDR-L1, 서열번호 2041에 제시된 CDR-L2 및 서열번호 2042에 제시된 CDR-L3 및

서열번호 2050에 제시된 CDR-H1, 서열번호 2051에 제시된 CDR-H2, 서열번호 2052에 제시된 CDR-H3, 서열번호 2053에 제시된 CDR-L1, 서열번호 2054에 제시된 CDR-L2 및 서열번호 2055에 제시된 CDR-L3;

(c) 서열번호 94에 제시된 CDR-H1, 서열번호 95에 제시된 CDR-H2, 서열번호 96에 제시된 CDR-H3, 서열번호 262에 제시된 CDR-L1, 서열번호 263에 제시된 CDR-L2 및 서열번호 264에 제시된 CDR-L3,

서열번호 100에 제시된 CDR-H1, 서열번호 101에 제시된 CDR-H2, 서열번호 102에 제시된 CDR-H3, 서열번호 268에 제시된 CDR-L1, 서열번호 269에 제시된 CDR-L2 및 서열번호 270에 제시된 CDR-L3,

서열번호 118에 제시된 CDR-H1, 서열번호 119에 제시된 CDR-H2, 서열번호 120에 제시된 CDR-H3, 서열번호 286에 제시된 CDR-L1, 서열번호 287에 제시된 CDR-L2 및 서열번호 288에 제시된 CDR-L3,

서열번호 154에 제시된 CDR-H1, 서열번호 155에 제시된 CDR-H2, 서열번호 156에 제시된 CDR-H3, 서열번호 322에 제시된 CDR-L1, 서열번호 323에 제시된 CDR-L2 및 서열번호 324에 제시된 CDR-L3,

서열번호 100에 제시된 CDR-H1, 서열번호 101에 제시된 CDR-H2, 서열번호 912에 제시된 CDR-H3, 서열번호 268에 제시된 CDR-L1, 서열번호 269에 제시된 CDR-L2 및 서열번호 270에 제시된 CDR-L3,

서열번호 100에 제시된 CDR-H1, 서열번호 101에 제시된 CDR-H2, 서열번호 913에 제시된 CDR-H3, 서열번호 268에 제시된 CDR-L1, 서열번호 269에 제시된 CDR-L2 및 서열번호 270에 제시된 CDR-L3,

서열번호 94에 제시된 CDR-H1, 서열번호 95에 제시된 CDR-H2, 서열번호 910에 제시된 CDR-H3, 서열번호 262에 제시된 CDR-L1, 서열번호 263에 제시된 CDR-L2 및 서열번호 264에 제시된 CDR-L3,

서열번호 94에 제시된 CDR-H1, 서열번호 95에 제시된 CDR-H2, 서열번호 911에 제시된 CDR-H3, 서열번호 262에 제시된 CDR-L1, 서열번호 263에 제시된 CDR-L2 및 서열번호 264에 제시된 CDR-L3,

서열번호 118에 제시된 CDR-H1, 서열번호 119에 제시된 CDR-H2, 서열번호 120에 제시된 CDR-H3, 서열번호 286에 제시된 CDR-L1, 서열번호 287에 제시된 CDR-L2 및 서열번호 288에 제시된 CDR-L3,

서열번호 118에 제시된 CDR-H1, 서열번호 914에 제시된 CDR-H2, 서열번호 120에 제시된 CDR-H3, 서열번호 286에 제시된 CDR-L1, 서열번호 287에 제시된 CDR-L2 및 서열번호 288에 제시된 CDR-L3,

서열번호 154에 제시된 CDR-H1, 서열번호 155에 제시된 CDR-H2, 서열번호 920에 제시된 CDR-H3, 서열번호 322에 제시된 CDR-L1, 서열번호 323에 제시된 CDR-L2 및 서열번호 324에 제시된 CDR-L3,

서열번호 996에 제시된 CDR-H1, 서열번호 997에 제시된 CDR-H2, 서열번호 998에 제시된 CDR-H3, 서열번호 999에 제시된 CDR-L1, 서열번호 1000에 제시된 CDR-L2 및 서열번호 1001에 제시된 CDR-L3,

서열번호 1048에 제시된 CDR-H1, 서열번호 1049에 제시된 CDR-H2, 서열번호 1050에 제시된 CDR-H3, 서열번호 1051에 제시된 CDR-L1, 서열번호 1052에 제시된 CDR-L2 및 서열번호 1053에 제시된 CDR-L3,

서열번호 1087에 제시된 CDR-H1, 서열번호 1088에 제시된 CDR-H2, 서열번호 1089에 제시된 CDR-H3, 서열번호 1090에 제시된 CDR-L1, 서열번호 1091에 제시된 CDR-L2 및 서열번호 1092에 제시된 CDR-L3,

서열번호 1608에 제시된 CDR-H1, 서열번호 1609에 제시된 CDR-H2, 서열번호 1610에 제시된 CDR-H3, 서열번호 1611에 제시된 CDR-L1, 서열번호 1612에 제시된 CDR-L2 및 서열번호 1613에 제시된 CDR-L3,

서열번호 1621에 제시된 CDR-H1, 서열번호 1622에 제시된 CDR-H2, 서열번호 1623에 제시된 CDR-H3, 서열번호 1624에 제시된 CDR-L1, 서열번호 1625에 제시된 CDR-L2 및 서열번호 1626에 제시된 CDR-L3,

서열번호 1634에 제시된 CDR-H1, 서열번호 1635에 제시된 CDR-H2, 서열번호 1636에 제시된 CDR-H3, 서열번호 1637에 제시된 CDR-L1, 서열번호 1638에 제시된 CDR-L2 및 서열번호 1639에 제시된 CDR-L3,

서열번호 1673에 제시된 CDR-H1, 서열번호 1674에 제시된 CDR-H2, 서열번호 1675에 제시된 CDR-H3, 서열번호 1676에 제시된 CDR-L1, 서열번호 1677에 제시된 CDR-L2 및 서열번호 1678에 제시된 CDR-L3,

서열번호 1686에 제시된 CDR-H1, 서열번호 1687에 제시된 CDR-H2, 서열번호 1688에 제시된 CDR-H3, 서열번호 1689에 제시된 CDR-L1, 서열번호 1690에 제시된 CDR-L2 및 서열번호 1691에 제시된 CDR-L3,

서열번호 1699에 제시된 CDR-H1, 서열번호 1700에 제시된 CDR-H2, 서열번호 1701에 제시된 CDR-H3, 서열번호 1702에 제시된 CDR-L1, 서열번호 1703에 제시된 CDR-L2 및 서열번호 1704에 제시된 CDR-L3,

서열번호 1712에 제시된 CDR-H1, 서열번호 1713에 제시된 CDR-H2, 서열번호 1714에 제시된 CDR-H3, 서열번호 1715에 제시된 CDR-L1, 서열번호 1716에 제시된 CDR-L2 및 서열번호 1717에 제시된 CDR-L3,

서열번호 1725에 제시된 CDR-H1, 서열번호 1726에 제시된 CDR-H2, 서열번호 1727에 제시된 CDR-H3, 서열번호 1728에 제시된 CDR-L1, 서열번호 1729에 제시된 CDR-L2 및 서열번호 1730에 제시된 CDR-L3,

서열번호 1738에 제시된 CDR-H1, 서열번호 1739에 제시된 CDR-H2, 서열번호 1740에 제시된 CDR-H3, 서열번호 1741에 제시된 CDR-L1, 서열번호 1742에 제시된 CDR-L2 및 서열번호 1743에 제시된 CDR-L3,

서열번호 1751에 제시된 CDR-H1, 서열번호 1752에 제시된 CDR-H2, 서열번호 1753에 제시된 CDR-H3, 서열번호 1754에 제시된 CDR-L1, 서열번호 1755에 제시된 CDR-L2 및 서열번호 1756에 제시된 CDR-L3,

서열번호 1764에 제시된 CDR-H1, 서열번호 1765에 제시된 CDR-H2, 서열번호 1766에 제시된 CDR-H3, 서열번호 1767에 제시된 CDR-L1, 서열번호 1768에 제시된 CDR-L2 및 서열번호 1769에 제시된 CDR-L3 및

서열번호 1920에 제시된 CDR-H1, 서열번호 1921에 제시된 CDR-H2, 서열번호 1922에 제시된 CDR-H3, 서열번호 1923에 제시된 CDR-L1, 서열번호 1924에 제시된 CDR-L2 및 서열번호 1925에 제시된 CDR-L3;

(d) 서열번호 4에 제시된 CDR-H1, 서열번호 5에 제시된 CDR-H2, 서열번호 6에 제시된 CDR-H3, 서열번호 172에 제시된 CDR-L1, 서열번호 173에 제시된 CDR-L2 및 서열번호 174에 제시된 CDR-L3,

서열번호 10에 제시된 CDR-H1, 서열번호 11에 제시된 CDR-H2, 서열번호 12에 제시된 CDR-H3, 서열번호 178에 제시된 CDR-L1, 서열번호 179에 제시된 CDR-L2 및 서열번호 180에 제시된 CDR-L3,

서열번호 28에 제시된 CDR-H1, 서열번호 29에 제시된 CDR-H2, 서열번호 30에 제시된 CDR-H3, 서열번호 196에 제시된 CDR-L1, 서열번호 197에 제시된 CDR-L2 및 서열번호 198에 제시된 CDR-L3,

서열번호 34에 제시된 CDR-H1, 서열번호 35에 제시된 CDR-H2, 서열번호 36에 제시된 CDR-H3, 서열번호 202에 제시된 CDR-L1, 서열번호 203에 제시된 CDR-L2 및 서열번호 204에 제시된 CDR-L3,

서열번호 46에 제시된 CDR-H1, 서열번호 47에 제시된 CDR-H2, 서열번호 48에 제시된 CDR-H3, 서열번호 214에 제시된 CDR-L1, 서열번호 215에 제시된 CDR-L2 및 서열번호 216에 제시된 CDR-L3,

서열번호 58에 제시된 CDR-H1, 서열번호 59에 제시된 CDR-H2, 서열번호 60에 제시된 CDR-H3, 서열번호 226에 제시된 CDR-L1, 서열번호 227에 제시된 CDR-L2 및 서열번호 228에 제시된 CDR-L3,

서열번호 64에 제시된 CDR-H1, 서열번호 65에 제시된 CDR-H2, 서열번호 66에 제시된 CDR-H3, 서열번호 232에 제시된 CDR-L1, 서열번호 233에 제시된 CDR-L2 및 서열번호 234에 제시된 CDR-L3,

서열번호 70에 제시된 CDR-H1, 서열번호 71에 제시된 CDR-H2, 서열번호 72에 제시된 CDR-H3, 서열번호 238에 제시된 CDR-L1, 서열번호 239에 제시된 CDR-L2 및 서열번호 240에 제시된 CDR-L3,

서열번호 160에 제시된 CDR-H1, 서열번호 161에 제시된 CDR-H2, 서열번호 162에 제시된 CDR-H3, 서열번호 328에 제시된 CDR-L1, 서열번호 329에 제시된 CDR-L2 및 서열번호 330에 제시된 CDR-L3,

서열번호 46에 제시된 CDR-H1, 서열번호 47에 제시된 CDR-H2, 서열번호 48에 제시된 CDR-H3, 서열번호 924에 제시된 CDR-L1, 서열번호 215에 제시된 CDR-L2 및 서열번호 216에 제시된 CDR-L3,

서열번호 46에 제시된 CDR-H1, 서열번호 47에 제시된 CDR-H2, 서열번호 902에 제시된 CDR-H3, 서열번호 924에 제시된 CDR-L1, 서열번호 215에 제시된 CDR-L2 및 서열번호 216에 제시된 CDR-L3,

서열번호 46에 제시된 CDR-H1, 서열번호 47에 제시된 CDR-H2, 서열번호 903에 제시된 CDR-H3, 서열번호 924에 제시된 CDR-L1, 서열번호 215에 제시된 CDR-L2 및 서열번호 216에 제시된 CDR-L3,

서열번호 46에 제시된 CDR-H1, 서열번호 47에 제시된 CDR-H2, 서열번호 48에 제시된 CDR-H3, 서열번호 925에 제시된 CDR-L1, 서열번호 215에 제시된 CDR-L2 및 서열번호 216에 제시된 CDR-L3,

서열번호 70에 제시된 CDR-H1, 서열번호 907에 제시된 CDR-H2, 서열번호 72에 제시된 CDR-H3, 서열번호 238에 제시된 CDR-L1, 서열번호 239에 제시된 CDR-L2 및 서열번호 240에 제시된 CDR-L3,

서열번호 70에 제시된 CDR-H1, 서열번호 907에 제시된 CDR-H2, 서열번호 908에 제시된 CDR-H3, 서열번호 238에 제시된 CDR-L1, 서열번호 239에 제시된 CDR-L2 및 서열번호 240에 제시된 CDR-L3,

서열번호 28에 제시된 CDR-H1, 서열번호 901에 제시된 CDR-H2, 서열번호 30에 제시된 CDR-H3, 서열번호 922에 제시된 CDR-L1, 서열번호 197에 제시된 CDR-L2 및 서열번호 923에 제시된 CDR-L3,

서열번호 58에 제시된 CDR-H1, 서열번호 905에 제시된 CDR-H2, 서열번호 906에 제시된 CDR-H3, 서열번호 226에 제시된 CDR-L1, 서열번호 227에 제시된 CDR-L2 및 서열번호 228에 제시된 CDR-L3,

서열번호 58에 제시된 CDR-H1, 서열번호 905에 제시된 CDR-H2, 서열번호 60에 제시된 CDR-H3, 서열번호 226에 제시된 CDR-L1, 서열번호 227에 제시된 CDR-L2 및 서열번호 228에 제시된 CDR-L3,

서열번호 160에 제시된 CDR-H1, 서열번호 161에 제시된 CDR-H2, 서열번호 162에 제시된 CDR-H3, 서열번호 939에 제시된 CDR-L1, 서열번호 329에 제시된 CDR-L2 및 서열번호 330에 제시된 CDR-L3,

서열번호 160에 제시된 CDR-H1, 서열번호 921에 제시된 CDR-H2, 서열번호 162에 제시된 CDR-H3, 서열번호 939에 제시된 CDR-L1, 서열번호 329에 제시된 CDR-L2 및 서열번호 940에 제시된 CDR-L3,

서열번호 160에 제시된 CDR-H1, 서열번호 161에 제시된 CDR-H2, 서열번호 162에 제시된 CDR-H3, 서열번호 941에 제시된 CDR-L1, 서열번호 329에 제시된 CDR-L2 및 서열번호 330에 제시된 CDR-L3,

서열번호 28에 제시된 CDR-H1, 서열번호 29에 제시된 CDR-H2, 서열번호 30에 제시된 CDR-H3, 서열번호 196에 제시된 CDR-L1, 서열번호 197에 제시된 CDR-L2 및 서열번호 923에 제시된 CDR-L3,

서열번호 28에 제시된 CDR-H1, 서열번호 29에 제시된 CDR-H2, 서열번호 30에 제시된 CDR-H3, 서열번호 922에 제시된 CDR-L1, 서열번호 197에 제시된 CDR-L2 및 서열번호 923에 제시된 CDR-L3,

서열번호 28에 제시된 CDR-H1, 서열번호 901에 제시된 CDR-H2, 서열번호 30에 제시된 CDR-H3, 서열번호 922에 제시된 CDR-L1, 서열번호 197에 제시된 CDR-L2 및 서열번호 923에 제시된 CDR-L3,

서열번호 28에 제시된 CDR-H1, 서열번호 29에 제시된 CDR-H2, 서열번호 30에 제시된 CDR-H3, 서열번호 939에 제시된 CDR-L1, 서열번호 329에 제시된 CDR-L2 및 서열번호 330에 제시된 CDR-L3,

서열번호 970에 제시된 CDR-H1, 서열번호 971에 제시된 CDR-H2, 서열번호 972에 제시된 CDR-H3, 서열번호 973에 제시된 CDR-L1, 서열번호 974에 제시된 CDR-L2 및 서열번호 975에 제시된 CDR-L3,

서열번호 1061에 제시된 CDR-H1, 서열번호 1062에 제시된 CDR-H2, 서열번호 1063에 제시된 CDR-H3, 서열번호 1064에 제시된 CDR-L1, 서열번호 1065에 제시된 CDR-L2 및 서열번호 1066에 제시된 CDR-L3,

서열번호 1139에 제시된 CDR-H1, 서열번호 1140에 제시된 CDR-H2, 서열번호 1141에 제시된 CDR-H3, 서열번호 1142에 제시된 CDR-L1, 서열번호 1143에 제시된 CDR-L2 및 서열번호 1144에 제시된 CDR-L3,

서열번호 1152에 제시된 CDR-H1, 서열번호 1153에 제시된 CDR-H2, 서열번호 1154에 제시된 CDR-H3, 서열번호 1155에 제시된 CDR-L1, 서열번호 1156에 제시된 CDR-L2 및 서열번호 1157에 제시된 CDR-L3,

서열번호 1178에 제시된 CDR-H1, 서열번호 1179에 제시된 CDR-H2, 서열번호 1180에 제시된 CDR-H3, 서열번호 1181에 제시된 CDR-L1, 서열번호 1182에 제시된 CDR-L2 및 서열번호 1183에 제시된 CDR-L3,

서열번호 1191에 제시된 CDR-H1, 서열번호 1192에 제시된 CDR-H2, 서열번호 1193에 제시된 CDR-H3, 서열번호 1194에 제시된 CDR-L1, 서열번호 1195에 제시된 CDR-L2 및 서열번호 1196에 제시된 CDR-L3,

서열번호 1204에 제시된 CDR-H1, 서열번호 1205에 제시된 CDR-H2, 서열번호 1206에 제시된 CDR-H3, 서열번호 1207에 제시된 CDR-L1, 서열번호 1208에 제시된 CDR-L2 및 서열번호 1209에 제시된 CDR-L3,

서열번호 1217에 제시된 CDR-H1, 서열번호 1218에 제시된 CDR-H2, 서열번호 1219에 제시된 CDR-H3, 서열번호 1220에 제시된 CDR-L1, 서열번호 1221에 제시된 CDR-L2 및 서열번호 1222에 제시된 CDR-L3,

서열번호 1230에 제시된 CDR-H1, 서열번호 1231에 제시된 CDR-H2, 서열번호 1232에 제시된 CDR-H3, 서열번호 1233에 제시된 CDR-L1, 서열번호 1234에 제시된 CDR-L2 및 서열번호 1235에 제시된 CDR-L3,

서열번호 1308에 제시된 CDR-H1, 서열번호 1309에 제시된 CDR-H2, 서열번호 1310에 제시된 CDR-H3, 서열번호 1311에 제시된 CDR-L1, 서열번호 1312에 제시된 CDR-L2 및 서열번호 1313에 제시된 CDR-L3,

서열번호 1321에 제시된 CDR-H1, 서열번호 1322에 제시된 CDR-H2, 서열번호 1323에 제시된 CDR-H3, 서열번호 1324에 제시된 CDR-L1, 서열번호 1325에 제시된 CDR-L2 및 서열번호 1326에 제시된 CDR-L3,

서열번호 1373에 제시된 CDR-H1, 서열번호 1374에 제시된 CDR-H2, 서열번호 1375에 제시된 CDR-H3, 서열번호 1376에 제시된 CDR-L1, 서열번호 1377에 제시된 CDR-L2 및 서열번호 1378에 제시된 CDR-L3,

서열번호 1386에 제시된 CDR-H1, 서열번호 1387에 제시된 CDR-H2, 서열번호 1388에 제시된 CDR-H3, 서열번호 1389에 제시된 CDR-L1, 서열번호 1390에 제시된 CDR-L2 및 서열번호 1391에 제시된 CDR-L3,

서열번호 1399에 제시된 CDR-H1, 서열번호 1400에 제시된 CDR-H2, 서열번호 1401에 제시된 CDR-H3, 서열번호 1402에 제시된 CDR-L1, 서열번호 1403에 제시된 CDR-L2 및 서열번호 1404에 제시된 CDR-L3,

서열번호 1412에 제시된 CDR-H1, 서열번호 1413에 제시된 CDR-H2, 서열번호 1414에 제시된 CDR-H3, 서열번호 1415에 제시된 CDR-L1, 서열번호 1416에 제시된 CDR-L2 및 서열번호 1417에 제시된 CDR-L3,

서열번호 1777에 제시된 CDR-H1, 서열번호 1778에 제시된 CDR-H2, 서열번호 1779에 제시된 CDR-H3, 서열번호 1780에 제시된 CDR-L1, 서열번호 1781에 제시된 CDR-L2 및 서열번호 1782에 제시된 CDR-L3,

서열번호 1790에 제시된 CDR-H1, 서열번호 1791에 제시된 CDR-H2, 서열번호 1792에 제시된 CDR-H3, 서열번호 1793에 제시된 CDR-L1, 서열번호 1794에 제시된 CDR-L2 및 서열번호 1795에 제시된 CDR-L3,

서열번호 1803에 제시된 CDR-H1, 서열번호 1804에 제시된 CDR-H2, 서열번호 1805에 제시된 CDR-H3, 서열번호 1806에 제시된 CDR-L1, 서열번호 1807에 제시된 CDR-L2 및 서열번호 1808에 제시된 CDR-L3,

서열번호 1816에 제시된 CDR-H1, 서열번호 1817에 제시된 CDR-H2, 서열번호 1818에 제시된 CDR-H3, 서열번호 1819에 제시된 CDR-L1, 서열번호 1820에 제시된 CDR-L2 및 서열번호 1821에 제시된 CDR-L3,

서열번호 1829에 제시된 CDR-H1, 서열번호 1830에 제시된 CDR-H2, 서열번호 1831에 제시된 CDR-H3, 서열번호 1832에 제시된 CDR-L1, 서열번호 1833에 제시된 CDR-L2 및 서열번호 1834에 제시된 CDR-L3,

서열번호 1842에 제시된 CDR-H1, 서열번호 1843에 제시된 CDR-H2, 서열번호 1844에 제시된 CDR-H3, 서열번호 1845에 제시된 CDR-L1, 서열번호 1846에 제시된 CDR-L2 및 서열번호 1847에 제시된 CDR-L3,

서열번호 1855에 제시된 CDR-H1, 서열번호 1856에 제시된 CDR-H2, 서열번호 1857에 제시된 CDR-H3, 서열번호 1858에 제시된 CDR-L1, 서열번호 1859에 제시된 CDR-L2 및 서열번호 1860에 제시된 CDR-L3,

서열번호 1868에 제시된 CDR-H1, 서열번호 1869에 제시된 CDR-H2, 서열번호 1870에 제시된 CDR-H3, 서열번호 1871에 제시된 CDR-L1, 서열번호 1872에 제시된 CDR-L2 및 서열번호 1873에 제시된 CDR-L3,

서열번호 1881에 제시된 CDR-H1, 서열번호 1882에 제시된 CDR-H2, 서열번호 1883에 제시된 CDR-H3, 서열번호 1884에 제시된 CDR-L1, 서열번호 1885에 제시된 CDR-L2 및 서열번호 1886에 제시된 CDR-L3,

서열번호 2063에 제시된 CDR-H1, 서열번호 2064에 제시된 CDR-H2, 서열번호 2065에 제시된 CDR-H3, 서열번호 2066에 제시된 CDR-L1, 서열번호 2067에 제시된 CDR-L2 및 서열번호 2068에 제시된 CDR-L3,

서열번호 2076에 제시된 CDR-H1, 서열번호 2077에 제시된 CDR-H2, 서열번호 2078에 제시된 CDR-H3, 서열번호 2079에 제시된 CDR-L1, 서열번호 2080에 제시된 CDR-L2 및 서열번호 2081에 제시된 CDR-L3,

서열번호 2089에 제시된 CDR-H1, 서열번호 2090에 제시된 CDR-H2, 서열번호 2091에 제시된 CDR-H3, 서열번호 2092에 제시된 CDR-L1, 서열번호 2093에 제시된 CDR-L2 및 서열번호 2094에 제시된 CDR-L3,

서열번호 2102에 제시된 CDR-H1, 서열번호 2103에 제시된 CDR-H2, 서열번호 2104에 제시된 CDR-H3, 서열번호 2105에 제시된 CDR-L1, 서열번호 2106에 제시된 CDR-L2 및 서열번호 2107에 제시된 CDR-L3,

서열번호 2115에 제시된 CDR-H1, 서열번호 2116에 제시된 CDR-H2, 서열번호 2117에 제시된 CDR-H3, 서열번호 2118에 제시된 CDR-L1, 서열번호 2119에 제시된 CDR-L2 및 서열번호 2120에 제시된 CDR-L3,

서열번호 2128에 제시된 CDR-H1, 서열번호 2129에 제시된 CDR-H2, 서열번호 2130에 제시된 CDR-H3, 서열번호 2131에 제시된 CDR-L1, 서열번호 2132에 제시된 CDR-L2 및 서열번호 2133에 제시된 CDR-L3,

서열번호 2141에 제시된 CDR-H1, 서열번호 2142에 제시된 CDR-H2, 서열번호 2143에 제시된 CDR-H3, 서열번호 2144에 제시된 CDR-L1, 서열번호 2145에 제시된 CDR-L2 및 서열번호 2146에 제시된 CDR-L3,

서열번호 2154에 제시된 CDR-H1, 서열번호 2155에 제시된 CDR-H2, 서열번호 2156에 제시된 CDR-H3, 서열번호 2157에 제시된 CDR-L1, 서열번호 2158에 제시된 CDR-L2 및 서열번호 2159에 제시된 CDR-L3,

서열번호 2180에 제시된 CDR-H1, 서열번호 2181에 제시된 CDR-H2, 서열번호 2182에 제시된 CDR-H3, 서열번호 2183에 제시된 CDR-L1, 서열번호 2184에 제시된 CDR-L2 및 서열번호 2185에 제시된 CDR-L3,

서열번호 2193에 제시된 CDR-H1, 서열번호 2194에 제시된 CDR-H2, 서열번호 2195에 제시된 CDR-H3, 서열번호 2196에 제시된 CDR-L1, 서열번호 2197에 제시된 CDR-L2 및 서열번호 2198에 제시된 CDR-L3 및

서열번호 2206에 제시된 CDR-H1, 서열번호 2207에 제시된 CDR-H2, 서열번호 2208에 제시된 CDR-H3, 서열번호 2209에 제시된 CDR-L1, 서열번호 2210에 제시된 CDR-L2 및 서열번호 2211에 제시된 CDR-L3; 및

(e) 서열번호 76에 제시된 CDR-H1, 서열번호 77에 제시된 CDR-H2, 서열번호 78에 제시된 CDR-H3, 서열번호 244에 제시된 CDR-L1, 서열번호 245에 제시된 CDR-L2 및 서열번호 246에 제시된 CDR-L3,

서열번호 88에 제시된 CDR-H1, 서열번호 89에 제시된 CDR-H2, 서열번호 90에 제시된 CDR-H3, 서열번호 256에 제시된 CDR-L1, 서열번호 257에 제시된 CDR-L2 및 서열번호 258에 제시된 CDR-L3,

서열번호 106에 제시된 CDR-H1, 서열번호 107에 제시된 CDR-H2, 서열번호 108에 제시된 CDR-H3, 서열번호 274에 제시된 CDR-L1, 서열번호 275에 제시된 CDR-L2 및 서열번호 276에 제시된 CDR-L3,

서열번호 112에 제시된 CDR-H1, 서열번호 113에 제시된 CDR-H2, 서열번호 114에 제시된 CDR-H3, 서열번호 280에 제시된 CDR-L1, 서열번호 281에 제시된 CDR-L2 및 서열번호 282에 제시된 CDR-L3,

서열번호 106에 제시된 CDR-H1, 서열번호 107에 제시된 CDR-H2, 서열번호 108에 제시된 CDR-H3, 서열번호 274에 제시된 CDR-L1, 서열번호 275에 제시된 CDR-L2 및 서열번호 276에 제시된 CDR-L3,

서열번호 983에 제시된 CDR-H1, 서열번호 984에 제시된 CDR-H2, 서열번호 985에 제시된 CDR-H3, 서열번호 986에 제시된 CDR-L1, 서열번호 987에 제시된 CDR-L2 및 서열번호 988에 제시된 CDR-L3,

서열번호 1582에 제시된 CDR-H1, 서열번호 1583에 제시된 CDR-H2, 서열번호 1584에 제시된 CDR-H3, 서열번호 1585에 제시된 CDR-L1, 서열번호 1586에 제시된 CDR-L2 및 서열번호 1587에 제시된 CDR-L3, 및

서열번호 1595에 제시된 CDR-H1, 서열번호 1596에 제시된 CDR-H2, 서열번호 1597에 제시된 CDR-H3, 서열번호 1598에 제시된 CDR-L1, 서열번호 1599에 제시된 CDR-L2 및 서열번호 1600에 제시된 CDR-L3

로 이루어진 그룹으로부터 선택된, CDR-H1, CDR-H2 및 CDR-H3을 포함하는 VH 영역 및 CDR-L1, CDR-L2 및 CDR-L3을 포함하는 VL 영역을 포함한다.

본 발명의 항체 작제물의 추가의 실시형태에서, 상기 제1 결합 도메인은

(a) 서열번호 362, 서열번호 364, 서열번호 485, 서열번호 486, 서열번호 487, 서열번호 492, 서열번호 493, 서열번호 494, 서열번호 495, 서열번호 1133, 서열번호 1172, 서열번호 1341, 서열번호 1354, 서열번호 1367, 서열번호 1432, 서열번호 1445 및 서열번호 2174에 제시된 VH 영역;

(b) 서열번호 342, 서열번호 366, 서열번호 370, 서열번호 344, 서열번호 372, 서열번호 368, 서열번호 496, 서열번호 497, 서열번호 498, 서열번호 499, 서열번호 500, 서열번호 508, 서열번호 509, 서열번호 510, 서열번호 511, 서열번호 512, 서열번호 519, 서열번호 520, 서열번호 521, 서열번호 522, 서열번호 523, 서열번호 524, 서열번호 525, 서열번호 526, 서열번호 527, 서열번호 528, 서열번호 529, 서열번호 530, 서열번호 531, 서열번호 532, 서열번호 533, 서열번호 534, 서열번호 535, 서열번호 536, 서열번호 537, 서열번호 538, 서열번호 1016, 서열번호 1029, 서열번호 1042, 서열번호 1081, 서열번호 1107, 서열번호 1120, 서열번호 1250, 서열번호 1263, 서열번호 1276, 서열번호 1289, 서열번호 1302, 서열번호 1654, 서열번호 1667, 서열번호 1901, 서열번호 1914, 서열번호 1940, 서열번호 1953, 서열번호 1966, 서열번호 1979, 서열번호 1992, 서열번호 2005, 서열번호 2018, 서열번호 2031, 서열번호 2044 및 서열번호 2057에 제시된 VH 영역;

(c) 서열번호 338, 서열번호 354, 서열번호 378, 서열번호 356, 서열번호 476, 서열번호 477, 서열번호 478, 서열번호 479, 서열번호 480, 서열번호 481, 서열번호 482, 서열번호 483, 서열번호 484, 서열번호 501, 서열번호 502, 서열번호 503, 서열번호 504, 서열번호 505, 서열번호 506, 서열번호 517, 서열번호 518, 서열번호 1003, 서열번호 1055, 서열번호 1094, 서열번호 1615, 서열번호 1628, 서열번호 1641, 서열번호 1680, 서열번호 1693, 서열번호 1706, 서열번호 1719, 서열번호 1732, 서열번호 1745, 서열번호 1758, 서열번호 1771 및 서열번호 1927에 제시된 VH 영역;

(d) 서열번호 352, 서열번호 360, 서열번호 388, 서열번호 386, 서열번호 340, 서열번호 346, 서열번호 374, 서열번호 348, 서열번호 390, 서열번호 463, 서열번호 464, 서열번호 465, 서열번호 466, 서열번호 467, 서열번호 468, 서열번호 469, 서열번호 470, 서열번호 471, 서열번호 472, 서열번호 473, 서열번호 474, 서열번호 475, 서열번호 488, 서열번호 489, 서열번호 490, 서열번호 491, 서열번호 513, 서열번호 514, 서열번호 515, 서열번호 516, 서열번호 540, 서열번호 541, 서열번호 542, 서열번호 543, 서열번호 977, 서열번호 1068, 서열번호 1146, 서열번호 1159, 서열번호 1185, 서열번호 1198, 서열번호 1211, 서열번호 1224, 서열번호 1237, 서열번호 1315, 서열번호 1328, 서열번호 1380, 서열번호 1393, 서열번호 1406, 서열번호 1419, 서열번호 1469, 서열번호 1478, 서열번호 1485, 서열번호 1494, 서열번호 1501, 서열번호 1508, 서열번호 1519, 서열번호 1526, 서열번호 1533, 서열번호 1542, 서열번호 1549, 서열번호 1558, 서열번호 1565, 서열번호 1784, 서열번호 1797, 서열번호 1810, 서열번호 1823, 서열번호 1836, 서열번호 1849, 서열번호 1862, 서열번호 1875, 서열번호 1888, 서열번호 2070, 서열번호 2083, 서열번호 2096, 서열번호 2109, 서열번호 2122, 서열번호 2135, 서열번호 2148, 서열번호 2161, 서열번호 2187, 서열번호 2200 및 서열번호 2213에 제시된 VH 영역; 및

(e) 서열번호 376, 서열번호 392, 서열번호 358, 서열번호 350, 서열번호 507, 서열번호 990, 서열번호 1589 및 서열번호 1602에 제시된 VH 영역으로 이루어진 그룹으로부터 선택된 VH 영역을 포함한다.

본 발명의 항체 작제물의 또 다른 실시형태에서, 상기 제1 결합 도메인은

(a) 서열번호 418, 서열번호 420, 서열번호 580, 서열번호 581, 서열번호 582, 서열번호 587, 서열번호 588, 서열번호 589, 서열번호 590, 서열번호 1135, 서열번호 1174, 서열번호 1343, 서열번호 1356, 서열번호 1369, 서열번호 1434, 서열번호 1447 및 서열번호 2176에 제시된 VL 영역;

(b) 서열번호 398, 서열번호 422, 서열번호 426, 서열번호 400, 서열번호 428, 서열번호 424, 서열번호 591, 서열번호 592, 서열번호 593, 서열번호 594, 서열번호 595, 서열번호 603, 서열번호 604, 서열번호 605, 서열번호 606, 서열번호 607, 서열번호 614, 서열번호 615, 서열번호 616, 서열번호 617, 서열번호 618, 서열번호 619, 서열번호 620, 서열번호 621, 서열번호 622, 서열번호 623, 서열번호 624, 서열번호 625, 서열번호 626, 서열번호 627, 서열번호 628, 서열번호 629, 서열번호 630, 서열번호 631, 서열번호 632, 서열번호 633, 서열번호 1018, 서열번호 1031, 서열번호 1044, 서열번호 1083, 서열번호 1109, 서열번호 1122, 서열번호 1252, 서열번호 1265, 서열번호 1278, 서열번호 1291, 서열번호 1304, 서열번호 1656, 서열번호 1669, 서열번호 1903, 서열번호 1916, 서열번호 1942, 서열번호 1955, 서열번호 1968, 서열번호 1981, 서열번호 1994, 서열번호 2007, 서열번호 2020, 서열번호 2033, 서열번호 2046 및 서열번호 2059에 제시된 VL 영역;

(c) 서열번호 394, 서열번호 410, 서열번호 434, 서열번호 412, 서열번호 571, 서열번호 572, 서열번호 573, 서열번호 574, 서열번호 575, 서열번호 576, 서열번호 577, 서열번호 578, 서열번호 579, 서열번호 596, 서열번호 597, 서열번호 598, 서열번호 599, 서열번호 600, 서열번호 601, 서열번호 612, 서열번호 613, 서열번호 1005, 서열번호 1057, 서열번호 1096, 서열번호 1617, 서열번호 1630, 서열번호 1643, 서열번호 1682, 서열번호 1695, 서열번호 1708, 서열번호 1721, 서열번호 1734, 서열번호 1747, 서열번호 1760, 서열번호 1773 및 서열번호 1929에 제시된 VL 영역;

(d) 서열번호 408, 서열번호 416, 서열번호 444, 서열번호 442, 서열번호 396, 서열번호 402, 서열번호 430, 서열번호 404, 서열번호 446, 서열번호 558, 서열번호 559, 서열번호 560, 서열번호 561, 서열번호 562, 서열번호 563, 서열번호 564, 서열번호 565, 서열번호 566, 서열번호 567, 서열번호 568, 서열번호 569, 서열번호 570, 서열번호 583, 서열번호 584, 서열번호 585, 서열번호 586, 서열번호 608, 서열번호 609, 서열번호 610, 서열번호 611, 서열번호 635, 서열번호 636, 서열번호 637, 서열번호 638, 서열번호 979, 서열번호 1070, 서열번호 1148, 서열번호 1161, 서열번호 1187, 서열번호 1200, 서열번호 1213, 서열번호 1226, 서열번호 1239, 서열번호 1317, 서열번호 1330, 서열번호 1382, 서열번호 1395, 서열번호 1408, 서열번호 1421, 서열번호 1471, 서열번호 1480, 서열번호 1487, 서열번호 1496, 서열번호 1503, 서열번호 1510, 서열번호 1521, 서열번호 1528, 서열번호 1535, 서열번호 1544, 서열번호 1551, 서열번호 1560, 서열번호 1567, 서열번호 1786, 서열번호 1799, 서열번호 1812, 서열번호 1825, 서열번호 1838, 서열번호 1851, 서열번호 1864, 서열번호 1877, 서열번호 1890, 서열번호 2072, 서열번호 2085, 서열번호 2098, 서열번호 2111, 서열번호 2124, 서열번호 2137, 서열번호 2150, 서열번호 2163, 서열번호 2189, 서열번호 2202 및 서열번호 2215에 제시된 VL 영역; 및

(e) 서열번호 432, 서열번호 448, 서열번호 414, 서열번호 406, 서열번호 602, 서열번호 992, 서열번호 1591 및 서열번호 1604에 제시된 VL 영역으로 이루어진 그룹으로부터 선택된 VL 영역을 포함한다.

본 발명은 본 발명의 항체 작제물의 양태를 추가로 제공하고, 여기서 제1 결합 도메인은

(1) 서열번호 362+418, 서열번호 364+420, 서열번호 485+580, 서열번호 486+581, 서열번호 487+582, 서열번호 492+587, 서열번호 493+588, 서열번호 494+589, 서열번호 495+590, 서열번호 1133+1135, 서열번호 1172+1174, 서열번호 1341+1343, 서열번호 1354+1356, 서열번호 1367+1369, 서열번호 1432+1434, 서열번호 1445+1447 및 서열번호 2174+2176에 제시된 VH 영역과 VL 영역의 쌍;

(2) 서열번호 342+398, 서열번호 366+422, 서열번호 370+426, 서열번호 344+400, 서열번호 372+428, 서열번호 368+424, 서열번호 496+591, 서열번호 497+592, 서열번호 498+593, 서열번호 499+594, 서열번호 500+595, 서열번호 508+603, 서열번호 509+604, 서열번호 510+605, 서열번호 511+606, 서열번호 512+607, 서열번호 519+614, 서열번호 520+615, 서열번호 521+616, 서열번호 522+617, 서열번호 523+618, 서열번호 524+619, 서열번호 525+620, 서열번호 526+621, 서열번호 527+622, 서열번호 528+623, 서열번호 529+624, 서열번호 530+625, 서열번호 531+626, 서열번호 532+627, 서열번호 533+628, 서열번호 534+629, 서열번호 535+630, 서열번호 536+631, 서열번호 537+632, 서열번호 538+633, 서열번호 1016+1018, 서열번호 1029+1031, 서열번호 1042+1044, 서열번호 1081+1083, 서열번호 1107+1109, 서열번호 1120+1122, 서열번호 1250+1252, 서열번호 1263+1265, 서열번호 1276+1278, 서열번호 1289+1291, 서열번호 1302+1304, 서열번호 1654+1656, 서열번호 1667+1669, 서열번호 1901+1903, 서열번호 1914+1916, 서열번호 1940+1942, 서열번호 1953+1955, 서열번호 1966+1968, 서열번호 1979+1981, 서열번호 1992+1994, 서열번호 2005+2007, 서열번호 2018+2020, 서열번호 2031+2033, 서열번호 2044+2046 및 서열번호 2057+2059에 제시된 VH 영역과 VL 영역의 쌍;

(3) 서열번호 338+394, 서열번호 354+410, 서열번호 378+434, 서열번호 356+412, 서열번호 476+571, 서열번호 477+572, 서열번호 478+573, 서열번호 479+574, 서열번호 480+575, 서열번호 481+576, 서열번호 482+577, 서열번호 483+578, 서열번호 484+579, 서열번호 501+596, 서열번호 502+597, 서열번호 503+598, 서열번호 504+599, 서열번호 505+600, 서열번호 506+601, 서열번호 517+612, 서열번호 518+613, 서열번호 1003+1005, 서열번호 1055+1057, 서열번호 1094+1096, 서열번호 1615+1617, 서열번호 1628+1630, 서열번호 1641+1643, 서열번호 1680+1682, 서열번호 1693+1695, 서열번호 1706+1708, 서열번호 1719+1721, 서열번호 1732+1734, 서열번호 1745+1747, 서열번호 1758+1760, 서열번호 1771+1773 및 서열번호 1927+1929에 제시된 VH 영역과 VL 영역의 쌍;

(4) 서열번호 352+408, 서열번호 360+416, 서열번호 388+444, 서열번호 386+442, 서열번호 340+396, 서열번호 346+402, 서열번호 374+430, 서열번호 348+404, 서열번호 390+446, 서열번호 463+558, 서열번호 464+559, 서열번호 465+560, 서열번호 466+561, 서열번호 467+562, 서열번호 468+563, 서열번호 469+564, 서열번호 470+565, 서열번호 471+566, 서열번호 472+567, 서열번호 473+568, 서열번호 474+569, 서열번호 475+570, 서열번호 488+583, 서열번호 489+584, 서열번호 490+585, 서열번호 491+586, 서열번호 513+608, 서열번호 514+609, 서열번호 515+610, 서열번호 516+611, 서열번호 540+635, 서열번호 541+636, 서열번호 542+637, 서열번호 543+638, 서열번호 977+979, 서열번호 1068+1070, 서열번호 1146+1148, 서열번호 1159+1161, 서열번호 1185+1187, 서열번호 1198+1200, 서열번호 1211+1213, 서열번호 1224+1226, 서열번호 1237+1239, 서열번호 1315+1317, 서열번호 1328+1330, 서열번호 1380+1382 서열번호 1393+1395, 서열번호 1406+1408, 서열번호 1419+1421, 서열번호 1469+1471, 서열번호 1478+1480, 서열번호 1485+1487, 서열번호 1494+1496, 서열번호 1501+1503, 서열번호 1508+1510, 서열번호 1519+1521, 서열번호 1526+1528, 서열번호 1533+1535, 서열번호 1542+1544, 서열번호 1549+1551, 서열번호 1558+1560, 서열번호 1565+1567, 서열번호 1784+1786, 서열번호 1797+1799, 서열번호 1810+1812, 서열번호 1823+1825, 서열번호 1836+1838, 서열번호 1849+1851, 서열번호 1862+1864, 서열번호 1875+1877, 서열번호 1888+1890, 서열번호 2070+2072, 서열번호 2083+2085, 서열번호 2096+2098, 서열번호 2109+2111, 서열번호 2122+2124, 서열번호 2135+2137, 서열번호 2148+2150, 서열번호 2161+2163, 서열번호 2187+2189, 서열번호 2200+2202 및 서열번호 2213+2215에 제시된 VH 영역과 VL 영역의 쌍; 및

(5) 서열번호 376+432, 서열번호 392+448, 서열번호 358+414, 서열번호 350+406, 서열번호 507+602, 서열번호 990+992, 서열번호 1589+1591 및 서열번호 1602+1604에 제시된 VH 영역과 VL 영역의 쌍으로 이루어진 그룹으로부터 선택된 VH 영역 및 VL 영역을 포함한다.

본 발명의 추가의 실시형태에서, 항체 작제물은 (scFv)2, (단일 도메인 mAb)2, scFv-단일 도메인 mAb, 디아바디 및 이의 올리고머로 이루어진 그룹으로부터 선택된 포맷(format)으로 존재한다.

바람직한 실시형태에서, 상기 제1 결합 도메인은

(a) 서열번호 117, 서열번호 1137, 서열번호 1176, 서열번호 1345, 서열번호 1358, 서열번호 1371, 서열번호 1436, 서열번호 1449 및 서열번호 2178에 제시된 아미노산 서열;

(b) 서열번호 1020, 서열번호 1033, 서열번호 1046, 서열번호 1085, 서열번호 1111, 서열번호 1124, 서열번호 1254, 서열번호 1267, 서열번호 1280, 서열번호 1293, 서열번호 1306, 서열번호 1658, 서열번호 1671, 서열번호 1905, 서열번호 1918, 서열번호 1944, 서열번호 1957, 서열번호 1970, 서열번호 1983, 서열번호 1996, 서열번호 2009, 서열번호 2022, 서열번호 2035, 서열번호 2048 및 서열번호 2061에 제시된 아미노산 서열;

(c) 서열번호 1007, 서열번호 1059, 서열번호 1098, 서열번호 1619, 서열번호 1632, 서열번호 1645, 서열번호 1684, 서열번호 1697, 서열번호 1710, 서열번호 1723, 서열번호 1736, 서열번호 1749, 서열번호 1762, 서열번호 1775 및 서열번호 1931에 제시된 아미노산 서열;

(d) 서열번호 981, 서열번호 1072, 서열번호 1150, 서열번호 1163, 서열번호 1189, 서열번호 1202, 서열번호 1215, 서열번호 1228, 서열번호 1241, 서열번호 1319, 서열번호 1332, 서열번호 1384, 서열번호 1397, 서열번호 1410, 서열번호 1423, 서열번호 1473, 서열번호 1482, 서열번호 1489, 서열번호 1498, 서열번호 1505, 서열번호 1512, 서열번호 1523, 서열번호 1530, 서열번호 1537, 서열번호 1546, 서열번호 1553, 서열번호 1562, 서열번호 1569, 서열번호 1788, 서열번호 1801, 서열번호 1814, 서열번호 1827, 서열번호 1840, 서열번호 1853, 서열번호 1866, 서열번호 1879, 서열번호 1892, 서열번호 2074, 서열번호 2087, 서열번호 2100, 서열번호 2113, 서열번호 2126, 서열번호 2139, 서열번호 2152, 서열번호 2165, 서열번호 2191, 서열번호 2204 및 서열번호 2217에 제시된 아미노산 서열; 및

(e) 서열번호 994, 서열번호 1593 및 서열번호 1606에 제시된 아미노산 서열로 이루어진 그룹으로부터 선택된 아미노산 서열을 포함한다.

본 발명의 항체 작제물의 또 다른 실시형태에서, 제2 결합 도메인은 인간 및 비단마모셋(Callithrix jacchus), 솜털머리타마린(Saguinus Oedipus) 또는 다람쥐원숭이(Saimiri sciureus) CD3 엡실론(epsilon)에 결합할 수 있다.

바람직한 실시형태에서, 본 발명의 항체 작제물은

(a) 서열번호 1138, 서열번호 1177, 서열번호 1346, 서열번호 1359, 서열번호 1372, 서열번호 1437, 서열번호 1450 및 서열번호 2179에 제시된 아미노산 서열;

(b) 서열번호 1021, 서열번호 1034, 서열번호 1047, 서열번호 1086, 서열번호 1112, 서열번호 1125, 서열번호 1255, 서열번호 1268, 서열번호 1281, 서열번호 1294, 서열번호 1307, 서열번호 1659, 서열번호 1672, 서열번호 1906, 서열번호 1919, 서열번호 1945, 서열번호 1958, 서열번호 1971, 서열번호 1984, 서열번호 1997, 서열번호 2010, 서열번호 2023, 서열번호 2036, 서열번호 2049 및 서열번호 2062에 제시된 아미노산 서열;

(c) 서열번호 1008, 서열번호 1060, 서열번호 1099, 서열번호 1620, 서열번호 1633, 서열번호 1646, 서열번호 1685, 서열번호 1698, 서열번호 1711, 서열번호 1724, 서열번호 1737, 서열번호 1750, 서열번호 1763, 서열번호 1776 및 서열번호 1932에 제시된 아미노산 서열;

(d) 서열번호 982, 서열번호 1073, 서열번호 1151, 서열번호 1164, 서열번호 1190, 서열번호 1203, 서열번호 1216, 서열번호 1229, 서열번호 1242, 서열번호 1320, 서열번호 1333, 서열번호 1385, 서열번호 1398, 서열번호 1411, 서열번호 1424, 서열번호 1474, 서열번호 1475, 서열번호 1476, 서열번호 1483, 서열번호 1490, 서열번호 1491, 서열번호 1492, 서열번호 1499, 서열번호 1506, 서열번호 1513, 서열번호 1514, 서열번호 1515, 서열번호 1516, 서열번호 1517, 서열번호 1524, 서열번호 1531, 서열번호 1538, 서열번호 1539, 서열번호 1540, 서열번호 1547, 서열번호 1554, 서열번호 1555, 서열번호 1556, 서열번호 1563, 서열번호 1570, 서열번호 1571, 서열번호 1572, 서열번호 1573, 서열번호 1574, 서열번호 1575, 서열번호 1576, 서열번호 1577, 서열번호 1578, 서열번호 1579, 서열번호 1580, 서열번호 1581, 서열번호 1789, 서열번호 1802, 서열번호 1815, 서열번호 1828, 서열번호 1841, 서열번호 1854, 서열번호 1867, 서열번호 1880, 서열번호 1893, 서열번호 2075, 서열번호 2088, 서열번호 2101, 서열번호 2114, 서열번호 2127, 서열번호 2140, 서열번호 2153, 서열번호 2166, 서열번호 2192, 서열번호 2205 및 서열번호 2218 내지 2228에 제시된 아미노산 서열; 및

(e) 서열번호 995, 서열번호 1594 및 서열번호 1607에 제시된 아미노산 서열로 이루어진 그룹으로부터 선택된 아미노산 서열을 갖는다.

본 발명은 본 발명의 항체 작제물을 코딩하는 핵산 서열을 추가로 제공한다.

추가로, 본 발명은 본 발명의 핵산 서열을 포함하는 벡터를 제공한다. 또한, 본 발명은 본 발명의 핵산 서열로 형질전환 또는 형질감염된 숙주 세포를 제공한다.

추가의 실시형태에서, 본 발명은, 본 발명의 숙주 세포를 본 발명의 항체 작제물의 발현을 가능하게 하는 조건하에 배양하는 단계 및 생성된 항체 작제물을 상기 배양물로부터 회수하는 단계를 포함하는, 본 발명의 항체 작제물의 생성 방법을 제공한다.

더욱이, 본 발명은 본 발명의 항체 작제물 또는 본 발명의 방법에 따라 생성된 항체 작제물을 포함하는 약제학적 조성물을 제공한다.

한 가지 실시형태에서, 본 발명은, 흑색종 질환 또는 전이성 흑색종 질환의 예방, 치료 또는 개선에 사용하기 위한, 본 발명의 따르거나 본 발명의 방법에 따라 생성된 항체 작제물을 제공한다.

본 발명은 또한, 본 발명에 따르거나 본 발명의 방법에 따라 생성된 항체 작제물을 이를 필요로 하는 대상체에게 투여하는 단계를 포함하는, 흑색종 질환 또는 전이성 흑색종 질환의 치료 또는 개선 방법을 제공한다.

본 발명의 사용 방법의 바람직한 실시형태에서, 흑색종 질환 또는 전이성 흑색종 질환은 표제 확장형 흑색종(superficial spreading melanoma), 악성 흑자(lentigo maligna), 악성 흑자 흑색종, 말단성 흑자성 흑색종(acral lentiginous melanoma) 및 결절성 흑색종으로 이루어진 그룹으로부터 선택된다.

추가의 실시형태에서, 본 발명은 본 발명에 따른 항체 작제물 또는 본 발명의 방법에 따라 생성된 항체 작제물, 본 발명의 벡터 및/또는 본 발명의 숙주 세포를 포함하는 키트를 제공한다.

도 1은 완전 인간 항-CDH19 항체, 및 약물-항체 비(DAR)(약 1.3)에서 DM1(DM1-Fab)과 접합된 고농도의 염소 항-인간 Fc 일가 Fab로 처리된 Colo-699 세포의 세포 생존율 데이터를 나타낸다.
도 2는 Colo-699 검정으로부터의 평균 세포 생존율에 대해 플롯된 CHL-1 검정으로부터의 평균 세포 생존율 데이터를 나타낸다.
도 3은 전이성 및 원발성 흑색종 샘플에서 CDH19 mRNA의 상대 발현을 나타낸다.
도 4는 IHC에 의한 인간 종양 샘플에서 CDH19 단백질의 발현을 나타낸다.
도 5는 세포 표면 상에 존재하는 CDH19 수용체의 수에 기초하여 인간 종양과 유사한 CDH19 발현으로 모델 시스템을 동정하기 위해 유동 세포분석 및 IHC에 의한 종양 세포주의 분석 결과를 나타낸다.
도 6은 하기 지시된 세포주에 대한 CDH19/CD3 이중특이적 항체의 FACS 분석이다:
1) 비형질감염된 L1.2, 2) 인간 CDH19로 안정하게 형질감염된 L1.2 세포, 3) 흑색종 세포주 CHL-1, 4) 흑색종 세포주 A2058, 5) 인간 CD3 양성 인간 T 세포주 HBP-ALL, 6) 마카크 T 세포주 4119 LnPx. 음성 대조군 [1) 내지 6)]: 선행 CDH19/CD3 이중특이적 항체 부재하의 검출 항체.
도 7은 48시간 FACS-기반 세포독성 검정으로 측정한 CDH19/CD3 이중특이적 항체의 세포독성 활성이다. 효과기 세포: 비자극된 인간 PBMC. 표적 세포: 지시된 바와 같음. 효과기 대 표적 세포(E:T)-비: 10:1.
도 8은 CDH19 BiTe 2G6의 투여에 의한 Colo699 세포의 종양 성장 생체내 억제이다. 이중특이적 항체 작제물은 0.5 mg/kg 용량에서 종양의 성장을 억제한다.
도 9는 CDH19 BiTE 2G6의 투여에 의한 CHL-1 세포의 종양 성장 생체내 억제이다. 이중특이적 항체 작제물은 0.5 mg/kg 용량에서 종양의 성장을 억제한다.
도 10은 48시간 화상-기반 세포독성 검정으로 측정한 CDH19/CD3 이중특이적 항체의 세포독성 활성이다. 효과기 세포: 비자극된 인간 T 세포. 표적 세포: 지시된 바와 같음. 효과기 대 표적 세포(E:T)-비: 10:1.
도 11은 CH19 2G6 301×I2C SA21의 크로마토그램 IMAC 포획 및 용출이다.
통상의 IMAC 용출 프로파일은 CDH19 BiTE 항체의 정제 동안 수득했다. 적색 라인은 254 nm에서의 흡광도를 나타내고, 청색 라인은 280 nm에서의 흡광도를 나타낸다. 갈색 라인은 도전성을 나타낸다. 1 - 포획. 2 - 예비-용출 50 mM 이미다졸. 3. BiTE 용출 500 mM 이미다졸.
도 12는 CH19 2G6 302×F12Q의 크로마토그램 단백질_A 포획 및 용출이다.
통상의 단백질_A 용출 프로파일은 CDH19 BiTE 항체의 정제 동안 수득했다. 적색 라인은 254 nm에서의 흡광도를 나타내고, 청색 라인은 280 nm에서의 흡광도를 나타낸다. 갈색 라인은 도전성을 나타낸다. 녹색 라인은 적용된 구배 비율을 나타낸다. 1 - 포획. 2 - BiTE 용출.
도 13은 CDH19 BiTE 항체 2G6 302×I2C SA21의 SEC 용출 프로파일이다.
통상의 SEC 용출 프로파일은 CDH19 BiTE 항체의 정제 동안 수득했다. 단량체성 및 이량체성 BiTE 항체 이소형에 상응하는 단백질 피크가 제시되어 있다. LMW = 저분자량. 적색 라인은 254 nm에서의 흡광도를 나타내고, 청색 라인은 280 nm에서의 흡광도를 나타낸다. 갈색 라인은 도전성을 나타낸다. 1 - SEC 배제 용적에서 비-BiTE 응집물. 2. BiTE 이량체. 3. BiTE 단량체. 4. 저분자량 오염물질 및 염.
도 14는 CDH19 BiTE 단량체 CH19 2G6 302×I2C SA21(좌측) 및 분자량 마커 노벡스 샤프(Novex Sharp) 단백질 표준(Life Technologies)의 감소된 SDS PAGE 분석이다.
도 15는 37℃에서 7일간 저장후 CDH19 BiTE CH19 2G6 302×I2C SA21의 용출을 나타내는 HP-SEC 크로마토그램이다. 분홍색 라인은 210 nm 파장에서 광학 흡광도를 나타낸다. 갈색 라인은 도전성을 나타낸다. 1. BiTE 이량체. 2. BiTE 단량체.
도 16은 3회의 동결/해동 사이클 후 CDH19 BiTE CH19 2G6 302×I2C SA21의 용출을 나타내는 HP-SEC 크로마토그램이다. 분홍색 라인은 210 nm 파장에서의 광학 흡광도를 나타낸다. 갈색 라인은 도전성을 나타낸다. 1. BiTE 단량체
도 17은 CDH19 BiTE CH19 2G6 302×I2C SA21의 용출의 CatIEX 크로마토그램이다. 청색 라인은 280 nm에서의 광학 흡광도를 나타낸다. 적색 라인은 254 nm에서의 광학 흡광도를 나타낸다.
도 18은 CDH19 BiTE CH19 2G6 302×I2C SA21의 HIC 용출 프로파일이다. 청색 라인은 280 nm에서의 광학 흡광도를 나타낸다. 적색 라인은 254 nm에서의 광학 흡광도를 나타낸다. 갈색 라인은 도전성을 나타낸다.
도 19는 하기 지시된 세포주에 대한 CDH19/CD3 이중특이적 항체의 FACS 분석이다: 1) 인간 CDH19로 안정하게 형질감염된 HEK293 세포, 2) 인간 CD3 양상 인간 T 세포주 HBP-ALL; 음성 대조군[1) 및 2)]: 선행 CDH19/CD3 이중특이적 항체 세포 배양 상청액 부재하의 검출 항체.
도 20은 18시간 크롬 방출-기반 세포독성 검정으로 측정한 CDH19/CD3 이중특이적 항체의 세포독성 활성이다. 효과기 세포: 자극된 인간 CD8+ T-세포. 표적 세포: 인간 CDH19로 형질감염된 HEK293. 효과기 대 표적 세포(E:T)-비: 10:1.

정의:

본원에 사용된 바와 같이, 단수형 "단수 (a, an)" 및 "상기 (the)"는, 당해 문맥이 달리 명시하지 않는 한, 복수의 참조를 포함한다. 따라서, 예를 들면, "시약"에 대한 언급은 하나 이상의 이러한 상이한 시약을 포함하고, "방법"에 대한 언급은 본원에 기재된 방법을 변형하거나 치환할 수 있는 당해 기술분야의 숙련가에게 공지된 동등한 단계 및 방법에 대한 참조를 포함한다.

달리 지시하지 않는 한, 일련의 요소에 선행하는 용어 "적어도"는 일련의 모든 요소를 지칭하는 것으로 이해되어야 한다. 당해 기술분야의 숙련가는 단지 통상의 실험을 사용하여 본원에 기재된 특정 실시형태에 대한 다수의 균등물을 인지하거나 확인할 수 있다. 이러한 균등물은 본 발명에 의해 포함되는 것으로 의도된다.

본원에 사용되는 용어 "및/또는"은 "및", "또는" 및 "상기 용어에 의해 연결된 요소의 모든 또는 임의의 기타 조합"의 의미를 포함한다.

본원에 사용되는 용어 "약" 또는 "대략"은 소정 값 또는 범위의 ±20% 이내, 바람직하게는 ±15% 이내, 보다 바람직하게는 ±10% 이내 및 가장 바람직하게는 ±5% 이내를 의미한다.

하기하는 본 명세서 및 특허청구범위 전반에 걸쳐, 당해 문맥이 달리 요구하지 않는 한, 단어 "포함하다" 및 "포함한다" 및 "포함하는" 등의 변형태는 언급된 정수나 단계 또는 정수나 단계의 그룹의 포함을 의미하는 것으로 이해되어야 하지만, 임의의 기타 정수나 단계 또는 정수나 단계의 그룹을 배제하는 것은 아니다. 본원에서 사용되는 경우, 용어 "포함하는(comprising)"은 용어 "함유하는(containing)" 또는 "포함하는(including)"으로 치환될 수 있거나, 종종 본원에서 사용되는 경우 용어 "갖는"으로 치환될 수 있다.

본원에서 사용되는 경우, "~으로 이루어진"은 청구항의 요소에서 지정하지 않은 임의의 요소, 단계 또는 성분을 배제한다. 본원에서 사용되는 경우, "실질적으로 ~으로 이루어진"은 청구항의 기본적 및 신규의 특징에 물질적으로 영향을 미치지 않는 물질 또는 단계를 배제하지 않는다.

본원의 각 예에서, 임의의 용어 "~를 포함하는", "실질적으로 ~으로 이루어진" 및 "~으로 이루어진"은 다른 두 용어의 어느 하나로 대체될 수 있다.

용어 "항체"의 정의는 항체 단편 등, 특히 Fab 단편 뿐만 아니라 모노클로날, 키메라, 일본쇄, 인간화 및 인간 항체 등의 실시형태를 포함한다. 항체 단편 또는 유도체는 F(ab')2, Fv, scFv 단편 또는 단일 도메인 항체, 예를 들면, 도메인 항체 또는 나노바디, 하나의 가변 도메인만을 포함하는 단일 가변 도메인 항체 또는 면역글로불린 단일 가변 도메인를 추가로 포함하고, 상기 가변 도메인은 VHH, VH 또는 VL일 수 있고 다른 V 영역 또는 도메인과는 독립적으로 항원 또는 에피토프에 특이적으로 결합한다[참조: Harlow and Lane (1988) and (1999), loc. cit.; Kontermann and Dubel, Antibody Engineering, Springer, 2nd ed. 2010 and Little, Recombinant Antibodies for Immunotherapy, Cambridge University Press 2009]. 이러한 면역글로불린 단일 가변 도메인은 분리된 항체 단일 가변 도메인 폴리펩티드를 포함할 뿐만 아니라, 항체 단일 가변 도메인 폴리펩티드 서열의 하나 이상의 단량체를 포함하는 보다 큰 폴리펩티드를 포함한다.

이러한 정의에 따라, 용어 항체의 상기 기재된 모든 실시형태는 용어 "항체 작제물"하에 포함될 수 있다. 상기 용어는 디아바디 또는 이중-친화성 재-표적화(Dual-Affinity Re-Targeting; DART) 항체를 또한 포함한다. 추가로, (이중특이적) 일본쇄 디아바디, 탠덤 디아바디(Tandub's), 다음과 같은 구조에 의해 예시되는 "미니바디": (VH-VL-CH3)2, (scFv-CH3)2 또는 (scFv-CH3-scFv)2, "Fc DART" 항체 및 "IgG DART" 항체 및 트리아바디 등의 멀티바디가 포함된다. 면역글로불린 단일 가변 도메인은 분리된 항체 단일 가변 도메인 폴리펩티드를 포함할 뿐만 아니라, 항체 단일 가변 도메인 폴리펩티드 서열의 하나 이상의 단량체를 포함하는 보다 큰 폴리펩티드를 포함한다.

다양한 공정이 당해 기술분야에 공지되어 있고, 이러한 항체 작제물(항체 및/또는 단편)의 생성에 사용될 수 있다. 따라서, (항체) 유도체는 펩티드모방체에 의해 생성할 수 있다. 추가로, 일본쇄 항체의 생성에 대해 기재된 기술[참조: 특히 US 특허 4,946,778, Kontermann and Dubel (2010), loc. cit. 및 Little (2009), loc. cit]은 선택된 폴리펩티드(들)에 특이적인 일본쇄 항체를 생성하는데 적합할 수 있다. 또한, 유전자도입 동물을 사용하여 본 발명의 폴리펩티드 및 융합 단백질에 특이적인 인간화 항체를 발현시킬 수 있다. 모노클로날 항체를 제조하는 경우, 연속 세포주 배양에 의해 생성된 항체를 제공하는 임의의 기술이 사용될 수 있다. 이러한 기술의 예는 하이브리도마 기술[참조: Kohler and Milstein Nature 256 (1975), 495-497], 트리오마 기술, 인간 B-세포 하이브리도마 기술[참조: Kozbor, Immunology Today 4 (1983), 72] 및 인간 모노클로날 항체를 제조하기 위한 EBV-하이브리도마 기술[참조: Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc. (1985), 77-96]을 포함한다. BIAcore 시스템에서 사용된 표면 플라스몬 공명은 CD3 엡실론 등의 표적 폴리펩티드의 에피토프에 결합하는 파지 항체의 효능을 증가시키기 위해 사용될 수 있다[참조: Schier, Human Antibodies Hybridomas 7 (1996), 97-105; Malmborg, J. Immunol. Methods 183 (1995), 7-13]. 또한, 본 발명의 문맥에서 용어 "항체"는 하기 본원에 기재된 숙주에서 발현될 수 있는 항체 작제물, 예를 들면, 특히 바이러스 또는 플라스미드 벡터를 통해 형질감염 및/또는 형질도입될 수 있는 항체 작제물을 포함한다.

추가로, 본원에 사용된 용어 "항체"는 또한 기재된 항체와 동일한 특이성을 나타내는 본원에 기재된 항체의 유도체 또는 변이체에 관한 것이다.

용어 "항원-결합 도메인", "항원-결합 단편" 및 항체 결합 영역"은, 본원에 사용되는 경우, 항체와 항원 사이의 특이적 결합에 관여하는 아미노산을 포함하는 항체 분자의 일부를 지칭한다. 항체에 의해 특이적으로 인식되거나 결합되는 항원의 부분은 상기 본원에 기재된 바와 같이 "에피토프"로서 지칭된다. 상기 언급된 바와 같이, 항원-결합 도메인은 통상 항체 경쇄 가변 영역(VL) 및 항체 중쇄 가변 영역(VH)을 포함하지만, 둘 다를 포함하지 않아야 한다. 예를 들면, Fd 단편은 2개의 VH 영역을 갖고, 종종 완전한 항원-결합 도메인의 일부 항원-결합 기능을 보유한다. 항체의 항원-결합 단편의 예는 (1) Fab 단편, VL, VH, CL 및 CH1 도메인을 갖는 일가 단편; (2) F(ab')2 단편, 힌지 영역에서 디설파이드 브릿지에 의해 연결된 2개의 Fab 단편을 갖는 이가 단편; (3) 2개의 VH 및 CH1 도메인을 갖는 Fd 단편; (4) 항체의 단일 암의 VL 및 VH 도메인을 갖는 Fv 단편; (5) VH 도메인을 갖는 dAb 단편[참조: Ward et al., (1989) Nature 341 :544-546]; (6) 분리된 상보성 결정 영역(CDR), 및 (7) 일본쇄 Fv(scFv)를 포함한다. Fv 단편의 2개 도메인, VL 및 VH가 별개의 유전자에 대해 코딩되어 있지만, 이들은 일가 분자를 형성하기 위해 VL 및 VH 영역이 쌍을 이루고 있는 단일 단백질 쇄로서 제조될 수 있게 하는 합성 링커에 의해 재조합 방법을 사용하여 결합시킬 수 있다[일본쇄 Fv (scFv)로서 공지됨; 참조: Huston et al. (1988) Proc. Natl. Acad. Sci USA 85:5879-5883]. 이들 항체 단편은 당해 기술분야의 숙련가에게 공지된 통상의 기술을 사용하여 수득되고, 단편은 완전한 항체와 동일한 방식으로 기능에 대해 평가된다.

본원에 사용되는 용어 "모노클로날 항체"는 실질적으로 균일한 항체의 모집단으로부터 수득된 항체를 지칭하고, 즉 상기 모집단을 구성하는 개개 항체는 소량으로 존재할 수 있는 가능한 자연 발생 돌연변이체 및/또는 번역후 변형체(예: 이성화, 아미드화)를 제외하고는 동일하다. 모노클로날 항체는 단일 항원성 부위에 대해 고도로 특이적, 지향되어 있다. 추가로, 상이한 결정기(에피토프)에 대해 지향된 상이한 항체를 일반적으로 포함하는 통상의 (폴리클로날) 항체 제제와 대조적으로, 각각의 모노클로날 항체는 항원 상의 단일 결정기에 대해 지향된다. 이들의 특이성에 추가하여, 모노클로날 항체는 이들이 다른 면역글로불린에 의해 오염되지 않은 하이브리도마 배양에 의해 합성된다는 점에서 유리하다. 변형태 "모노클로날"은 항체의 실질적으로 균질한 모집단으로부터 수득되는 항체의 특성을 나타내고, 임의의 특정 방법에 의한 항체의 생성을 필요로 하는 것으로 해석되지 않아야 한다. 예를 들면, 본 발명에 따라 사용되는 모노클로날 항체는 문헌[참조: Kohler et al., Nature, 256: 495 (1975)]에 최초로 기재된 하이브리도마 방법에 의해 제조할 수 있거나, 재조합 DNA 방법[참조: U.S. 특허 4,816,567]에 의해 제조할 수 있다. "모노클로날 항체"는 또한, 예를 들면, 문헌[참조: Clackson et al., Nature, 352: 624-628 (1991) and Marks et al., J. Mol. Biol., 222: 581-597 (1991)]에 기재된 기술을 사용하여 파지 항체 라이브러리로부터 분리할 수 있다.

용어 "인간 항체"는, 예를 들면, 카바트 등[참조: Kabat et al. (1991) loc. cit]에 기재된 것들을 포함하여 당해 기술분야에 공지된 인간 생식계 면역글로불린 서열에 실질적으로 상응하는 가변 및 불변 영역을 갖는 항체를 포함한다. 본 발명의 인간 항체는, 예를 들면, CDR 및 특히 CDR3에서 인간 생식계 면역글로불린 서열에 의해 코딩되지 않은 아미노산 서열(예: 시험관내 랜덤 또는 부위-특이적 돌연변이유발 또는 생체내 체세포 돌연변이에 의해 도입된 돌연변이)을 포함할 수 있다. 인간 항체는 인간 생식계 면역글로불린 서열에 의해 코딩되지 않은 아미노산 잔기로 대체된 적어도 1개, 2개, 3개, 4개, 5개 또는 그 이상의 위치를 가질 수 있다. 본원에서 사용된 인간 항체의 정의는 또한 제노미스(Xenomice) 등의 시스템을 사용한 기술을 사용함으로써 유도할 수 있는 것과 같은 항체의 비-인공적 및/또는 유전자적으로 변화된 인간 서열을 포함하는 완전 인간 항체를 고려하는 것이 강조된다.

"항체 변이체"의 예는 비-인간 항체의 인간화 변이체, "친화성 돌연변이된" 항체[참조: Hawkins et al. J. Mol. Biol. 254, 889-896 (1992) and Lowman et al., Biochemistry 30, 10832- 10837 (1991)] 및 변화된 효과기 기능(들)을 갖는 항체 돌연변이체[참조: US Patent 5, 648, 260, Kontermann and Dubel (2010), loc. cit. and Little(2009), loc. cit]를 포함한다.

본원에 사용된 바와 같이, "시험관내 생성된 항체"는 가변 영역의 전부 또는 일부(예: 적어도 하나의 CDR)가 비-면역 세포 선택(예: 후보 서열이 항원에 결합하는 이들의 능력에 대해 시험될 수 있는 시험관내 파지 디스플레이, 단백질 칩 또는 임의의 기타 방법)으로 생성되는 항체를 지칭한다. 따라서, 이 용어는 바람직하게는 면역 세포에서 게놈 재정렬에 의해 생성된 서열을 제외한다.

함께 VH 및 VL의 짝짓기는 단일 항원-결합 부위를 형성한다. VH에 가장 인접한 CH 도메인은 CH1로서 지정된다. 각각의 L 쇄는 하나의 공유 디설파이드 결합에 의해 H 쇄에 연결되고, 2개의 H 쇄는 H 쇄 이소형에 따라 하나 이상의 디설파이드 결합에 의해 서로 연결된다. VH 및 VL 도메인은 프레임워크 영역(FR1, FR2, FR3 및 FR4)으로 불리우는 비교적 보존된 서열의 4개 영역으로 구성되고, 이들 영역은 초가변 서열의 3개 영역(상보성 결정 영역, CDR)을 위한 스캐폴드를 형성한다. CDR은 항체와 항원의 특이적 상호작용에 관여하는 대부분의 잔기를 함유한다. CDR은 CDR1, CDR2 및 CDR3으로 지칭된다. 따라서, 중쇄 상의 CDR 성분은 H1, H2 및 H3으로 지칭되는 반면, 경쇄 상의 CDR 성분은 L1, L2 및 L3로서 지칭된다.

용어 "가변"은 이들의 서열에서 가변성을 나타내고 특정 항체의 특이성 및 결합 친화성의 결정에 관여하는 면역글로불린 도메인의 부분을 지칭한다(즉, "가변 도메인(들)"). 가변성은 항체의 가변 도메인 전체에 걸쳐 균일하게 분포되지 않고; 각각의 중쇄 및 경쇄 가변 영역의 서브-도메인에 집중되어 있다. 이들 서브-도메인은 "초가변" 영역 또는 "상보성 결정 영역"(CDR)으로 불리운다. 가변 도메인의 보다 보존된(즉, 비-초가변성) 부분은 "프레임워크" 영역(FRM)으로 불리운다. 자연 발생 중쇄 및 경쇄의 가변 도메인은 각각 3개의 초가변 영역에 의해 연결된, 주로 β-시트 배치를 채용하는 4개의 FRM 영역을 포함하고, 상기 초가변 영역은 β-시트 구조를 연결하고 일부 경우에 이의 일부를 형성하는 루프를 형성한다. 각 쇄에서 초가변 영역은 FRM에 의해 근접하여 함께 유지되고, 다른 쇄로부터 초가변 영역과 함께 항원-결합 부위의 형성에 관여한다[참조: Kabat et al., loc. cit]. 불변 도메인은 항원 결합에 직접 관여하지 않지만, 예를 들면, 항체-의존성, 세포-매개된 세포독성 및 보체 활성화 등의 다양한 효과기 기능을 나타낸다.

용어 "CDR" 및 복수형 "CDRs"는 3개가 경쇄 가변 영역(CDRL1, CDRL2 및 CDRL3)의 결합 특성을 구성하고 3개가 중쇄 가변 영역(CDRH1, CDRH2 및 CDRH3)의 결합 특성을 구성하는 상보성 결정 영역(CDR)을 지칭한다. CDR은 항체 분자의 기능 활성에 기여하고, 스캐폴드 또는 프레임워크 영역을 포함하는 아미노산 서열에 의해 분리되어 있다. 정확한 정의의 CDR 경계 및 길이는 상이한 분류 및 넘버링 시스템으로 제공된다. 따라서, CDR은 본원에 기재된 넘버링 시스템을 포함하여 카카트(Kabat), 코티아(Chothia), 접촉 또는 임의의 기타 경계 정의에 의해 지칭될 수 있다. 상이한 경계에도 불구하고, 각각의 이들 시스템은 가변 서열 내에 소위 "초가변 영역"을 구성하는 것에 있어서 어느 정도의 중첩을 갖는다. 따라서, 이들 시스템에 따르는 CDR 정의는 인접한 프레임워크 영역과 관련하여 길이 및 경계 영역이 상이하다[참조: Kabat, Chothia, and/or MacCallum (Kabat et al., loc. cit.; Chothia et al., J. MoI. Biol, 1987, 196: 901; and MacCallum et al., J. MoI. Biol, 1996, 262: 732)]. 그러나, 소위 카바트 시스템에 따르는 넘버링이 바람직하다. 경쇄의 CDR3 및 특히 중쇄의 CDR3은 경쇄 및 중쇄 가변 영역 내의 항원 결합에 있어서 가장 중요한 결정기를 구성할 수 있다. 일부 항체 작제물에서, 중쇄 CDR3은 항원과 항체 사이의 접촉의 주요 영역을 구성하는 것을 나타낸다. CDR3 단독이 변화되는 시험관내 선택 도식은 항체의 결합 특성을 변화시키거나 어떠한 잔기가 항원의 결합에 기여하는지를 결정하기 위해 사용할 수 있다.

"~으로 실질적으로 이루어진"은 아미노산 서열이 인용된 서열번호의 서열과 비교하여 약 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 또는 15% 상이할 수 있고 본원에 기재된 바와 같은 생물학적 활성을 여전히 보유하는 것을 의미한다.

일부 실시형태에서, 본 발명의 항체 작제물은 분리된 단백질 또는 실질적으로 순수한 단백질이다. "분리된" 단백질은 이의 자연 상태에서 정상적으로 연관되는 적어도 일부 물질에 의해 수반되고, 예를 들면, 소정 샘플 중의 전체 단백질의 적어도 약 5% 또는 적어도 약 50중량%를 구성한다. 분리된 단백질은 상황에 따라 전체 단백질 함량의 5 내지 99.9중량%를 구성할 수 있는 것으로 이해된다. 예를 들면, 단백질은, 당해 단백질이 증가된 농도 수준으로 제조되도록, 유도 프로모터 또는 고발현 프로모터의 사용을 통해 현저히 보다 높은 농도로 제조될 수 있다. 상기 정의는 당해 기술분야에 공지되어 있는 다양한 생물 및/또는 숙주 세포에서 항원 결합 단백질의 생성을 포함한다.

아미노산 서열의 경우, 서열 동일성 및/또는 유사성은 당해 기술분야에 공지된 표준 기술을 사용하여 결정되고, 이로써 한정되는 것은 아니지만, 국소 서열 동일성 알고리즘[참조: Smith and Waterman, 1981, Adv. Appl. Math. 2:482], 서열 동일성 정렬 알고리즘[참조: Needleman and Wunsch, 1970, J. Mol. Biol. 48:443], 유사성 방법에 대한 연구[참조: Pearson and Lipman, 1988, Proc. Nat. Acad. Sci. U.S.A. 85:2444], 이들 알고리즘의 컴퓨터 실행[참조: GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Drive, Madison, Wis], 바람직하게는 디펄트 설정을 사용하거나 검사에 의해 문헌[참조: Devereux et al., 1984, Nucl. Acid Res. 12:387-395]에 기재된 베스트 피트 서열 프로그램을 포함한다. 바람직하게는, 퍼센트 동일성은 하기 파라미터에 기반하여 FastDB에 의해 계산된다: 1의 부정합 패널티; 1의 갭 패널티; 0.33의 갭 사이즈 패널티; 및 30의 결합 패널티[참조: "Current Methods in Sequence Comparison and Analysis," Macromolecule Sequencing and Synthesis, Selected Methods and Applications, pp 127-149 (1988), Alan R. Liss, Inc].

유용한 알고리즘의 예는 PILEUP이다. PILEUP은 혁신적 짝짓기 정렬을 사용하여 관련 서열 그룹으로부터 복수 서열 정렬을 작성한다. 이는 또한 상기 정렬을 작성하기 위해 사용된 클러스터링 관계를 나타내는 트리를 플롯할 수 있다. PILEUP은 혁신적 정렬 방법의 단순화를 사용하고[참조: Feng & Doolittle, 1987, J. Mol. Evol. 35:351-360]; 상기 방법은 문헌[참조: Higgins and Sharp, 1989, CABIOS 5:151-153]에 기재된 것과 유사하다. 유용한 PILEUP 파라미터는 3.00의 디펄트 갭 중량, 0.10의 디펄트 갭 길이 및 칭량된 말단 갭을 포함한다.

유용한 알고리즘의 또 다른 예는 문헌[참조: Altschul et al., 1990, J. Mol. Biol. 215:403-410; Altschul et al., 1997, Nucleic Acids Res. 25:3389-3402; and Karin et al., 1993, Proc. Natl. Acad. Sci. U.S.A. 90:5873-5787]에 기재된 BLAST 알고리즘이다. 특히 유용한 BLAST 프로그램은 문헌[참조: Altschul et al., 1996, Methods in Enzymology 266:460-480]으로부터 수득된 WU-BLAST-2 프로그램이다. WU-BLAST-2는 수개의 검색 파라미터를 사용하고, 대부분은 디펄트 값으로 설정된다. 조절가능한 파라미터는 하기 값으로 설정된다: 중첩 스팬=1, 중첩 프랙션=0.125, 원드 역치(T)=II. HSP S 및 HSP S2 파라미터는 동적 값이고, 특정 서열의 조성 및 목적하는 서열이 검색되는 특정 데이터베이스의 조성에 따라 프로그램 자체에 의해 확립되지만, 상기 값은 감도를 증가시키기 위해 조정할 수 있다.

추가의 유용한 알고리즘은 문헌[참조: Altschul et al., 1993, Nucl. Acids Res. 25:3389-3402]에 의해 보고된 바와 같은 갭이 있는 BLAST이다. 갭이 있는 BLAST는 BLOSUM-62 치환 스코어를 사용하고; 역치 T 파라미터는 9로 설정하고; 갭이 없는 확장을 유발하기 위한 2개의 적중 방법은 k의 갭 길이를 10+k의 비용으로 충전하고; Xg는 데이터베이스 검색 단계의 경우에 40으로 설정하고 알고리즘의 출력 단계의 경우에 67로 설정했다. 갭이 있는 정렬은 약 22비트에 상응하는 스코어에 의해 유발된다.

일반적으로, 개개 변이체 CDR 사이의 아미노산 상동성, 유사성 또는 동일성은 본원에 제시된 서열에 대해 적어도 80%이고, 보다 전형적으로 바람직하게는 적어도 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 및 거의 100%의 증가하는 상동성 또는 동일성을 갖는다. 유사한 방식으로, 본원에서 동정된 결합 단백질의 핵산 서열과 관련하여 "퍼센트(%) 핵선 서열 동일성"은 항원 결합 단백질의 코딩 서열 중의 뉴클레오티드 잔기와 동일한 후보 서열 중의 뉴클레오티드 잔기의 퍼센트로서 정의된다. 구체적인 방법은, 각각 1 및 0.125로 설정된 중첩 스판 및 중첩 프랙션을 갖는 디펄트 파라미터로 설정된 WU-BLAST-2의 BLASTN 모듈을 이용한다.

일반적으로, 개개 변이체 CDR을 코딩하는 뉴클레오티드 서열과 본원에 제시된 뉴클레오티드 서열 사이의 핵산 서열 상동성, 유사성 또는 동일성은 적어도 80%이고, 보다 전형적으로 적어도 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 또는 99%, 및 거의 100%의 바람직하게 증가하는 상동성 또는 동일성을 갖는다.

따라서, "변이체 CDR"은 본 발명의 친 CDR에 대해 지정된 상동성, 유사성 또는 동일성을 갖는 것이고, 이로써 한정되지 않지만, 적어도 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 또는 99%의 친 CDR의 특이성 및/또는 활성을 포함하는 생물학적 기능을 공유한다.

아미노산 서열 변이를 도입하는 부위 또는 영역은 예비결정되지만, 돌연변이 자체는 예비결정되지 않는다. 예를 들면, 소정 부위에서 돌연변이의 성능을 최적화하기 위해, 랜덤 돌연변이유발은 표적 코돈 또는 영역에서 수행될 수 있고, 발현된 항원 결합 단백질 CDR 변이체는 목적하는 활성의 최적 조합에 대해 스크리닝된다. 공지된 서열을 갖는 DNA에서 예비결정된 부위에서 치환 돌연변이를 작제하는 기술, 예를 들면, M13 프라이머 돌연변이유발 및 PCR 돌연변이유발은 공지되어 있다. 돌연변이체의 스크리닝은 CDH19 결합 등의 항원 결합 단백질 활성의 검정을 사용하여 수행한다.

용어 "아미노산" 또는 "아미노산 잔기"는, 변형된, 합성 또는 희소 아미노산이 경우에 따라 사용될 수 있지만, 전형적으로 다음으로 이루어진 그룹으로부터 선택된 아미노산 등과 같이 당해 기술분야에서 인식되는 정의를 갖는 아미노산을 지칭한다: 알라닌(Ala 또는 A); 아르기닌(Arg 또는 R); 아스파라긴(Asn 또는 N); 아스파르트산(Asp 또는 D); 시스테인(Cys 또는 C); 글루타민(GIn 또는 Q); 글루탐산(GIu 또는 E); 글리신(GIy 또는 G); 히스티딘(His 또는 H); 이소류신(He 또는 I): 류신(Leu 또는 L); 리신(Lys 또는 K); 메티오닌(Met 또는 M); 페닐알라닌(Phe 또는 F); 프롤린(Pro 또는 P); 세린(Ser 또는 S); 트레오닌(Thr 또는 T); 트립토판(Trp 또는 W); 티로신(Tyr 또는 Y); 및 발린(VaI 또는 V). 일반적으로, 아미노산은 비극성 측쇄(예: Ala, Cys, He, Leu, Met, Phe, Pro, VaI); 음으로 하전된 측쇄(예: Asp, GIu); 양으로 하전된 측쇄(예: Arg, His, Lys); 또는 하전되지 않은 극성 측쇄(예: Asn, Cys, GIn, GIy, His, Met, Phe, Ser, Thr, Trp 및 Tyr)를 갖는 것으로 분류할 수 있다.

용어 "초가변 영역"(또한 "상보성 결정 영역" 또는 CDR로서 공지됨)은, 본원에서 사용되는 경우, 항원-결합 부위를 형성하고 항원 특이성의 주요 결정인자인 면역글로불린의 V-영역 도메인 내에 존재하는 항체의 아미노산 잔기(통상 극단적 서열 가변성의 3 또는 4개의 짧은 영역)를 지칭한다. CDR 잔기를 동정하는 적어도 2개의 방법이 있다: (1) 교차-종 서열 가변성에 기반한 접근법[참조: Kabat et al., loc. cit]; 및 (2) 항원-항체 복합체의 결정학 연구에 기반한 접근법[참조: Chothia, C. et al., J. Mol. Biol. 196: 901-917 (1987)]. 그러나, 2개의 잔기 동정 기술이 중첩 영역을 한정하지만 동일한 영역을 한정하지 않는 정도로, 이들은 하이브리드 CDR을 정의하기 위해 조합될 수 있다. 그러나, 일반적으로, CDR 잔기는 바람직하게는 소위 카바트(Kabat)(넘버링) 시스템에 따라 특정된다.

용어 "프레임워크 영역"은 보다 상이한(즉, 초가변성) CDR 사이에 존재하는 항체 가변 영역의 당해 기술분야에 인식되는 부분을 지칭한다. 이러한 프레임워크 영역은 전형적으로 프레임워크 1 내지 4(FR1, FR2, FR3 및 FR4)로서 지칭되고, 항원-결합 표면을 형성하기 위해 3차원 공간에서 6개 CDR(중쇄로부터 3개 및 경쇄로부터 3개)의 제시를 위한 골격을 제공한다.

전형적으로, CDR은 정규 구조로서 분류될 수 있는 루프 구조를 형성한다. 용어 "정규 구조"는 항원 결합 (CDR) 루프에 의해 채용되는 주쇄 입체구조를 지칭한다. 경쟁 구조 연구로부터, 6개 항원 결합 루프 중의 5개는 이용가능한 입체구조의 제한된 레퍼토리만을 갖는 것으로 밝혀졌다. 각각의 정규 구조는 폴리펩티드 골격의 비틀림 각에 의해 특성화할 수 있다. 따라서, 항체 사이의 특파 루프는 루프의 대부분에서 높은 아미노산 가변성에도 불구하고 매우 유사한 3차원 구조를 갖는다[참조: Chothia and Lesk, J. MoI. Biol., 1987, 196: 901; Chothia et al., Nature, 1989, 342: 877; Martin and Thornton, J. MoI. Biol, 1996, 263: 800, 각각은 이의 전체가 참조로서 도입된다]. 추가로, 채용된 루프 구조와 이를 둘러싸는 아미노산 서열과의 사이에 관계가 존재한다. 특정 정규 부류의 입체구조는 루프의 길이, 및 루프 뿐만 아니라 보존된 프레임워크(즉, 루프 외부) 내의 주요 위치에 존재하는 아미노산 잔기에 의해 결정된다. 따라서, 특정 정규 부류에 대한 할당은 이들 주요 아미노산 잔기의 존재에 기반하여 이루어질 수 있다. 용어 "정규 구조"는 또한, 예를 들면, 카바트에 의해 카탈로그화된 항체의 선형 서열에 대한 고려를 포함할 수 있다[참조: Kabat et al., loc. cit]. 카바트 넘버링 스킴(시스템)은 일관된 방식으로 항체 가변 도에민의 아미노산 잔기를 넘버링하기 위한 광범위하게 채용된 표준이고, 또한 본원의 다른 부분에서 언급된 바와 같이 본원에서 적용된 바람직한 스킴이다. 추가의 구조적 고찰은 또한 항체의 정규 구조를 결정하기 위해 사용될 수 있다. 예를 들면, 카바트 넘버링에 의해 완전히 반영되지 않은 이들 차이는 코티아 등의 넘버링 시스템에 의해 기재될 수 있고/있거나 다른 기술, 예를 들면, 결정학 및 2차원 또는 3차원 컴퓨터 모델링에 의해 밝혀질 수 있다. 따라서, 소정 항체 서열은, 그 중에서, 적절한 샤시 서열을 동정하는 것을 가능하게 하는 정규 부류로 배치할 수 있다(예를 들면, 라이브러리에 정규 구조의 다양성을 포함시키기 위한 욕구에 기반함). 문헌[참조: Chothia et al., loc. cit]에 기재된 바와 같은 항체 아미노산 서열의 카바트 넘버링 및 구조적 고려 및 항체 구조의 정규 양상을 해석하기 위한 이들의 영향은 문헌에 기재되어 있다.

CDR3은 전형적으로 항체-결합 부위 내의 분자 다양성의 최대 공급원이다. 예를 들면, H3은 2개 아미노산 잔기와 같이 짧거나 26개 초과의 아미노산일 수 있다. 상이한 부류의 면역글로불린의 아단위 구조 및 3차원 구조는 당해 기술분야에 공지되어 있다. 항체 연구의 고찰에 대해서는 문헌[참조: Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, eds. Harlow et al., 1988]을 참조한다. 당해 기술분야의 숙련가는 각각의 아단위 구조, 예를 들면, CH, VH, CL, VL, CDR, FR 구조가 활성 단편, 예를 들면, VH, VL의 일부 또는 항원에 결합하는 CDR 아단위, 즉 항원-결합 단편, 또는, 예를 들면, Fc 수용체 및/또는 보체에 결합하고/하거나 이를 활성화시키는 CH 아단위의 일부를 포함한다는 것을 인식할 것이다. CDR은 전형적으로 문헌[참조: Sequences of Proteins of immunological Interest, US Department of Health and Human Services (1991), eds. Kabat et al]에 기재된 바와 같은 카바트 CDR을 지칭한다. 항원 결합 부위를 특성화하는 또 다른 기준은 코티아에 기재된 바와 같은 초가변 루프를 참조하는 것이다[참조: Chothia, et al. (1987; J. MoI. Biol. 227:799-817); and Tomlinson et al. (1995) EMBO J. 14: 4628-4638]. 또 다른 기준은 옥스포드 분자 AbM 항체 모델링 소프트웨어에 의해 사용된 AbM 정의이다[참조: 일반적으로, 예를 들면, Protein Sequence and Structure Analysis of Antibody Variable Domains. In: Antibody Engineering Lab Manual (Ed.: Duebel, S. and Kontermann, R., Springer-Verlag, Heidelberg)]. 카바트 CDR과 관련하여 기재된 실시형태는 코티아 초가변 루프 또는 AbM-정의된 루프와 관련하여 유사하게 기재된 관계를 사용하여 대안적으로 실시할 수 있다.

조립 및 체세포 돌연변이 후의 항체 유전자의 서열은 매우 다양하고, 이들 다양한 유전자는 1010 상이한 항체 분자를 코딩하는 것으로 추정된다[참조: Immunoglobulin Genes, 2nd ed., eds. Jonio et al., Academic Press, San Diego, CA, 1995]. 따라서, 면역계는 면역글로불린의 레퍼토리를 제공한다. 용어 "레퍼토리"는 적어도 하나의 면역글로불린을 코딩하는 적어도 하나의 서열로부터 완전히 또는 부분적으로 유래하는 적어도 하나의 뉴클레오티드 서열을 지칭한다. 서열(들)은 중쇄의 V, D 및 J 세그먼트 및 경쇄의 V 및 J 세그먼트의 생체내 재정렬에 의해 생성될 수 있다. 또는, 서열(들)은 재정렬이 발생하는 반응, 예를 들면, 시험관내 자극으로 세포로부터 생성될 수 있다. 또는, 서열(들)의 일부 또는 전부는 DNA 스플라이싱, 뉴클레오티드 합성, 돌연변이유발 및 기타 방법에 의해 수득할 수 있다[참조: 미국 특허 제5,565,332호]. 레터토리는 하나의 서열만을 포함하거나, 유전적으로 다양한 모집단 중의 하나를 포함하는 복수의 서열을 포함할 수 있다.

본 명세서의 측면에서 용어 "결합 분자" 또는 "항체 작제물"은 표적 분자 CDH19 및 CD3과 (특이적으로) 결합 또는 상호작용하거나 이를 인식할 수 있는 임의의 분자를 나타낸다. 이러한 분자 또는 작제물은 단백질성 부분 및 비-단백질성 부분(예: 글루타르알데히드 등의 화학적 링커 또는 화학적 가교-결합제)을 포함할 수 있다.

링커가 사용되는 경우, 이러한 링커는 바람직하게는 각각의 제1 및 제2 도메인이 서로 독립적으로 이들의 차동 결합 특이성을 보유할 수 있는 것을 보장하기에 충분한 길이 및 서열을 갖는다. 가장 바람직하게는 및 첨부된 실시예에 기재된 바와 같이, 본 발명의 항체 작제물은 "이중특이적 일본쇄 항체 작제물", 보다 바람직하게는 이중특이적 일본쇄 Fv(scFv)이다. 이중특이적 일본쇄 분자는 당해 기술분야에 공지되어 있고, 문헌[참조: WO 99/54440, Mack, J. Immunol. (1997), 158, 3965-3970, Mack, PNAS, (1995), 92, 7021-7025, Kufer, Cancer Immunol. Immunother., (1997), 45, 193-197, Loffler, Blood, (2000), 95, 6, 2098-2103, Bruhl, Immunol., (2001), 166, 2420-2426, Kipriyanov, J. Mol. Biol., (1999), 293, 41-56]에 기재되어 있다.

본원에 기재된 항체 작제물에 포함된 상기 가변 도메인은 추가의 링커 서열에 의해 연결될 수 있다. 용어 "펩티드 링커"는 본 발명의 항체 작제물의 제1 도메인 및 제2 도메인의 아미노산이 서로 결합됨으로써 본 발명에 따라 정의된다. 이러한 펩티드 링커의 필수 기술적 특징은 임의의 중합 활성을 포함하지 않는다. 적합한 펩티드 링커 중에는 미국 특허 제4,751,180호 및 제4,935,233호 또는 WO 88/09344에 기재된 것들이 있다. 펩티드 링커의 바람직한 실시형태는 아미노산 서열 Gly-Gly-Gly-Gly-Ser, 즉 Gly4Ser, 또는 이의 중합체, 즉 (Gly4Ser)x(여기서, x는 정수 1 이상이다)를 특징으로 한다. 제2 구조의 촉진이 존재하지 않는 상기 펩티드 링커의 특성은 당해 기술분야에 공지되어 있고, 예를 들면, 문헌[참조: Dall'Acqua et al. (Biochem. (1998) 37, 9266-9273), Cheadle et al. (Mol Immunol (1992) 29, 21-30) and Raag and Whitlow (FASEB (1995) 9(1), 73-80]에 기재되어 있다. 또한, 임의의 제2 구조를 촉진하지 않는 펩티드 링커가 바람직하다. 상기 도메인의 서로에 대한 결합은, 예를 들면, 실시예에 기재된 바와 같이 유전자 조작에 의해 제공될 수 있다. 융합된 및 작동적으로 연결된 이중특이적 일본쇄 작제물을 제조하고 이들을 포유동물 세포 또는 세균에서 발현시키는 방법은 당해 기술분야에 공지되어 있다[참조: WO 99/54440 또는 Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 2001].

본 발명의 항체 작제물에서 적어도 2개의 결합 도메인을 연결하는 펩티드 링커의 경우, 소수의 아미노산 잔기, 예를 들면, 12개 이하의 아미노산 잔기만을 포함하는 펩티드 링커가 바람직하다. 따라서, 12, 11, 10, 9, 8, 7, 6 또는 5개 아미노산 잔기의 펩티드 링커가 바람직하다. 5개 미만의 아미노산을 갖는 상정된 펩티드 링커는 4, 3, 2 또는 1개의 아미노산(들)을 포함하고, 여기서 Gly-풍부 링커가 바람직하다. 상기 "펩티드 링커"의 문맥에서 특히 바람직한 "단일" 아미노산은 Gly이다. 따라서, 상기 펩티드 링커는 단일 아미노산 Gly로 이루어질 수 있다.

본원에 사용된 용어 "다중특이적"은 항체 작제물이고 적어도 제1 및 제2 결합 도메인을 포함하는 결합 분자를 지칭하고, 여기서 제1 결합 도메인은 하나의 항원 또는 표적에 결합할 수 있고, 제2 결합 도메인은 또 다른 항원 또는 표적에 결합할 수 있다. 따라서, 본 발명에 따른 항체 작제물은 2개의 상이한 항원 또는 표적에 대해 적어도 특이성을 포함하고, 적어도 이중특이성이다. 본 발명의 "항체 작제물"은 또한 다중특이적 결합 분자, 예를 들면, 삼중특이적 결합 분자를 포함하고, 후자의 분자는 3개의 결합 도메인을 포함한다.

또한, 본 발명의 항체 작제물은, 표적 분자 CDH19 및 CD3에 결합하는 이의 기능에 추가하여, 추가 기능을 갖는 것으로 상정된다. 이러한 포맷에서, 항체 작제물은, CDH19에 대한 결합을 통해 혈장 세포를 표적화하고 CD3 결합을 통해 세포독성 T 세포를 매개하고 추가 기능, 예를 들면, NK 세포 등의 효과기 세포의 동원, 표지(형광 등), 예를 들면, 독소 또는 방사선핵종 등의 치료제 및/또는 혈청 반감기 등을 증강시키는 수단을 통해 항체-의존성 세포 세포독성을 매개하는 완전한 기능적 Fc 불변 도메인을 제공함으로써 삼기능성 또는 다기능성 항체 작제물이다.

용어 "결합 도메인"은 표적 분자 CDH19 및 CD3 상의 소정 표적 에피토프 또는 소정 표적 부위와 특이적으로 결합/상호작용할 수 있는 도메인을 본 발명과 관련하여 특성화한다.

결합 도메인은, 예를 들면, 항체 등의 결합 도메인 공여체로부터 유래할 수 있다. 본 발명의 결합 도메인은 표적 분자 CDH19 및 CD3 상의 소정 표적 에피토프 또는 소정 표적 부위와의 결합/상호작용에 요구되는 임의의 상술한 결합 도메인의 적어도 상기 부분을 포함하는 것으로 상정된다.

상술된 결합 도메인 공여체의 결합 도메인은 각각의 표적과의 결합에 관여할 수 있는 이들 공여체의 당해 부분을 특징으로 하고, 즉 당해 부분이 결합 도메인 공여체로부터 제거되는 경우 상기 공여체는 이의 결합 능력을 상실한다. "상실"은, 결합 도메인과 비교하는 경우, 결합 능력의 적어도 50%의 감소를 의미한다. 이들 결합 부위를 맵핑하는 방법은 당해 기술분야에 공지되어 있다. - 따라서, 결합 도메인 공여체의 결합 부위를 배치/맵핑하고 따라서 각각의 결합 도메인 공여체로부터 상기 결합 도메인을 "유도"하는 것을 당해 기술분야의 숙련가의 표준 지식 내에 있다.

용어 "에피토프"는 결합 도메인, 예를 들면, 항체 또는 면역글로불린, 또는 항체 또는 면역글로불린의 유도체 또는 단편이 특이적으로 결합하는 항원 상의 부위를 지칭한다. "에피토프"는 항원성이고, 따라서 용어 에피토프는 종종 본원에서 "항원성 구조" 또는 "항원성 결정인자"로서 지칭된다. 따라서, 결합 도메인은 "항원-상호작용-부위"이다. 상기 결합/상호작용은 또한 "특이적 인식"을 정의하는 것으로 이해된다. 한 가지 예에서, 표적 분자 CDH19 및 CD3 상의 소정 표적 에피토프 또는 소정 표적 부위와 (특이적으로) 결합/상호작용하는 상기 결합 도메인은 항체 또는 면역글로불린이고, 상기 결합 도메인은 항체 또는 면역글로불린의 VH 및/또는 VL 영역이다.

"에피토프"는 단백질의 3차 폴딩에 의해 병치된 연속 아미노산 또는 비-연속 아미노산 둘 다에 의해 형성될 수 있다. "선형 에피토프"는 아미노산 1차 서열이 인식된 에피토프를 포함하는 에피토프이다. 선형 에피토프는 전형적으로 특유의 서열 중에 적어도 3개 또는 적어도 4개, 및 보다 일반적으로 적어도 5개 또는 적어도 6개 또는 적어도 7개, 예를 들면, 약 8 내지 약 10개 아미노산을 포함한다.

선형 에피토프와 대조적으로, "입체구조 에피토프"는 에피토프를 포함하는 아미노산의 1차 서열이 인식된 에피토프의 유일한 정의 성분이 아닌 에피토프이다(예를 들면, 아미노산의 1차 서열이 결합 도메인에 의해 반드시 인식되는 것은 아닌 에피토프). 전형적으로, 입체구조 에피토프는 선형 에피토프에 대하여 증가된 수의 아미노산을 포함한다. 입체구조 에피토프의 인식과 관련하여, 결합 도메인은 항원, 바람직하게는 펩티드 또는 단백질 또는 이의 단편의 3차원 구조를 인식한다(본 발명의 문맥에서, 결합 도메인 중의 하나에 대한 항원은 CDH19 단백질 중에 포함된다). 예를 들면, 단백질 분자가 3차원 구조를 형성하기 위해 폴딩되는 경우, 입체구조 에피토프를 형성하는 특정 아미노산 및/또는 폴리펩티드 골격은 병치되어 항체가 에피토프를 인식하는 것을 가능하게 한다. 에피토프의 입체구조를 결정하는 방법은, 이로써 한정되지 않지만, x-선 결정학, 2차원 핵 자기 공명(2D-NMR) 분광법 및 부위 지시된 스핀 표지화 및 전자 상자성 공명(EPR) 분광법을 포함한다. 더욱이, 제공된 실시예는 소정 결합 도메인이 소정 단백질, 특히 CDH19의 하나 이상의 에피토프 클러스터(들)에 결합하는지에 대한 시험을 포함하여 비닝의 방식으로 소정 결합 도메인을 특성화하는 추가 방법을 기재한다.

본원에 사용된 바와 같이, 용어 "에피토프 클러스터"는 항원의 정의된 연속 스트레치 내에 있는 에피토프의 전체를 나타낸다. 에피토프 클러스터는 1, 2 또는 그 이상의 에피토프를 포함할 수 있다. 에피토프 클러스터의 개념은 또한 본 발명의 항체 작제물의 기능의 특성화에 사용된다.

용어 "~에 결합(할 수 있는)하는", "특이적으로 인식하는", "~에 대해 지향되는" 및 "~와 반응하는"은 결합 도메인이 에피토프의 하나 이상, 바람직하게는 적어도 2개, 보다 바람직하게는 적어도 3개 및 가장 바람직하게는 적어도 4개 아미노산과 특이적으로 상호작용할 수 있는 것을 본 발명에 따라 의미한다.

본원에 사용된 바와 같이, 용어 "~와 특이적으로 상호작용하는", "~와 특이적으로 결합하는" 또는 "~와 특이적으로 결합한다"는 결합 도메인이 특정 단백질 또는 항원에 대해 상당한 친화성을 나타내고, 일반적으로 CDH19 또는 CD3 이외의 단백질 또는 항원과 유의한 반응성을 나타내지 않는 것을 의미한다. "상당한 친화성"은 약 10-6(KD) 이상의 친화성을 갖는 결합을 포함한다. 바람직하게는, 결합은, 결합 친화성이 10-12 내지 10-8 M, 10-12 내지 10-9 M, 10-12 내지 10-10 M, 10-11 내지 10-8 M, 바람직하게는 약 10-11 내지 10-9 M인 경우에 특이적인 것으로 간주된다. 결합 도메인이 표적과 특이적으로 반응하거나 결합하는지의 여부는 특히 상기 결합 도메인과 표적 단백질 또는 항원과의 반응을 상기 결합 도메인과 CDH19 또는 CD3 이외의 단백질 또는 항원과의 반응과 비교함으로써 용이하게 시험할 수 있다. 바람직하게는, 본 발명의 결합 도메인은 CDH19 또는 CD3 이외의 단백질 또는 항원과 본질적으로 결합하지 않거나 이들과 결합할 수 없다(즉, 제1 결합 도메인은 CDH19 이외의 단백질에 결합할 수 없고, 제2 결합 도메인은 CD3 이외의 결합 도메인과 결합할 수 없다).

용어 "실질적으로 결합하지 않는다" 또는 "결합할 수 없다"는 본 발명의 결합 도메인이 CDH19 또는 CD3 이외의 또 다른 단백질 또는 항원과 결합하지 않고, 즉 CDH19 또는 CD3 이외의 단백질 또는 항원과 30% 이상, 바람직하게는 20% 이상, 보다 바람직하게는 10% 이상, 특히 바람직하게는 9%, 8%, 7%, 6% 또는 5%의 반응성을 나타내지 않아 CHD19 또는 CD3에 대한 결합이 각각 100%인 것으로 설정되는 것을 의미한다.

특이적 결합은 결합 도메인 및 항원의 아미노산 서열 중의 특이적 모티브에 의해 수행되는 것으로 생각된다. 따라서, 결합은 상기 구조의 2차 변형의 결과 뿐만 아니라 이들의 1차, 2차 및/또는 3차 구조의 결과로서 달성된다. 항원-상호작용-부위와 이의 특이적 항원과의 특이적 상호작용은 항원에 대한 상기 부위의 단순한 결합을 야기할 수 있다. 더욱이, 항원-상호작용-부위와 이의 특이적 항원과의 특이적 상호작용은, 예를 들면, 항원의 입체구조의 변화의 유도, 항원의 올리고머화 등에 기인하여 신호의 개시를 대안적으로 또는 추가적으로 야기할 수 있다.

단백질(통상 30개 미만의 아미노산을 갖는 이의 단편, 바람직하게는 생물학적 활성 단편 및 펩티드를 포함)은 공유 펩티드 결합(아미노산 쇄를 생성)에 의해 서로 커플링된 하나 이상의 아미노산을 포함한다. 본원에 사용된 용어 "폴리펩티드"는 30개 초과의 아미노산으로 이루어진 분자 그룹을 기재한다. 폴리펩티드는 하나 이상의 폴리펩티드 분자로 이루어진 다량체, 예를 들면, 이량체, 삼량체 또는 보다 고차 올리고머를 추가로 형성할 수 있다. 이러한 이량체, 삼량체 등을 형성하는 폴리펩티드 분자는 동일하거나 동일하지 않을 수 있다. 이러한 다량체의 상응하는 보다 고차 구조는 결과적으로 호모이량체 또는 헤테로이량체, 호모삼량체 또는 헤테로삼량체 등으로 지칭된다. 헤테로다량체의 예는 이의 자연 발생 형태에서 2개의 동일한 폴리펩티드 경쇄 및 2개의 동일한 폴리펩티드 중쇄로 이루어진 항체 분자이다. 용어 "폴리펩티드" 및 "단백질"은 또한 자연적으로 변형된 폴리펩티드/단백질을 지칭하고, 여기서 변형은, 예를 들면, 글리코실화, 아세틸화, 포스포릴화 등과 같이 번역후 변형에 의해 수행된다. "폴리펩티드"는, 본원에 언급되는 경우, PEG화된 것과 같이 화학적으로 변형될 수 있다. 이러한 변형은 당해 기술분야에 공지되어 있다.

"분리된"은, 본원에 개시된 항체 작제물을 기재하기 위해 사용될 때, 이의 생성 환경의 성분으로부터 동정, 분리 및/또는 회수된 항체 작제물을 의미한다. 바람직하게는, 분리된 항체 작제물은 이의 생성 환경으로부터 모든 기타 성분과의 회합을 포함하지 않는다. 이의 생성 환경의 오염물 성분, 예를 들면, 재조합 형질감염된 세포로부터 수득되는 것은 폴리펩티드에 대한 진단학적 또는 치료학적 사용을 전형적으로 간섭할 수 있는 물질이고, 효소, 호르몬 및 기타 단백질성 또는 비-단백질성 용질을 포함할 수 있다. 바람직한 실시형태에서, 항체 작제물은 (1) 회전 컵 서열분석기의 사용에 의해 N-말단 또는 내부 아미노산 서열의 적어도 15개 잔기를 수득하기에 충분한 정도, 또는 (2) 쿠마시에 블루 또는 바람직하게는 은 염색을 사용하는 비-환원 또는 환원 조건하에 SDS-PAGE에 의해 균질성으로 정제될 것이다. 그러나, 통상적으로, 분리된 항체는 적어도 하나의 정제 단계에 의해 제조된다.

본원에 기재된 항체 작제물의 아미노산 서열 변형이 고려된다. 예를 들면, 항체의 결합 친화성 및/또는 기타 생물학적 특성을 개선시키는 것이 바람직할 수 있다. 항체 작제물의 아미노산 서열 변이체는 적절한 뉴클레오티드 변화를 항체 작제물 핵산에 도입하거나 펩티드 합성에 의해 제조된다.

이러한 변형은, 예를 들면, 항체 작제물의 아미노산 서열 내의 잔기로부터의 결실, 및/또는 잔기 내로의 삽입, 및/또는 잔기의 치환을 포함한다. 결실, 삽입 및 치환의 임의의 조합은 최종 작제물에 도달하기 위해 이루어지고, 단 최종 작제물은 목적하는 특성을 보유해야 한다. 아미노산 변화는 또한 항체 작제물의 번역후 프로세스를 변경할 수 있고, 예를 들면, 글리코실화 부위의 수 또는 위치를 변화시킬 수 있다. 바람직하게는, 1, 2, 3, 4, 5, 6, 7, 8, 9 또는 10개 아미노산은 CDR에서 치환될 수 있고, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 또는 25개 아미노산은 프레임워크 영역(FR)에서 치환될 수 있다. 치환은 바람직하게는 본원에 기재된 바와 같이 보존적 치환이다. 추가로 또는 대안적으로, 1, 2, 3, 4, 5 또는 6개 아미노산이 각각의 CDR에서 (물론, 이들의 길이에 의존하여) 삽입되거나 결실될 수 있고, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 또는 25개 아미노산이 각각의 FR에서 삽입 또는 결실될 수 있다.

돌연변이유발을 위한 바람직한 위치인 항체 작제물의 특정 잔기 또는 영역을 동정하는 유용한 방법은 문헌[참조: Cunningham and Wells in Science, 244: 1081-1085 (1989)]에 기재된 바와 같이 "알라닌 스캐닝 돌연변이유발"이라 한다. 여기서, 항체 작제물 내의 표적 잔기의 잔기 또는 그룹이 동정되고(예를 들면, arg, asp, his, lys 및 glu 등의 하전된 잔기), 중성 또는 음으로 하전된 아미노산(가장 바람직하게는 알라닌 또는 폴리알라닌)에 의해 치환되어 아미노산과 에피토프와의 상호작용에 영향을 미친다.

이어서, 치환에 대한 기능적 감수성을 입증하는 이들 아미노산 위치는 추가 또는 기타 변이체를 치환 부위에 또는 치환 부위를 위해 도입함으로써 정련된다. 따라서, 아미노산 변이를 도입하는 부위는 예비결정되지만, 돌연변이 자체의 성질은 예비결정될 필요가 없다. 예를 들면, 소정 부위에서 돌연변이의 성능을 분석하기 위해, ala 스캐닝 또는 랜덤 돌연변이유발은 표적 코돈 또는 영역에서 수행되고, 발현된 항체 작제물 변이체는 목적하는 활성에 대해 스크리닝된다.

바람직하게는, 아미노산 서열 삽입은 단일 또는 복수의 아미노산 잔기의 서열내 삽입 뿐만 아니라 수백개 이상의 잔기를 함유하는 폴리펩티드에 대한 1, 2, 3, 4, 5, 6, 7, 8, 9 또는 10개 길이 범위의 잔기의 아미노- 및/또는 카복실-말단 융합을 포함한다. 항체 작제물의 삽입 변이체는 효소에 대한 항체의 N- 또는 C-말단의 융합, 또는 항체의 혈청 반감기를 증가시키는 폴리펩티드에 대한 융합을 포함한다.

또 다른 유형의 변이체는 아미노산 치환 변이체이다. 이들 변이체는 상이한 잔기에 의해 치환된 항체 작제물에서 바람직하게는 적어도 1, 2, 3, 4, 5, 6, 7, 8, 9 또는 10개 아미노산 잔기를 갖는다. 치환 돌연변이유발에 대하여 가장 관심있는 부위는 중쇄 및/또는 경쇄의 CDR, 특히 초가변 영역을 포함하지만, 중쇄 및/또는 경쇄 중의 FR 변이도 또한 고려된다.

예를 들면, CDR 서열이 6개 아미노산을 포함하는 경우, 이는 1, 2 또는 3개의 이들 아미노산이 치환되는 것을 상정한다. 유사하게는, CDR 서열이 15개 아미노산을 포함하는 경우, 이는 1, 2, 3, 4, 5 또는 6개의 아미노산이 치환되는 것을 상정한다.

일반적으로, 아미노산이 중쇄 및/또는 경쇄의 CDR 중의 하나 이상 또는 모두에서 치환되는 경우, 이렇게 수득된 "치환된" 서열은 "원래" CDR 서열과 적어도 60%, 보다 바람직하게는 65%, 보다 더 바람직하게는 70%, 특히 바람직하게는 75%, 보다 특히 바람직하게 80% 동일한 것이 바람직하다. 이는 "치환된" 서열과 동일한 정도까지 CDR의 길이에 의존적임을 의미한다. 예를 들면, 5개 아미노산을 갖는 CDR은, 치환된 적어도 하나의 아미노산을 갖기 위해 이의 치환된 서열과 바람직하게는 80% 동일하다. 따라서, 항체 작제물의 CDR은 이들의 치환된 서열과 상이한 정도의 동일성을 가질 수 있고, 예를 들면, CDRL1은 80% 동일성을 가질 수 있는 반면, CDRL3은 90% 동일성을 가질 수 있다.

바람직한 치환(또는 대체)은 보존적 치환이다. 그러나, 임의의 치환(비-보존적 치환 또는, 하기 표 1에 수록된 "예시적 치환"으로부터의 하나 이상을 포함)은, 항체 작제물이 제1 결합 도메인을 통해 CDH19에 결합하고 제2 결합 도메인을 통해 CD3 엡실론에 결합하는 이의 능력을 보유하고/하거나 이의 CDR이 후속적으로 치환된 서열과 동일성("원래" CDR 서열과 적어도 60%, 보다 바람직하게는 65%, 보다 더 바람직하게는 70%, 특히 바람직하게는 75%, 보다 특히 바람직하게는 80% 동일함)을 갖는 것으로 상정된다.

보존적 치환은 "바람직한 치환"이란 제목하에 표 1에 제시되어 있다. 이러한 치환이 생물학적 활성의 변화를 야기하는 경우, 표 1에서 "예시적 치환"으로 명명되거나 아미노산 부류와 관련하여 하기에 추가로 기재되어 있는 보다 실질적 변화가 도입될 수 있고, 생성물은 목적하는 특성에 대해 스크리닝될 수 있다.

아미노산 치환

원래 예시적 치환 바람직한 치환
Ala (A) val, leu, ile val
Arg (R) lys, gln, asn lys
Asn (N) gln, his, asp, lys, arg gln
Asp (D) glu, asn glu
Cys (C) ser, ala ser
Gln (Q) asn, glu asn
Glu (E) asp, gln asp
Gly (G) ala ala
His (H) asn, gln, lys, arg arg
Ile (I) leu, val, met, ala, phe leu
Leu (L) norleucine, ile, val, met, ala ile
Lys (K) arg, gln, asn arg
Met (M) leu, phe, ile leu
Phe (F) leu, val, ile, ala, tyr tyr
Pro (P) ala ala
Ser (S) thr thr
Thr (T) ser ser
Trp (W) tyr, phe tyr
Tyr (Y) trp, phe, thr, ser phe
Val (V) ile, leu, met, phe, ala leu

본 발명의 항체 작제물의 생물학적 특성에서 실질적 변형은, (a) 예를 들면, 시트 또는 나선 입체구조로서 치환 영역에서 폴리펩티드 골격의 구조, (b) 표적 부위에서 분자의 전하 또는 소수성, 또는 (c) 측쇄의 벌크를 유지하는 이들의 효과가 현저하기 상이한 치환을 선택함으로써 달성된다. 자연 발생 잔기는 통상의 측쇄 특성: (1) 소수성: 노르류신, met, ala, val, leu, ile; (2) 중성 친수성: cys, ser, thr; (3) 산성: asp, glu; (4) 염기성: asn, gin, his, lys, arg; (5) 쇄 배향에 영향을 미치는 잔기: gly, pro; 및 (6) 방향족: trp, tyr, phe에 기반하여 그룹으로 구분된다.

비-보존적 치환은 이들 부류 중의 하나의 구성원을 또 다른 부류으로 교환하는 것을 필요로 할 것이다. 항체 작제물의 적절한 입체구조임의의 시스테인 잔기는 일반적으로 세린으로 치환되어 분자의 산화적 안정성을 개선시키고 이상 가교결합을 방지할 수 있다. 역으로, 시스테인 결합(들)을 항체에 부가하여 이의 안정성을 개선시킬 수 있다(특히 항체가 Fv 단편 등의 항체 단편인 경우).

특히 바람직한 유형의 치환 변이체는 친 항체의 하나 이상의 초가변 영역 잔기의 치환을 수반한다(예: 인간화 또는 인간 항체). 일반적으로, 추가의 개발을 위해 선택된 생성되는 변이체(들)는 이들이 생성되는 친 항체에 대하여 개선된 생물학적 특성을 가질 것이다. 이러한 치환 변이체를 생성하는 편리한 방법은 파지 디스플레이를 사용하는 친화성 성숙을 수반한다. 요약하면, 몇몇 초가변 영역 부위(예: 6 내지 7개 부위)는 각 부위에서 모든 가능한 아미노산 치환을 생성하기 위해 돌연변이된다. 이렇게 생성된 항체 변이체는 각 입자 내에 팩키징된 M13의 유전자 III 생성물에 대한 융합물로서 사상 파지 입자로부터 일가 방식으로 표시된다. 이어서, 파지-표시된 변이체는 본원에 개시된 이들의 생물학적 활성(예: 결합 친화성)에 대해 스크리닝한다. 변형을 위한 후보 초가변 영역을 동정하기 위해, 알라닌 스캐닝 돌연변이유발을 수행하여 항원 결합에 유의적으로 기여하는 초가변 영역 잔기를 동정할 수 있다. 대안적으로 또는 추가적으로, 결합 도메인, 예를 들면, 인간 CDH19 사이의 접촉점을 동정하기 위해 항원-항체 복합체의 결정 구조를 분석하는 것이 유리할 수 있다. 이러한 접촉 잔기 및 인접 잔기는 본원에서 상술된 기술에 따라 치환 후보이다. 이러한 변이체가 생성되는 경우, 변이체의 패널은 본원에 기재된 바와 같이 스크리닝을 실시하고, 하나 이상의 관련 검정에서 보다 우수한 특성을 갖는 항체는 추가 개발을 위해 선택할 수 있다.

항체 작제물의 다른 변형이 본원에서 고려된다. 예를 들면, 항체 작제물은 다양한 비-단백질성 중합체 중의 하나, 예를 들면, 폴리에틸렌 글리콜, 폴리프로필렌 글리콜, 폴리옥시알킬렌, 또는 폴리에틸렌 글리콜과 폴리프로필렌 글리콜의 공중합체에 연결시킬 수 있다. 항체 작제물은 또한, 예를 들면, 코아세르베이션 기술 또는 계면 중합반응(예를 들면, 각각 하이드록시메틸셀룰로즈 또는 젤라틴-마이크로캡슐 및 폴리(메틸메타크릴레이트) 마이크로캡슐)에 의해 제조된 마이크로캡슐, 콜로이드성 약물 전달 시스템(예: 리포좀, 알부민 미소구, 마이크로에멀젼, 나노입자 및 나노캡슐) 또는 마이크로에멀젼에 포획될 수 있다. 이러한 기술은 문헌[참조: Remington's Pharmaceutical Sciences, 16th edition, Oslo, A., Ed., (1980)]에 개시되어 있다.

본원에 개시된 항체 작제물은 또한 면역-리포솜으로 제형화될 수 있다. "리포좀"은 포유동물로 약물의 전달에 유용한 다양한 유형의 지질, 인지질 및/또는 계면활성제로 구성된 소포체이다. 리포좀의 성분은 생물학적 막의 지질 배치와 유사한 이층 구성으로 통상 배치된다. 항체를 함유하는 리포좀은 당해 기술분야에 공지된 방법, 예를 들면, 문헌[참조: Epstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688 (1985); Hwang et al. , Proc. Natl Acad. Sci. USA, 77: 4030 (1980); US Pat. Nos. 4,485,045 and 4,544,545; and W0 97/38731 published October 23, 1997]에 기재된 바와 같이 제조된다. 증강된 순환 시간을 갖는 리포좀은 미국 특허 제5,013,556호에 개시되어 있다. 특히 유용한 리포좀은 포스파티딜콜린, 콜레스테롤 및 PEG-유도체화 포스파티딜에탄올아민(PEG-PE)을 포함하는 지질 조성물로 역상 증발 방법에 의해 생성할 수 있다. 리포좀은 목적하는 직경을 갖는 리포좀을 수득하기 위해 규정된 기공 크기의 필터를 통해 압출된다. 본 발명의 항체의 Fab 단편은 디설파이드 교환 반응을 통해 문헌[참조: Martin et al. J. Biol. Chem. 257: 286-288 (1982)]에 기재된 리포좀에 접합시킬 수 있다. 화학요법제는 리포좀 내에 임의로 함유된다[참조: Gabizon et al. J. National Cancer Inst. 81 (19) 1484 (1989)].

재조합 기술을 사용하는 경우, 항체 작제물은 세포내, 세포질주변 공간에서 생성되거나, 배지로 직접 분비할 수 있다. 항체 작제물이 세포내에서 생성되는 경우, 제1 단계로서, 입상 파편, 숙주 도는 용해된 단편은, 예를 들면, 원심분리 또는 한외여과에 의해 제거한다. 문헌[참조: Carter et al., Bio/Technology 10: 163-167 (1992)]은 이. 콜라이(E. coli)의 세포질주변 공간으로 분비되는 항체를 분리하는 공정을 기재한다.

세포로부터 제조한 항체 작제물 조성물은, 예를 들면, 하이드록실아파타이트 크로마토그래피, 겔 전기영동, 투석 및 친화성 크로마토그래피를 사용하여 정제할 수 있고, 친화성 크로마토그래피가 바람직한 정제 기술이다.

용어 "핵산"은 당해 기술분야의 숙련가에게 공지되어 있고, DNA(예: cDNA) 및 RNA(mRNA)를 포함한다. 핵산은 이본쇄 및 일본쇄, 선형 및 환상일 수 있다. 상기 핵산 분자는 바람직하게는 숙주 세포에 포함되는 벡터에 바람직하게 포함된다. 상기 숙주 세포는, 예를 들면, 본 발명의 핵산 서열을 사용한 형질전환 또는 형질감염 후, 항체 작제물을 발현시킬 수 있다. 당해 목적을 위해, 핵산 분자는 조절 서열과 작동적으로 연결된다.

벡터는 (외래) 유전자 물질을 세포 내로 전달하기 위해 비히클로서 사용되는 핵산 분자이다. 용어 "벡터"는, 이로써 한정되지 않지만, 플라스미드, 바이러스, 코스미드 및 인공 염색체를 포함한다. 일반적으로, 조작된 벡터는 복제 기원, 멀티클로닝 부위 및 선택가능한 마커를 포함한다. 벡터 자체는 일반적으로 뉴클레오티드 서열, 통상 DNA 서열이고, 이는 삽입체(도입유전자) 및 벡터의 "골격"으로 작용하는 보다 큰 서열을 포함한다. 현대의 벡터는 도입유전자 삽입체 및 골격 이외에 추가의 특징: 프로모터, 유전자 마커, 항생제 내성, 리포터 유전자, 표적 서열, 단백질 정제 태그를 포함할 수 있다. 발현 벡터(발현 작제물)로 불리우는 벡터는 구체적으로 표적 세포에서 도입유전자의 발현을 위한 것이고, 도입유전자의 발현을 유도하는 프로모터 서열 등의 조절 서열을 일반적으로 갖는다. 표적 세포 내로 벡터의 삽입은, 바이러스 벡터의 삽입을 "형질도입"으로 또한 부를 수 있지만, 세균의 경우에 "형질전환" 및 진핵세포의 경우에 "형질감염"으로 통상 불리운다.

본원에 사용된 바와 같이, 용어 "숙주 세포"는 본 발명의 항체 작제물을 코딩하는 핵산이 형질전환, 형질감염 등에 의해 도입되는 세포를 지칭하는 것으로 의도된다. 이러한 용어는 특정 대상체 세포 뿐만 아니라 이러한 세포의 자손 또는 잠재적 자손을 지칭하는 것으로 이해되어야 한다. 특정 변형은 돌연변이 또는 환경적 영향에 기인하여 후대에 발생할 수 있기 때문에, 이러한 자손은 사실 친 세포와 동일하지 않지만, 본원에 사용된 용어의 범위 내에 여전히 포함된다.

본원에 사용된 바와 같이, 용어 "발현"은, 이로써 한정되지 않지만, 전사, 전사후 변형, 번역, 번역후 변형 및 분비를 포함하는 본 발명의 항체 작제물의 생성에 관여하는 임의의 단계를 포함한다.

용어 "조절 서열"은 특정 숙주 생물에서 작동적으로 연결된 코딩 서열의 발현에 필요한 DNA 서열을 지칭한다. 원핵생물에 적합한 조절 서열은, 예를 들면, 프로모터, 임의로 작동 서열 및 리보솜 결합 부위를 포함한다. 진핵생물 세포는 프로모터, 폴리아데닐화 신호 및 인핸서를 이용하는 것으로 공지되어 있다.

핵산은, 또 다른 핵산 서열과 기능적 관계에 있는 경우, "작동가능하게 연결"된다. 예를 들면, 프리서열 또는 분비 리더의 DNA는, 폴리펩티드의 분비에 관여하는 프리단백질로서 발현되는 경우, 폴리펩티드의 DNA에 작동적으로 연결되고; 프로모터 또는 인핸서는, 서열의 전사에 영향을 미치는 경우, 코딩 서열에 작동적으로 연결되거나, 리보솜 결합 부위는, 번역을 촉진하도록 위치되는 경우, 코딩 서열에 작동적으로 연결된다. 일반적으로, "작동적으로 연결된"은 연결되는 DNA 서열이 인접하고, 분비 리더의 경우에 판독 상에서 인접하는 것을 의미한다. 그러나, 인핸서는 인접할 필요는 없다. 연결은 편리한 제한 부위에서 결찰에 의해 달성된다. 이러한 부위가 존재하지 않는 경우, 합성 올리고뉴클레오티드 어댑터 또는 링커가 종래의 관행에 따라 사용된다.

용어 "숙주 세포", "표적 세포" 또는 "수용체 세포"는 벡터를 위한 수용체 또는 외인성 핵산 분자, 폴리뉴클레오티드 및/또는 단백질의 도입이 존재하거나 갖는 임의의 개개 세포 또는 세포 배양물을 포함하는 것으로 의도된다. 또한, 이는 단일 세포의 자손을 포함하는 것으로 의도되고, 자손은 자연적, 우발적 또는 의도적 돌연변이에 기인하여 원래 친 세포와 완전히 동일(형태 또는 게놈 또는 전체 DNA 상보체에서)한 것은 아닐 수 있다. 세포는 원핵생물 또는 진핵생물의 것일 수 있고, 이로써 한정되지 않지만, 세균, 효모 세포, 동물 세포 및 포유동물 세포, 예를 들면, 뮤린, 랫트, 마카크 또는 인간을 포함한다.

적합한 숙주 세포는 효모, 진균, 곤충 세포 및 포유동물 세포를 포함하는 원핵생물 및 진핵생물 숙주 세포를 포함한다.

본 발명의 항체 작제물은 세균에서 생성될 수 있다. 발현 후, 본 발명의 항체 작제물, 바람직하게는 항체 작제물은 가용성 분획으로 이. 콜라이 세포 페이스트로부터 분리되고, 예를 들면, 친화성 크로마토그래피 및/또는 크기 배제를 통해 정제할 수 있다. 최종 정제는, 예를 들면, CHO 세포에서 발현된 항체를 정제하는 프로세스와 유사하게 수행할 수 있다.

원핵생물에 추가하여, 사상균 또는 효모균 등의 진핵 미생물은 본 발명의 항체 작제물을 위한 적합한 클로닝 또는 발현 숙주이다. 사카로마이세스 세레비지애(Saccharomyces cerevisiae) 또는 통상의 빵 효모는 저급 진핵생물 숙주 미생물 중에서 가장 일반적으로 사용되는 것들이다. 그러나, 다수의 기타 속, 종 및 균주, 예를 들면, 스키조사카로마이세스 폼베(Schizosaccharomyces pombe), 클루이베로마이세스 숙주, 예를 들면, 케이. 락티스(K. lactis), 케이. 프라질리스(K. fragilis)(ATCC 12424), 케이 불가리쿠스(K. bulgaricus)(ATCC 16045), 케이. 위케라미(K. wickeramii)(ATCC 24178), 케이. 왈티(K. waltii)(ATCC 56500), 케이. 드로소필라룸(K. drosophilarum)(ATCC 36906), 케이. 테르모톨레란스(K. thermotolerans) 및 케이. 마르시아누스(K. marxianus); 야로위아(yarrowia)(EP 402 226); 피키아 파스토리스(Pichia pastoris)(EP 183 070); 칸디다(Candida); 트리코데르마 레에시아(Trichoderma reesia)(EP 244 234); 뉴로스포라 크라싸(Neurospora crassa); 슈완니오마이세스(Schwanniomyces), 예를 들면, 슈완니오마이세스 옥시덴탈리스(Schwanniomyces occidentalis); 및 사상균, 예를 들면, 뉴로스포라(Neurospora), 페니실리움(Penicillium), 톨리포클라디움(Tolypocladium), 및 아스퍼길루스(Aspergillus) 숙주, 예를 들면, 에이. 니둘란스(A. nidulans) 및 에이. 니거(A. niger)는 상업적으로 이용가능하고 본원에서 유용하다.

본 발명의 글리코실화 항체 작제물, 바람직하게는 항체 유래된 항체 작제물의 발현에 적합한 숙주 세포는 다세포 생물로부터 유래한다. 무척추동물 세포의 예는 식물 및 곤충 세포를 포함한다. 숙주로부터 다수의 바쿨로바이러스 균주 및 변이체 및 상응하는 허용가능한 곤충 숙주 세포, 예를 들면, 스포도프테라 프루기페르다(Spodoptera frugiperda)(모충), 아에데스 아에깁티(Aedes aegypti)(모기), 아데데스 알보픽투스(Aedes albopictus)(모기), 드로소필라 멜라노가스터(Drosophila melanogaster)(초파리) 및 봄빅스 모리(Bombyx mori)는 동정되어 있다. 형질감염을 위한 다양한 바이러스 균주, 예를 들면, 오토그라파 칼리포르니카(Autographa californica) NPV의 L-1 변이체 및 봄빅스 모리(Bombyx mori) NPV의 Bm-5 균주는 공개적으로 이용가능하고, 이러한 바이러스는 특히 스포도프테라 프루기페르다(Spodoptera frugiperda ) 세포의 형질감염을 위해 본 발명에 따라 본원에서 바이러스로서 사용될 수 있다.

목면, 옥수수, 감자, 대두, 페투니아, 토마토, 아라비돕시스 및 담배의 식물 세포 배양물을 숙주로서 또한 사용할 수 있다. 식물 세포 배양에서 단백질의 생성에 유용한 클로닝 및 발현 벡터는 당해 기술분야의 숙련가에게 공지되어 있다[참조: Hiatt et al., Nature (1989) 342: 76-78, Owen et al. (1992) Bio/Technology 10: 790-794, Artsaenko et al. (1995) The Plant J 8: 745-750, and Fecker et al. (1996) Plant Mol Biol 32: 979-986].

그러나, 관심은 척추 동물에서 최대이고, 배양(조직 배양)에서 척추동물 세포의 증식은 통상의 공정으로 되었다. 유용한 포유동물 숙주 세포주의 예는 SV40(COS-7, ATCC CRL 1651)에 의해 형질전환된 원숭이 신장 CV1 세포주; 인간 배아 신장 세포주(현탁 배양에서 성장을 위한 서브클론된 293 또는 293 세포, 문헌[Graham et al. , J. Gen Virol. 36 : 59 (1977)] 참조); 베이비 햄스터 신장 세포(BHK, ATCC CCL 10); 차이니즈 햄스터 난소 세포/-DHFR[참조: CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77: 4216 (1980)]; 마우스 세르톨리 세포(TM4, Mather, Biol. Reprod. 23: 243-251 (1980)); 원숭이 신장 세포주(CVI ATCC CCL 70); 아프리카 그린 원숭이 신장 세포(VERO-76, ATCC CRL1587); 인간 자궁암 세포(HELA, ATCC CCL 2); 개 신장 세포(MDCK, ATCC CCL 34); 버팔로 랫트 간 세포(BRL 3A, ATCC CRL 1442); 인간 폐 세포(W138, ATCC CCL 75); 인간 간 세포(Hep G2,1413 8065); 마우스 유방암(MMT 060562, ATCC CCL5 1); TRI 세포(Mather et al., Annals N. Y Acad. Sci. 383: 44-68 (1982)) ; MRC 5 세포; FS4 세포; 및 인간 간종양 세포주(Hep G2)이다.

재조합 기술을 사용하는 경우, 본 발명의 항체 작제물은 세포내에서, 세포질주변 공간에서 생성되거나, 배지 내로 직접 분비될 수 있다. 항체 작제물이 세포내에서 생성되는 경우, 제1 단계로서, 입상 파편, 숙주 세포 또는 용해된 단편은, 예를 들면, 원심분리 또는 한외여과에 의해 제거된다. 문헌[참조: Carter et al., Bio/Technology 10: 163-167 (1992)]은 이. 콜라이의 세포질주변 공간으로 분비되는 항체를 분리하는 공정을 기재한다. 요약하면, 세포 페이스트를 나트륨 아세테이트(pH 3.5), EDTA 및 페닐메틸설포닐플루오라이드(PMSF)의 존재하에 약 30분에 걸쳐 해동시킨다. 세포 파편은 원심분리에 의해 제거할 수 있다. 항체가 배지 내로 분비되는 경우, 이러한 발현 시스템으로부터의 상청액은 상업적으로 이용가능한 단백질 농축 필터, 예를 들면, 아미콘 또는 밀리포어 펠리콘 한외여과 장치를 사용하여 일반적으로 먼저 농축시킨다. PMSF 등의 프로테아제 억제제는 단백질분해를 억제하기 위해 상기 단계의 임의의 단계에 포함시킬 수 있고, 항생제는 외래성 오염물의 성장을 방지하기 위해 포함시킬 수 있다.

숙주 세포로부터 제조된 본 발명의 항체 작제물은, 예를 들면, 하이드록실아파타이트 크로마토그래피, 겔 전기영동 및 친화성 크로마토그래피를 사용하여 정제할 수 있고, 친화성 크로마토그래피가 바람직한 정제 기술이다.

친화성 리간드가 부착되는 매트릭스는 가장 빈번하게는 아가로즈이지만, 다른 매트릭스도 이용가능하다. 조절된 기공 유리 또는 폴리 (스티렌디비닐) 벤젠 등의 기계적으로 안정한 매트릭스는 아가로즈에 의해 달성될 수 있는 것보다 신속한 유동 속도 및 보다 짧은 처리 시간을 가능하게 한다. 본 발명의 항체 작제물이 CH3 도메인을 포함하는 경우, 베이커본드(Bakerbond) ABXMresin(J. T. Baker, Phillipsburg, NJ)가 정제에 유용하다. 또한, 단백질 정제를 위한 기타 기술, 예를 들면, 이온-교환 컬럼 상에서의 분별, 에탄올 침전, 역상 HPLC, 실리카 상에서의 크로마토그래피, 헤파린 상에서의 크로마토그래피, 음이온 또는 양이온 교환 수지 상에서의 SEPHAROSETM 크로마토그래피(예: 폴리아스파르트산 컬럼), 크로마토-포커싱, SDS-PAGE 및 황산암모늄 침전이 회수되는 항체에 따라 이용가능하다.

용어 "배양하는"은 배지에서 적합한 조건하에 세포의 시험관내 유지, 분화, 성장, 증식 및/또는 번식을 지칭한다.

본원에 사용된 바와 같이, 용어 "약제학적 조성물"은 환자, 바람직하게는 인간 환자에게 투여하기 위한 조성물을 지칭한다. 본 발명의 특히 바람직한 약제학적 조성물은 본 발명의 항체 작제물을 포함한다. 바람직하게는, 약제학적 조성물은 담체, 안정화제 및/또는 부형제의 적합한 조합물을 포함한다. 바람직한 실시형태에서, 약제학적 조성물은 비경구, 경피, 체강내, 동맥내, 척추내 및/또는 비내 투여를 위한 또는 조직 내로의 직접 주사에 의한 조성물을 포함한다. 상기 조성물은 주입 또는 주사를 통해 환자에게 투여되는 것이 특히 상정된다. 적합한 조성물의 투여는 상이한 방식, 예를 들면, 정맥내, 복강내, 피하, 근육내, 국소 또는 경피 투여에 의해 실시할 수 있다. 특히, 본 발명은 적합한 조성물의 중단 없는 투여를 제공한다. 비-제한적 예로서, 중단 없는, 즉 연속 투여는 환자 체내로 치료제의 유입을 계량하기 위해 환자가 착용한 작은 펌프 시스템에 의해 실현할 수 있다. 본 발명의 항체 작제물을 포함하는 약제학적 조성물은 상기 펌프 시스템을 사용하여 투여할 수 있다. 이러한 펌프 시스템은 일반적으로 당해 기술분야에 공지되어 있고, 통상 주입되는 치료제를 함유하는 카트리지의 주기적 교환에 의존한다. 이러한 펌프 시스템에서 카트리지를 교환하는 경우, 환자 체내로 치료제의 다른 방식의 중단 없는 유동의 일시적 중단이 발생할 수 있다. 이러한 경우에, 카트리지 교환 전의 투여 상 및 카트리지 교환 후의 투여 상은 당연히 약제학적 수단의 의미 내에 포함되는 것으로 간주될 것이고, 본 발명의 방법은 함께 이러한 치료제의 하나의 "중단 없는 투여"를 구성한다.

본 발명의 이들 항체 작제물의 연속적 또는 중단 없는 투여는 저장소 외부로 유체를 유도하는 유체 유도 메카니즘 및 유도 메카니즘을 작동시키는 작동 메카니즘을 포함하는 유체 전달 장치 또는 작은 펌프 시스템에 의해 정맥내 또는 피하로 이루어질 수 있다. 피하 투여를 위한 펌프 시스템은 환자의 피부를 관통하고 환자 체내로 적합한 조성물을 전달하는 니들 또는 캐뉼라를 포함할 수 있다. 상기 펌프 시스템은 독립적으로 정맥, 동맥 또는 혈관의 환자 피부에 직접 고정 또는 부착되어 펌프 시스템과 환자 피부 사이의 직접 접촉을 가능하게 할 수 있다. 펌프 시스템은 24시간 내지 수일 동안 환자 피부에 부착될 수 있다. 펌프 시스템은 작은 용적을 위한 저장소를 갖는 작은 크기로 이루어질 수 있다. 비-제한적 예로서, 투여되는 적합한 약제학적 조성물을 위한 저장소의 용적은 0.1 내지 50ml일 수 있다.

연속 투여는 피부에 착용된 패치에 의해 경피로 이루어지거나 간격을 두고서 대체될 수 있다. 당해 기술분야의 숙련가는 이러한 목적에 적합한 약물 전달용 패치 시스템을 인식하고 있다. 경피 투여는 중단 없는 투여에 특히 적합하다는 것에 주목해야 하고, 이는 1차 소모된 패치의 교환이 유리하게는, 예를 들면, 1차 소모된 패치에 바로 인접하여 새로운 2차 패치의 교체와 동시에 및 피부 표면 상에서 1차 소모된 패치의 1차 소모된 패치의 제거 직전에 달성될 수 있기 때문이다. 유동 중단 문제 또는 파워 셀 실패는 발생하지 않는다.

본 발명의 조성물은 약제학적으로 허용되는 담체를 추가로 포함할 수 있다. 적합한 약제학적 담체의 예는 당해 기술분야에 공지되어 있고, 용액, 예를 들면, 인산염 완충된 염수 용액, 물, 에멀젼, 예를 들면, 오일/물 에멀젼, 다양한 유형의 습윤제, 멸균 용액, 리포좀 등을 포함한다. 이러한 담체를 포함하는 조성물은 공지된 종래의 방법에 의해 제형화할 수 있다. 제형은 탄수화물, 완충제 용액, 아미노산 및/또는 계면활성제를 포함할 수 있다. 탄수화물은 비-환원 당, 바람직하게는 트레할로즈, 슈크로즈, 옥타설페이트, 솔비톨 또는 크실리톨일 수 있다. 일반적으로, 본원에서 사용된 바와 같이, "약제학적으로 허용되는 담체"는 의약 투여에 적합한 임의의 및 모든 용매, 분산 매질, 코팅, 항균제 및 항진균제, 등장성 및 흡수 지연제를 의미한다. 약제학적 활성 물질을 위한 이러한 매질 및 제제의 사용은 당해 기술분야에 공지되어 있다. 허용되는 담체, 부형제 또는 안정화제는 사용된 용량 및 농도에서 수용자에게 무독성이고, 추가의 완충제; 방부제; 조-용매; 아스코르브산 및 메티오닌을 포함하는 항산화제; 킬레이트화제, 예를 들면, EDTA; 금속 착물(예: Zn-단백질 착물); 생분해성 중합체, 예를 들면, 폴리에스테르; 염-형성 카운터-이온, 예를 들면, 나트륨, 다가 당 알콜; 아미노산, 예를 들면, 알라닌, 글리신, 아스파라긴, 2-페닐알라닌 및 트레오닌; 당 또는 당 알콜, 예를 들면, 트레할로즈, 슈크로즈, 옥타설페이트, 솔비톨 또는 크실리톨 스타키오즈, 만노즈, 소르보즈, 크실로즈, 리보즈, 미오이니시토즈, 갈라토즈, 락티톨, 리비톨, 미오이니시톨, 갈락티톨, 글리세롤, 사이클리톨(예: 이노시톨), 폴리에틸렌 글리콜; 황 함유 환원제, 예를 들면, 글루타티온, 티옥트산, 나트륨 티오글리콜레이트, 티오글리세롤, [알파]모노티오글리세롤 및 나트륨 티오 설페이트; 저분자량 단백질, 예를 들면, 인간 혈청 알부민, 소 혈청 알부민, 젤라틴 또는 기타 면역글로불린; 및 친수성 중합체, 예를 들면, 폴리비닐피롤리돈을 포함한다. 이러한 제형은 정맥내 또는 피하 및/또는 펌프 시스템의 부재하에 연속 투여에 사용될 수 있다. 아미노산은 하전된 아미노산, 바람직하게는 리신, 리신 아세테이트, 아르기닌, 글루타메이트 및/또는 히스티딘일 수 있다. 계면활성제는 바람직하게는 >1.2 KD의 분자량을 갖는 세정제 및/또는 바람직하게는 >3 KD의 분자량을 갖는 폴리에테르일 수 있다. 바람직한 세정제의 비-제한적 예는 트윈 20, 트윈 40, 트윈 60, 트윈 80 또는 트윈 85이다. 바람직한 폴리에테르의 비-제한적 예는 PEG 3000, PEG 3350, PEG 4000 또는 PEG 5000이다. 본 발명에 사용된 완충제 시스템은 5 내지 9의 바람직한 pH를 가질 수 있고, 시트레이트, 석시네이트, 포스페이트, 히스티딘 및 아세테이트를 포함할 수 있다.

본 발명의 조성물은, 예를 들면, 본원에 기재된 교차-종 특이성을 나타내는 본 발명의 증가량의 폴리펩티드를 비-침팬지 영장류, 예를 들면, 마카크에게 투여하여 용량 상승 연구에 의해 결정될 수 있는 적합한 용량으로 대상체에게 투여할 수 있다. 상기 기재된 바와 같이, 본원에 기재된 교차-종 특이성을 나타내는 본 발명의 항체 작제물은 유리하게는 비-침팬지 영장류에서 임상 시험 전에 동일한 형태로 및 인간에서 약물로서 사용될 수 있다. 이들 조성물은 또한 다른 단백질성 및 비-단백질성 약물과 조합하여 투여할 수 있다. 이들 약물은 본원에 정의된 본 발명의 폴리펩티드를 포함하는 조성물과 동시에 투여하거나, 시간 정의된 간격 및 용량으로 상기 폴리펩티드의 투여 전후에 별도로 투여할 수 있다. 용량 섭생은 주치의 및 임상 인자에 의해 결정될 것이다. 의학 분야에 공지되어 있는 바와 같이, 임의의 환자를 위한 투약량은 환자의 크기, 신체 표면적, 연령, 투여되는 특정 화합물, 성별, 투여 시간 및 경로, 일반 건강 및 동시 투여되는 기타 약물을 포함하는 다수의 요인에 의존한다.

비경구 투여를 위한 제제는 멸균 수성 또는 비-수성 용액, 현탁액 및 에멀젼을 포함한다. 비-수성 용매의 예는 프로필렌 글리콜, 폴리에틸렌 글리콜, 식물성 오일, 예를 들면, 올리브유, 및 주사가능한 유기 에스테르, 예를 들면, 에틸 올레이트를 포함한다. 수성 담체는 식염수 및 완충된 매질을 포함하여 물, 알콜성/수성 용액, 에멀젼 또는 현탁액을 포함한다. 비경구 비히클은 염화나트륨 용액, 링거 덱스트로즈, 덱스트로즈 및 염화나트륨, 락테이트화 링거액 또는 고정유를 포함한다. 정맥내 비히클은 유체 및 영양 보충액, 전해질 보충액(예: 링거 덱스트로즈에 기반한 것들) 등을 포함한다. 방부제 및 기타 첨가제, 예를 들면, 항생제, 항산화제, 킬레이트화제, 불활성 가스 등이 또한 존재할 수 있다. 또한, 본 발명의 조성물은 바람직하게는 인간 기원의 단백질성 담체 등, 예를 들면, 혈청 알부민 또는 면역글로불린을 포함할 수 있다. 본 발명의 조성물은, 본원에 정의된 본 발명의 폴리펩티드에 추가하여, 조성물의 의도된 용도에 따라 추가의 생물학적 활성제를 포함할 수 있는 것으로 상정된다. 이러한 제제는 위장 시스템에 작용하는 약물, 세포증식 억제제로서 작용하는 약물, 고요산혈증을 방지하는 약물, 면역반응을 억제하는 약물(예: 코르티코스테로이드), 염증 반응을 조절하는 약물, 순환계에 작용하는 약물 및/또는 당해 기술분야에 공지된 사이토킨 등의 제제일 수 있다. 또한, 본 발명의 항체 작제물은 병용 요법, 즉 또 다른 항암 의약과 조합하여 적용되는 것으로 상정된다.

본원에 정의된 약제학적 조성물의 생물학적 활성은, 예를 들면, 하기 실시예, 국제공개공보 WO 99/54440 또는 문헌[참조: Schlereth et al., Cancer Immunol. Immunother. 20 (2005), 1-12]에 기재된 바와 같은 세포독성 검정에 의해 측정할 수 있다. 본원에서 사용된 "효능" 또는 "생체내 효능"은, 예를 들면, 표준 NCI 반응 기준을 사용하여 본 발명의 약제학적 조성물에 의한 치료에 대한 반응을 지칭한다. 본 발명의 약제학적 조성물을 사용하는 치료의 성공 또는 생체내 효능은 이들의 의도된 목적에 대한 조성물의 효과, 즉 이의 목적하는 효과, 즉 병리학적 세포, 예를 들면, 종양 세포의 고갈을 유발하는 조성물의 능력을 지칭한다. 생체내 효능은, 이로써 한정되지 않지만, 백혈구 계수, 차동, 형광 활성화된 세포 분류, 골수 흡인을 포함하여 각각의 질환 속성에 대한 확립된 표준 방법으로 모니터링할 수 있다. 또한, 다양한 질환 특이적 임상 화학 파라미터 및 기타 확립된 표준 방법이 사용될 수 있다. 추가로, 컴퓨터 지원 단층촬영, X-선, 핵 자기 공명 단층촬영(예를 들면, 국립 암 연구-기준 기반 반응 평가[Cheson BD, Horning SJ, Coiffier B, Shipp MA, Fisher RI, Connors JM, Lister TA, Vose J, Grillo-Lopez A, Hagenbeek A, Cabanillas F, Klippensten D, Hiddemann W, Castellino R, Harris NL, Armitage JO, Carter W, Hoppe R, Canellos GP. 비-호지킨 림프종에 대한 반응 기준을 표준화하기 위한 국제 워크숍의 보고(Report of an international workshop to standardize response criteria for non-Hodgkin's lymphomas). NCI Sponsored International Working Group. J Clin Oncol. 1999 Apr;17(4):1244]), 포지트론-방사 단층촬영 스캐닝, 백혈구 계수, 차동, 형광 활성화된 세포 분류, 골수 흡인, 림프절 생검/조직학, 및 다양한 림프종 특이적 임상 화학 파라미터(예: 락테이트 데하이드로게나제) 및 기타 확립된 표준 방법이 사용될 수 있다.

본 발명의 약제학적 조성물 등의 약물의 개발에서 또 다른 주요 과제는 약물동태학적 특성의 예측가능한 조절이다. 이러한 목적으로, 약물 후보의 약물동태학적 프로파일, 즉 소정 병태를 치료하는 특정 약물의 능력에 영향을 미치는 약물동태학적 파라미터의 프로파일을 확립할 수 있다. 특정 질환 실체를 치료하는 약물의 능력에 영향을 미치는 약물의 약물동태학적 파리미터는, 이로써 한정되지 않지만, 반감기, 분포 용적, 간 1차-통과 대사 및 혈액 혈청 결합도를 포함한다. 소정 약물 제제의 효능은 상기 언급된 각각의 파라미터에 의해 영향을 받을 수 있다.

"반감기"는 투여된 약물의 50%가 생물학적 프로세스, 예를 들면, 대사, 분비 등을 통해 제거되는 시간을 의미한다.

"간 1차-통과 대사"란 간과 1차 접촉시, 즉 간을 통한 이의 1차 통과 동안 대사되는 약물의 경향을 의미한다.

"분포 용적"은 신체의 다양한 구획 등, 예를 들면, 세포내 및 세포외 공간, 조직 및 기관 등을 통한 약물의 체류 정도, 및 이들 구획 내의 약물의 분포를 의미한다.

"혈액 혈청 결합도"는, 혈액 혈청 단백질, 예를 들면, 알부민과 상호작용하고 이와 결합하여 약물의 생물학적 활성의 감소 또는 소실을 유도하는 약물의 경향을 의미한다.

약물동태 파라미터는 또한 투여된 소정량의 약물에 대한 생체이용성, 래그 시간(Tlag), Tmax, 흡수율, 보다 많은 개시 및/또는 Cmax를 포함한다. "생체이용성"은 혈액 구획 중의 약물의 양을 의미한다. "래그 시간"은 약물의 투여와 혈액 또는 혈장에서의 이의 검출 및 측정능 사이의 시간 지연을 의미한다.

"Tmax"는 약물의 최대 혈액 농도가 도달한 후의 시간이고, "Cmax"는 소정 약물로 수득되는 최대 혈액 농도이다. 이의 생물학적 효과에 요구되는 약물의 혈액 또는 조직 농도에 도달하는 시간은 모든 파라미터에 의해 영향을 받는다. 상기 개력된 비-침팬지 영장류에서 임상전 동물 시험으로 측정될 수 있는, 교차-종 특이성을 나타내는 이중특이적 일본쇄 항체의 약물동태 파라미터는 또한, 예를 들면, 공개 문헌[참조: Schlereth et al., Cancer Immunol. Immunother. 20 (2005), 1-12]에 기재되어 있다.

본원에서 사용된 용어 "독성"은 유해 사상 또는 심각한 유사 사상으로 나타나는 약물의 독성 효과를 지칭한다. 이들 부작용은 일반적으로 약물의 내성의 결여 및/또는 투여후 국소 인용성의 결여를 지칭할 수 있다. 독성은 또한 약물에 의해 유발된 기형발생 또는 발암성 효과를 포함할 수 있다.

본원에서 사용된 용어 "안전성", "생체내 안전성" 또는 "내성"은 투여 직후(국소 인용성) 및 약물의 보다 긴 적용 기간 동안 심각한 유해 사상을 유도하지 않는 약물의 투여를 정의한다. "안전성", "생체내 안전성" 또는 "내성"은, 예를 들면, 치료 동안 및 후속 기간 동안 규칙적 간격으로 평가할 수 있다. 측정은 임상적 평가, 예를 들면, 기관 증상, 및 실험 이상치의 스크리닝을 포함한다. 임상 평가를 수행할 수 있고, 정상 발견에 대한 편차를 NCI-CTC 및/또는 MedDRA 표준에 따라 기록/코드화한다. 기관 증상은, 예를 들면, 유해 사상 v3.0(CTCAE)에 대한 공통 용어 기준에 기재된 바와 같이 알러지/면역학, 혈액/골수, 심장 부정맥, 응고 등의 기준을 포함할 수 있다. 시험될 수 있는 실험 파라미터는, 예를 들면, 혈액학, 임상 화학, 응고 프로파일 및 뇨 분석, 및 혈청, 혈장, 림프액 또는 척수액, 액체 등의 기타 체액의 검사를 포함한다. 따라서, 안전성은 실험 파라미터를 측정하고 유해 사상을 기록함으로써, 예를 들면, 물리적 검사, 화상 기술(즉, 초음파, x-선, CT 스캔, 자기 공명 영상(MRI)), 기술적 장치를 사용한 기타 측정(즉, 심전도), 바이탈 징후에 의해 평가할 수 있다. 예를 들면, 본 발명에 따르는 용도 및 방법에서 비-침팬지 영장류에서 유해 사상은 조직병 및/또는 조직화학적 방법에 의해 검사할 수 있다.

용어 "유효량" 또는 "유효 용량"은 목적하는 효과를 달성하거나 적어도 부분적으로 달성하기에 충분한 양으로 정의된다. 용어 "치료학적 유효량"은 질환을 이미 앓고 있는 환자에서 질환 및 이의 합병증을 치유하거나 적어도 부분적으로 저지하기에 충분한 양으로 정의된다. 이러한 용도에 효과적인 양은 감염의 중증도 및 대상체 자신의 면역계의 일반 상태에 의존할 것이다. 용어 "환자"는 예방학적 또는 치료학적 치료를 받는 인간 및 기타 포유동물 대상체를 포함한다.

본원에서 사용된 바와 같은 용어 "유효 및 무독성 양"은 주요 독성 효과 없이 또는 실질적으로 없이 병적 세포의 고갈, 종양 제거, 종양 축소 또는 질환의 안정화를 유발하기에 충분히 높은 본 발명의 항체 작제물의 인용 용량을 지칭한다. 이러한 유효 및 무독성 용량은, 예를 들면, 당해 기술분야에 기재된 용량 점증 연구에 의해 결정될 수 있고, 심각한 유해 사상(용량 제한 독성, DLT)을 유도하는 용량 미만이어야 한다.

상기 용어는 또한, 예를 들면, 생물기술학-유래 의약품 S6[ICH Harmonised Tripartite Guideline; ICH Steering Committee meeting on July 16, 1997]의 임상전 안전성 평가에서 언급되어 있다.

본 발명의 항체 작제물의 적절한 용량 또는 치료학적 유효량은 치료되는 병태, 병태의 중증도, 선행 요법 및 환자의 임상 병력 및 치료제에 대한 반응에 의존할 것이다. 적절한 용량은 환자에게 한번에 또는 일련의 투여에 걸쳐 투여할 수 있도록 주치의의 판단에 따라 조정될 수 있다. 약제학적 조성물은 단일 치료로서 또는, 필요에 따라, 항암 요법 등과 같은 추가 요법과 함께 투여할 수 있다.

본 발명의 약제학적 조성물은 비경구 투여, 즉 피하, 근육내, 정맥내, 관절내 및/또는 활막내 투여에 특히 유용하다. 비경구 투여는 볼러스 주사 또는 연속 주입에 의해 이루어질 수 있다.

약제학적 조성물이 동결건조된 경우, 동결건조된 물질은 먼저 투여 전에 적절한 액체로 재구성한다. 동결건조된 물질은, 예를 들면, 주사용 정균수(BWFI), 생리 식염수, 인산염 완충 식염수(PBS) 또는 단백질이 동결건조 전에 존재했던 것과 동일한 제형으로 재구성할 수 있다.

독자의 mRNA 발현의 내부 분석에서, CDH19 발현은 정상의 비형질전환된 조직과 비교하여 1차 및 전이성 흑색종 종양 둘 다에서 상승되는 것이 놀랍게도 밝혀졌다. 내부 분석은 또한 정상 조직에서 CDH19의 발현이 말초 신경절 및 신경 섬유 유래의 신경능으로 제한되는 것을 확인했다. 정상 및 종양 조직에서 상이한 CDH19 발현은 이 단백질을 세포-표면 표적화 치료에 매력적으로 되게 한다. CDH19가 일부 암 유형(참조: WO 2009/055937) 또는 파킨슨병(참조: WO 2005/067391)와 연관된 마커의 긴 리스트 중의 일부로서 하나의 마커로서 언급되었지만, CDH19는 흑색종 종양과 관련하여 예후 마커 또는 약물 표적으로서 논의되지 않았다.

상기 언급된 바와 같이, 본 발명은 표적 세포 표면 상의 인간 CDH19에 결합할 수 있는 제1 인간 결합 도메인 및 T 세포 표면 상의 인간 CD3에 결합할 수 있는 제2 도메인을 포함하는 분리된 다중특이적 항체 작제물을 제공한다.

"CDH19 세포외 도메인" 또는 "CDH19 ECD"는 본질적으로 CDH19의 막관통 및 세포질 도메인을 포함하지 않는 CDH19의 형태를 지칭한다. 본 발명의 CDH19 폴리펩티드에 대해 동정된 막관통 도메인은 당해 유형의 소수성 도메인을 동정하기 위해 당해 기술분야에서 통상 사용되는 기준에 따라 동정된다는 것이 당해 기술분야의 숙련가에게 이해될 것이다. 막관통 도메인의 정확한 경계는 상이할 수 있지만, 본원에 구체적으로 언급된 도메인의 어느 하나의 말단에서 약 5개 이하의 아미노산이 가장 상이할 가능성이 있다. 바람직한 인간 CDH19 ECD는 서열번호 948에 제시되어 있다. 이러한 맥락에서, CDH19 ECD는 표적 세포의 표면 상의 CDH19의 일부를 나타내는 것이 이해된다.

T 세포 CD3 수용체 복합체는 단백질 복합체이고, 4개의 별개의 쇄로 구성되어 있다. 포유동물에서, 상기 복합체는 CD3γ 쇄, CD3δ 쇄 및 2개의 CD3ε(엡실론) 쇄를 함유한다. 이들 쇄는 T 림파구에서 활성화 신호를 생성하기 위해 T 세포 수용체(TCR) 및 ζ 쇄로서 공지된 분자와 회합한다.

다중특이적, 적어도 이중특이적 항체 작제물에 의한 T 세포의 동원을 통해 표적 세포의 재지향된 용해는 세포용해 시냅스 형성 및 페르포린 및 그란자임의 전달을 수반한다. 계합된 T 세포는 연속 표적 세포 용해가 가능하고, 펩티드 항원 프로세싱 및 제시, 또는 클론 T 세포 분화를 간섭하는 면역 회피 메카니즘에 의해 영향을 받지 않는다[참조: WO 2007/042261].

인간 CDH19에 대한 제1 결합 도메인의 친화성을 바람직하게는 ≤15 nM, 보다 바람직하게는 ≤10 nM, 보다 더 바람직하게는 ≤5 nM, 보다 더 바람직하게는 ≤1 nM, 보다 더 바람직하게는 ≤0.5 nM, 보다 더 바람직하게는 ≤0.1 nM, 및 가장 바람직하게는 ≤0.05 nM이다. 마카크 CDH19에 대한 제1 결합 도메인의 친화성은 바람직하게는 ≤15 nM, 보다 바람직하게는 ≤10 nM, 보다 더 바람직하게는 ≤5 nM, 보다 더 바람직하게는 ≤1 nM, 보다 더 바람직하게는 ≤0.5 nM, 보다 더 바람직하게는 ≤0.1 nM, 및 가장 바람직하게는 ≤0.05 nM 또는 심지어 ≤0.01 nM이다. 친화성은, 예를 들면, 실시예에 기재된 바와 같이, 예를 들면, 바이아코어 검정 또는 스캐챠드 검정으로 측정할 수 있다. 마카크 CDH19 대 인간 CDH19에 대한 결합을 위한 친화성 갭은 바람직하게는 [1:10-1:5] 또는 [5:1-10:1], 보다 바람직하게는 [1:5-5:1], 및 가장 바람직하게는 [1:2-3:1] 또는 심지어 [1:1-3:1]이다. 친화성을 측정하는 다른 방법은 당해 기술분야의 숙련가에게 공지되어 있다.

인간 항체, 각각 인간 항체 작제물은, 뮤린 또는 랫트 가변 및/또는 불변 영역을 보유하는 항체/항체 작제물과 연관된 일부 문제를 회피한다. 이러한 뮤린 또는 랫트 유래 단백질의 존재는 항체/항체 작제물의 신속한 클리어런스를 유도할 수 있거나, 환자에 의한 항체/항체 작제물에 대한 면역 반응의 생성을 유도할 수 있다. 뮤린 또는 랫트 유래 항체/항체 작제물의 이용을 회피하기 위해, 인간 또는 완전 인간 항체는 설치류가 완전 인간 항체를 생성하도록 인간 항체 기능을 설치류 내로 도입하여 생성할 수 있다.

YAC에서 메가베이스-크기의 인간 유전자좌를 클로닝하고 재구성하고 이들을 마우스 생식계열 내로 도입하는 능력은 인간 질환의 유용한 모델의 생성 뿐만 아니라 매우 거대하거나 조 맵핑(crudly mapping)된 유전자좌의 기능적 성분을 해명하는 강력한 접근법을 제공한다. 추가로, 마우스 유전자좌를 이들의 인간 균등물로 치환하기 위해 이러한 기술의 사용은 개발 동안 인간 유전자 생성물의 발현 및 조절, 다른 시스템과 이들의 통신, 및 질환 유도 및 진행에서 이들의 관여에 대한 특유의 통찰을 제공한다.

이러한 전략의 중요한 실용적 응용은 마우스 인간 면역계의 "인간화"이다. 내인성 Ig 유전자가 불활성화된 마우스 내로 인간 면역글로불린(Ig) 유전자좌의 도입은 B-세포 개발에서의 이들의 역할 뿐만 아니라 항체의 프로그램된 발현 및 조립의 근간이 되는 메카니즘을 연구하는 기회를 제공한다. 추가로, 이러한 전략은 완전 인간 모노클로날 항체(mAb)의 생성을 위한 이상적 공급원 - 인간 질환에서 항체 치료의 약속을 이행하는 것에 대한 중요한 초석을 제공할 수 있다. 완전 인간 항체/항체 작제물은 마우스 또는 마우스-유도체화 mAb에 고유한 면역원성 및 알러지성 반응을 최소화하고 따라서 투여된 항체/항체 작제물의 효능 및 안전성을 증가시킬 것으로 예상된다. 완전 인간 항체/항체 작제물의 사용은, 반복된 화합물 투여를 필요로 하는, 염증, 자가면역 및 암 등의 만성 및 재발 인간 질환의 치료에 있어서 실질적 잇점을 제공할 것으로 예상할 수 있다.

이러한 목표를 향한 한 가지 접근법은, 이러한 마우스가 마우스 항체의 부재하에 인간 항체의 거대한 거대한 레퍼토리를 생성하는 것을 예상하여 인간 Ig 유전자좌의 거대 단편을 갖는 마우스 항체 생성에서 결여한 마우스 균주를 조작하는 것이었다. 거대 인간 Ig 단편은 항체 생성 및 발현의 적절한 조절 뿐만 아니라 거대 가변 유전자 다양성을 보존할 것이다. 항체 다양화 및 선택 및 인간 단백질에 대한 면역학적 내성의 결여에 대한 마우스 기구를 이용함으로써 이들 마우스 균주에서 재생된 인간 항체 레퍼토리는 인간 항원을 포함하여 목적하는 임의의 항원에 대한 고친화성 항체를 생성해야 한다. 하이브리도마 기술을 사용하여, 목적하는 특이성을 갖는 항원-특이적 인간 mAb는 용이하게 생성 및 선택될 수 있다. 이러한 일반적 전략은 1994년에 공개된 최초의 XenoMouse 마우스 균주의 생성과 관련하여 입증되었다[참조: Green et al. Nature Genetics 7:13-21 (1994)]. XenoMouse 균주는, 코어 가변 및 불변 영역 서열을 함유하는 각각 인간 중쇄 유전자좌 및 카파 경쇄 유전자좌의 245kb 및 190kb 크기의 생식계 배열 단편을 함유하는 효모 인공 염색체(YAC)로 조작되었다(상동). 인간 Ig 함유 YAC는 항체의 재배열 및 발현 둘 다를 위한 마우스 시스템에 적합한 것으로 증명되었고, 불활성화된 마우스 Ig 유전자를 치환할 수 있었다. 이는 B-세포 발달을 유도하고 완전 인간 항체의 성인-유사 인간 레퍼토리를 생성하고 항원-특이적 인간 mAb를 생성하는 이들의 능력에 의해 입증되었다. 이들 결과는 또한 보다 많은 수의 V 유전자, 추가의 조절 요소 및 인간 Ig 불변 영역을 함유하는 인간 Ig 유전자좌의 보다 큰 부분의 도입이 감염 및 면역화에 대한 인간 체액성 반응의 특성인 완전 레퍼토리를 실질적으로 재현할 수 있음을 시사했다. 그린(Green) 등의 작업은 각각 인간 중쇄 유전자좌 및 카파 경쇄 유전자좌의 메가베이스 크기의 생식계 배열 YAC 단편의 도입을 통해 대략 80% 초과의 인간 항체 레퍼토리의 도입까지 최근 확장되었다[참조: Mendez et al. Nature Genetics 15:146-156 (1997) 및 미국 출원번호 제08/759,620호(1996년 12월 3일자로 출원), 이들의 개시는 참조로서 도입된다].

XenoMouse 마우스의 생성은 문헌[참조: 1990년 1월 12일자로 출원된 미국 특허출원번호 제07/466,008호, 1990년 11월 8일자 출원된 출원번호 제07/610,515호, 1992년 7월 24일자로 출원된 출원번호 제07/919,297호, 1992년 7월 30일자로 출원된 출원번호 제07/922,649호, 1993년 3월 15일자로 출원된 출원번호 제08/031,801호, 1993년 8월 27일자로 출원된 출원번호 제08/112,848호, 1994년 4월 28일자로 출원된 제08/234,145호, 1995년 1월 20일자로 출원된 출원번호 제08/376,279호, 1995년 4월 27일자로 출원된 출원번호 제08/430,938호, 1995년 6월 5일자로 출원된 출원번호 제08/464,584호, 1995년 6월 5일자로 출원된 출원번호 제08/464,582호, 1995년 6월 5일자로 출원된 출원번호 제08/463,191호, 1995년 6월 5일자로 출원된 출원번호 제08/462,837호, 1995년 6월 5일자로 출원된 출원번호 제08/486,853호, 1995년 6월 5일자로 출원된 출원번호 제08/486,857호, 1995년 6월 5일자로 출원된 출원번호 제08/486,859호, 1995년 6월 5일자로 출원된 출원번호 제08/462,513호, 1996년 10월 2일자로 출원된 출원번호 제08/724,752호, 및 1996년 12월 3일자로 출원된 출원번호 제08/759,620호, 및 미국 특허 제6,162,963호, 제6,150,584호, 제6,114,598호, 제6,075,181호, 및 제5,939,598호 및 일본 특허 제3 068 180 B2호, 제3 068 506 B2호, 및 제3 068 507 B2호. 또한, Mendez et al. Nature Genetics 15:146-156 (1997) and Green and Jakobovits J. Exp. Med. 188:483-495 (1998). 또한, 1996년 6월 12일자로 공고된 유럽 특허 제EP 0 463151 B1호, 1994년 2월 3일자로 공개된 국제특허 공개공보 WO 94/02602, 1996년 10월 31일자로 공개된 국제특허 공개공보 WO 96/34096, 1998년 6월 11일자로 공개된 국제특허 공개공보 WO 98/24893, 2000년 12월 21일자로 공개된 국제특허 공개공보 WO 00/76310, WO 03/47336]에 추가로 논의 및 발표되었다. 상기 인용된 특허, 출원 및 참조문헌 각각의 개시는 이들의 전체가 참조로서 본원에 도입된다.

대안적 접근법에서, 젠팜 인터네셔날 인코포레티드(GenPharm International, Inc.)를 포함하는 다른 회사는 "미니유전자좌" 접근법을 사용해 왔다. 미니유전자좌 접근법에서, 외인성 Ig 유전자좌는 Ig 유전자좌로부터의 소편(개개 유전자)의 포함에 의해 모방된다. 따라서, 하나 이상의 V.sub.H 유전자, 하나 이상의 D.sub.H 유전자, 하나 이상의 J.sub.H 유전자, mu 불변 영역 및 제2 불변 영역(바람직하게는 감마 불변 영역)이 동물 내로의 삽입을 위해 작제물에 형성된다. 이러한 접근법은 문헌[참조: 미국 특허 제5,545,807호(Surani et al.) 및 미국 특허 제5,545,806호, 제5,625,825호, 제5,625,126호, 제5,633,425호, 제5,661,016호, 제5,770,429호, 제5,789,650호, 제5,814,318호, 제5,877,397호, 제5,874,299호, 및 제6,255,458호(각각 Lonberg and Kay), 미국 특허 제5,591,669호 및 제6,023.010호(Krimpenfort and Berns), 미국 특허 제5,612,205호, 제5,721,367호, 및 제5,789,215호(Berns et al.), 및 미국 특허 제5,643,763호(Choi and Dunn), 및 젠팜 인터네셔날(GenPharm International)의 미국 특허출원 제07/574,748호(1990년 8월 29일자로 출원), 출원번호 제07/575,962호(1990년 8월 31일자로 출원), 출원번호 제07/810,279호(1991년 12월 17일자로 출원), 출원번호 제07/853,408호(1992년 3월 18일자로 출원), 출원번호 제07/904,068호(1992년 6월 23일자로 출원), 출원번호 제07/990,860호(1992년 12월 16일자로 출원), 출원번호 제08/053,131호(1993년 4월 26일자로 출원), 출원번호 제08/096,762호(1993년 7월 22일자로 출원), 출원번호 제08/155,301호(1993년 11월 18일자로 출원), 출원번호 제08/161,739호(1993년 12월 3일자로 출원), 출원번호 제08/165,699호(1993년 12월 10일자로 출원), 출원번호 제08/209,741호(1994년 3월 9일자로 출원), 이의 개시는 참조로서 본원에서 도입됨, 또한 유럽 특허 제0 546 073 B1호, 국제 특허출원 공개공보 WO 92/03918, WO 92/22645, WO 92/22647, WO 92/22670, WO 93/12227, WO 94/00569, WO 94/25585, WO 96/14436, WO 97/13852, 및 WO 98/24884 및 미국 특허 제5,981,175호, 이의 개시는 이의 전체가 본원에 참조로서 도입됨, 또한, 추가로, 문헌[참조: Taylor et al., 1992, Chen et al., 1993, Tuaillon et al., 1993, Choi et al., 1993, Lonberg et al., (1994), Taylor et al., (1994), and Tuaillon et al., (1995), Fishwild et al., (1996)], 이의 개시는 이들의 전체가 본원에서 참조로서 도입됨]에 기재되어 있다.

기린(Kirin)은 또한, 마이크로셀 융합을 통해 염색체 또는 전체 염색체의 거대 단편이 도입된 마우스로부터 인간 항체의 생성을 입증했다[참조: 유럽 특허출원번호 제773 288호 및 제843 961호, 이의 개시는 참조로서 본원에 도입됨]. 제네렉스 바이오사이언시스(Xenerex Biosciences)는 인간 항체의 잠재적 생성을 위한 기술을 개발하고 있다. 이 기술에서, SCID 마우스는 인간 림프 세포, 예를 들면, B 및/또는 T 세포로 재구성된다. 이어서, 마우스는 항원으로 면역화시키고, 항원에 대한 면역 반응을 생성할 수 있다[참조: 미국 특허번호 제5,476,996호, 제5,698,767호 및 제5,958,765호].

인간 항-마우스 항체(HAMA) 반응은 키메라 또는 달리는 인간화 항체를 제조하기 위해 산업계를 유도해 왔다. 키메라 항체는 인간 불변 영역 및 뮤린 가변 영역을 갖지만, 특정 인간 항-키메라 항체(HACA) 반응이 특히 항체의 만성 또는 다용량 사용시에 관찰될 것으로 예상된다. 따라서, 이는 HAMA 또는 HACA 반응의 개념 및/또는 효과를 손상시키기 위해 EGFRvIII에 대한 완전 인간 항체를 제공하는 것이 바람직할 것이다.

CDH19/CD3 이중특이적 항체 작제물에 의해 매개된 세포독성은 다양한 방식으로 측정할 수 있다. 효과기 세포는, 예를 들면, 자극된 강화 (인간) CD8 양성 T 세포 또는 비자극된 (인간) 말초혈 단핵구(PBMC)일 수 있다. 표적 세포가 마카크 기원의 것이거나 마카크 CDH19를 발현하거나 마카크 CDH19로 형질감염되는 경우, 효과기 세포는 또한 마카크 T 세포주, 예를 들면, 4119LnPx 등의 마카크 기원 것이어야 한다. 표적 세포는 CDH19(적어도 이의 세포외 도메인), 예를 들면, 인간 또는 마카크 CDH19를 발현해야 한다. 표적 세포는 CDH19, 예를 들면, 인간 또는 마카크 CDH19로 안정하게 또는 일시적으로 형질감염되는 세포주(예: CHO)일 수 있다. 또는, 표적 세포는 CDH19 양성 자연 발현체 세포주, 예를 들면, 인간 골수 세포주 CHL-1 또는 Colo-699일 수 있다. 통상적으로, EC50-값은 세포 표면 상에서 고도의 CDH19를 발현하는 표적 세포주에 의해 저하될 것으로 예상된다. 효과기 대 표적 세포(E:T) 비는 통상 약 10:1이지만, 또한 달라질 수 있다. CDH19/CD3 이중특이적 항체 작제물의 세포독성 활성은 51-크롬 방출 검정(약 18시간의 항온처리 시간) 또는 FACS-기반 세포독성 검정(약 48시간의 항온처리 시간)으로 측정할 수 있다. 검정 항온처리 시간(세포독성 반응)의 변형이 또한 가능하다. 세포독성을 측정하는 다른 방법은 상해 기술분야의 숙련가에게 공지되어 있고, MTT 또는 MTS 검정, 생물발광 검정을 포함하는 ATP-기반 검정, 설포르로다민 (SRB) 검정, WST 검정, 클론원성 검정 및 ECIS 기술을 포함한다.

본 발명의 CDH19/CD3 이중특이적 항체 작제물에 의해 매개된 세포독성 활성은 바람직하게는 세포-기반 세포독성 검정으로 측정된다. 이는 EC50 값에 의해 제시되며, 이는 절반 최대 유효 농도의 절반(기준선 및 최대치 사이의 세포독성 반응 절반을 유도하는 항체 작제물의 농도)에 상응한다. 바람직하게는, CDH19/CD3 이중특이적 항체 작제물의 EC50 값은 ≤20.000 pg/ml, 보다 바람직하게는 ≤5000 pg/ml, 보다 더 바람직하게는 ≤1000 pg/ml, 보다 더 바람직하게는 ≤500 pg/ml, 보다 더 바람직하게는 ≤350 pg/ml, 보다 더 바람직하게는 ≤320 pg/ml, 보다 더 바람직하게는 ≤250 pg/ml, 보다 더 바람직하게는 ≤100 pg/ml, 보다 더 바람직하게는 ≤50 pg/ml, 보다 더 바람직하게는 ≤10 pg/ml, 및 가장 바람직하게는 ≤5 pg/ml이다.

상기 제공된 임의의 EC50 값은 세포-기반 세포독성 검정의 지시된 시나리오 중의 어느 하나와 조합될 수 있다. 예를 들면, (인간) CD8 양성 T 세포 또는 마카크 T 세포주가 효과기 세포로서 사용되는 경우, CDH19/CD3 이중특이적 항체 작제물의 EC50 값은 바람직하게는 ≤1000 pg/ml, 보다 바람직하게는 ≤500 pg/ml, 보다 더 바람직하게는 ≤250 pg/ml, 보다 더 바람직하게는 ≤100 pg/ml, 보다 더 바람직하게는 ≤50 pg/ml, 보다 더 바람직하게는 ≤10 pg/ml, 및 가장 바람직하게는 ≤5 pg/ml이다. 이러한 검정에서 표적 세포가 (인간 또는 마카크) CDH19 형질감염된 세포, 예를 들면, CHO 세포인 경우, CDH19/CD3 이중특이적 항체 작제물의 EC50 값은 바람직하게는 ≤150 pg/ml, 보다 바람직하게는 ≤100 pg/ml, 보다 더 바람직하게는 ≤50 pg/ml, 보다 더 바람직하게는 ≤30 pg/ml, 보다 더 바람직하게는 ≤10 pg/ml, 및 가장 바람직하게는 ≤5 pg/ml이다.

표적 세포가 CDH19 양성 자연 발현체 세포주인 경우, EC50 값은 바람직하게는 ≤350 pg/ml, 보다 바람직하게는 ≤320 pg/ml, 보다 더 바람직하게는 ≤250 pg/ml, 보다 더 바람직하게는 ≤200 pg/ml, 보다 더 바람직하게는 ≤100 pg/ml, 보다 더 바람직하게는 ≤150 pg/ml, 보다 더 바람직하게는 ≤100 pg/ml, 및 가장 바람직하게는 ≤50 pg/ml 또는 그 이하이다. (인간) PBMC가 효과기 세포로 사용되는 경우, CDH19/CD3 이중특이적 항체 작제물의 EC50 값은 바람직하게는 ≤1000 pg/ml, 보다 바람직하게는 ≤750 pg/ml, 보다 바람직하게는 ≤500 pg/ml, 보다 더 바람직하게는 ≤350 pg/ml, 보다 더 바람직하게는 ≤320 pg/ml, 보다 더 바람직하게는 ≤250 pg/ml, 보다 더 바람직하게는 ≤100 pg/ml, 및 가장 바람직하게는 ≤50 pg/ml 또는 그 이하이다.

단량체성 및 이량체성 이소형의 개개 CDH19/CD3 이중특이적 항체 작제물 사이의 세포독성 활성의 차이는 "효능 갭"으로 지칭된다. 이러한 효능 갭은, 예를 들면, 분자의 단량체성 형태와 이량체성 형태의 EC50 값 사이의 비로서 계산할 수 있다. 본 발명의 CDH19/CD3 이중특이적 항체 작제물의 효능 갭은 바람직하게는 ≤5, 보다 바람직하게는 ≤4, 보다 더 바람직하게는 ≤3, 보다 더 바람직하게는 ≤2 및 가장 바람직하게는 ≤1이다.

본 발명의 항체 작제물은 펩티드 링커(스페이서 펩티드)의 존재 또는 부재하에 적어도 2개의 결합 도메인을 포함하는 융합 단백질이다. 적합한 펩티드 링커 중에는 미국 특허 제4,751,180호 및 제4,935,233호 또는 WO 88/09344에 기재된 것들이 있다.

올리고머성 항체 작제물 유도체를 제조하는 또 다른 방법은 류신 지퍼의 사용을 수반한다. 류신 지퍼 도메인은 이들이 발견되는 단백질의 올리고머화를 촉진하는 펩티드이다. 류신 지퍼는 몇몇 DNA-결합 단백질에서 본래 동정되었고[참조: Landschulz et al., 1988, Science 240:1759], 이후 각종 상이한 단백질에서 발견되었다. 공지된 류신 지퍼 중에는 이량체화 또는 삼량체화하는 자연 발생 펩티드 및 이의 유도체가 있다. 적합한 올리고머성 단백질을 생성하기에 적합한 류신 지퍼 도메인의 예는 PCT 공개공보 WO 94/10308에 기재되어 있고, 폐 계면활성제 단백질 D(SPD)로부터 유래하는 류신 지퍼는 문헌[참조: Hoppe et al., 1994, FEBS Letters 344:191, 이에 의해 참조로서 도입됨]에 기재되어 있다. 이에 융합된 이종성 단백질의 안정한 삼량체화를 가능하게 하는 변형된 류신 지퍼의 사용은 문헌[참조: Fanslow et al., 1994, Semin. Immunol. 6:267-78]에 기재되어 있다. 한 가지 접근법에서, 류신 지퍼 펩티드에 융합된 CDH19 항체 단편 또는 유도체를 포함하는 재조합 융합 단백질은 적합한 숙주 세포에서 발현되고, 형성되는 가용성 올리고머성 CDH19 항체 단편 또는 유도체는 배양 상청액으로부터 회수된다.

항원 결합 단백질의 공유결합 변형은 본 발명의 범위 내에 포함되고, 일반적으로, 항상은 아니지만, 번역후에 수행된다. 예를 들면, 항원 결합 단백질의 몇몇 유형의 공유결합 변형은 항원 결합 단백질의 특이적 아미노산 잔기를 선택된 측쇄 또는 N- 또는 C-말단 잔기와 반응할 수 있는 유기 유도체화제와 반응시킴으로써 분자 내로 도입된다.

시스테이닐 잔기는 가장 일반적으로는 α-할로아세테이트(및 상응하는 아민), 예를 들면, 클로로아세트산 또는 클로로아세트아미드와 반응하여 카복시메틸 또는 카복시아미도메틸 유도체를 제공한다. 시스테이닐 잔기는 또한 브로모트리플루오로아세톤, α-브로모-β-(5-이미다조일)프로피온산, 클로로아세틸 포스페이트, N-알킬말레이미드, 3-니트로-2-피리딜 디설파이드, 메틸 2-피리딜 디설파이드, p-클로로머큐리벤조에이트, 2-클로모머큐리-4-니트로페놀 또는 클로로-7-니트로벤조-2-옥사-1,3-디아졸과의 반응에 의해 유도체화된다.

히스티딜 잔기는, 이러한 제제가 히스티딜 측쇄에 비교적 특이적이기 때문에 pH 5.5 내지 7.0에서 디에틸피로카보네이트와의 반응에 의해 유도체화된다. 파라-브로모펜아실 브로마이드가 또한 유용하고; 반응은 바람직하게는 pH 6.0에서 0.1M 나트륨 카코딜레이트에서 수행된다. 리시닐 및 아미노 말단 잔기는 석신산 또는 기타 카복실산 무수물과 반응시킨다. 이들 제제를 사용한 유도체화는 리시닐 잔기의 전하를 역전시키는 효과를 갖는다. 알파-아미노-함유 잔기를 유도체화하는 다른 적합한 시약은 이미도에스테르, 예를 들면, 메틸 피콜린이미데이트; 피리독살 포스페이트; 피리독살; 클로로보로하이드라이드; 트리니트로벤젠설폰산; O-메틸이소우레아; 2,4-펜탄디온; 및 글리옥실레이트와의 트랜스아미나제-촉매된 반응을 포함한다.

아지닐 잔기는 하나 또는 몇몇의 종래의 시약, 그 중에서 페닐글리옥살, 2,3-부탄디온, 1,2-사이클로헥산디온 및 닌하이드린과의 반응에 의해 변형시킨다. 아르기닌 잔기의 유도체화는 구아니딘 관능기의 높은 pKa 때문에 반응을 알칼리 조건에서 수행하는 것을 필요로 한다. 추가로, 이들 시약은 아르기닌 엡실론-아미노 그룹 뿐만 아니라 리신 그룹과 반응할 수 있다.

티로실 잔기의 특이적 변형은 방향족 디아조늄 화합물 또는 테트라니트로메탄과의 반응에 의해 특히 흥미롭게는 티로실 잔기 내로 스펙트럼 표지의 도입으로 이루어질 수 있다. 가장 일반적으로, N-아세틸이미디졸 및 테트라니트로메탄은 각각 O-아세틸 티로실 종 및 3-니트로 유도체를 형성하기 위해 사용된다. 티로실 잔기는 방사선면역검정에 사용하기 위한 표지된 단백질을 제조하기 위해 125I 또는 135I를 사용하여 요오드화되고, 상기 기재된 클로르아민 T 방법이 적합하다.

카복실 측쇄 그룹(아스파르틸 또는 글루타밀)은 카보디이미드(R'-N=C=N-R')(여기서, R 및 R'는 임의로 상이한 알킬 그룹이다), 예를 들면, 1-사이클로헥실-3-(2-모르폴리닐-4-에틸)카보디이미드 또는 1-에틸-3-(4-아조니아-4,4-디메틸펜틸)카보디이미드와의 반응에 의해 선택적으로 변형된다. 추가로, 아스파르틸 및 글루타밀 잔기는 암모늄 이온과의 반응에 의해 아스파라기닐 및 글루타미닐 잔기로 전환된다.

이관능성 제제를 사용한 유도체화는 다양한 방법에서 사용하기 위해 수-불용성 지지체 매트릭스 또는 표면에 대한 항원 결합 단백질의 가교결합에 유용하다. 통상 사용되는 가교결합제는, 예를 들면, 1,1-비스(디아조아세틸)-2-페닐에탄, 글루타르알데히드, N-하이드록시석신이미드 에스테르, 예를 들면, 4-아지도살리실산과의 에스테르, 3,3'-디티오비스(석신이미딜프로피오네이트) 등의 디석신이미딜 에스테를 포함하는 호모이관능성 이미도에스테르, 및 비스-N-말레이미도-1,8-옥탄 등의 이관능성 말레이미드를 포함한다. 메틸-3-[(p-아지도페닐)디티오]프로피오이미데이트 등의 유도체화제는 광의 존재하에 가교결합을 형성할 수 있는 광활성화 가능한 중간체를 제공한다. 또는, 시아노겐 브로마이드-활성화된 탄수화물 및 미국 특허 제3,969,287호; 제3,691,016호; 제4,195,128호; 제4,247,642호; 제4,229,537호; 및 제4,330,440호에 기재된 반응성 기질 등의 반응성 수-불용성 매트릭스가 단백질 고정화에 사용된다.

글루타미닐 및 아스파라기닐 잔기는 각각 상응하는 글루타밀 및 아스파르틸 잔기로 종종 탈아미드화된다. 또는, 이들 잔기는 온화한 산성 조건하에 탈아미드화된다. 이들 잔기의 어느 형태도 본 발명의 범위 내에 포함된다.

다른 변형은 프로필린 및 리신의 하이드록실화, 세릴 또는 트레오닐 잔기의 하이드록실 그룹의 포스포릴화, 리신, 아르기닌 및 히스티딘 측쇄의 α-아미노 그룹의 메틸화[참조: T. E. Creighton, Proteins: Structure and Molecular Properties, W. H. Freeman & Co., San Francisco, 1983, pp. 79-86], N-말단 아민의 아세틸화 및 임의의 C-말단 카복실 그룹의 아미드화를 포함한다.

본 발명의 범위 내에 포함되는 항원 결합 단백질의 또 다른 유형의 공유결합 변형은 단백질의 글리코실화 패턴의 변경을 포함한다. 당해 기술분야에 공지된 바와 같이, 글리코실화 패턴은 단백질의 서열(예: 하기 논의된 바와 같이 특정 글리코실화 아미노산 잔기의 존재 또는 부재), 또는 단백질이 생성되는 숙주 세포 또는 생물 둘 다에 의존할 수 있다. 특정 발현 시스템은 하기에 논의되어 있다.

폴리펩티드의 글리코실화는 전형적으로 N-연결형 또는 O-연결형이다. N-연결형은 아스파라긴 잔기의 측쇄에 대한 탄수화물 잔기의 부착을 지칭한다. 트리-펩티드 서열 아스파라긴-X-세린 및 아스파라긴-X-트레오닌(여기서, X는 프롤린을 제외한 임의의 아미노산이다)은 아스파라긴 측쇄에 대한 탄수화물 잔기의 효소적 부착을 위한 인식 서열이다. 따라서, 폴리펩티드 중의 이들 트리-펩티드 서열의 어느 하나의 존재는 잠재적 글리코실화 부위를 생성한다. O-연결형 글리코실화는, 5-하이드록시프롤린 또는 5-하이드록시리신이 또한 사용될 수 있지만, 하이드록시아미노산, 가장 통상적으로는 세린 또는 트레오닌에 대한 당 N-아세틸갈락토스아민, 갈락토즈 또는 크실로즈 중의 하나의 부착을 지칭한다.

항원 결합 단백질에 대한 글리코실화 부위의 부가는 , 하나 이상의 상기한 트리-펩티드 서열(N-연결형 글리코실화 부위를 위해)을 함유하도록 아미노산 서열을 변경함으로써 편리하게 달성된다. 변경은 또한 출발 서열(O-연결형 글리코실화 부위)에 대한 하나 이상의 세린 또는 트레오닌 잔기의 부가 또는 이에 의한 치환으로 이루어질 수 있다. 용이하게 하기 위해, 항원 결합 단백질 아미노산 서열은 바람직하게는, 목적하는 아미노산 으로 번역할 수 있는 코돈이 생성되도록, 특히 예비선택된 염기에서 표적 폴리펩티드를 코딩하는 DNA를 돌연변이시킴으로써 DNA 수준에서의 변화를 통해 변경된다.

항원 결합 단백질 상의 탄수화물 잔기 수를 증가시키는 또 다른 수단은 단백질에 대한 글리코사이드의 화학적 또는 효소적 커플링에 의한 것이다. 이들 공정은 이들이 N- 및 O-연결형 글리코실화를 위한 글리코실화 능력을 갖는 숙주 세포에서 단백질의 생성을 필요로 하지 않는다는 점에서 유리하다. 사용된 커플링 방식에 따라, 당(들)은 (a) 아르기닌 및 히스티딘, (b) 유리 카복실 그룹, (c) 유리 설프하이드릴 그룹, 예를 들면, 시스테인의 것들, (d) 유리 하이드록실 그룹, 예를 들면, 세린, 트레오닌 또는 하이드록시프롤린의 것들, (e) 방향족 잔기, 예를 들면, 페닐알라닌, 티로신 또는 트립토판의 것들 또는 (f) 글루타민의 아미드 그룹에 부착할 수 있다. 이들 방법은 1987년 9월 11일자로 공개된 WO 87/05330 및 문헌[참조: Aplin and Wriston, 1981, CRC Crit . Rev. Biochem ., pp. 259-306]에 기재되어 있다.

출발 항원 결합 단백질 상에 존재하는 탄수화물 잔기의 제거는 화학적 또는 효소적으로 달성할 수 있다. 화학적 탈글리코실화는 화합물 트리플루오로메탄설폰산 또는 등가 화합물에 대한 단백질의 노출을 필요로 한다. 이 처리는 연결 당 (N-아세틸글루코사민 또는 N-아세틸갈락토사민)을 제외한 대부분 또는 모든 당의 절단을 야기하여 폴리펩티드를 온전하게 잔류시킨다. 화학적 탈글리코실화는 문헌[참조: Hakimuddin et al., 1987, Arch. Biochem. Biophys. 259:52 and by Edge et al., 1981, Anal. Biochem. 118:131]에 기재되어 있다. 폴리펩티드 상의 탄수화물 잔기의 효소적 절단은 문헌[참조: Thotakura et al., 1987, Meth. Enzymol. 138:350]에 기재된 바와 같이 각종 엔도- 및 엑소-글리코시다제의 사용에 의해 달성할 수 있다. 잠재적 글리코실화 부위에서의 글리코실화는 문헌[참조: Duskin et al., 1982, J. Biol. Chem. 257:3105]에 기재된 바와 같은 화합물 투니카마이신의 사용에 의해 방지할 수 있다. 투니카마이신은 단백질-N-글리코사이드 결합의 형성을 차단한다.

항원 결합 단백질의 또 다른 유형의 공유결합 변형은 문헌[참조: 미국 특허 제4,640,835호; 제4,496,689호; 제4,301,144호; 제4,670,417호; 제4,791,192호 또는 제4,179,337호]에 기재된 방식으로, 이로써 한정되지 않지만, 다양한 폴리올, 예를 들면, 폴리에틸렌 글리콜, 폴리프로필렌 글리콜 또는 폴리옥시알킬렌을 포함하는 다양한 비-단백질성 중합체에 대한 항원 결합 단백질의 연결을 포함한다. 또한, 당해 기술분야에 공지된 바와 같이, 아미노산 치환은 PEG 등의 중합체의 부가를 용이하게 하기 위해 항원 결합 단백질 내의 다양한 위치에서 이루어질 수 있다.

일부 실시형태에서, 본 발명의 항원 결합 단백질의 공유결합 변형은 하나 이상의 표지의 부가를 포함한다.

용어 "표지 그룹"은 임의의 검출가능한 표지를 의미한다. 적합한 표지 그룹의 예는, 이로써 한정되지 않지만, 하기의 것들을 포함한다: 방사성동위원소 또는 방사성핵종(예: 3H, 14C, 15N, 35S, 89Zr, 90Y, 99Tc, 111In, 125I, 131I), 형광 그룹(예: FITC, 로다민, 란타나이드 인광체), 효소 그룹(예: 서양고추냉이 퍼옥시다제, β-갈락토시다제, 루시퍼라제, 알칼리 포스파타제), 화학발광 그룹, 비오티닐 그룹 또는 2차 리포터에 의해 인식되는 소정 폴리펩티드 에피토프(예: 류신 지퍼 쌍 서열, 2차 항체를 위한 결합 부위, 금속 결합 도메인, 에피토프 태그). 일부 실시형태에서, 표지 그룹은 잠재적 입체 장애를 감소시키기 위해 다양한 길이의 스페이서 암을 통해 항원 결합 단백질에 커플링된다. 단백질을 표지하는 다양한 방법은 당해 기술분야에 공지되어 있고, 본 발명의 실시에 사용될 수 있다.

일반적으로, 표지는, 이들이 검출하고자 하는 하는 검정에 따라 다양한 부류로 분류된다: a) 방사성 동위체 또는 중동위체일 수 있는 동위체 표지; b) 자기 표지(예: 자기 입자); c) 산화환원 활성 잔기; d) 광학 염료; 효소 그룹(예: 서양고추냉이 퍼옥시다제, β-갈락토시다제, 루시퍼라제, 알칼리 포스파타제); e) 비오티닐화 그룹; 및 f) 2차 리포터에 의해 인식되는 소정 폴리펩티드 에피토프(예: 류신 지퍼 쌍 서열, 2차 항체를 위한 결합 부위, 금속 결합 도메인, 에피토프 태그 등). 일부 실시형태에서, 표지 그룹은 잠재적 입체 장애를 감소시키기 위해 다양한 길이의 스페이서 암을 통해 항원 결합 단백질에 커플링된다. 단백질을 표지하는 다양한 방법은 당해 기술분야에 공지되어 있고, 본 발명의 실시에 사용될 수 있다.

구체적 표지는, 이로써 한정되지 않지만, 발색단, 인광체 및 형광체를 포함하는 광학 염료를 포함하고, 후자는 다수의 경우에 특이적이다. 형광체는 "소분자" 형광물질 또는 단백질성 형광물질일 수 있다.

"형광 표지"란 이의 고유의 형광 특성을 통해 검출될 수 있는 임의의 분자를 의미한다. 적합한 형광 표지는, 이로써 한정되지 않지만, 플루오레세인, 로다민, 테트라메틸로다민, 에오신, 에리트로신, 쿠마린, 메틸-쿠마린, 피렌, 말라사이트 그린, 스틸벤, 루시퍼 옐로우, 캐스케이드 BlueJ, 텍사스(Texas) Red, IAEDANS, EDANS, BODIPY FL, LC Red 640, Cy 5, Cy 5.5, LC Red 705, 오레곤(Oregon) 그린, 알렉사-플루오르(Alexa-Fluor) 염료(Alexa Fluor 350, Alexa Fluor 430, Alexa Fluor 488, Alexa Fluor 546, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 633, Alexa Fluor 660, Alexa Fluor 680), 캐스케이드 블루(Cascade Blue), 캐스케이드 옐로우(Cascade Yellow) 및 R-리코에리트린(PE)(Molecular Probes, Eugene, OR), FITC, Rhodamine, and Texas Red(Pierce, Rockford, IL), Cy5, Cy5.5, Cy7 (Amersham Life Science, Pittsburgh, PA)를 포함한다. 형광체를 포함하는 광학 염료는 문헌[참조: Molecular Probes Handbook by Richard P. Haugland, 이에 의해 참조로서 명시적으로 도입됨]에 기재되어 있다.

적합한 단백질성 형광 표지는 또한, 이로써 한정되지 않지만, 녹색 형광 단백질(Renilla, Ptilosarcus, 또는 GFP의 아에쿠오레아(Aequorea) 종(Chalfie et al., 1994, Science 263:802-805), EGFP(Clontech Laboratories, Inc., Genbank Accession Number U55762)), 청색 형광 단백질(BFP, Quantum Biotechnologies, Inc. 1801 de Maisonneuve Blvd. West, 8th Floor, Montreal, Quebec, Canada H3H 1J9; Stauber, 1998, Biotechniques 24:462-471; Heim et al., 1996, Curr. Biol. 6:178-182), 증강된 황색 형광 단백질(EYFP, Clontech Laboratories, Inc.), 루시퍼라제(Ichiki et al., 1993, J. Immunol. 150:5408-5417), β 갈락토시다제(Nolan et al., 1988, Proc . Natl . Acad . Sci . U.S.A. 85:2603-2607) 및 레닐라(Renilla)(WO 92/15673, WO 95/07463, WO 98/14605, WO 98/26277, WO 99/49019, 미국 특허 제5292658호, 제5418155호, 제5683888호, 제5741668호, 제5777079호, 제5804387호, 제5874304호, 제5876995호, 제5925558호)를 포함한다. 상기 인용된 모든 참조문헌은 본원에서 참조로서 명시적으로 도입된다.

본 발명의 항체 작제물은 또한, 예를 들면, 분자의 분리에 유용하거나 분자의 적합한 약물동태 프로파일과 관련되는 추가의 도메인을 포함할 수 있다.

항체 작제물의 분리에 유용한 도메인은 펩티드 모티브 또는 2차 도입된 잔기로부터 선택될 수 있고, 이는 분리 방법, 예를 들면, 분리 컬럼에 포획될 수 있다. 이러한 추가 도메인의 비-제한적 실시형태는 Myc-tag, HAT-tag, HA-tag, TAP-tag, GST-tag, 키틴 결합 도메인(CBD-tag), 말토즈 결합 단백질(MBP-tag), Flag-tag, Strep-tag 및 이의 변이체(예: StrepII-tag) 및 His-tag로서 공지된 펩티드 모티브를 포함한다. 동정된 CDR을 특징으로 하는 본원에 개시된 모든 항체 작제물은 His-tag 도메인을 포함하는 것이 바람직하고, 이는 일반적으로 분자의 아미노산 서열 중의 연속 His 잔기의 반복체, 바람직하게는 6개 His 잔기로서 공지되어 있다.

첨부된 실시예 2에 기재된 바와 같이, 광범위한 수의 CDH19 특이적 결합제가 동정된 결합 특성과 관련하여 특성화되었고, 이들 결합제는 CDH19 특이적 결합 도메인의 5개 상이한 아그룹을 지칭하는 5개의 상이한 빈으로 분류되었다. 따라서, 본 발명의 항체 작제물의 한 가지 실시형태에서, 제1 결합 도메인은

(a) 서열번호 52에 제시된 CDR-H1, 서열번호 53에 제시된 CDR-H2, 서열번호 54에 제시된 CDR-H3, 서열번호 220에 제시된 CDR-L1, 서열번호 221에 제시된 CDR-L2 및 서열번호 222에 제시된 CDR-L3,

서열번호 82에 제시된 CDR-H1, 서열번호 83에 제시된 CDR-H2, 서열번호 84에 제시된 CDR-H3, 서열번호 250에 제시된 CDR-L1, 서열번호 251에 제시된 CDR-L2 및 서열번호 252에 제시된 CDR-L3,

서열번호 82에 제시된 CDR-H1, 서열번호 83에 제시된 CDR-H2, 서열번호 84에 제시된 CDR-H3, 서열번호 250에 제시된 CDR-L1, 서열번호 251에 제시된 CDR-L2 및 서열번호 927에 제시된 CDR-L3,

서열번호 82에 제시된 CDR-H1, 서열번호 83에 제시된 CDR-H2, 서열번호 909에 제시된 CDR-H3, 서열번호 250에 제시된 CDR-L1, 서열번호 251에 제시된 CDR-L2 및 서열번호 927에 제시된 CDR-L3,

서열번호 52에 제시된 CDR-H1, 서열번호 53에 제시된 CDR-H2, 서열번호 54에 제시된 CDR-H3, 서열번호 220에 제시된 CDR-L1, 서열번호 221에 제시된 CDR-L2 및 서열번호 926에 제시된 CDR-L3,

서열번호 52에 제시된 CDR-H1, 서열번호 53에 제시된 CDR-H2, 서열번호 904에 제시된 CDR-H3, 서열번호 220에 제시된 CDR-L1, 서열번호 221에 제시된 CDR-L2 및 서열번호 926에 제시된 CDR-L3,

서열번호 1126에 제시된 CDR-H1, 서열번호 1127에 제시된 CDR-H2, 서열번호 1128에 제시된 CDR-H3, 서열번호 1129에 제시된 CDR-L1, 서열번호 1130에 제시된 CDR-L2 및 서열번호 1131에 제시된 CDR-L3,

서열번호 1165에 제시된 CDR-H1, 서열번호 1166에 제시된 CDR-H2, 서열번호 1167에 제시된 CDR-H3, 서열번호 1168에 제시된 CDR-L1, 서열번호 1169에 제시된 CDR-L2 및 서열번호 1170에 제시된 CDR-L3,

서열번호 1334에 제시된 CDR-H1, 서열번호 1335에 제시된 CDR-H2, 서열번호 1336에 제시된 CDR-H3, 서열번호 1337에 제시된 CDR-L1, 서열번호 1338에 제시된 CDR-L2 및 서열번호 1339에 제시된 CDR-L3,

서열번호 1347에 제시된 CDR-H1, 서열번호 1348에 제시된 CDR-H2, 서열번호 1349에 제시된 CDR-H3, 서열번호 1350에 제시된 CDR-L1, 서열번호 1351에 제시된 CDR-L2 및 서열번호 1352에 제시된 CDR-L3,

서열번호 1360에 제시된 CDR-H1, 서열번호 1361에 제시된 CDR-H2, 서열번호 1362에 제시된 CDR-H3, 서열번호 1363에 제시된 CDR-L1, 서열번호 1364에 제시된 CDR-L2 및 서열번호 1365에 제시된 CDR-L3,

서열번호 1425에 제시된 CDR-H1, 서열번호 1426에 제시된 CDR-H2, 서열번호 1427에 제시된 CDR-H3, 서열번호 1428에 제시된 CDR-L1, 서열번호 1429에 제시된 CDR-L2 및 서열번호 1430에 제시된 CDR-L3,

서열번호 1438에 제시된 CDR-H1, 서열번호 1439에 제시된 CDR-H2, 서열번호 1440에 제시된 CDR-H3, 서열번호 1441에 제시된 CDR-L1, 서열번호 1442에 제시된 CDR-L2 및 서열번호 1443에 제시된 CDR-L3,

서열번호 2167에 제시된 CDR-H1, 서열번호 2168에 제시된 CDR-H2, 서열번호 2169에 제시된 CDR-H3, 서열번호 2170에 제시된 CDR-L1, 서열번호 2171에 제시된 CDR-L2 및 서열번호 2172에 제시된 CDR-L3 (이들 모두는 빈 1으로 분류된 CDH19에 대한 결합 도메인을 특성화한다);

(b) 서열번호 124에 제시된 CDR-H1, 서열번호 125에 제시된 CDR-H2, 서열번호 126에 제시된 CDR-H3, 서열번호 292에 제시된 CDR-L1, 서열번호 293에 제시된 CDR-L2 및 서열번호 294에 제시된 CDR-L3,

서열번호 130에 제시된 CDR-H1, 서열번호 131에 제시된 CDR-H2, 서열번호 132에 제시된 CDR-H3, 서열번호 298에 제시된 CDR-L1, 서열번호 299에 제시된 CDR-L2 및 서열번호 300에 제시된 CDR-L3,

서열번호 136에 제시된 CDR-H1, 서열번호 137에 제시된 CDR-H2, 서열번호 138에 제시된 CDR-H3, 서열번호 304에 제시된 CDR-L1, 서열번호 305에 제시된 CDR-L2 및 서열번호 306에 제시된 CDR-L3,

서열번호 142에 제시된 CDR-H1, 서열번호 143에 제시된 CDR-H2, 서열번호 144에 제시된 CDR-H3, 서열번호 310에 제시된 CDR-L1, 서열번호 311에 제시된 CDR-L2 및 서열번호 312에 제시된 CDR-L3,

서열번호 148에 제시된 CDR-H1, 서열번호 149에 제시된 CDR-H2, 서열번호 150에 제시된 CDR-H3, 서열번호 316에 제시된 CDR-L1, 서열번호 317에 제시된 CDR-L2 및 서열번호 318에 제시된 CDR-L3,

서열번호 166에 제시된 CHR-H1, 서열번호 167에 제시된 CDR-H2, 서열번호 168에 제시된 CDR-H3, 서열번호 334에 제시된 CDR-L1, 서열번호 335에 제시된 CDR-L2 및 서열번호 336에 제시된 CDR-L3,

서열번호 124에 제시된 CDR-H1, 서열번호 125에 제시된 CDR-H2, 서열번호 915에 제시된 CDR-H3, 서열번호 292에 제시된 CDR-L1, 서열번호 293에 제시된 CDR-L2 및 서열번호 294에 제시된 CDR-L3,

서열번호 124에 제시된 CDR-H1, 서열번호 125에 제시된 CDR-H2, 서열번호 915에 제시된 CDR-H3, 서열번호 292에 제시된 CDR-L1, 서열번호 293에 제시된 CDR-L2 및 서열번호 928에 제시된 CDR-L3,

서열번호 124에 제시된 CDR-H1, 서열번호 125에 제시된 CDR-H2, 서열번호 915에 제시된 CDR-H3, 서열번호 292에 제시된 CDR-L1, 서열번호 293에 제시된 CDR-L2 및 서열번호 929에 제시된 CDR-L3,

서열번호 166에 제시된 CDR-H1, 서열번호 167에 제시된 CDR-H2, 서열번호 168에 제시된 CDR-H3, 서열번호 334에 제시된 CDR-L1, 서열번호 335에 제시된 CDR-L2 및 서열번호 336에 제시된 CDR-L3,

서열번호 166에 제시된 CDR-H1, 서열번호 167에 제시된 CDR-H2, 서열번호 168에 제시된 CDR-H3, 서열번호 334에 제시된 CDR-L1, 서열번호 335에 제시된 CDR-L2 및 서열번호 942에 제시된 CDR-L3,

서열번호 166에 제시된 CDR-H1, 서열번호 167에 제시된 CDR-H2, 서열번호 168에 제시된 CDR-H3, 서여번호 334에 제시된 CDR-L1, 서열번호 335에 제시된 CDR-L2 및 서열번호 943에 제시된 CDR-L3,

서열번호 148에 제시된 CDR-H1, 서열번호 149에 제시된 CDR-H2, 서열번호 150에 제시된 CDR-H3, 서열번호 316에 제시된 CDR-L1, 서열번호 317에 제시된 CDR-L2 및 서열번호 318에 제시된 CDR-L3,

서열번호 148에 제시된 CDR-H1, 서열번호 149에 제시된 CDR-H2, 서열번호 150에 제시된 CDR-H3, 서열번호 316에 제시된 CDR-L1, 서열번호 317에 제시된 CDR-L2 및 서열번호 937에 제시된 CDR-L3,

서열번호 148에 제시된 CDR-H1, 서열번호 149에 제시된 CDR-H2, 서열번호 150에 제시된 CDR-H3, 서열번호 316에 제시된 CDR-L1, 서열번호 317에 제시된 CDR-L2 및 서열번호 938에 제시된 CDR-L3,

서열번호 148에 제시된 CDR-H1, 서열번호 149에 제시된 CDR-H2, 서열번호 919에 제시된 CDR-H3, 서열번호 316에 제시된 CDR-L1, 서열번호 317에 제시된 CDR-L2 및 서열번호 938에 제시된 CDR-L3,

서열번호 142에 제시된 CDR-H1, 서열번호 143에 제시된 CDR-H2, 서열번호 144에 제시된 CDR-H3, 서열번호 310에 제시된 CDR-L1, 서열번호 311에 제시된 CDR-L2 및 서열번호 935에 제시된 CDR-L3,

서열번호 142에 제시된 CDR-H1, 서열번호 143에 제시된 CDR-H2, 서열번호 918에 제시된 CDR-H3, 서열번호 310에 제시된 CDR-L1, 서열번호 311에 제시된 CDR-L2 및 서열번호 935에 제시된 CDR-L3,

서열번호 142에 제시된 CDR-H1, 서열번호 143에 제시된 CDR-H2, 서열번호 918에 제시된 CDR-H3, 서열번호 310에 제시된 CDR-L1, 서열번호 311에 제시된 CDR-L2 및 서열번호 936에 제시된 CDR-L3,

서열번호 136에 제시된 CDR-H1, 서열번호 137에 제시된 CDR-H2, 서열번호 138에 제시된 CDR-H3, 서열번호 304에 제시된 CDR-L1, 서열번호 305에 제시된 CDR-L2 및 서열번호 933에 제시된 CDR-L3,

서열번호 136에 제시된 CDR-H1, 서열번호 137에 제시된 CDR-H2, 서열번호 917에 제시된 CDR-H3, 서열번호 304에 제시된 CDR-L1, 서열번호 305에 제시된 CDR-L2 및 서열번호 934에 제시된 CDR-L3,

서열번호 130에 제시된 CDR-H1, 서열번호 131에 제시된 CDR-H2, 서열번호 132에 제시된 CDR-H3, 서열번호 298에 제시된 CDR-L1, 서열번호 299에 제시된 CDR-L2 및 서열번호 930에 제시된 CDR-L3,

서열번호 130에 제시된 CDR-H1, 서열번호 131에 제시된 CDR-H2, 서열번호 916에 제시된 CDR-H3, 서열번호 298에 제시된 CDR-L1, 서열번호 299에 제시된 CDR-L2 및 서열번호 931에 제시된 CDR-L3,

서열번호 130에 제시된 CDR-H1, 서열번호 131에 제시된 CDR-H2, 서열번호 916에 제시된 CDR-H3, 서열번호 298에 제시된 CDR-L1, 서열번호 299에 제시된 CDR-L2 및 서열번호 932에 제시된 CDR-L3,

서열번호 1009에 제시된 CDR-H1, 서열번호 1010에 제시된 CDR-H2, 서열번호 1011에 제시된 CDR-H3, 서열번호 1012에 제시된 CDR-L1, 서열번호 1013에 제시된 CDR-L2 및 서열번호 1014에 제시된 CDR-L3,

서열번호 1022에 제시된 CDR-H1, 서열번호 1023에 제시된 CDR-H2, 서열번호 1024에 제시된 CDR-H3, 서열번호 1025에 제시된 CDR-L1, 서열번호 1026에 제시된 CDR-L2 및 서열번호 1027에 제시된 CDR-L3,

서열번호 1035에 제시된 CDR-H1, 서열번호 1036에 제시된 CDR-H2, 서열번호 1037에 제시된 CDR-H3, 서열번호 1038에 제시된 CDR-L1, 서열번호 1039에 제시된 CDR-L2 및 서열번호 1040에 제시된 CDR-L3,

서열번호 1074에 제시된 CDR-H1, 서열번호 1075에 제시된 CDR-H2, 서열번호 1076에 제시된 CDR-H3, 서열번호 1077에 제시된 CDR-L1, 서열번호 1078에 제시된 CDR-L2 및 서열번호 1079에 제시된 CDR-L3,

서열번호 1100에 제시된 CDR-H1, 서열번호 1101에 제시된 CDR-H2, 서열번호 1102에 제시된 CDR-H3, 서열번호 1103에 제시된 CDR-L1, 서열번호 1104에 제시된 CDR-L2 및 성열번호 1105에 제시된 CDR-L3,

서열번호 1113에 제시된 CDR-H1, 서열번호 1114에 제시된 CDR-H2, 서열번호 1115에 제시된 CDR-H3, 서열번호 1116에 제시된 CDR-L1, 서열번호 1117에 제시된 CDR-L2 및 서열번호 1118에 제시된 CDR-L3,

서열번호 1243에 제시된 CDR-H1, 서열번호 1244에 제시된 CDR-H2, 서열번호 1245에 제시된 CDR-H3, 서열번호 1246에 제시된 CDR-L1, 서열번호 1247에 제시된 CDR-L2 및 서열번호 1248에 제시된 CDR-L3,

서열번호 1256에 제시된 CDR-H1, 서열번호 1257에 제시된 CDR-H2, 서열번호 1258에 제시된 CDR-H3, 서열번호 1259에 제시된 CDR-L1, 서열번호 1260에 제시된 CDR-L2 및 서열번호 1261에 제시된 CDR-L3,

서열번호 1269에 제시된 CDR-H1, 서열번호 1270에 제시된 CDR-H2, 서열번호 1271에 제시된 CDR-H3, 서열번호 1272에 제시된 CDR-L1, 서열번호 1273에 제시된 CDR-L2 및 서열번호 1274에 제시된 CDR-L3,

서열번호 1282에 제시된 CDR-H1, 서열번호 1283에 제시된 CDR-H2, 서열번호 1284에 제시된 CDR-H3, 서열번호 1285에 제시된 CDR-L1, 서열번호 1286에 제시된 CDR-L2 및 서열번호 1287에 제시된 CDR-L3,

서열번호 1295에 제시된 CDR-H1, 서열번호 1296에 제시된 CDR-H2, 서열번호 1297에 제시된 CDR-H3, 서열번호 1298에 제시된 CDR-L1, 서열번호 1299에 제시된 CDR-L2 및 서열번호 1300에 제시된 CDR-L3,

서열번호 1647에 제시된 CDR-H1, 서열번호 1648에 제시된 CDR-H2, 서열번호 1649에 제시된 CDR-H3, 서열번호 1650에 제시된 CDR-L1, 서열번호 1651에 제시된 CDR-L2 및 서열번호 1652에 제시된 CDR-L3,

서열번호 1660에 제시된 CDR-H1, 서열번호 1661에 제시된 CDR-H2, 서열번호 1662에 제시된 CDR-H3, 서열번호 1663에 제시된 CDR-L1, 서열번호 1664에 제시된 CDR-L2 및 서열번호 1665에 제시된 CDR-L3,

서열번호 1894에 제시된 CDR-H1, 서열번호 1895에 제시된 CDR-H2, 서열번호 1896에 제시된 CDR-H3, 서열번호 1897에 제시된 CDR-L1, 서열번호 1898에 제시된 CDR-L2 및 서열번호 1899에 제시된 CDR-L3,

서열번호 1907에 제시된 CDR-H1, 서열번호 1908에 제시된 CDR-H2, 서열번호 1909에 제시된 CDR-H3, 서열번호 1910에 제시된 CDR-L1, 서열번호 1911에 제시된 CDR-L2, 서열번호 1912에 제시된 CDR-L3,

서열번호 1933에 제시된 CDR-H1, 서열번호 1934에 제시된 CDR-H2, 서열번호 1935에 제시된 CDR-H3, 서열번호 1936에 제시된 CDR-L1, 서열번호 1937에 제시된 CDR-L2 및 서열번호 1938에 제시된 CDR-L3,

서열번호 1946에 제시된 CDR-H1, 서열번호 1947에 제시된 CDR-H2, 서열번호 1948에 제시된 CDR-H3, 서열번호 1949에 제시된 CDR-L1, 서열번호 1950에 제시된 CDR-L2 및 서열번호 1951에 제시된 CDR-L3,

서열번호 1959에 제시된 CDR-H1, 서열번호 1960에 제시된 CDR-H2, 서열번호 1961에 제시된 CDR-H3, 서열번호 1962에 제시된 CDR-L1, 서열번호 1963에 제시된 CDR-L2 및 서열번호 1964에 제시된 CDR-L3,

서열번호 1972에 제시된 CDR-H1, 서열번호 1973에 제시된 CDR-H2, 서열번호 1974에 제시된 CDR-H3, 서열번호 1975에 제시된 CDR-L1, 서열번호 1976에 제시된 CDR-L2 및 서열번호 1977에 제시된 CDR-L3,

서열번호 1985에 제시된 CDR-H1, 서열번호 1986에 제시된 CDR-H2, 서열번호 1987에 제시된 CDR-H3, 서열번호 1988에 제시된 CDR-L1, 서열번호 1989에 제시된 CDR-L2 및 서열번호 1990에 제시된 CDR-L3 ,

서열번호 1998에 제시된 CDR-H1, 서열번호 1999에 제시된 CDR-H2, 서열번호 2000에 제시된 CDR-H3, 서열번호 2001에 제시된 CDR-L1, 서열번호 2002에 제시된 CDR-L2 및 서열번호 2003에 제시된 CDR-L3,

서열번호 2011에 제시된 CDR-H1, 서열번호 2012에 제시된 CDR-H2, 서열번호 2013에 제시된 CDR-H3, 서열번호 2014에 제시된 CDR-L1, 서열번호 2015에 제시된 CDR-L2 및 서열번호 2016에 제시된 CDR-L3,

서열번호 2024에 제시된 CDR-H1, 서열번호 2025에 제시된 CDR-H2, 서열번호 2026에 제시된 CDR-H3, 서열번호 2027에 제시된 CDR-L1, 서열번호 2028에 제시된 CDR-L2 및 서열번호 2029에 제시된 CDR-L3,

서열번호 2037에 제시된 CDR-H1, 서열번호 2038에 제시된 CDR-H2, 서열번호 2039에 제시된 CDR-H3, 서열번호 2040에 제시된 CDR-L1, 서열번호 2041에 제시된 CDR-L2 및 서열번호 2042에 제시된 CDR-L3 및

서열번호 2050에 제시된 CDR-H1, 서열번호 2051에 제시된 CDR-H2, 서열번호 2052에 제시된 CDR-H3, 서열번호 2053에 제시된 CDR-L1, 서열번호 2054에 제시된 CDR-L2 및 서열번호 2055에 제시된 CDR-L3 (이들 모두는 빈 2로 분류된 CDH19에 대한 결합 도메인을 특성화한다);

(c) 서열번호 94에 제시된 CDR-H1, 서열번호 95에 제시된 CDR-H2, 서열번호 96에 제시된 CDR-H3, 서열번호 262에 제시된 CDR-L1, 서열번호 263에 제시된 CDR-L2 및 서열번호 264에 제시된 CDR-L3,

서열번호 100에 제시된 CDR-H1, 서열번호 101에 제시된 CDR-H2, 서열번호 102에 제시된 CDR-H3, 서열번호 268에 제시된 CDR-L1, 서열번호 269에 제시된 CDR-L2 및 서열번호 270에 제시된 CDR-L3,

서열번호 118에 제시된 CDR-H1, 서열번호 119에 제시된 CDR-H2, 서열번호 120에 제시된 CDR-H3, 서열번호 286에 제시된 CDR-L1, 서열번호 287에 제시된 CDR-L2 및 서열번호 288에 제시된 CDR-L3,

서열번호 154에 제시된 CDR-H1, 서열번호 155에 제시된 CDR-H2, 서열번호 156에 제시된 CDR-H3, 서열번호 322에 제시된 CDR-L1, 서열번호 323에 제시된 CDR-L2 및 서열번호 324에 제시된 CDR-L3,

서열번호 100에 제시된 CDR-H1, 서열번호 101에 제시된 CDR-H2, 서열번호 912에 제시된 CDR-H3, 서열번호 268에 제시된 CDR-L1, 서열번호 269에 제시된 CDR-L2 및 서열번호 270에 제시된 CDR-L3,

서열번호 100에 제시된 CDR-H1, 서열번호 101에 제시된 CDR-H2, 서열번호 913에 제시된 CDR-H3, 서열번호 268에 제시된 CDR-L1, 서열번호 269에 제시된 CDR-L2 및 서열번호 270에 제시된 CDR-L3,

서열번호 94에 제시된 CDR-H1, 서열번호 95에 제시된 CDR-H2, 서열번호 910에 제시된 CDR-H3, 서열번호 262에 제시된 CDR-L1, 서열번호 263에 제시된 CDR-L2 및 서열번호 264에 제시된 CDR-L3,

서열번호 94에 제시된 CDR-H1, 서열번호 95에 제시된 CDR-H2, 서열번호 911에 제시된 CDR-H3, 서열번호 262에 제시된 CDR-L1, 서열번호 263에 제시된 CDR-L2 및 서열번호 264에 제시된 CDR-L3,

서열번호 118에 제시된 CDR-H1, 서열번호 119에 제시된 CDR-H2, 서열번호 120에 제시된 CDR-H3, 서열번호 286에 제시된 CDR-L1, 서열번호 287에 제시된 CDR-L2 및 서열번호 288에 제시된 CDR-L3,

서열번호 118에 제시된 CDR-H1, 서열번호 914에 제시된 CDR-H2, 서열번호 120에 제시된 CDR-H3, 서열번호 286에 제시된 CDR-L1, 서열번호 287에 제시된 CDR-L2 및 서열번호 288에 제시된 CDR-L3,

서열번호 154에 제시된 CDR-H1, 서열번호 155에 제시된 CDR-H2, 서열번호 920에 제시된 CDR-H3, 서열번호 322에 제시된 CDR-L1, 서열번호 323에 제시된 CDR-L2 및 서열번호 324에 제시된 CDR-L3,

서열번호 996에 제시된 CDR-H1, 서열번호 997에 제시된 CDR-H2, 서열번호 998에 제시된 CDR-H3, 서열번호 999에 제시된 CDR-L1, 서열번호 1000에 제시된 CDR-L2 및 서열번호 1001에 제시된 CDR-L3,

서열번호 1048에 제시된 CDR-H1, 서열번호 1049에 제시된 CDR-H2, 서열번호 1050에 제시된 CDR-H3, 서열번호 1051에 제시된 CDR-L1, 서열번호 1052에 제시된 CDR-L2 및 서열번호 1053에 제시된 CDR-L3,

서열번호 1087에 제시된 CDR-H1, 서열번호 1088에 제시된 CDR-H2, 서열번호 1089에 제시된 CDR-H3, 서열번호 1090에 제시된 CDR-L1, 서열번호 1091에 제시된 CDR-L2 및 서열번호 1092에 제시된 CDR-L3,

서열번호 1608에 제시된 CDR-H1, 서열번호 1609에 제시된 CDR-H2, 서열번호 1610에 제시된 CDR-H3, 서열번호 1611에 제시된 CDR-L1, 서열번호 1612에 제시된 CDR-L2 및 서열번호 1613에 제시된 CDR-L3,

서열번호 1621에 제시된 CDR-H1, 서열번호 1622에 제시된 CDR-H2, 서열번호 1623에 제시된 CDR-H3, 서열번호 1624에 제시된 CDR-L1, 서열번호 1625에 제시된 CDR-L2 및 서열번호 1626에 제시된 CDR-L3,

서열번호 1634에 제시된 CDR-H1, 서열번호 1635에 제시된 CDR-H2, 서열번호 1636에 제시된 CDR-H3, 서열번호 1637에 제시된 CDR-L1, 서열번호 1638에 제시된 CDR-L2 및 서열번호 1639에 제시된 CDR-L3,

서열번호 1673에 제시된 CDR-H1, 서열번호 1674에 제시된 CDR-H2, 서열번호 1675에 제시된 CDR-H3, 서열번호 1676에 제시된 CDR-L1, 서열번호 1677에 제시된 CDR-L2 및 서열번호 1678에 제시된 CDR-L3,

서열번호 1686에 제시된 CDR-H1, 서열번호 1687에 제시된 CDR-H2, 서열번호 1688에 제시된 CDR-H3, 서열번호 1689에 제시된 CDR-L1, 서열번호 1690에 제시된 CDR-L2 및 서열번호 1691에 제시된 CDR-L3,

서열번호 1699에 제시된 CDR-H1, 서열번호 1700에 제시된 CDR-H2, 서열번호 1701에 제시된 CDR-H3, 서열번호 1702에 제시된 CDR-L1, 서열번호 1703에 제시된 CDR-L2 및 서열번호 1704에 제시된 CDR-L3,

서열번호 1712에 제시된 CDR-H1, 서열번호 1713에 제시된 CDR-H2, 서열번호 1714에 제시된 CDR-H3, 서열번호 1715에 제시된 CDR-L1, 서열번호 1716에 제시된 CDR-L2 및 서열번호 1717에 제시된 CDR-L3,

서열번호 1725에 제시된 CDR-H1, 서열번호 1726에 제시된 CDR-H2, 서열번호 1727에 제시된 CDR-H3, 서열번호 1728에 제시된 CDR-L1, 서열번호 1729에 제시된 CDR-L2 및 서열번호 1730에 제시된 CDR-L3,

서열번호 1738에 제시된 CDR-H1, 서열번호 1739에 제시된 CDR-H2, 서열번호 1740에 제시된 CDR-H3, 서열번호 1741에 제시된 CDR-L1, 서열번호 1742에 제시된 CDR-L2 및 서열번호 1743에 제시된 CDR-L3,

서열번호 1751에 제시된 CDR-H1, 서열번호 1752에 제시된 CDR-H2, 서열번호 1753에 제시된 CDR-H3, 서열번호 1754에 제시된 CDR-L1, 서열번호 1755에 제시된 CDR-L2 및 서열번호 1756에 제시된 CDR-L3,

서열번호 1764에 제시된 CDR-H1, 서열번호 1765에 제시된 CDR-H2, 서열번호 1766에 제시된 CDR-H3, 서열번호 1767에 제시된 CDR-L1, 서열번호 1768에 제시된 CDR-L2 및 서열번호 1769에 제시된 CDR-L3 및

서열번호 1920에 제시된 CDR-H1, 서열번호 1921에 제시된 CDR-H2, 서열번호 1922에 제시된 CDR-H3, 서열번호 1923에 제시된 CDR-L1, 서열번호 1924에 제시된 CDR-L2 및 서열번호 1925에 제시된 CDR-L3 (이들 모두는 빈 3으로 분류된 CDH19에 대한 결합 도메인을 특성화한다);

(d) 서열번호 4에 제시된 CDR-H1, 서열번호 5에 제시된 CDR-H2, 서열번호 6에 제시된 CDR-H3, 서열번호 172에 제시된 CDR-L1, 서열번호 173에 제시된 CDR-L2 및 서열번호 174에 제시된 CDR-L3,

서열번호 10에 제시된 CDR-H1, 서열번호 11에 제시된 CDR-H2, 서열번호 12에 제시된 CDR-H3, 서열번호 178에 제시된 CDR-L1, 서열번호 179에 제시된 CDR-L2 및 서열번호 180에 제시된 CDR-L3,

서열번호 28에 제시된 CDR-H1, 서열번호 29에 제시된 CDR-H2, 서열번호 30에 제시된 CDR-H3, 서열번호 196에 제시된 CDR-L1, 서열번호 197에 제시된 CDR-L2 및 서열번호 198에 제시된 CDR-L3,

서열번호 34에 제시된 CDR-H1, 서열번호 35에 제시된 CDR-H2, 서열번호 36에 제시된 CDR-H3, 서열번호 202에 제시된 CDR-L1, 서열번호 203에 제시된 CDR-L2 및 서열번호 204에 제시된 CDR-L3,

서열번호 46에 제시된 CDR-H1, 서열번호 47에 제시된 CDR-H2, 서열번호 48에 제시된 CDR-H3, 서열번호 214에 제시된 CDR-L1, 서열번호 215에 제시된 CDR-L2 및 서열번호 216에 제시된 CDR-L3,

서열번호 58에 제시된 CDR-H1, 서열번호 59에 제시된 CDR-H2, 서열번호 60에 제시된 CDR-H3, 서열번호 226에 제시된 CDR-L1, 서열번호 227에 제시된 CDR-L2 및 서열번호 228에 제시된 CDR-L3,

서열번호 64에 제시된 CDR-H1, 서열번호 65에 제시된 CDR-H2, 서열번호 66에 제시된 CDR-H3, 서열번호 232에 제시된 CDR-L1, 서열번호 233에 제시된 CDR-L2 및 서열번호 234에 제시된 CDR-L3,

서열번호 70에 제시된 CDR-H1, 서열번호 71에 제시된 CDR-H2, 서열번호 72에 제시된 CDR-H3, 서열번호 238에 제시된 CDR-L1, 서열번호 239에 제시된 CDR-L2 및 서열번호 240에 제시된 CDR-L3,

서열번호 160에 제시된 CDR-H1, 서열번호 161에 제시된 CDR-H2, 서열번호 162에 제시된 CDR-H3, 서열번호 328에 제시된 CDR-L1, 서열번호 329에 제시된 CDR-L2 및 서열번호 330에 제시된 CDR-L3,

서열번호 46에 제시된 CDR-H1, 서열번호 47에 제시된 CDR-H2, 서열번호 48에 제시된 CDR-H3, 서열번호 924에 제시된 CDR-L1, 서열번호 215에 제시된 CDR-L2 및 서열번호 216에 제시된 CDR-L3,

서열번호 46에 제시된 CDR-H1, 서열번호 47에 제시된 CDR-H2, 서열번호 902에 제시된 CDR-H3, 서열번호 924에 제시된 CDR-L1, 서열번호 215에 제시된 CDR-L2 및 서열번호 216에 제시된 CDR-L3,

서열번호 46에 제시된 CDR-H1, 서열번호 47에 제시된 CDR-H2, 서열번호 903에 제시된 CDR-H3, 서열번호 924에 제시된 CDR-L1, 서열번호 215에 제시된 CDR-L2 및 서열번호 216에 제시된 CDR-L3,

서열번호 46에 제시된 CDR-H1, 서열번호 47에 제시된 CDR-H2, 서열번호 48에 제시된 CDR-H3, 서열번호 925에 제시된 CDR-L1, 서열번호 215에 제시된 CDR-L2 및 서열번호 216에 제시된 CDR-L3,

서열번호 70에 제시된 CDR-H1, 서열번호 907에 제시된 CDR-H2, 서열번호 72에 제시된 CDR-H3, 서열번호 238에 제시된 CDR-L1, 서열번호 239에 제시된 CDR-L2 및 서열번호 240에 제시된 CDR-L3,

서열번호 70에 제시된 CDR-H1, 서열번호 907에 제시된 CDR-H2, 서열번호 908에 제시된 CDR-H3, 서열번호 238에 제시된 CDR-L1, 서열번호 239에 제시된 CDR-L2 및 서열번호 240에 제시된 CDR-L3,

서열번호 28에 제시된 CDR-H1, 서열번호 901에 제시된 CDR-H2, 서열번호 30에 제시된 CDR-H3, 서열번호 922에 제시된 CDR-L1, 서열번호 197에 제시된 CDR-L2 및 서열번호 923에 제시된 CDR-L3,

서열번호 58에 제시된 CDR-H1, 서열번호 905에 제시된 CDR-H2, 서열번호 906에 제시된 CDR-H3, 서열번호 226에 제시된 CDR-L1, 서열번호 227에 제시된 CDR-L2 및 서열번호 228에 제시된 CDR-L3,

서열번호 58에 제시된 CDR-H1, 서열번호 905에 제시된 CDR-H2, 서열번호 60에 제시된 CDR-H3, 서열번호 226에 제시된 CDR-L1, 서열번호 227에 제시된 CDR-L2 및 서열번호 228에 제시된 CDR-L3,

서열번호 160에 제시된 CDR-H1, 서열번호 161에 제시된 CDR-H2, 서열번호 162에 제시된 CDR-H3, 서열번호 939에 제시된 CDR-L1, 서열번호 329에 제시된 CDR-L2 및 서열번호 330에 제시된 CDR-L3,

서열번호 160에 제시된 CDR-H1, 서열번호 921에 제시된 CDR-H2, 서열번호 162에 제시된 CDR-H3, 서열번호 939에 제시된 CDR-L1, 서열번호 329에 제시된 CDR-L2 및 서열번호 940에 제시된 CDR-L3,

서열번호 160에 제시된 CDR-H1, 서열번호 161에 제시된 CDR-H2, 서열번호 162에 제시된 CDR-H3, 서열번호 941에 제시된 CDR-L1, 서열번호 329에 제시된 CDR-L2 및 서열번호 330에 제시된 CDR-L3,

서열번호 28에 제시된 CDR-H1, 서열번호 29에 제시된 CDR-H2, 서열번호 30에 제시된 CDR-H3, 서열번호 196에 제시된 CDR-L1, 서열번호 197에 제시된 CDR-L2 및 서열번호 923에 제시된 CDR-L3,

서열번호 28에 제시된 CDR-H1, 서열번호 29에 제시된 CDR-H2, 서열번호 30에 제시된 CDR-H3, 서열번호 922에 제시된 CDR-L1, 서열번호 197에 제시된 CDR-L2 및 서열번호 923에 제시된 CDR-L3,

서열번호 28에 제시된 CDR-H1, 서열번호 901에 제시된 CDR-H2, 서열번호 30에 제시된 CDR-H3, 서열번호 922에 제시된 CDR-L1, 서열번호 197에 제시된 CDR-L2 및 서열번호 923에 제시된 CDR-L3,

서열번호 28에 제시된 CDR-H1, 서열번호 29에 제시된 CDR-H2, 서열번호 30에 제시된 CDR-H3, 서열번호 939에 제시된 CDR-L1, 서열번호 329에 제시된 CDR-L2 및 서열번호 330에 제시된 CDR-L3,

서열번호 970에 제시된 CDR-H1, 서열번호 971에 제시된 CDR-H2, 서열번호 972에 제시된 CDR-H3, 서열번호 973에 제시된 CDR-L1, 서열번호 974에 제시된 CDR-L2 및 서열번호 975에 제시된 CDR-L3,

서열번호 1061에 제시된 CDR-H1, 서열번호 1062에 제시된 CDR-H2, 서열번호 1063에 제시된 CDR-H3, 서열번호 1064에 제시된 CDR-L1, 서열번호 1065에 제시된 CDR-L2 및 서열번호 1066에 제시된 CDR-L3,

서열번호 1139에 제시된 CDR-H1, 서열번호 1140에 제시된 CDR-H2, 서열번호 1141에 제시된 CDR-H3, 서열번호 1142에 제시된 CDR-L1, 서열번호 1143에 제시된 CDR-L2 및 서열번호 1144에 제시된 CDR-L3,

서열번호 1152에 제시된 CDR-H1, 서열번호 1153에 제시된 CDR-H2, 서열번호 1154에 제시된 CDR-H3, 서열번호 1155에 제시된 CDR-L1, 서열번호 1156에 제시된 CDR-L2 및 서열번호 1157에 제시된 CDR-L3,

서열번호 1178에 제시된 CDR-H1, 서열번호 1179에 제시된 CDR-H2, 서열번호 1180에 제시된 CDR-H3, 서열번호 1181에 제시된 CDR-L1, 서열번호 1182에 제시된 CDR-L2 및 서열번호 1183에 제시된 CDR-L3,

서열번호 1191에 제시된 CDR-H1, 서열번호 1192에 제시된 CDR-H2, 서열번호 1193에 제시된 CDR-H3, 서열번호 1194에 제시된 CDR-L1, 서열번호 1195에 제시된 CDR-L2 및 서열번호 1196에 제시된 CDR-L3,

서열번호 1204에 제시된 CDR-H1, 서열번호 1205에 제시된 CDR-H2, 서열번호 1206에 제시된 CDR-H3, 서열번호 1207에 제시된 CDR-L1, 서열번호 1208에 제시된 CDR-L2 및 서열번호 1209에 제시된 CDR-L3,

서열번호 1217에 제시된 CDR-H1, 서열번호 1218에 제시된 CDR-H2, 서열번호 1219에 제시된 CDR-H3, 서열번호 1220에 제시된 CDR-L1, 서열번호 1221에 제시된 CDR-L2 및 서열번호 1222에 제시된 CDR-L3,

서열번호 1230에 제시된 CDR-H1, 서열번호 1231에 제시된 CDR-H2, 서열번호 1232에 제시된 CDR-H3, 서열번호 1233에 제시된 CDR-L1, 서열번호 1234에 제시된 CDR-L2 및 서열번호 1235에 제시된 CDR-L3,

서열번호 1308에 제시된 CDR-H1, 서열번호 1309에 제시된 CDR-H2, 서열번호 1310에 제시된 CDR-H3, 서열번호 1311에 제시된 CDR-L1, 서열번호 1312에 제시된 CDR-L2 및 서열번호 1313에 제시된 CDR-L3,

서열번호 1321에 제시된 CDR-H1, 서열번호 1322에 제시된 CDR-H2, 서열번호 1323에 제시된 CDR-H3, 서열번호 1324에 제시된 CDR-L1, 서열번호 1325에 제시된 CDR-L2 및 서열번호 1326에 제시된 CDR-L3,

서열번호 1373에 제시된 CDR-H1, 서열번호 1374에 제시된 CDR-H2, 서열번호 1375에 제시된 CDR-H3, 서열번호 1376에 제시된 CDR-L1, 서열번호 1377에 제시된 CDR-L2 및 서열번호 1378에 제시된 CDR-L3,

서열번호 1386에 제시된 CDR-H1, 서열번호 1387에 제시된 CDR-H2, 서열번호 1388에 제시된 CDR-H3, 서열번호 1389에 제시된 CDR-L1, 서열번호 1390에 제시된 CDR-L2 및 서열번호 1391에 제시된 CDR-L3,

서열번호 1399에 제시된 CDR-H1, 서열번호 1400에 제시된 CDR-H2, 서열번호 1401에 제시된 CDR-H3, 서열번호 1402에 제시된 CDR-L1, 서열번호 1403에 제시된 CDR-L2 및 서열번호 1404에 제시된 CDR-L3,

서열번호 1412에 제시된 CDR-H1, 서열번호 1413에 제시된 CDR-H2, 서열번호 1414에 제시된 CDR-H3, 서열번호 1415에 제시된 CDR-L1, 서열번호 1416에 제시된 CDR-L2 및 서열번호 1417에 제시된 CDR-L3,

서열번호 1777에 제시된 CDR-H1, 서열번호 1778에 제시된 CDR-H2, 서열번호 1779에 제시된 CDR-H3, 서열번호 1780에 제시된 CDR-L1, 서열번호 1781에 제시된 CDR-L2 및 서열번호 1782에 제시된 CDR-L3,

서열번호 1790에 제시된 CDR-H1, 서열번호 1791에 제시된 CDR-H2, 서열번호 1792에 제시된 CDR-H3, 서열번호 1793에 제시된 CDR-L1, 서열번호 1794에 제시된 CDR-L2 및 서열번호 1795에 제시된 CDR-L3,

서열번호 1803에 제시된 CDR-H1, 서열번호 1804에 제시된 CDR-H2, 서열번호 1805에 제시된 CDR-H3, 서열번호 1806에 제시된 CDR-L1, 서열번호 1807에 제시된 CDR-L2 및 서열번호 1808에 제시된 CDR-L3,

서열번호 1816에 제시된 CDR-H1, 서열번호 1817에 제시된 CDR-H2, 서열번호 1818에 제시된 CDR-H3, 서열번호 1819에 제시된 CDR-L1, 서열번호 1820에 제시된 CDR-L2 및 서열번호 1821에 제시된 CDR-L3,

서열번호 1829에 제시된 CDR-H1, 서열번호 1830에 제시된 CDR-H2, 서열번호 1831에 제시된 CDR-H3, 서열번호 1832에 제시된 CDR-L1, 서열번호 1833에 제시된 CDR-L2 및 서열번호 1834에 제시된 CDR-L3,

서열번호 1842에 제시된 CDR-H1, 서열번호 1843에 제시된 CDR-H2, 서열번호 1844에 제시된 CDR-H3, 서열번호 1845에 제시된 CDR-L1, 서열번호 1846에 제시된 CDR-L2 및 서열번호 1847에 제시된 CDR-L3,

서열번호 1855에 제시된 CDR-H1, 서열번호 1856에 제시된 CDR-H2, 서열번호 1857에 제시된 CDR-H3, 서열번호 1858에 제시된 CDR-L1, 서열번호 1859에 제시된 CDR-L2 및 서열번호 1860에 제시된 CDR-L3,

서열번호 1868에 제시된 CDR-H1, 서열번호 1869에 제시된 CDR-H2, 서열번호 1870에 제시된 CDR-H3, 서열번호 1871에 제시된 CDR-L1, 서열번호 1872에 제시된 CDR-L2 및 서열번호 1873에 제시된 CDR-L3,

서열번호 1881에 제시된 CDR-H1, 서열번호 1882에 제시된 CDR-H2, 서열번호 1883에 제시된 CDR-H3, 서열번호 1884에 제시된 CDR-L1, 서열번호 1885에 제시된 CDR-L2 및 서열번호 1886에 제시된 CDR-L3,

서열번호 2063에 제시된 CDR-H1, 서열번호 2064에 제시된 CDR-H2, 서열번호 2065에 제시된 CDR-H3, 서열번호 2066에 제시된 CDR-L1, 서열번호 2067에 제시된 CDR-L2 및 서열번호 2068에 제시된 CDR-L3,

서열번호 2076에 제시된 CDR-H1, 서열번호 2077에 제시된 CDR-H2, 서열번호 2078에 제시된 CDR-H3, 서열번호 2079에 제시된 CDR-L1, 서열번호 2080에 제시된 CDR-L2 및 서열번호 2081에 제시된 CDR-L3,

서열번호 2089에 제시된 CDR-H1, 서열번호 2090에 제시된 CDR-H2, 서열번호 2091에 제시된 CDR-H3, 서열번호 2092에 제시된 CDR-L1, 서열번호 2093에 제시된 CDR-L2 및 서열번호 2094에 제시된 CDR-L3,

서열번호 2102에 제시된 CDR-H1, 서열번호 2103에 제시된 CDR-H2, 서열번호 2104에 제시된 CDR-H3, 서열번호 2105에 제시된 CDR-L1, 서열번호 2106에 제시된 CDR-L2 및 서열번호 2107에 제시된 CDR-L3,

서열번호 2115에 제시된 CDR-H1, 서열번호 2116에 제시된 CDR-H2, 서열번호 2117에 제시된 CDR-H3, 서열번호 2118에 제시된 CDR-L1, 서열번호 2119에 제시된 CDR-L2 및 서열번호 2120에 제시된 CDR-L3,

서열번호 2128에 제시된 CDR-H1, 서열번호 2129에 제시된 CDR-H2, 서열번호 2130에 제시된 CDR-H3, 서열번호 2131에 제시된 CDR-L1, 서열번호 2132에 제시된 CDR-L2 및 서열번호 2133에 제시된 CDR-L3,

서열번호 2141에 제시된 CDR-H1, 서열번호 2142에 제시된 CDR-H2, 서열번호 2143에 제시된 CDR-H3, 서열번호 2144에 제시된 CDR-L1, 서열번호 2145에 제시된 CDR-L2 및 서열번호 2146에 제시된 CDR-L3,

서열번호 2154에 제시된 CDR-H1, 서열번호 2155에 제시된 CDR-H2, 서열번호 2156에 제시된 CDR-H3, 서열번호 2157에 제시된 CDR-L1, 서열번호 2158에 제시된 CDR-L2 및 서열번호 2159에 제시된 CDR-L3,

서열번호 2180에 제시된 CDR-H1, 서열번호 2181에 제시된 CDR-H2, 서열번호 2182에 제시된 CDR-H3, 서열번호 2183에 제시된 CDR-L1, 서열번호 2184에 제시된 CDR-L2 및 서열번호 2185에 제시된 CDR-L3,

서열번호 2193에 제시된 CDR-H1, 서열번호 2194에 제시된 CDR-H2, 서열번호 2195에 제시된 CDR-H3, 서열번호 2196에 제시된 CDR-L1, 서열번호 2197에 제시된 CDR-L2 및 서열번호 2198에 제시된 CDR-L3 및

서열번호 2206에 제시된 CDR-H1, 서열번호 2207에 제시된 CDR-H2, 서열번호 2208에 제시된 CDR-H3, 서열번호 2209에 제시된 CDR-L1, 서열번호 2210에 제시된 CDR-L2 및 서열번호 2211에 제시된 CDR-L3 (이들 모두는 빈 4로 분류된 CDH19에 대한 결합 도메인을 특성화한다); 및

(e) 서열번호 76에 제시된 CDR-H1, 서열번호 77에 제시된 CDR-H2, 서열번호 78에 제시된 CDR-H3, 서열번호 244에 제시된 CDR-L1, 서열번호 245에 제시된 CDR-L2 및 서열번호 246에 제시된 CDR-L3,

서열번호 88에 제시된 CDR-H1, 서열번호 89에 제시된 CDR-H2, 서열번호 90에 제시된 CDR-H3, 서열번호 256에 제시된 CDR-L1, 서열번호 257에 제시된 CDR-L2 및 서열번호 258에 제시된 CDR-L3,

서열번호 106에 제시된 CDR-H1, 서열번호 107에 제시된 CDR-H2, 서열번호 108에 제시된 CDR-H3, 서열번호 274에 제시된 CDR-L1, 서열번호 275에 제시된 CDR-L2 및 서열번호 276에 제시된 CDR-L3,

서열번호 112에 제시된 CDR-H1, 서열번호 113에 제시된 CDR-H2, 서열번호 114에 제시된 CDR-H3, 서열번호 280에 제시된 CDR-L1, 서열번호 281에 제시된 CDR-L2 및 서열번호 282에 제시된 CDR-L3,

서열번호 106에 제시된 CDR-H1, 서열번호 107에 제시된 CDR-H2, 서열번호 108에 제시된 CDR-H3, 서열번호 274에 제시된 CDR-L1, 서열번호 275에 제시된 CDR-L2 및 서열번호 276에 제시된 CDR-L3,

서열번호 983에 제시된 CDR-H1, 서열번호 984에 제시된 CDR-H2, 서열번호 985에 제시된 CDR-H3, 서열번호 986에 제시된 CDR-L1, 서열번호 987에 제시된 CDR-L2 및 서열번호 988에 제시된 CDR-L3,

서열번호 1582에 제시된 CDR-H1, 서열번호 1583에 제시된 CDR-H2, 서열번호 1584에 제시된 CDR-H3, 서열번호 1585에 제시된 CDR-L1, 서열번호 1586에 제시된 CDR-L2 및 서열번호 1587에 제시된 CDR-L3, 및

서열번호 1595에 제시된 CDR-H1, 서열번호 1596에 제시된 CDR-H2, 서열번호 1597에 제시된 CDR-H3, 서열번호 1598에 제시된 CDR-L1, 서열번호 1599에 제시된 CDR-L2 및 서열번호 1600에 제시된 CDR-L3 (이들 모두는 빈 1으로 분류된 CDH19에 대한 결합 도메인을 특성화한다)

으로 이루어진 그룹으로부터 선택된, CDR-H1, CDR-H2 및 CDR-H3을 포함하는 VH 영역 및 CDR-L1, CDR-L2 및 CDR-L3을 포함하는 VL 영역을 포함한다.

본 발명의 항체 작제물의 추가의 실시형태에서, 제1 결합 도메인은

(a) 빈 1로 분류된, 서열번호 362, 서열번호 364, 서열번호 485, 서열번호 486, 서열번호 487, 서열번호 492, 서열번호 493, 서열번호 494, 서열번호 495, 서열번호 1133, 서열번호 1172, 서열번호 1341, 서열번호 1354, 서열번호 1367, 서열번호 1432, 서열번호 1445 및 서열번호 2174에 제시된 VH 영역;

(b) 빈 2로 분류된, 서열번호 342, 서열번호 366, 서열번호 370, 서열번호 344, 서열번호 372, 서열번호 368, 서열번호 496, 서열번호 497, 서열번호 498, 서열번호 499, 서열번호 500, 서열번호 508, 서열번호 509, 서열번호 510, 서열번호 511, 서열번호 512, 서열번호 519, 서열번호 520, 서열번호 521, 서열번호 522, 서열번호 523, 서열번호 524, 서열번호 525, 서열번호 526, 서열번호 527, 서열번호 528, 서열번호 529, 서열번호 530, 서열번호 531, 서열번호 532, 서열번호 533, 서열번호 534, 서열번호 535, 서열번호 536, 서열번호 537, 서열번호 538, 서열번호 1016, 서열번호 1029, 서열번호 1042, 서열번호 1081, 서열번호 1107, 서열번호 1120, 서열번호 1250, 서열번호 1263, 서열번호 1276, 서열번호 1289, 서열번호 1302, 서열번호 1654, 서열번호 1667, 서열번호 1901, 서열번호 1914, 서열번호 1940, 서열번호 1953, 서열번호 1966, 서열번호 1979, 서열번호 1992, 서열번호 2005, 서열번호 2018, 서열번호 2031, 서열번호 2044 및 서열번호 2057에 제시된 VH 영역;

(c) 빈 3으로 분류된, 서열번호 338, 서열번호 354, 서열번호 378, 서열번호 356, 서열번호 476, 서열번호 477, 서열번호 478, 서열번호 479, 서열번호 480, 서열번호 481, 서열번호 482, 서열번호 483, 서열번호 484, 서열번호 501, 서열번호 502, 서열번호 503, 서열번호 504, 서열번호 505, 서열번호 506, 서열번호 517, 서열번호 518, 서열번호 1003, 서열번호 1055, 서열번호 1094, 서열번호 1615, 서열번호 1628, 서열번호 1641, 서열번호 1680, 서열번호 1693, 서열번호 1706, 서열번호 1719, 서열번호 1732, 서열번호 1745, 서열번호 1758, 서열번호 1771 및 서열번호 1927에 제시된 VH 영역;

(d) 빈 4로 분류된, 서열번호 352, 서열번호 360, 서열번호 388, 서열번호 386, 서열번호 340, 서열번호 346, 서열번호 374, 서열번호 348, 서열번호 390, 서열번호 463, 서열번호 464, 서열번호 465, 서열번호 466, 서열번호 467, 서열번호 468, 서열번호 469, 서열번호 470, 서열번호 471, 서열번호 472, 서열번호 473, 서열번호 474, 서열번호 475, 서열번호 488, 서열번호 489, 서열번호 490, 서열번호 491, 서열번호 513, 서열번호 514, 서열번호 515, 서열번호 516, 서열번호 540, 서열번호 541, 서열번호 542, 서열번호 543, 서열번호 977, 서열번호 1068, 서열번호 1146, 서열번호 1159, 서열번호 1185, 서열번호 1198, 서열번호 1211, 서열번호 1224, 서열번호 1237, 서열번호 1315, 서열번호 1328, 서열번호 1380, 서열번호 1393, 서열번호 1406, 서열번호 1419, 서열번호 1469, 서열번호 1478, 서열번호 1485, 서열번호 1494, 서열번호 1501, 서열번호 1508, 서열번호 1519, 서열번호 1526, 서열번호 1533, 서열번호 1542, 서열번호 1549, 서열번호 1558, 서열번호 1565, 서열번호 1784, 서열번호 1797, 서열번호 1810, 서열번호 1823, 서열번호 1836, 서열번호 1849, 서열번호 1862, 서열번호 1875, 서열번호 1888, 서열번호 2070, 서열번호 2083, 서열번호 2096, 서열번호 2109, 서열번호 2122, 서열번호 2135, 서열번호 2148, 서열번호 2161, 서열번호 2187, 서열번호 2200 및 서열번호 2213에 제시된 VH 영역; 및

(e) 빈 5로 분류된, 서열번호 376, 서열번호 392, 서열번호 358, 서열번호 350, 서열번호 507, 서열번호 990, 서열번호 1589 및 서열번호 1602에 제시된 VH 영역으로 이루어진 그룹으로부터 선택된 VH 영역을 포함한다.

본 발명의 항체 작제물의 또 다른 실시형태에서, 제1 결합 도메인은

(a) 빈 1로 분류된, 서열번호 418, 서열번호 420, 서열번호 580, 서열번호 581, 서열번호 582, 서열번호 587, 서열번호 588, 서열번호 589, 서열번호 590, 서열번호 1135, 서열번호 1174, 서열번호 1343, 서열번호 1356, 서열번호 1369, 서열번호 1434, 서열번호 1447 및 서열번호 2176에 제시된 VL 영역;

(b) 빈 2로 분류된, 서열번호 398, 서열번호 422, 서열번호 426, 서열번호 400, 서열번호 428, 서열번호 424, 서열번호 591, 서열번호 592, 서열번호 593, 서열번호 594, 서열번호 595, 서열번호 603, 서열번호 604, 서열번호 605, 서열번호 606, 서열번호 607, 서열번호 614, 서열번호 615, 서열번호 616, 서열번호 617, 서열번호 618, 서열번호 619, 서열번호 620, 서열번호 621, 서열번호 622, 서열번호 623, 서열번호 624, 서열번호 625, 서열번호 626, 서열번호 627, 서열번호 628, 서열번호 629, 서열번호 630, 서열번호 631, 서열번호 632, 서열번호 633, 서열번호 1018, 서열번호 1031, 서열번호 1044, 서열번호 1083, 서열번호 1109, 서열번호 1122, 서열번호 1252, 서열번호 1265, 서열번호 1278, 서열번호 1291, 서열번호 1304, 서열번호 1656, 서열번호 1669, 서열번호 1903, 서열번호 1916, 서열번호 1942, 서열번호 1955, 서열번호 1968, 서열번호 1981, 서열번호 1994, 서열번호 2007, 서열번호 2020, 서열번호 2033, 서열번호 2046 및 서열번호 2059에 제시된 VL 영역;

(c) 빈 3으로 분류된, 서열번호 394, 서열번호 410, 서열번호 434, 서열번호 412, 서열번호 571, 서열번호 572, 서열번호 573, 서열번호 574, 서열번호 575, 서열번호 576, 서열번호 577, 서열번호 578, 서열번호 579, 서열번호 596, 서열번호 597, 서열번호 598, 서열번호 599, 서열번호 600, 서열번호 601, 서열번호 612, 서열번호 613, 서열번호 1005, 서열번호 1057, 서열번호 1096, 서열번호 1617, 서열번호 1630, 서열번호 1643, 서열번호 1682, 서열번호 1695, 서열번호 1708, 서열번호 1721, 서열번호 1734, 서열번호 1747, 서열번호 1760, 서열번호 1773 및 서열번호 1929에 제시된 VL 영역;

(d) 빈 4로 분류된, 서열번호 408, 서열번호 416, 서열번호 444, 서열번호 442, 서열번호 396, 서열번호 402, 서열번호 430, 서열번호 404, 서열번호 446, 서열번호 558, 서열번호 559, 서열번호 560, 서열번호 561, 서열번호 562, 서열번호 563, 서열번호 564, 서열번호 565, 서열번호 566, 서열번호 567, 서열번호 568, 서열번호 569, 서열번호 570, 서열번호 583, 서열번호 584, 서열번호 585, 서열번호 586, 서열번호 608, 서열번호 609, 서열번호 610, 서열번호 611, 서열번호 635, 서열번호 636, 서열번호 637, 서열번호 638, 서열번호 979, 서열번호 1070, 서열번호 1148, 서열번호 1161, 서열번호 1187, 서열번호 1200, 서열번호 1213, 서열번호 1226, 서열번호 1239, 서열번호 1317, 서열번호 1330, 서열번호 1382, 서열번호 1395, 서열번호 1408, 서열번호 1421, 서열번호 1471, 서열번호 1480, 서열번호 1487, 서열번호 1496, 서열번호 1503, 서열번호 1510, 서열번호 1521, 서열번호 1528, 서열번호 1535, 서열번호 1544, 서열번호 1551, 서열번호 1560, 서열번호 1567, 서열번호 1786, 서열번호 1799, 서열번호 1812, 서열번호 1825, 서열번호 1838, 서열번호 1851, 서열번호 1864, 서열번호 1877, 서열번호 1890, 서열번호 2072, 서열번호 2085, 서열번호 2098, 서열번호 2111, 서열번호 2124, 서열번호 2137, 서열번호 2150, 서열번호 2163, 서열번호 2189, 서열번호 2202 및 서열번호 2215에 제시된 VL 영역; 및

(e) 빈 5로 분류된, 서열번호 432, 서열번호 448, 서열번호 414, 서열번호 406, 서열번호 602, 서열번호 992, 서열번호 1591 및 서열번호 1604에 제시된 VL 영역으로 이루어진 그룹으로부터 선택된 VL 영역을 포함한다.

본 발명은 본 발명의 항체 작제물의 실시형태를 제공하고, 여기서 제1 결합 도메인은

(1) 서열번호 362+418, 서열번호 364+420, 서열번호 485+580, 서열번호 486+581, 서열번호 487+582, 서열번호 492+587, 서열번호 493+588, 서열번호 494+589, 서열번호 495+590, 서열번호 1133+1135, 서열번호 1172+1174, 서열번호 1341+1343, 서열번호 1354+1356, 서열번호 1367+1369, 서열번호 1432+1434, 서열번호 1445+1447 및 서열번호 2174+2176에 제시된 VH 영역과 VL 영역의 쌍 (모든 쌍은 빈 1로 분류된다);

(2) 서열번호 342+398, 서열번호 366+422, 서열번호 370+426, 서열번호 344+400, 서열번호 372+428, 서열번호 368+424, 서열번호 496+591, 서열번호 497+592, 서열번호 498+593, 서열번호 499+594, 서열번호 500+595, 서열번호 508+603, 서열번호 509+604, 서열번호 510+605, 서열번호 511+606, 서열번호 512+607, 서열번호 519+614, 서열번호 520+615, 서열번호 521+616, 서열번호 522+617, 서열번호 523+618, 서열번호 524+619, 서열번호 525+620, 서열번호 526+621, 서열번호 527+622, 서열번호 528+623, 서열번호 529+624, 서열번호 530+625, 서열번호 531+626, 서열번호 532+627, 서열번호 533+628, 서열번호 534+629, 서열번호 535+630, 서열번호 536+631, 서열번호 537+632, 서열번호 538+633, 서열번호 1016+1018, 서열번호 1029+1031, 서열번호 1042+1044, 서열번호 1081+1083, 서열번호 1107+1109, 서열번호 1120+1122, 서열번호 1250+1252, 서열번호 1263+1265, 서열번호 1276+1278, 서열번호 1289+1291, 서열번호 1302+1304, 서열번호 1654+1656, 서열번호 1667+1669, 서열번호 1901+1903, 서열번호 1914+1916, 서열번호 1940+1942, 서열번호 1953+1955, 서열번호 1966+1968, 서열번호 1979+1981, 서열번호 1992+1994, 서열번호 2005+2007, 서열번호 2018+2020, 서열번호 2031+2033, 서열번호 2044+2046 및 서열번호 2057+2059에 제시된 VH 영역과 VL 영역의 쌍 (모든 쌍은 빈 2로 분류된다);

(3) 서열번호 338+394, 서열번호 354+410, 서열번호 378+434, 서열번호 356+412, 서열번호 476+571, 서열번호 477+572, 서열번호 478+573, 서열번호 479+574, 서열번호 480+575, 서열번호 481+576, 서열번호 482+577, 서열번호 483+578, 서열번호 484+579, 서열번호 501+596, 서열번호 502+597, 서열번호 503+598, 서열번호 504+599, 서열번호 505+600, 서열번호 506+601, 서열번호 517+612, 서열번호 518+613, 서열번호 1003+1005, 서열번호 1055+1057, 서열번호 1094+1096, 서열번호 1615+1617, 서열번호 1628+1630, 서열번호 1641+1643, 서열번호 1680+1682, 서열번호 1693+1695, 서열번호 1706+1708, 서열번호 1719+1721, 서열번호 1732+1734, 서열번호 1745+1747, 서열번호 1758+1760, 서열번호 1771+1773 및 서열번호 1927+1929에 제시된 VH 영역과 VL 영역의 쌍 (모든 쌍은 빈 3으로 분류된다);

(4) 서열번호 352+408, 서열번호 360+416, 서열번호 388+444, 서열번호 386+442, 서열번호 340+396, 서열번호 346+402, 서열번호 374+430, 서열번호 348+404, 서열번호 390+446, 서열번호 463+558, 서열번호 464+559, 서열번호 465+560, 서열번호 466+561, 서열번호 467+562, 서열번호 468+563, 서열번호 469+564, 서열번호 470+565, 서열번호 471+566, 서열번호 472+567, 서열번호 473+568, 서열번호 474+569, 서열번호 475+570, 서열번호 488+583, 서열번호 489+584, 서열번호 490+585, 서열번호 491+586, 서열번호 513+608, 서열번호 514+609, 서열번호 515+610, 서열번호 516+611, 서열번호 540+635, 서열번호 541+636, 서열번호 542+637, 서열번호 543+638, 서열번호 977+979, 서열번호 1068+1070, 서열번호 1146+1148, 서열번호 1159+1161, 서열번호 1185+1187, 서열번호 1198+1200, 서열번호 1211+1213, 서열번호 1224+1226, 서열번호 1237+1239, 서열번호 1315+1317, 서열번호 1328+1330, 서열번호 1380+1382 서열번호 1393+1395, 서열번호 1406+1408, 서열번호 1419+1421, 서열번호 1469+1471, 서열번호 1478+1480, 서열번호 1485+1487, 서열번호 1494+1496, 서열번호 1501+1503, 서열번호 1508+1510, 서열번호 1519+1521, 서열번호 1526+1528, 서열번호 1533+1535, 서열번호 1542+1544, 서열번호 1549+1551, 서열번호 1558+1560, 서열번호 1565+1567, 서열번호 1784+1786, 서열번호 1797+1799, 서열번호 1810+1812, 서열번호 1823+1825, 서열번호 1836+1838, 서열번호 1849+1851, 서열번호 1862+1864, 서열번호 1875+1877, 서열번호 1888+1890, 서열번호 2070+2072, 서열번호 2083+2085, 서열번호 2096+2098, 서열번호 2109+2111, 서열번호 2122+2124, 서열번호 2135+2137, 서열번호 2148+2150, 서열번호 2161+2163, 서열번호 2187+2189, 서열번호 2200+2202 및 서열번호 2213+2215에 제시된 VH 영역과 VL 영역의 쌍 (모든 쌍은 빈 4로 분류된다); 및

(5) 서열번호 376+432, 서열번호 392+448, 서열번호 358+414, 서열번호 350+406, 서열번호 507+602, 서열번호 990+992, 서열번호 1589+1591 및 서열번호 1602+1604에 제시된 VH 영역과 VL 영역의 쌍(모든 쌍은 빈 5로 분류된다)으로 이루어진 그룹으로부터 선택된 VH 영역 및 VL 영역을 포함한다.

본 발명의 추가의 실시형태에서, 항체 작제물은 (scFv)2, (단일 도메인 mAb)2, scFv-단일 도메인 mAb, 디아바디 및 이의 올리고머로 이루어진 그룹으로부터 선택된 포맷으로 존재한다.

바람직한 실시형태에서, 제1 결합 도메인은

(a) 서열번호 117, 서열번호 1137, 서열번호 1176, 서열번호 1345, 서열번호 1358, 서열번호 1371, 서열번호 1436, 서열번호 1449 및 서열번호 2178에 제시된 아미노산 서열 (모든 결합제는 빈 1로 분류된다);

(b) 서열번호 1020, 서열번호 1033, 서열번호 1046, 서열번호 1085, 서열번호 1111, 서열번호 1124, 서열번호 1254, 서열번호 1267, 서열번호 1280, 서열번호 1293, 서열번호 1306, 서열번호 1658, 서열번호 1671, 서열번호 1905, 서열번호 1918, 서열번호 1944, 서열번호 1957, 서열번호 1970, 서열번호 1983, 서열번호 1996, 서열번호 2009, 서열번호 2022, 서열번호 2035, 서열번호 2048 및 서열번호 2061에 제시된 아미노산 서열 (모든 결합제는 빈 2로 분류된다);

(c) 서열번호 1007, 서열번호 1059, 서열번호 1098, 서열번호 1619, 서열번호 1632, 서열번호 1645, 서열번호 1684, 서열번호 1697, 서열번호 1710, 서열번호 1723, 서열번호 1736, 서열번호 1749, 서열번호 1762, 서열번호 1775 및 서열번호 1931에 제시된 아미노산 서열 (모든 결합제는 빈 3으로 분류된다);

(d) 서열번호 981, 서열번호 1072, 서열번호 1150, 서열번호 1163, 서열번호 1189, 서열번호 1202, 서열번호 1215, 서열번호 1228, 서열번호 1241, 서열번호 1319, 서열번호 1332, 서열번호 1384, 서열번호 1397, 서열번호 1410, 서열번호 1423, 서열번호 1473, 서열번호 1482, 서열번호 1489, 서열번호 1498, 서열번호 1505, 서열번호 1512, 서열번호 1523, 서열번호 1530, 서열번호 1537, 서열번호 1546, 서열번호 1553, 서열번호 1562, 서열번호 1569, 서열번호 1788, 서열번호 1801, 서열번호 1814, 서열번호 1827, 서열번호 1840, 서열번호 1853, 서열번호 1866, 서열번호 1879, 서열번호 1892, 서열번호 2074, 서열번호 2087, 서열번호 2100, 서열번호 2113, 서열번호 2126, 서열번호 2139, 서열번호 2152, 서열번호 2165, 서열번호 2191, 서열번호 2204 및 서열번호 2217에 제시된 아미노산 서열 (모든 결합제는 빈 4로 분류된다); 및

(e) 서열번호 994, 서열번호 1593 및 서열번호 1606에 제시된 아미노산 서열(모든 결합제는 빈 5로 분류된다)로 이루어진 그룹으로부터 선택된 아미노산 서열을 포함한다.

본 발명의 한 가지 양상에서, 제2 결합 도메인은 인간 CD3 및 마카크 CD3, 바람직하게는 인간 CD3 엡실론 및 마카크 CD3 엡실론에 결합할 수 있다. 추가로 또는 대안적으로, 제2 결합 도메인은 비단마모셋(Callithrix jacchus), 솜털머리타마린(Saguinus Oedipus) 및/또는 다람쥐원숭이(Saimiri sciureus) CD3 엡실론에 결합할 수 있다. 이들 실시형태에 따라, 본 발명의 항체 작제물의 결합 도메인 중의 하나 또는 둘 다는 바람직하게는 영장류의 포유동물 목의 구성원에 대해 교차-종 특이적이다. 교차-종 특이적 CD3 결합 도메인은, 예를 들면, WO 2008/119567에 기재되어 있다.

본 발명의 항체 작제물은 T 세포 CD3 수용체 복합체가

(a) WO 2008/119567의 서열번호 27에 제시된 CDR-L1, WO 2008/119567의 서열번호 28에 제시된 CDR-L2 및 WO 2008/119567의 서열번호 29에 제시된 CDR-L3;

(b) WO 2008/119567의 서열번호 117에 제시된 CDR-L1, WO 2008/119567의 서열번호 118에 제시된 CDR-L2 및 WO 2008/119567의 서열번호 119에 제시된 CDR-L3; 및

(c) WO 2008/119567의 서열번호 153에 제시된 CDR-L1, WO 2008/119567의 서열번호 154에 제시된 CDR-L2 및 WO 2008/119567의 서열번호 155에 제시된 CDR-L3로부터 선택된 CDR-L1, CDR-L2 및 CDR-L3을 포함하는 VL 영역을 포함한다.

본 발명의 항체 작제물의 또 다른 바람직한 실시형태에서, T 세포 CD3 수용체 복합체에 결합할 수 있는 제2 결합 도메인은

(a) WO 2008/119567의 서열번호 12에 제시된 CDR-H1, WO 2008/119567의 서열번호 13에 제시된 CDR-H2 및 WO 2008/119567의 서열번호 14에 제시된 CDR-H3;

(b) WO 2008/119567의 서열번호 30에 제시된 CDR-H1, WO 2008/119567의 서열번호 31에 제시된 CDR-H2 및 WO 2008/119567의 서열번호 32에 제시된 CDR-H3;

(c) WO 2008/119567의 서열번호 48에 제시된 CDR-H1, WO 2008/119567의 서열번호 49에 제시된 CDR-H2 및 WO 2008/119567의 서열번호 50에 제시된 CDR-H3;

(d) WO 2008/119567의 서열번호 66에 제시된 CDR-H1, WO 2008/119567의 서열번호 67에 제시된 CDR-H2 및 WO 2008/119567의 서열번호 68에 제시된 CDR-H3;

(e) WO 2008/119567의 서열번호 84에 제시된 CDR-H1, WO 2008/119567의 서열번호 85에 제시된 CDR-H2 및 WO 2008/119567의 서열번호 86에 제시된 CDR-H3;

(f) WO 2008/119567의 서열번호 102에 제시된 CDR-H1, WO 2008/119567의 서열번호 103에 제시된 CDR-H2 및 WO 2008/119567의 서열번호 104에 제시된 CDR-H3;

(g) WO 2008/119567의 서열번호 120에 제시된 CDR-H1, WO 2008/119567의 서열번호 121에 제시된 CDR-H2 및 WO 2008/119567의 서열번호 122에 제시된 CDR-H3;

(h) WO 2008/119567의 서열번호 138에 제시된 CDR-H1, WO 2008/119567의 서열번호 139에 제시된 CDR-H2 및 WO 2008/119567의 서열번호 140에 제시된 CDR-H3;

(i) WO 2008/119567의 서열번호 156에 제시된 CDR-H1, WO 2008/119567의 서열번호 157에 제시된 CDR-H2 및 WO 2008/119567의 서열번호 158에 제시된 CDR-H3; 및

(j) WO 2008/119567의 서열번호 174에 제시된 CDR-H1, WO 2008/119567의 서열번호 175에 제시된 CDR-H2 및 WO 2008/119567의 서열번호 176에 제시된 CDR-H3로부터 선택된 CDR-H1, CDR-H2 및 CDR-H3을 포함하는 VH 영역을 포함한다.

본 발명의 항체 작제물은 T 세포 CD3 수용체 복합체에 결합할 수 있는 제2 결합 도메인이 WO 2008/119567의 서열번호 서열번호 35, 39, 125, 129, 161 또는 165에 제시된 VL 영역으로 이루어진 그룹으로부터 선택된 VL 영역을 포함하는 것이 추가로 바람직하다.

T 세포 CD3 수용체 복합체에 결합할 수 있는 제2 결합 도메인은 WO 2008/119567의 서열번호 15, 19, 33, 37, 51, 55, 69, 73, 87, 91, 105, 109, 123, 127, 141, 145, 159, 163, 177 또는 181에 제시된 VH 영역으로 이루어진 그룹으로부터 선택된 VH 영역을 포함하는 것이 또한 바람직하다.

보다 바람직하게는, 본 발명의 항체 작제물은

(a) WO 2008/119567의 서열번호 17 또는 21에 제시된 VL 영역 및 WO 2008/119567의 서열번호 15 또는 19에 제시된 VH 영역;

(b) WO 2008/119567의 서열번호 35 또는 39에 제시된 VL 영역 및 WO 2008/119567의 서열번호 33 또는 37에 제시된 VH 영역;

(c) WO 2008/119567의 서열번호 53 또는 57에 제시된 VL 영역 및 WO 2008/119567의 서열번호 51 또는 55에 제시된 VH 영역;

(d) WO 2008/119567의 서열번호 71 또는 75에 제시된 VL 영역 및 WO 2008/119567의 서열번호 69 또는 73에 제시된 VH 영역;

(e) WO 2008/119567의 서열번호 89 또는 93에 제시된 VL 영역 및 WO 2008/119567의 서열번호 87 또는 91에 제시된 VH 영역;

(f) WO 2008/119567의 서열번호 107 또는 111에 제시된 VL 영역 및 WO 2008/119567의 서열번호 105 또는 109에 제시된 VH 영역;

(g) WO 2008/119567의 서열번호 125 또는 129에 제시된 VL 영역 및 WO 2008/119567의 서열번호 123 또는 127에 제시된 VH 영역;

(h) WO 2008/119567의 서열번호 143 또는 147에 제시된 VL 영역 및 WO 2008/119567의 서열번호 141 또는 145에 제시된 VH 영역;

(i) WO 2008/119567의 서열번호 161 또는 165에 제시된 VL 영역 및 WO 2008/119567의 서열번호 159 또는 163에 제시된 VH 영역; 및

(j) WO 2008/119567의 서열번호 179 또는 183에 제시된 VL 영역 및 WO 2008/119567의 서열번호 177 또는 181에 제시된 VH 영역으로 이루어진 그룹으로부터 선택된 VL 영역 및 VH 영역을 포함하는, T 세포 CD3 수용체 복합체에 결합할 수 있는 제2 결합 도메인을 특징으로 한다.

본 발명의 항체 작제물, 특히 T 세포 CD3 수용체 복합체에 결합할 수 있는 제2 결합 도메인의 바람직한 실시형태에 따라, VH-영역 및 VL-영역의 쌍은 일본쇄 항체(scFv)의 포맷으로 존재한다. VH 및 VL 영역은 순서 VH-VL 또는 VL-VH로 정렬된다. VH-영역은 링커 서열에 대해 N-말단에 위치하는 것이 바람직하다. VL-영역은 링커 서열의 C-말단에 위치한다.

본 발명의 상기 기재된 항체 작제물의 바람직한 실시형태는 WO 2008/119567의 서열번호 23, 25, 41, 43, 59, 61, 77, 79, 95, 97, 113, 115, 131, 133, 149, 151, 167, 169, 185 또는 187로 이루어진 그룹으로부터 선택된 아미노산 서열을 포함하는, T 세포 CD3 수용체 복합체에 결합할 수 있는 제2 결합 도메인을 특징으로 한다.

바람직한 실시형태에서, 본 발명의 항체 작제물은

(a) 서열번호 1138, 서열번호 1177, 서열번호 1346, 서열번호 1359, 서열번호 1372, 서열번호 1437, 서열번호 1450 및 서열번호 2179에 제시된 아미노산 서열;

(b) 서열번호 1021, 서열번호 1034, 서열번호 1047, 서열번호 1086, 서열번호 1112, 서열번호 1125, 서열번호 1255, 서열번호 1268, 서열번호 1281, 서열번호 1294, 서열번호 1307, 서열번호 1659, 서열번호 1672, 서열번호 1906, 서열번호 1919, 서열번호 1945, 서열번호 1958, 서열번호 1971, 서열번호 1984, 서열번호 1997, 서열번호 2010, 서열번호 2023, 서열번호 2036, 서열번호 2049 및 서열번호 2062에 제시된 아미노산 서열;

(c) 서열번호 1008, 서열번호 1060, 서열번호 1099, 서열번호 1620, 서열번호 1633, 서열번호 1646, 서열번호 1685, 서열번호 1698, 서열번호 1711, 서열번호 1724, 서열번호 1737, 서열번호 1750, 서열번호 1763, 서열번호 1776 및 서열번호 1932에 제시된 아미노산 서열;

(d) 서열번호 982, 서열번호 1073, 서열번호 1151, 서열번호 1164, 서열번호 1190, 서열번호 1203, 서열번호 1216, 서열번호 1229, 서열번호 1242, 서열번호 1320, 서열번호 1333, 서열번호 1385, 서열번호 1398, 서열번호 1411, 서열번호 1424, 서열번호 1474, 서열번호 1475, 서열번호 1476, 서열번호 1483, 서열번호 1490, 서열번호 1491, 서열번호 1492, 서열번호 1499, 서열번호 1506, 서열번호 1513, 서열번호 1514, 서열번호 1515, 서열번호 1516, 서열번호 1517, 서열번호 1524, 서열번호 1531, 서열번호 1538, 서열번호 1539, 서열번호 1540, 서열번호 1547, 서열번호 1554, 서열번호 1555, 서열번호 1556, 서열번호 1563, 서열번호 1570, 서열번호 1571, 서열번호 1572, 서열번호 1573, 서열번호 1574, 서열번호 1575, 서열번호 1576, 서열번호 1577, 서열번호 1578, 서열번호 1579, 서열번호 1580, 서열번호 1581, 서열번호 1789, 서열번호 1802, 서열번호 1815, 서열번호 1828, 서열번호 1841, 서열번호 1854, 서열번호 1867, 서열번호 1880, 서열번호 1893, 서열번호 2075, 서열번호 2088, 서열번호 2101, 서열번호 2114, 서열번호 2127, 서열번호 2140, 서열번호 2153, 서열번호 2166, 서열번호 2192, 서열번호 2205 및 서열번호 2218 내지 2228에 제시된 아미노산 서열; 및

(e) 서열번호 995, 서열번호 1594 및 서열번호 1607에 제시된 아미노산 서열로 이루어진 그룹으로부터 선택된 아미노산 서열을 갖는다.

본 발명은 본 발명의 항체 작제물을 코딩하는 핵산 서열을 추가로 제공한다.

추가로, 본 발명은 본 발명의 핵산 서열을 포함하는 벡터를 제공한다. 더욱이, 본 발명은 본 발명의 핵산 서열로 형질전환 또는 형질감염된 숙주 세포를 제공한다.

추가의 실시형태에서, 본 발명은, 본 발명의 숙주 세포를 본 발명의 항체 작제물의 발현을 가능하게 하는 조건하에 배양하는 단계 및 생성된 항체 작제물을 상기 배양물로부터 회수하는 단계를 포함하는, 본 발명의 항체 작제물의 생성 방법을 제공한다.

더욱이, 본 발명은 본 발명의 항체 작제물 또는 본 발명의 방법에 따라 생성된 항체 작제물을 포함하는 약제학적 조성물을 제공한다.

본원에 기재된 제형은 이를 필요로 하는 환자에서 본원에 기재된 병리학적 의학적 병태의 치료, 개선 및/또는 예방에서 약제학적 조성물로서 유용하다. 용어 "치료"는 치료적 처치 및 예방적 또는 방지적 수단 둘 다를 지칭한다. 치료는, 질환, 질환의 증상 또는 질환에 대한 소인을 치료, 치유, 개선, 완화, 변경, 개량, 경감, 개선 또는 영향을 미칠 목적으로 질환/장애, 질환/장애의 증상, 또는 질환/장애에 대한 소인을 갖는 환자의 신체, 분리된 조직 또는 세포에 제형의 적용 또는 투여를 포함한다.

이들 "치료를 필요로 하는"은 장애가 예방되어야 하는 것들 뿐만 아니라 장애를 이미 갖는 것들을 포함한다. 용어 "질환"은 본원에 기재된 단백질 제형을 사용한 치료로부터 혜택을 받을 수 있는 임의의 병태이다. 이는 문제의 질환에 포유동물이 걸리기 쉬운 병적 상태를 포함하는 만성 및 급성 장애 또는 질환을 포함한다. 본원에서 치료되는 질환/장애의 비제한적 예는 증식성 질환, 종양 질환 또는 면역학적 장애를 포함한다.

일부 실시형태에서, 본 발명은 본 발명의 하나 또는 복수의 항체 작제물을 약제학적으로 효과적인 희석제, 담체, 용해제, 유화제, 방부제 및/또는 보조제와 함께 치료학적 유효량으로 포함하는 약제학적 조성물을 제공한다. 본 발명의 약제학적 조성물은, 이로써 한정되지 않지만, 액체, 동결 및 동결건조된 조성물을 포함한다.

바람직하게는, 제형 물질은 사용된 용량 및 농도에서 수용자에게 무독성이다. 특정 실시형태에서, 약제학적 조성물은 본 발명의 항체 작제물의 치료학적 유효량을 포함한다.

특정 실시형태에서, 약제학적 조성물은, 예를 들면, 조성물의 pH, 삼투압, 점도, 투명도, 색상, 등장성, 냄새, 멸균성, 안정성, 용해 또는 방출 속도, 흡수 또는 침투를 변형, 유지 또는 보존하기 위한 제형 물질을 함유할 수 있다. 이러한 실시형태에서, 적합한 제형 물질은, 이로써 한정되지 않지만, 아미노산(예: 글리신, 글루타민, 아스파라긴, 아르기닌, 프롤린 또는 리신); 항균제; 항산화제(예: 아스코르브산, 아황산나트륨 또는 아황산수소나트륨); 완충제(예: 보레이트, 중탄산염, 트리스-HCl, 시트레이트, 포스페이트 또는 기타 유기 산); 증량제(예: 만니톨 또는 글리신); 킬레이트제(예: 에틸렌디아민 테트라아세트산(EDTA)); 착화제(예: 카페인, 폴리비닐피롤리돈, 베타-사이클로덱스트린 또는 하이드록시프로필-베타-사이클로덱스트린); 충전제; 단당류; 이당류; 및 기타 탄수화물(예: 글루코즈, 만노즈 또는 덱스트린); 단백질(예: 혈청 알부민, 젤라틴 또는 면역글로불린); 착색제, 향미제 및 희석제; 유화제; 친수성 폴리머(예: 폴리비닐피롤리돈); 저분자량 폴리펩티드; 염-형성 카운터이온(예: 나트륨); 방부제(예: 벤즈알코늄 클로라이드, 벤조산, 살시실산, 티메로살, 페닐에틸 알콜, 메틸파라벤, 프로필파라벤, 클로르헥시딘, 소르브산 또는 과산화수소); 용매(예: 글리세린, 프로필렌 글리콜 또는 폴리에틸렌 글리콜); 당 알콜(예: 만니톨 또는 솔비톨); 현탁제; 계면활성제 또는 습윤제(예: 플루로닉, PEG, 솔비탄 에스테르, 폴리솔베이트, 예를 들면, 폴리솔베이트 20, 폴리솔베이트, 트리톤, 트로메타민, 레시틴, 콜레스테롤, 틸옥사팔); 안정성 증강제(예: 슈크로즈 또는 솔비톨); 긴장 증강제(예: 알칼리 금속 할라이드, 바람직하게는 염화나트륨 또는 염화칼륨, 만니톨, 솔비톨); 전달 비히클; 희석제; 부형제 및/또는 약제학적 보조제를 포함한다[참조: REMINGTON'S PHARMACEUTICAL SCIENCES, 18" Edition, (A. R. Genrmo, ed.), 1990, Mack Publishing Company].

특정 실시형태에서, 최적 약제학적 조성물은, 예를 들면, 의도된 투여 경로, 전달 포맷 및 목적하는 용량에 따라 당해 기술분야의 숙련가가 결정할 것이다[참조: REMINGTON'S PHARMACEUTICAL SCIENCES, supra]. 특정 실시형태에서, 이러한 조성물은 본 발명의 항원 결합 단백질의 물리적 상태, 안정성, 생체내 방출 속도 및 생체내 소거 속도에 영향을 미칠 수 있다. 특정 실시형태에서, 약제학적 조성물 중의 주요 비히클 또는 담체는 성질이 수성 또는 비-수성일 수 있다. 예를 들면, 적합한 비히클 또는 담체는, 가능하게는 비경구 투여용 조성물에서 일반적으로 다른 물질이 보충된, 주사용수, 생리학적 식염수 용액 또는 인공 뇌척수액일 수 있다. 혈청 알부민과 혼합된 중성 완충 식염수 또는 식염수는 추가의 예시적 비히클이다. 특정 실시형태에서, 약제학적 조성물은 약 pH 7.0 내지 8.5의 트리스 완충제, 또는 약 pH 4.0 내지 5.5의 아세테이트 완충제를 포함하고, 따라서 솔비톨 또는 적합한 대체물을 추가로 포함할 수 있다. 본 발명의 특정 실시형태에서, 본 발명의 인간 항체 또는 이의 항원 결합 단편 또는 본 발명 조성물의 항체 작제물은 동결건조된 케이크 또는 수용액의 형태로 목적하는 순도를 갖는 선택된 조성물을 임의의 제형화제[참조: REMINGTON'S PHARMACEUTICAL SCIENCES, supra]와 혼합함으로써 저장용으로 제조할 수 있다. 추가로, 특정 실시형태에서, 본 발명의 인간 항체 또는 이의 항원 결합 단편 또는 본 발명의 항체 작제물은 슈크로즈 등의 적절한 부형제를 사용하여 동결건조물로서 제형화할 수 있다.

본 발명의 약제학적 조성물은 비경구 전달을 위해 선택할 수 있다. 또는, 조성물은 흡입 또는 소화관을 통한 전달, 예를 들면, 경구적으로 선택할 수 있다. 이러한 약제학적으로 허용되는 조성물의 제조는 당해 기술분야의 숙련가의 범위 내이다. 제형 성분은 바람직하게는 투여 부위에 허용되는 농도로 존재한다. 특정한 실시형태에서, 완충제를 사용하여 조성물을 생리학적 pH 또는 약간 낮은 pH, 전형적으로 약 5 내지 약 8의 pH 범위로 유지할 수 있다.

비경구 투여가 고려되는 경우, 본 발명에서 사용하기 위한 치료학적 조성물은, 본 발명의 목적하는 인간 항체 또는 이의 항원 결합 단편 또는 본 발명의 항체 작제물을 약제학적으로 허용되는 비히클에 포함하는 피로겐-비함유, 비경구적으로 허용되는 수용액의 형태로 제공될 수 있다. 비경구 주사에 특히 적합한 비히클은 멸균 증류수이고, 여기서 본 발명의 항체 작제물은 적절하게 보존된 멸균 등장액으로서 제형화된다. 특정 실시형태에서, 제조는 제제, 예를 들면, 주사가능한 미소구, 생체침식성 입자, 중합체성 화합물(예: 폴리락트산 또는 폴리글리콜산), 데포 주사를 통해 전달될 수 있는 생성물의 조절된 또는 지속 방출을 제공할 수 있는 비드 또는 리포좀을 사용한 목적하는 분자의 제형화를 수반할 수 있다. 특정 실시형태에서, 순환 중에 지속 기간을 촉진시키는 효과를 갖는 히알루론산이 또한 사용될 수 있다. 특정 실시형태에서, 이식가능한 약물 전달 장치를 사용하여 목적하는 항원 결합 단백질을 도입할 수 있다.

추가의 약제학적 조성물은, 지속-전달 또는 조절-전달 제형에 본 발명의 항체 작제물을 수반하는 제형을 포함하여 당해 기술분야의 숙련가에게 명백할 것이다. 다양한 다른 지속-전달 또는 조절-전달 수단을 제형화하는 기술, 예를 들면, 리포좀 담체, 생체-침식성 미립자 또는 다공성 비드 및 데포 주사는 당해 기술분야의 숙련가에게 공지되어 있다[참조: 국제 특허출원번호 제PCT/US93/00829호, 이는 참조로서 도입되고, 약제학적 조성물의 다공성 중합체 미립자의 조절된 방출을 기재한다]. 지속-방출 제제는 성형품의 형태, 예를 들면, 필름 또는 마이크로캡슐로 반투과성 중합체 매트릭스를 포함할 수 있다. 지속 방출 매트릭스는 폴리에스테르, 하이드로겔, 폴리락티드(미국 특허 제3,773,919호 및 유럽 특허출원 공개공보 제EP 058481호, 각각은 참조로서 도입된다), L-글루탐산과 감마 에틸-L-글루타메이트의 공중합체[참조: Sidman et al., 1983, Biopolymers 2:547-556], 폴리(2-하이드록시에틸-메타크릴레이트)[참조: Langer et al., 1981, J. Biomed. Mater. Res. 15:167-277 and Langer, 1982, Chem. Tech. 12:98-105], 에틸렌 비닐 아세테이트[참조: Langer et al., 1981, supra] 또는 폴리-D(-)-3-하이드록시부티르산(유럽 특허출원 공개공보 제EP 133,988호)을 포함한다. 지속 방출 조성물은 또한 당해 기술분야에 공지된 임의의 몇몇 방법에 의해 제조할 수 있는 리포좀을 포함할 수 있다[참조: Eppstein et al., 1985, Proc. Natl. Acad. Sci. U.S.A. 82:3688-3692; 유럽 특허출원 공개공보 제EP 036,676호; 제EP 088,046호 및 제EP 143,949호, 참조로서 도입됨].

생체내 투여에 사용된 약제학적 조성물은 전형적으로 멸균 제제로서 제공된다. 멸균은 멸균 여과 막을 통한 여과에 의해 달성할 수 있다. 조성물을 동결건조시키는 경우, 이러한 방법을 사용한 멸균은 동결건조 및 재구성 전 또는 후에 수행할 수 있다. 비경구 투여용 조성물은 동결건조 형태 또는 용액에 저장할 수 있다. 비경구 조성물은 일반적으로 멸균 접근 포트를 갖는 용기, 예를 들면, 피하 주사 니들에 의해 관통가능한 스토퍼를 갖는 정맥내 용액 백 또는 바이알에 배치된다.

본 발명의 양상은 본 발명의 제형의 자가-완충 항체 작제물을 포함하고, 이는 이의 전체가 본원에서 참조로서 도입되는 국제 공개공보 WO 06138181A2(PCT/US2006/022599)에 기재된 바와 같이 약제학적 조성물로서 사용될 수 있다.

상기 논의한 바와 같이, 특정 실시형태는, 본 발명의 항체 작제물에 추가하여, 이 부분 및 본원의 다른 부분에서 설명적으로 기재된 것들과 같은 하나 이상의 부형제를 포함하는, 본 발명의 단백질 조성물, 특히 본 발명의 약제학적 조성물의 항체 작제물을 제공한다. 부형제는 이와 관련하여 다양한 목적, 예를 들면, 제형의 물리적, 화학적 또는 생물학적 특성의 조정, 예를 들면, 점도의 조정을 위해 본 발명에서 사용되고/되거나, 효과를 개선시키기 위해 및/또는 제조, 선적, 저장, 사용전 제조, 투여 동안 및 그 후에 발생하는 스트레스에 기인하여 열화 및 부패에 대해 이러한 제형 및 공정을 안정화시키기 위해 본 발명의 방법에서 사용될 수 있다.

다양한 설명이 이와 관련하여 유용한 단백질 안정화 및 제형 물질 및 방법[참조: Arakawa et al., "Solvent interactions in pharmaceutical formulations," Pharm Res. 8(3): 285-91 (1991); Kendrick et al., "Physical stabilization of proteins in aqueous solution," in: RATIONAL DESIGN OF STABLE PROTEIN FORMULATIONS: THEORY AND PRACTICE, Carpenter and Manning, eds. Pharmaceutical Biotechnology. 13: 61-84 (2002), and Randolph et al., "Surfactant-protein interactions," Pharm Biotechnol. 13: 159-75 (2002), 이들 각각은 이의 전체가 본원에서 참조로서 도입된다], 특히 부분적으로 본 발명에 따라 단백질 제형을 자가-완충시키기 위한 이들의 부형제 및 방법과 관련하여, 특히 가축 및/또는 인간 의약 사용을 위한 단백질 약제학적 생성물 및 방법에 대해 이용가능하다.

염은, 예를 들면, 제형의 이온 강도 및/또는 등장성을 조정하고/하거나 본 발명에 따르는 조성물의 단백질 또는 기타 성분의 용해도 및/또는 물리적 안정성을 개선시키기 위해 본 발명의 특정 양태에 따라 사용될 수 있다.

공지된 바와 같이, 이온은 단백질의 표면 상의 하전된 잔기에 결합하고 단백질 중의 하전된 및 극성 그룹을 차폐하고 이들의 정전기 상호작용, 인력 및 반발 상호작용의 강도를 감소시킴으로써 단백질의 자연 상태를 안정화시킬 수 있다. 이온은 또한, 특히 단백질의 변성 펩티드 결합(--CONH)에 결함으로써 단백질의 변성 상태를 안정화시킬 수 있다. 추가로, 단백질 중의 하전된 및 극성 그룹과의 이온 상호작용은 분자간 정전기 상호작용을 감소시키고, 이에 의해 단백질 응집 및 불용성을 방지 또는 감소시킬 수 있다.

이온 종은 단백질에 대한 이들의 효과가 현저히 상이하다. 단백질에 대한 이온의 다수의 카테고리 랭킹 및 이들의 효과가 개발되었고, 본 발명에 따른 약제학적 조성물의 제형화에 사용될 수 있다. 한 가지 예는 호프마이스터(Hofmeister) 시리즈이고, 이는 용액에서 단백질의 입체 구조 안정성에 대한 이들의 효과에 의해 이온성 및 극성 비-이온성 용질을 평가한다. 안정화 용질은 "코스모트로픽(kosmotropic)"으로 지칭된다. 불안정화 용질은 "카오스토픽(chaotropic)"으로 지칭된다. 코스모트로프는 통상 용액으로부터 단백질을 침전시키기 위해("염석(salting-out)") 고농도(예: >1몰 황산암모늄)로 사용된다. 카오트로프는 통상 단백질을 변성시키고/시키거나 용해시키기 위해("염용(salting-in)") 사용된다. "염석" 및 "염용"에 대한 이온의 상대적 효과는 호프마이스터 시리즈에서의 이들의 위치를 한정한다.

유리 아미노산은 기타 표준 사용 뿐만 아니라 증량제, 안정화제 및 항산화제로서 본 발명의 다양한 양태에 따라 본 발명 제형의 항체 작제물에 사용될 수 있다. 리신, 프롤린, 세린 및 알라닌이 제형에서 단백질의 안정화에 사용될 수 있다. 글리신은 정확한 케이크 구조 및 특성을 보장하기 위해 동결건조에서 유용하다. 아르기닌은 액체 및 동결건조 제형 둘 다에서 단백질 응집을 억제하는데 유용할 수 있다. 메티오닌은 항산화제로서 유용하다.

폴리올은 당, 예를 들면, 만니콜, 슈크로즈 및 솔비톨 및 다가 알콜, 예를 들면, 글리세롤 및 프로필렌 글리콜, 및 본원에서의 논의를 목적으로, 폴리에틸렌 글리콜(PEG) 및 관련물질을 포함한다. 폴리올은 코스모트로픽이다. 이들은 물리적 및 화학적 열화 프로세스로부터 단백질을 보호하기 위해 액체 및 동결건조 제형 둘 다에서 유용한 안정화제이다. 폴리올은 또한 제형의 긴장성을 조정하는데 유용하다.

본 발명의 선택 양태에서 유용한 폴리올 중에는 동결건조 제형에서 케이크의 구조적 안정성을 보장하기 위해 통상 사용되는 만니톨이 있다. 이는 케이크에 대한 구조적 안정성을 보장한다. 이는 일반적으로 동결보호제, 예를 들면, 슈크로즈와 함께 사용된다. 솔비톨 및 슈크로즈는 긴장성을 조절하기 위해 및 수송 동안 또는 제조 프로세스 중에 벌크의 제조 동안 동결-해동 응력으로부터 보호하기 위한 안정화제로서 바람직한 제제이다. 환원 당(이는 유리 알데히드 또는 케톤 그룹을 함유한다), 예를 들면, 글루코즈 및 락토즈는 표면 리신 및 아르기닌 잔기를 당화시킬 수 있다. 따라서, 이들은 일반적으로 본 발명에 따라 사용하기에 바람직한 폴리올이 아니다. 또한, 이러한 반응 종을 형성하는 당, 예를 들면, 프럭토즈 및 글루코즈를 산성 조건하에 가수분해시키고 결과적으로 당화를 야기하는 슈크로즈는 또한 이와 관련하여 본 발명의 바람직한 폴리올이 아니다. PEG는 단백질을 안정화시키는데 유용하고, 동결보호제로서 이와 관련하여 본 발명에서 사용될 수 있다.

본 발명의 제형의 항체 작제물의 실시형태는 계면활성제를 추가로 포함한다. 단백질 분자는 표면 상에서의 흡수 및 공기-액체, 고체-액체 및 액체-액체 계면에서 변형 및 결과적으로 응집에 감수성일 수 있다. 이들 효과는 일반적으로 단백질 농도와 반비례하여 증가한다. 이들 유해한 상호작은 일반적으로 단백질 농도와 반비례하여 증가하고, 전형적으로 생성물의 선적 및 취급 동안 생성된 것과 같이 물리적 진탕에 의해 악화된다.

계면활성제는 통상적으로 표면 흡수를 방지, 최소화 또는 감소시키기 위해 사용된다. 이와 관련하여 본 발명에서 유용한 계면활성제는 폴리솔베이트 20, 폴리솔베이트 80, 솔비탄 폴리에톡실레이트의 기타 지방산 에스테르 및 폴록사머 188을 포함한다.

계면활성제는 또한 단백질 입체구조 안정성을 조절하기 위해 통상적으로 사용된다. 이와 관련하여 계면활성제의 사용은, 임의의 소정 계면활성제가 전형적으로 일부 단백질은 안정화시키고 다른 단백질은 불안정화시키기 때문에, 단백질-특이적이다.

폴리솔베이트는 산화 분해에 감수성이고, 종종, 공급된 바와 같이, 단백질 잔기 측쇄, 특히 메티오닌의 산화을 유발하기 위해 충분한 양의 퍼옥사이드를 함유한다. 결과적으로, 폴리솔베이트는 주의 깊게 사용되어야 하고, 사용되는 경우, 이들의 최저 유효 농도로 사용되어야 한다. 이와 관련하여, 폴리솔베이트는, 부형제가 이들의 최저 유효 농도로 사용되어야 하는 일반 법칙을 예시한다.

본 발명의 제형의 항체 작제물의 실시형태는 하나 이상의 항산화제를 포함한다. 단백질의 어느 정도의 유해한 산화는 적당한 수준의 주위 산소 및 온도를 유지하고 광에 대한 노출을 회피함으로써 약제학적 제형에서 방지될 수 있다. 항산화제 부형제는 단백질의 산화 열화를 방지하기 위해 또한 사용될 수 있다. 이와 관련하여 유용한 항산화제에는 환원제, 산소/유리-라디칼 스캐빈저 및 킬레이트제가 있다. 본 발명에 따르는 치료학적 단백질 제형에 사용하기 위한 항산화제는 바람직하게는 수용성이고, 생성물의 반감기 전체에 걸쳐 이들의 활성을 유지한다. EDTA는 이와 관련하여 본 발명에 따르는 바람직한 항산화제이다.

항산화제를 단백질을 손상시킬 수 있다. 예를 들면, 환원제, 예를 들면, 글루타티온은 특히 분자간 디설파이드 결합을 파괴할 수 있다. 따라서, 본 발명에서 사용하기 위한 항산화제는, 그 중에서, 제형에서 단백질을 자체로 손상시킬 가능성을 제거하거나 충분히 감소시키도록 선택된다.

본 발명에 따르는 제형은 단백질 보조-인자이고 단백질 배위 착물을 형성하는데 필요한 금속 이온, 예를 들면, 특정한 인슐린 현탁액을 형성하는데 필요한 아연을 포함할 수 있다. 금속 이온은 또한 단백질을 분해하는 일부 프로세스를 억제할 수 있다. 그러나, 금속 이온은 또한 단백질을 분해하는 물리적 및 화학적 프로세스를 촉매한다.

마그네슘 이온(10-120mM)은 아스파르트산의 이소아스파르트산으로의 이성화를 억제하기 이해 사용될 수 있다. Ca+2 이온(최대 100mM)은 인간 데옥시리보뉴클레아제의 안정성을 증가시킬 수 있다. 그러나, Mg+2, Mn+2 및 Fe+2는 rhDNase를 불안정화시킬 수 있다. 유사하게는 Ca+2 및 Sr+2는 인자 VIII을 안정화시킬 수 있고, Mg+2, Mn+2 및 Zn+2에 의해 불안정화될 수 있고, Cu+2 및 Fe+2 및 이의 응집은 Al+3 이온에 의해 증가될 수 있다.

본 발명의 항체 작제물의 실시형태는 하나 이상의 방부제를 추가로 포함한다. 방부제는, 동일한 용기로부터 1회 이상을 추출을 수반하는 다용량 비경구 제형을 개발할 때에 필요하다. 이들의 주요 기능은 미생물 성장을 억제하고 생성물 멸균성을 반감기 또는 약물 생성물의 사용 기간 전체에 걸쳐 보장하는 것이다. 통상 사용되는 방부제는 벤질 알콜, 페닐 및 m-크레졸을 포함한다. 방부제는 소분자 비경구에 의한 사용의 장기간 역사를 갖지만, 방부제를 포함하는 단백질 제형의 개발은 곤란할 수 있다. 방부제는 거의 항상 단백질에 대한 불안정화 효과(응집)를 갖고, 이는 다용량 단백질 제형에서 이들의 사용을 제한하는 주요 요인이 되어 왔다. 현재까지, 대부분의 단백질 약물은 단일-사용을 위해서만 제형화되어 왔다. 그러나, 다용량 제형이 가능한 경우, 이들은 환자 편의성을 가능하게 하는 부가 잇점 및 증가된 시장성을 갖는다. 양호한 예는 보존된 제형의 개발이 보다 편리한 다복적 주사 펜 프레젠테이션의 상품화를 유도하는 인간 성장 호르몬(hGH)의 것이다. hGH의 보존된 제형을 함유하는 적어도 4개의 이러한 펜 장치는 현재 시장에서 이용가능하다. 노르디트로핀(Norditropin)(액체, Novo Nordisk), 누트로핀(Nutropin) AQ(액체, Genentech) & 제노트로핀(Genotropin)(동결건조-이중 챔버 카트리지, Pharmacia & Upjohn)는 페놀을 함유하는 반면, 소마트로프(Somatrope)(Eli Lilly)은 m-크레졸로 제형화된다. 몇몇 양상은 보존된 투여형의 제형화 및 개발 동안 고려될 필요가 있다. 약물 생성물 중의 유효 방부제 농도는 최적화되어야 한다. 이는 단백질 안정성을 손상시키지 않고서 항균 효과를 제공하는 농도 범위로 투약형으로 소정 방부제를 시험할 필요가 있다.

예상할 수 있는 바와 같이, 방부제를 함유하는 액체 제형의 개발은 동결건조된 제형보다 곤란하다. 동결-건조 생성물은 방부제 없이 동결건조될 수 있고, 사용 시점에서 방부제 함유 희석제로 재구성할 수 있다. 이는 방부제가 단백질과 접촉하는 시간을 단축시켜 연관 안정성 위험을 현저히 최소화한다. 액체 제형의 경우, 방부제 효과 및 안정성은 전체 생성물 반감기(약 18 내지 24개월)에 걸쳐 유지되어야 한다. 주목해야 할 중요한 점은 방부제 효과가 활성 약물 및 모든 부형제 성분을 함유하는 최종 제형에서 입증되어야 한다는 것이다.

본 발명의 항체 작제물은 일반적으로 그 중에서도 특정한 투여 경로 및 방법, 특정한 투여 용량 및 투여 빈도, 특정한 질환의 특정 치료를 위해 생체-이용성 및 지속성의 범위로 설계될 수 있다. 따라서, 제형은, 이로써 한정되지 않지만, 경구적, 청각적, 점안, 직장 및 질내를 포함하는 임의의 적합한 경로, 및 정맥내 및 동맥내 주사, 근육내 주사 및 피하 주사를 포함하는 비경구 경로에 의한 전달을 위해 본 발명에 따라 설계될 수 있다.

약제학적 조성물이 제형화되면, 이는 용액, 현탁액, 겔, 에멀젼, 고체, 결정으로서 또는 탈수 또는 동결건조 분말로서 멸균 바이알에 저장할 수 있다. 이러한 제형은 사용 준비 형태 또는 투여전 재구성되는 형태(예: 동결건조)로 저장할 수 있다. 본 발명은 또한 단일-용량 투여 단위를 생성하는 키트를 제공한다. 본 발명의 키트는 건조 단백질을 갖는 제1 용기 및 수성 제형을 갖는 제2 용기를 각각 함유할 수 있다. 본 발명의 특정 실시형태에서, 단일 및 복수-챔버 예비-충전된 시린지(예: 액체 시린지 및 리오시린지(lyosyringe)를 함유하는 키트가 제공된다. 사용되는 본 발명의 단백질-함유 약제학적 조성물의 항체 작제물의 치료학적 유효량은, 예를 들면, 치료 상황 및 목적에 따라 달라질 것이다. 당해 기술분야의 숙련가는 치료를 위한 적절한 용량 수준이 전달된 분자, 본 발명의 항체 작제물이 사용되는 적응도, 투여 경로 및 환자의 크기(체중, 신체 표면 또는 기관 크기) 및/또는 상태(연령 및 일반 건강)에 따라 부분적으로 달라질 수 있음을 이해할 것이다. 특정 실시형태에서, 임상의는 최적 치료 효과를 수득하기 위해 용량을 적정하고 투여 경로를 변경할 수 있다. 전형적인 용량은 상기 언급된 요인에 따라 약 0.1㎍/kg 내지 약 30mg/kg 또는 그 이상의 범위일 수 있다. 특정 실시형태에서, 용량은 1.0㎍/kg 내지 약 20mg/kg, 임의로 10㎍/kg 내지 약 10mg/kg 또는 100㎍/kg 내지 약 5mg/kg 범위일 수 있다.

본 발명의 항체 작제물의 치료학적 유효량은 바람직하게는 질환 증상의 중증도의 감소, 질환 증상-비함유 기간의 빈도 또는 기간, 또는 질환 고통에 기인하는 손상 또는 불안정성의 방지를 야기한다. CDH19-발현 종양을 치료하기 위해, 치료학적 유효량의 본 발명의 항체 작제물, 예를 들면, 항-CDH19/CD3 항체 작제물은 바람직하게는 무처리 환자와 비교하여 세포 성장 또는 종양 성장을 적어도 약 20%, 적어도 약 40%, 적어도 약 50%, 적어도 약 60%, 적어도 약 70%, 적어도 약 80% 또는 적어도 약 90% 억제시킨다. 종양 성장을 억제하는 화합물의 능력은 인간 종양에서의 효능을 예측하는 동물 모델에서 평가할 수 있다.

약제학적 조성물은 의료 장치를 사용하여 투여할 수 있다. 약제학적 조성물을 투여하는 의료 장치의 예는 미국 특허 제4,475,196호; 제4,439,196호; 제4,447,224호; 제4,447,233호; 제4,486,194호; 제4,487,603호; 제4,596,556호; 제4,790,824호; 제4,941,880호; 제5,064,413호; 제5,312,335호; 제5,312,335호; 제5,383,851호; 및 제5,399,163호에 기재되어 있고, 이들 모두는 본원에서 참조로서 도입된다.

한 가지 실시형태에서, 본 발명은 흑색종 질환 또는 전이성 흑색종 질환의 예방, 치료 또는 개선에 사용하기 위해 본 발명의 항체 작제물 또는 본 발명의 방법에 따라 생성한 항제 작제물을 제공한다.

본 발명은 또한, 본 발명의 항체 작제물 또는 본 발명의 방법에 따라 생성한 항체 작제물을 이를 필요로 하는 대상체에게 투여하는 단계를 포함하는, 흑색종 질환 또는 전이성 흑색종 질환의 치료 또는 개선 방법을 제공한다.

본 발명의 사용 방법의 바람직한 실시형태에서, 흑색종 질환 또는 전이성 흑색종 질환은 표재 확산성 흑색종, 악성 흑자, 악성 흑자 흑색종, 말단성 흑자성 흑색종 및 결절성 흑색종으로 이루어진 그룹으로부터 선택된다.

추가의 실시형태에서, 본 발명은 본 발명의 항체 작제물 또는 본 발명의 방법에 따라 생성된 항체 작제물, 본 발명의 벡터 및/또는 본 발명의 숙주 세포를 포함하는 키트를 제공한다.

본원에서 본 발명은, 자체가 달라질 수 있기 때문에, 특정의 방법학, 프로토콜 또는 시약으로 한정되지 않는 것으로 이해되어야 한다. 본원에 제공된 논의 및 실시예는 단지 특정 실시형태를 기재할 목적으로 제공된 것이고, 본 발명의 범위를 한정하는 것으로 의도되지 않으며, 이는 단지 특허청구범위에 의해서만 한정된다.

본 명세서의 전문을 통해 인용된 모든 간행물 및 특허(모든 특허, 특허 출원, 과학 간행물, 제조업자의 사양서, 지침 등을 포함)는, 상기 또는 하기 모두에서, 이의 전체가 본원에서 참조로서 도입된다. 본원의 어떠한 것도 본 발명이 선행 발명에 비추어 이러한 개시를 선행하는 권리가 없다는 것을 인정하는 것으로 해석되지 않아야 한다. 참조로서 도입된 자료가 모순되거나 본 명세서와 일치하지 않는 한, 본 명세서는 임의의 이러한 자료에 우선할 것이다.

실시예:

이하의 실시예는 본 발명의 특정의 실시형태 또는 특징을 예시하는 목적을 위해 제공된다. 이러한 실시예는 본 발명의 범위를 한정하는 것으로 해석되어서는 안된다. 실시예는 예시 목적으로 포함되고, 본 발명은 특허청구범위에 의해서만 한정된다.

실시예 1 - CDH19에 대한 완전 인간 모노클로날 항체

1.1 면역화:

캐드헤린-19(CDH19)에 대한 완전 인간 항체는 제노마우스(XENOMOUSE?) 기술, 상응하는 이소형의 완전 인간 IgGκ 및 IgGλ 항체의 다양한 레퍼토리를 발현시키기 위해 조작된 유전자도입 마우스를 사용하여 생성했다[참조: 전문이 본원에 참조로 인용된 미국 특허 제6,114,598호; 제6,162,963호; 제6,833,268호; 제7,049,426호; 제7,064,244호; Green et al., 1994, Nature Genetics 7:13-21; Mendez et al., 1997, Nature Genetics 15:146-156; Green and Jakobovitis, 1998, J. Ex. Med . 188:483-495; Kellermann and Green, Current Opinion in Biotechnology 13, 593-597, 2002].

마우스는 (1) 전장 인간 및 시노몰로구스("시노") 원숭이 캐드헤린-19, (2) 분비된 캐드헤린-19 엑토-도메인(아미노산 1-596) 및 (3) 인간 캐드헤린-19(아미노산 1-624)의 절단된 막 결합 형태를 포함하는 캐드헤린-19 면역원의 복수 형태로 면역화시켰다. 마우스를 16-18부스트의 범위로 8 내지 10주 동안 면역화시켰다.

혈청을 제1 주사 후 약 5 및 9주에 수집하고, 특정 역가는 CHO-S 세포 상에서 일시적으로 발현된 재조합 캐드헤린-19 수용체의 FAC 염색으로 측정했다. 총 37마리 동물을 특이적 면역 반응으로 동정하고, 이러한 동물들은 3개 그룹으로 풀링하고 항체 생성으로 진전시켰다.

1.2 모노클로날 항체의 제조

적합한 역가를 나타내는 동물을 동정하고, 림프구는 림프절을 배출시켜 수득하고, 필요에 따라, 각 코호트를 위해 풀링시켰다. 림프구는 적합한 배지(예: 둘베코 변형 이글 배지(DEME); 캘리포니아주 칼즈배드의 인비트로겐(Invitrogen)으로부터 입수가능)에서 분쇄함으로써 림프 조직으로부터 해리시켜 조직으로부터 세포를 방출시키고, DMEM에 현탁시켰다. B 세포를 표준 방법을 사용하여 선택하고/하거나 확장시키고, 당해 기술 분야에 공지된 기술을 사용하여 적합한 융합 파트너로 융합시켰다.

배양 수일 후, 하이브리도마 상청액을 수집하고, 인간 및 시노몰로구스 원숭이에 대한 결합의 확인 뿐만 아니라 2차 항체-약물 접합체 생물검정에서 세포주를 사멸시키는 능력을 포함하여 이하 실시예에 상술된 바와 같은 스크리닝 검정에 적용했다. 이어서, 목적하는 결합 및 기능적 특성을 갖는 것으로 동정된 하이브리도마 주를 추가로 선택하고, 표준 클로닝 및 서브클로링 기술에 적용했다. 클론주를 시험관내 확장시키고, 분비된 인간 항체를 분석을 위해 수득하고, v 유전자 서열분석을 수행했다.

1.3 FMAT에 의한 캐드헤린-19 수용체 특이적 결합 항체의 선택

배양 14일 후, 하이브리도마 상청액을 형광 미량 검정 기술(FMAT)(어플라이드 바이오시스템즈(Applied Biosystems), Foster City, CA)에 의해 CDH19-특이적 모노클로날 항체에 대해 스크리닝했다. 상청액을 인간 캐드헤린-19로 일시적으로 형질감염된 부착성 CHO 세포에 대해 스크리닝하고, 캐드헤린-19 유전자를 함유하지 않은 동일한 발현 플라스미드로 일시적으로 형질감염된 CHO 세포에 대해 역 스크리닝했다.

복수의 스크리닝 캠페인 후, 1570 항-캐드헤린-19 결합 하이브리도마 주의 패널을 동정하고, 추가의 특성화 검정으로 진전시켰다.

실시예 2 - CDH19에 대한 완전 인간 모노클로날 항체의 평가

2.1 유동 세포분석(FAC)에 의한 추가의 결합 특성화

FACS 결합 검정을 수행하여 CHL-1 종양 세포주 상에서 발현된 내인성 캐드헤린-19 수용체에 대한 항-캐드헤린-19 수용체 특이적 항체의 결합을 평가했다. 또한, 뮤린 및 시노몰로구스 원숭이 캐드헤린-19 오르톨로그에 대한 교차-반응성 결합은 293T 세포 상에서 일시적으로 발현된 다양한 수용체의 재조합 형태를 사용하여 FAC로 평가했다.

FAC 검정은 하이브리도마 상청액을 PBS/2% 소 태아 혈청/2mM 염화칼슘 중의 10,000 내지 25,000개 세포로 4℃에서 1시간 동안 배양 후 PBS/2% 소 태아 혈청/2mM 염화칼슘으로 2회 세척하여 수행했다. 이어서, 세포를 4℃에서 플루오로크롬 표지된 2차 항체로 처리한 다음, 1회 세척했다. 세포를 50㎕의 PBS/2% FBS에 재현탁시키고, 항체 결합을 FACSCalibur™ 장치를 사용하여 분석했다.

2.2 제노마우스 ? 하이브리도마로부터 유래된 완전 인간 항체의 항체 약물 접합체 스크리닝

항체 약물 접합체를 통한 세포 사멸은 내재화를 통해 접합체의 세포로의 전달 및 이것이 세포에 독성인 형태로 약물-접합체의 이화를 필요로 한다. 이러한 특성을 갖는 항체를 동정하기 위해, CDH19-양성 세포주(Colo-699 또는 CHL-1)를 낮은 세포 밀도에서 접종하고, 384 웰 플레이트에서 밤새 부착되도록 했다. 이어서, 완전 인간 항-CDH19 항체를 함유하는 제노마우스? 하이브리도마 샘플을 비교적 낮은 약물-항체 비(DAR)(약 1.3)에서 DM1에 접합된 고농도의 염소 항-인간 Fc 1가 Fab(DM1-Fab)의 존재하에 이러한 세포에 첨가했다. 세포를 항체 샘플 및 DM1-Fab의 존재하에 37℃ 및 5% CO2에서 96시간 동안 배양했다. 이 시간 말기에, 세포 생존율을 제조업자의 권장에 따라서 CellTiter-Glo? 발광 세포 생존 시약(Promega)을 사용하여 평가했다.

Colo-699 세포를 사용한 세포 생존율 데이터의 예는 도 1 및 도 2에 제시되어 있다. DM1-Fab를 세포에 전달하고 세포 성장을 억제할 수 있는 항체는 보다 낮은 발광 신호(RLU)로 판독한다. 이 스크린으로부터 목적하는 상부 항체는 도 1의 하부 좌측 코너에서 관찰되고, 개방 원으로 표시된다. 이러한 항체는 CHL-1 세포 상의 세포 생존율 검정으로 진행시켰다. CHL-1 검정으로부터 평균 세포 생존율 데이터를 Colo-699 검정으로부터 평균 세포 생존율 데이터에 대해 플롯팅한다(도 2). Colo-699 및 CHL-1 세포 둘 다에 대한 활성을 갖는 항체는 도 2의 좌측 측면 위 개방 원으로서 표시된다.

이 검정을 상기 FAC 항체 결합 검정(2.2)과 병행하여 실행하고, 이러한 두 연구로부터의 결과는 추가의 특성화용 항체를 선택하기 위해 사용했다. 전체로, 1570개 항체를 이러한 세포계 생존율 검정을 통해 실행하고, 약 44개 항체는 시험관내 세포 사멸 및/또는 서브-클로닝, V 유전자 서열 분석에 대한 항체 결합에 기반하여 선택하고, 기재된 바와 같은 추가의 특성화 검정을 위한 재조합 형태로 발현시켰다.

이러한 44개 항체를 다시 실시예 2에서와 같이 검정하고, 독특한 서열을 함유한 19개 항체를 선택했다. 이러한 19개 항체 중, 18개 항체를 분석하고, 이들의 특성을 이하 표 2에 특성화했다. 이 표 중의 데이터는 재조합 인간 및 시노몰로구스 CDH-19 상의 FAC 결합, 293/CDH-19 형질감염체 상의 +/- 칼슘(Ca+2) 결합 데이터, CHL-1 및 Colo699 종양 세포 상의 내인성 CDH-19에 대한 결합 및 표에 4A9로서 지정된 항체와의 경쟁을 사용하여 생성했다. 이러한 실험은 5개 그룹 또는 빈(bin)으로 이러한 항체의 그룹화에 대해 추가의 특성을 제공한다.

항체 결합 정보를 사용하는 리드 패널의 비닝

빈 ID LMR 서열/
Ab ID

클론
ID
빈 특성
1 13589 4A9 높은 내인성 결합, 칼슘 비감수성 , 서열 클러스터화 , 적당한 사이노 완전 4A9 경쟁자
13591 4F7
2 13885 19B5 높은 내인성 결합, 칼슘 비감수성 , 서열 클러스터화 , 양호한 사이노 부분 4A9 경쟁자
13880 25F8
13882 26D1
13881 26F12=27B3
13878 16H2=20D3=23E7
13879 22D1
3 13877 22G10 높은 내인성 결합, 적당한 293 결합, 칼슘 비감수성, 2 서열 클러스터, 적당한 사이노 부분 4A9 경쟁자, 빈 중의 22G10 최선 결합제
13874 17H8=23B6=28D10
13883 25G10
13875 16C1
4
13590 4B10 낮은 내인성 및 재조합 결합, 칼슘 감수성, 서열 다양한 그룹, 동등한 사이노 , 4A9 없는 경쟁
13586 4F3
13592 4A2
13884 23A10
13588 2G6
5 13876
16A4
최고 내인성 결합제, 적당한 재조합 결합제, 매우 약한 사이노, 4A9 없는 경쟁

이러한 18개 항체 중, 8개 항체를 이하 상술되는 바와 같이 이들의 에피토프 결합의 추가의 분석을 위해 선택했다. 각각의 빈으로부터 적어도 1개의 대표적 항체를 추가의 분석을 위해 선택했다.

실시예 3- 에피토프 예측

4A9 항체 경쟁 및 인간/마우스 캐드헤린 -19 키메라에 의한 에피토프 예측

4A9 결합과 경쟁하는 항체를 동정하기 위해 4A9 결합 경쟁 방법을 개발했다. 96-웰 V-기저 플레이트(Sarstedt #82.1583.001)에서, 50,000개의 일시적으로 형질감염된 293T 세포를 5㎍/ml의 정제된 항-CDH19 항체로 4℃에서 1시간 동안 배양한 다음, PBS/2% FBS로 1회 세척했다. 이어서, 25㎕의 5㎍/ml Alexa647-표지된 4A9를 각 웰에 첨가하고, 플레이트를 4℃에서 1시간 동안 배양했다. 이어서, 세포를 2회 세척하고, 세포 연관 Alexa647-표지된 4A9의 양을 유동 세포분석으로 정량화했다.

실험은 PBS/2% FBS만으로 이루어진 음성 대조군을 포함한다. 이러한 음성 대조군 실험에서 관찰된 평균 신호는 검정을 위한 최대 가능한 신호로서 채택되었다. 항체를 이 최대 신호와 비교하였고, 억제 %를 각 웰에 대해 계산했다(억제 % = (1-(항-CDH19 항체에 의한 FL4 기하평균/최대 FL4 기하평균 신호)).

도메인 결합은 천연 인간 또는 뮤린 CDH19 리더 서열 및 플래그 태그(서열번호 968)가 즉시 선행된 pTT5 발현 벡터로 클로닝된 마우스 캐드헤린19 골격에서 단일 또는 이중 인간 CDH19 캐드헤린 반복 도메인 치환으로 이루어진 플라스미드로 일시적으로 형질감염된 293T 세포 상에서 상기한 바와 같은 유동 세포분석에 의해 측정했다. 실험은 이러한 인간/마우스 키메라 상의 비닝을 위한 적합성을 측정하기 위해 마우스 캐드헤린19에 대한 항-CDH19 항체를 검정하는 것을 포함한다.

이러한 실험으로부터 데이터는 다음과 같은 표제하의 표에 제시된다:

Figure pct00001

범례 표 3

인간 및/또는 뮤린 키메라 작제물

A = huCDH19(44-772) (서열번호 944 참조)

B = huCDH19(44-141)::muCDH19(140-770) (서열번호 952 참조)

C = huCDH19(44-249)::muCDH19(248-770) (서열번호 954 참조)

D = muCDH19(44-139)::huCDH19(142-249)::muCDH19(248-770) (서열번호 956 참조)

E = muCDH19(44-139)::huCDH19(142-364)::muCDH19(363-770) (서열번호 958 참조)

F = muCDH19(44-247)::huCDH19(250-364)::muCDH19(363-770) (서열번호 960 참조)

G = muCDH19(44-362)::huCDH19(365-772) (서열번호 962 참조)

H = muCDH19(44-461)::huCDH19(464-772) (서열번호 964 참조)

I = muCDH19(44-770) (서열번호 966 참조)

인간/닭 캐드헤린-19 키메라에 의한 에피토프 예측

도메인 결합은 천연 인간 또는 닭 CDH19 리더 서열 및 플래그 태그가 즉시 선행된 pTT5 발현 벡터로 클로닝된 치킨 캐드헤린19 골격에서 단일 인간 CDH19 캐드헤린 반복 도메인 치환으로 이루어진 플라스미드로 일시적으로 형질감염된 293T 세포 상에서 유동 세포분석에 의해 측정했다. 실험은 이러한 인간/닭 키메라 상의 비닝을 위한 적합성을 측정하기 위해 키친 캐드헤린19에 대한 항-CDH19 항체의 서브세트를 검정하는 것을 포함한다.

다음 결합 검정은 2mM CaCl2의 존재하에 완료했다. 96-웰 V-기저 플레이트(Costar 3897)에서, 50,000개의 일시적으로 형질감염된 293T 세포를 4℃에서 1시간 동안 5㎍/ml의 정제된 항-CDH19 항체로 배양한 후 PBS/2% FBS로 2회 세척했다. 이어서, 50㎕의 5㎍/ml Alexa647-표지된 항-인간 IgG 2차 항체(Jackson Immuno 109-605-098) 및 2㎍/ml 7AAD(Sigma A9400)를 각 웰에 첨가하고, 플레이트를 4℃에서 15분 동안 배양했다. 이어서, 세포를 1회 세척하고, 세포 연관 Alexa647-표지된 Ab의 양을 유동 세포분석으로 정량화했다. 실험은 모의 형질감염된 대조군을 포함한다. 이들 실험으로부터 데이터는 이하 표에 제시하고, n.d.는 측정되지 않았음을 나타낸다.

항체 빈 C 에피토프 예측 개요

Hu EC1-5 Ck
EC1-5
Hu EC1 Hu
EC2
Hu
EC3
Hu
EC5
클론 ID Ab. ID A J K L M O 예측된 에피토프 영역
4A9 13589 1 + - + - - - 44-141
빈 A
26F12 13881 2 + - + - - -
25F8 14096 2 + - + - - -
26D1 13882 2 + - + - - -
17H8 13874 3 + - + - - -
16A4 14071 5 + - + - - -
4A2 13592 4 + - - - + - 250-364
빈 B
4B10 13590 4 + - - - + -
2G6 13588 4 + - - - + -
23A10 14077 4 + - - - + -
랫트 항-FLAG + + + + + + 대조군
양성 결합 (+)
음성 결합 (-)

범례 표 4

인간 및/또는 닭 키메라 작제물

A = huCDH19(44-772) (서열번호 944 참조)

J = ckCDH19(44-776) (서열번호 1451 참조)

K = huCDH19(44-141)::ckCDH19(142-776) (서열번호 1452 참조)

L = ckCDH19(44-141)::huCDH19(142-249)::ckCDH19(250-776) (서열번호 1453 참조)

M = ckCDH19(44-249)::huCDH19(250-364)::ckCDH19(365-776) (서열번호 1454 참조)

N = ckCDH19(44-364)::huCDH19(365-463)::ckCDH19(469-776) (서열번호 1455 참조)

O = ckCDH19(44-468)::huCDH19(464-772) (서열번호 1456 참조)

마카크/개 또는 랫트/마카크 캐드헤린-19 키메라에 의한 에피토프 예측

도메인 결합은 천연 붉은털 원숭이 또는 개과 CDH19 리더 서열 및 플래그 태그가 즉시 선행된 pTT5 발현 벡터로 클로닝된 개 캐드헤린19 골격에서 붉은털 원숭이 마카크 CDH19 캐드헤린 반복 도메인 1 또는 세그먼트 도메인 1(지정된 EC1a, EC1b, EC1c) 치환 또는 붉은 털 원숭이 캐드헤린19 골격에서 랫트 CDH19 캐드헤린 반복 도메인 2 치환으로 이루어진 플라스미드로 일시적으로 형질감염된 293T 세포 상에서 유동 세포분석으로 측정했다. 실험은 이들 마카크/개 및 랫트/붉은털 원숭이 키메라 상의 비닝을 위한 적합성을 측정하기 위해 개, 랫트 및 마카크 캐드헤린 19에 대한 항-CDH19 항체의 서브세트를 검정함을 포함한다.

다음 결합 검정은 2mM CaCl2의 존재하에 완료했다. 96-웰 V-기저 플레이트(Costar 3897)에서, 50,000개의 일시적으로 형질감염된 293T 세포를 4℃에서 1시간 동안 5㎍/ml의 정제된 항-CDH19 항체로 배양한 후 PBS/2% FBS로 2회 세척했다. 이어서, 50㎕의 5㎍/ml Alexa647-표지된 항-인간 IgG 2차 항체(Jackson Immuno 109-605-098) 및 2㎍/ml 7AAD (Sigma A9400)를 각 웰에 첨가하고, 플레이트를 4℃에서 15분 동안 배양했다. 이어서, 세포를 1회 세척하고, 세포 연관 Alexa647-표지된 Ab의 양을 유동 세포분석으로 정량화했다. 실험은 모의 형질감염된 대조군을 포함한다. 이들 실험으로부터 데이터는 이하 표에 제시하고, n.d.는 측정되지 않았음을 나타낸다.

항체 빈A 에피토프 예측 개요

Rh EC1-5 Ca EC1-5 rh
EC1
rh
EC1a
rh
EC1b
ra
EC2
Ra
EC1-5
클론 ID Ab. ID P Q R S T V W 예측된 에피토프 영역
4A9 13589 1 + - + - - - - 44- 141 빈 A.1
26F12 13881 2 + - + + + - - 44- 141 빈 A.2
(44-114)
25F8 14096 2 + - + + + - -
26D1 13882 2 + - + + + - -
17H8 13874 3 + - + + - - - 44- 141 빈 A.3
(44-65)
16A4 14071 5 + - + + - n.d. +
4A2 13592 4 + - n.d. n.d. n.d. n.d. + 250-364
빈 B
4B10 13590 4 + + n.d. n.d. n.d. n.d. +
2G6 13588 4 + + n.d. n.d. n.d. n.d. +
23A10 14077 4 + + n.d. n.d. n.d. n.d. +
랫트 항-FLAG + + + + + + +
양성 결합 (+)
음성 결합 (-)
측정되지 않음 (n.d.)

범례 표 5

붉은털 원숭이 마카트, 개 및/또는 랫트 키메라 작제물

P = rhCDH19(44-772) (서열번호 1457 참조)

Q = caCDH19(44-770) (서열번호 1458 참조)

R = rhCDH19(44-141)::caCDH19(141-770) (서열번호 1459 참조)

S = rhCDH19(44-65)::caCDH19(65-770) (서열번호 1460 참조)

T = caCDH19(44-87)::rhCDH19(89-114)::caCDH19(115-770) (서열번호 1461 참조)

U = caCDH19(44-120)::rhCDH19(122-137)::caCDH19(137-770) (서열번호 1462 참조)

V = rhCDH19(44-141)::raCDH19(140-247)::rhCDH19(250-772) (서열번호 1463 참조)

W = raCDH19(44-770) (서열번호 1464 참조)

표 5에 요약된 데이터는 빈 A 44-141의 결합제를 다음 서브그룹으로의 분리를 가능하게 한다:

빈 A.1 44-141

빈 A.2 44-141 (44-114)

빈 A.3 44-141 (44-65)

랫트 /마우스 또는 인간/마우스 캐드헤린 -19 키메라에 의한 에피토프 예측

도메인 결합은 천연 마우스 CDH19 리더 서열 및 플래그 태그가 즉시 선행된 pTT5 발현 벡터로 클로닝된 마우스 캐드헤린19 골격에서 랫트 CDH19 캐드헤린 반복 도메인 3 치환(지정된 EC3a, EC3b) 또는 인간 CDH19 캐드헤린 반복 도메인 3 치환(지정된 EC3c)으로 이루어진 플라스미드로 일시적으로 형질감염된 293T 세포 상에서 유동 세포분석으로 측정했다. 실험은 이들 랫트/마우스 및 인간/마우스 키메라 상의 비닝을 위한 적합성을 측정하기 위해 인간, 랫트 및 마우스 캐드헤린 19에 대한 항-CDH19 항체의 서브세트를 검정함을 포함한다.

다음 결합 검정은 2mM CaCl2의 존재하에 완료했다. 96-웰 V-기저 플레이트(Costar 3897)에서, 50,000개의 일시적으로 형질감염된 293T 세포를 4℃에서 1시간 동안 5㎍/ml의 정제된 항-CDH19 항체로 배양한 후 PBS/2% FBS로 2회 세척했다. 이어서, 50㎕의 5㎍/ml Alexa647-표지된 항-인간 IgG 2차 항체(Jackson Immuno 109-605-098) 및 2㎍/ml 7AAD (Sigma A9400)를 각 웰에 첨가하고, 플레이트를 4℃에서 15분 동안 배양했다. 이어서, 세포를 1회 세척하고, 세포 연관 Alexa647-표지된 Ab의 양을 유동 세포분석으로 정량화했다. 실험은 모의 형질감염된 대조군을 포함한다. 이들 실험으로부터 데이터는 이하 표에 제시하고, n.d.는 측정되지 않았음을 나타낸다.

항체 빈 B 에피토프 예측 개요

Hu EC1-5 Mo EC1-5 Ra
EC1-5
Ra EC3c Ra EC3b Hu EC3a
클론 ID Ab. ID A I W X Y Z 예측된 에피토프 영역
4A9 13589 1 + - - n.d. n.d. n.d. 44-141
빈 A
26F12 13881 2 + - - n.d. n.d. n.d.
25F8 14096 2 + - - n.d. n.d. n.d.
26D1 13882 2 + - - n.d. n.d. n.d.
17H8 13874 3 + - - n.d. n.d. n.d.
16A4 14071 5 + - + n.d. n.d. n.d.
4A2 13592 4 + - + + - - 250-364 (324-327)
빈 B.2
4B10 13590 4 + - + + - -
2G6 13588 4 + + + + + + 250-364 빈 B.1
23A10 14077 4 + + + n.d. n.d. n.d.
랫트 항-FLAG + + + + + + 대조군
양성 결합 (+)
음성 결합 (-)
측정되지 않음 (n.d.)

범례 표 6

랫트/마우스 또는 인간/마우스 키메라 작제물

A = huCDH19(44-772) (서열번호 944 참조)

I = muCDH19(44-770) (서열번호 966 참조)

W = raCDH19(44-770) (서열번호 1464 참조)

X = muCDH19(44-323)::raCDH19(324-327)::muCDH19(328-770) (서열번호 1465 참조)

Y = muCDH19(44-770)::raCDH19(290,299,308) (서열번호 1466 참조)

Z = muCDH19(44-770)::huCDH19(271) (서열번호 1467 참조)

표 6에 요약된 데이터는 인간 및 마카크 CDH19 내의 잔기(326-329)에 상응하는 표 6에 참조된 설치류 번호지정에 의해 빈 B 250-364의 결합제를 다음 서브그룹으로의 분리를 가능하게 한다:

빈 B.1 250-364

빈 B.2 250-364 (324-327)).

실시예 4 - 핫스팟 /공변 돌연변이

총 18개 항체를 잠재적인 핫스팟 및 공분산 위반에 대해 분석했다. 설계된 변이체(이하 제시됨)는 이성체화, 탈이미드화, 산화, 공분산 위반 등을 감소시키고/시키거나 회피할 수 있는 아미노산 치환의 윤곽을 보여준다. 15개의 친(parent) 항체와 함께 80개의 조작된 변이체, 따라서 총 95개 서열을 클로닝, 발현 및 정제 프로세스로 진행시켰다. 부위 특이적 돌연변이유발은 96-웰 포켓에서 조작 변이체 상에서 수행했다. 친 항체 및 조작 변이체는 HEK 293-6E 세포에서 높은 처리량의 일시적 형질감염에 의해 발현시키고, 변형된 AKTA 오토-샘플러를 사용하여 정제하고, 활성 및 생물물리학적 특성에 대해 검정했다. 자유(쌍을 이루지 않음) Cys 또는 N-글리코실화 부위를 갖는 3개의 친 항체는 이 프로세스로 진행하지 않았다. 이들은 친 항체의 조작된 버젼으로 치환되었다. 설계된 변이체는 이성체화, 탈아미드화, 산화, 공분산 위반, 면역원성 등을 감소시키고/시키거나 회피할 수 있는 아미노산 치환의 윤곽을 보여준다. 이러한 변이체 서열은 본 발명의 의미 내의 조작된 항체의 예이지만, 단일 점 및/또는 복수 점 돌연변이는 최종적인 목적하는 결합 분자 또는 항체에 도달하기 위해 임의의 조합 방식으로 조합할 수 있다.

실시예 5 - CDH19 mRNA 발현 패턴

RNA는 종양(세포수에 의한 종양 함량 >70%) 또는 정상(세포수에 의한 종양 함량 0%)을 나타내는 개개의 환자 조직으로부터 추출했다. 개별 조직은 티슈라이저(TisssueLyzer)(Qiagen, Valencia, CA)를 사용하여 균질화하고, 총 RNA를 추출하고, mirVana 총 RNA 추출 키트(Life Technologies, Foster City, CA)로 정제했다. RNA 품질 및 양은 나노드롭(NanoDrop)(NanoDrop, Wilmington, DE) 분광광도계 판독 및 바이오어날라이저(Bioanalyzer) RNA 프로파일링(Agilient Technologies, Santa Clara, CA)으로 확인했다. RNA는 DNA-부재 키트(Life Technologies, Foster City, CA)로 처리되고 고용량 cDNA 역전사 키트(Life Technologies, Foster City, CA) 중 랜덤 헥사머를 사용하여 제조업자의 사양에 따라서 역전사시킨 DNAse였다. 정량적 실시간 폴리머라제 연쇄 반응(qRT-PCR)은 CDH19, 프로브세트 Hs00253534_m1, (Life Technologies, Foster City, CA) 또는 항존 유전자 인간 ACTB(프라이머 CCT GGC ACC CAG CAC AA; GCC GAT CCA CAC GGA GTA CT; 프로브 ATC AAG ATC ATT GCT CCT CCT GAG CG)에 대한 프라이머를 사용하여 cDNA 상에서 수행했다. 10μL qRT-PCR 반응 성분; 1.0 ng/μL cDNA, 2x범용 PCR 마스터 믹스(Life Technologies, Foster City, CA), 유전자 발현 검정(ACTB; 75 nM 프라이머, 150 nM 프로브. EPOR; 300 nM 프라이머, 250 nM 프로브) qRT-PCR 증폭 프로그램: (1) 50℃에서 2분 동안 활성화; (2) 95℃에서 10분 동안 변성; (3) 각 단계(ABI PRISM 7900HT 서열 검출 시스템즈, Applied Biosystems)에서 형광 포획으로 95℃에서 15초 동안 및 60℃에서 1분 동안 40회 사이클 증폭을 따른다. 임계 사이클 값(CT)은 서열 검출기 소프트웨어 버전 2.3(Applied Biosystems)을 사용하여 측정하고, ACTB에 대한 CDH19 특이적 전사물의 상대적 발현을 위해 2-△CT로 변환시켰다. 결과는 도 3에 제시한다. 54개의 독특한 전이성 및 원발성 흑색종 샘플 중, 대다수는 정상 조직으로부터 샘플 중의 발현에 대해 CDH19 mRNA를 과발현한다는 것을 알 수 있다.

실시예 6 - CDH19 단백질 발현

CDH19 단백질의 발현은 IHC에 의해 인간 종양 샘플에서 분석하고, 결과는 도 4에 제시한다. 샘플을 10% 중성 완충 포르말린으로 24시간 동안 고정시키고, 탈수하고, 파라핀 매립했다. 4㎛ 단편을 절단했다. 단편들을 먼저 탈파라핀화한 다음, 항원 회복을 위해 40분 동안 디바 데클로아커(DIVA Decloaker) 용액(Biocare)으로 가열했다. 나머지 IHC 단계는 실온에서 다코 자동염색기(DAKO Autostainer)로 수행했다. 단편들은 내인성 퍼옥시다제를 차단하기 위해 퍼옥시다제 1(Biocare)로 10분 동안 배양한 다음, 비특이적 배경을 감소시키기 위해 배경 스나이퍼(Biocare)로 10분 동안 배양했다. 단편은 CDH19 항체(Novo Biologicals, Catalog #H00028513-B01P)를 사용하여 5㎍/ml로 60분 동안 배양한 다음, 30분 동안 Envision+ HRP 항-마우스 중합체(DAKO), 이어서 DAB+ (DAKO)로 5분 동안 배양했다. 단편들은 약 1분 동안 헤마톡실린(DAKO)으로 대비염색했다. CDH19 발현은 시험된 종양의 62%에서 검출될 수 있었다(162개 샘플 중 101개에서 염색 강도 ≥1+). 종양 샘플의 51%는 중간 내지 고발현을 나타냈다(162개 샘플 중 83개에서 염색 강도 2+ 내지 3+). 일부 종양에서 이질성이 지적되었지만, CDH19는 많은 샘플에서 치밀하고 명확한 막 염색을 나타냈다.

실시예 7 - 모델 세포주의 선택

종양 세포주는 인간 종양과 유사한 CDH19 발현을 갖는 모델 시스템을 동정하기 위해 유동 세포분석 및 IHC로 분석했다. 인간 항-huCDH19 IgG4 항체 4A2는 하이브리도마 조정 배지로부터 직접 정제했다. 유동 세포분석을 위해, 2x105 세포를 1:1 비로 PE에 접합된 200nM의 CDH19 4A2 항체로 배양했다. 배양 및 후속적 세척 단계는 1.2mM 칼슘의 존재하에 수행했다. 4개 레벨의 PE(BD, cat# 340495)를 갖는 QuantiBRITE PE 동결건조된 비드의 튜브를 제조업자의 지침에 따라 동시에 제조했다. 비드는 표준 곡선을 생성하기 위해 유동 세포분석으로 분석했다. 이어서, FACS 분석 후 흑색종 주로부터 수득된 PE 중간 값을 각 세포 상의 수용체의 수의 추정을 제공하는 세포당 결합된 항체(ABC)를 계산하기 위해 표준 곡선에 대해 보정했다. IHC를 실시예 6에 기술된 바와 같이 수행하고, 결과를 도 5에 제공한다. 흑색종 세포주 CHL-1은 세포 표면 위에 약 10,000개 CDH19 분자를 발현시키는 반면, Colo699 세포는 약 5,000개 수용체를 발현시킨다. 두 세포주는 IHC에 기초하는 중간 내지 고발현 수준을 갖는 종양을 나타낸다. A2058에서 발현은 매우 낮은 반면, LOX 세포는 임의의 검출가능한 CDH19 단백질을 발현시키지 않는다.

실시예 8

이중특이적 결합 및 종간 교차-반응성

인간 CDH19 및 인간 및 마카크 CD3에 대한 결합을 확인하기 위해, 이중특이적 항체를 지시된 세포주를 사용하여 유동 세포분석으로 시험했다. 인간 CDH19, 천연 인간 CDH19를 발현시키는 인간 흑색종 세포주 CHL-1 및 A2058, CD3-발현 인간 T 세포 백혈병 세포주 HPB-ALL(DSMZ, Braunschweig, ACC483) 및 CD3-발현 마카크 T 세포주 4119LnPx[참조: Knappe A, et al., Blood, 2000, 95, 3256-3261]로 형질감염된 L1.2를 항원 양성 세포주로서 사용했다. 또한, 형질감염되지 않은 L1.2 세포는 음성 대조군으로서 사용했다.

유동 세포분석을 위해, 각각의 세포주의 200,000개 세포는 50㎕의 정제된 이중특이적 항체를 사용하여 5㎍/ml의 농도로 아이스 상에서 30분 동안 배양했다. 세포를 PBS/2% FCS로 2회 세척하고, 작제물의 결합은 뮤린 펜타히스(PentaHis) 항체(Qiagen; 50㎕의 PBS/2% FCS 중에서 1:20으로 희석)로 검출했다. 세척 후, 결합된 펜타히스 항체는 PBS/2% FCS 중에서 1:100으로 희석된 피코에리트린에 접합된 Fc 감마-특이적 항체(Dianova)로 검출시켰다. 샘플을 FACSCanto II 장치 상에서 유동 세포분석으로 측정하고, FACSDiva 소프트웨어(둘 다 벡톤 딕킨슨(Becton Dickinson)으로부터)로 분석했다.

CDH19/CD3 이중특이적 항체는 인간 CDH19, 인간 CDH19-발현 흑색종 세포주 CHL-1 및 A2058 뿐만 아니라 인간 및 마카크 T 세포로 형질감염된 L1.2 세포를 염색했다. 또한, 형질감염되지 않은 L1.2 세포의 염색은 존재하지 않았다(참조: 도 6).

실시예 9

세포독성 활성

비자극된 인간 PBMC를 사용하는 FACS-기반 세포독성 검정

효과기 세포의 분리

인간 말초 혈액 단핵 세포(PBMC)는 수혈용 혈액을 수집하는 혈액 은행의 부생성물인 농축된 림프구 제제(예: 연막)로부터 피콜(Ficoll) 밀도 구배 원심분리로 제조했다. 연막은 국소 혈액 은행에 의해 공급되었고, PBMC는 혈액 수집과 같은 날에 제조했다. 피콜 밀도 원심분리 및 둘베코 PBS(Gibco)에 의한 광범위한 세척 후, 잔류하는 적혈구를 적혈구 용해 완충제(155mM NH4Cl, 10mM KHCO3, 100μM EDTA)로의 배양을 통해 PBMC로부터 제거했다. 혈소판은 100 × g에서 PBMC의 원심분리시 상청액을 통해 제거했다. 잔류하는 림프구는 주로 B 및 T 림프구, NK 세포 및 단구를 포함한다. PBMC는 10% FCS(Gibco)를 갖는 RPMI 배지(Gibco) 중에서 37℃/5% CO2에서 배양물에 유지시켰다.

CD14 + 및 CD56 + 세포의 고갈

CD14+ 세포의 고갈을 위해, 인간 CD14 마이크로비드(Milteny Biotec, MACS, #130-050-201)를 NK 세포 인간 CD56 마이크로비드(MACS, #130-050-401)의 고갈용으로 사용했다. PBMC를 계수하고, 실온에서 10분 동안 300 × g으로 원심분리했다. 상청액을 버리고, 세포 펠릿을 MACS 분리 완충제[80μL/107 세포; PBS(Invitrogen, #20012-043), 0.5% (v/v) FBS(Gibco, #10270-106), 2mM EDTA(Sigma-Aldrich, #E-6511)]에 재현탁시켰다. CD14 마이크로비드 및 CD56 마이크로비드(20μL/107 세포)를 첨가하고, 4 내지 8℃에서 15분 동안 배양했다. 세포를 MACS 분리 완충제(1 내지 2mL/107 세포)로 세척했다. 원심분리(상기 참조) 후, 상청액을 버리고, 세포를 MACS 분리 완충제(500μL/108 세포)에 재현탁시켰다. 이어서, CD14/CD56 음성 세포를 LS 컬럼(Miltenyi Biotec, #130-042-401)을 사용하여 분리시켰다. PBMC w/o CD14+/CD56+ 세포를 RPMI 완전 배지, 즉 10% FBS(Biochrom AG, #S0115), 1x 비필수 아미노산(Biochrom AG, #K0293), 10mM Hepes 완충제(Biochrom AG, #L1613), 1mM 나트륨 피루베이트(Biochrom AG, #L0473) 및 100U/mL 페니실린/스트렙토마이신(Biochrom AG, #A2213)이 보충된 RPMI1640(Biochrom AG, #FG1215)로 필요할 때까지 배양기 중에서 37℃에서 배양했다.

표적 세포 표지

유동 세포분석 검정에서 세포 용해의 분석을 위해, 형광 막 염료 DiOC18 DiO)(Molecular Probes, #V22886)를 사용하여 표적 세포로서 인간 CDH19-를 표지하고 이들을 효과기 세포와 구별했다. 간단하게, 세포를 수거하고, PBS로 1회 세척하고, 2%(v/v) FBS 및 막 염료 DiO(5μL/106 세포)를 함유하는 PBS에서 106 세포/mL로 조정했다. 37℃에서 3분 동안 배양 후, 세포를 완전 RPMI 배지로 2회 세척하고, 세포 수를 1.25 x 105 세포/mL로 조정했다. 세포의 활력은 0.5% (v/v) 등장성 에오신지(EosinG) 용액(Roth, #45380)을 사용하여 측정했다.

유동 세포분석 기반 분석

이 검정은 CDH19 이중특이적 항체의 일련의 희석물의 존재하에 인간 CDH19-형질감염된 CHO 세포의 용해를 정량화하기 위해 설계되었다.

동일 용적의 DiO-표지된 표적 세포 및 효과기 세포(즉, PBMC w/o CD14+ 세포)를 혼합하여 E:T 세포 비 10:1을 수득했다. 160μL의 이 현탁액을 96-웰 플레이트의 각 웰에 이동시켰다. 40μL의 DH19 이중특이적 항체의 일련의 희석물 및 추가의 음성 대조군으로서 음성 대조군 이중특이적(무관 표적 항원을 인식하는 CD3-기반 이중특이적 항체) 또는 RPMI 완전 배지를 첨가했다. 이중특이적 항체 매개된 세포독성 반응을 7% CO2 가습 배양기에서 48시간 동안 진행시켰다. 이어서, 세포를 새로운 96-웰 플레이트로 이동시키고, 표적 세포막 완전성의 상실은 요오드화프로피듐(PI)를 최종 농도 1㎍/mL로 첨가하여 모니터했다. PI는 일반적으로 생존 세포로부터 제외되는 막 불투과성 염료인 반면, 사멸 세포는 이를 흡수하여 형광 방출에 의해 식별가능하게 된다.

샘플은 FACSCanto II 장치 상에서 유동 세포분석으로 측정하였고, FACSDiva 소프트웨어(둘 다 벡톤 딕킨슨으로부터)로 분석했다.

표적 세포는 DiO-양성 세포로서 동정되었다. PI-음성 표적 세포는 살아있는 표적 세포로서 분류되었다. 세포독성의 백분율은 다음 식에 따라 계산했다:

Figure pct00002

그래프패드 프리즘 5 소프트웨어(Graph Pad Software, San Diego)를 사용하여, 세포독성의 백분율을 상응하는 이중특이적 항체 농도에 대해 플롯팅했다. 용량 반응 곡선은 고정 힐 경사를 갖는 s자형 용량 반응 곡선을 평가하기 위한 4개의 파라미터 로지스틱 회귀 모델로 분석하였고, EC50 값을 계산했다. 결과는 도 7에 제시한다.

실시예 10

생체내 종양 성장 억제 실험

500만개의 Colo699 또는 CHL-1 종양 세포를 250만개의 새로 분리된 말초 혈액 단핵 세포(PBMC)와 혼합하고, 0일차에 웅성 무흉선 누드 마우스의 왼쪽 옆구리에 피하 주사했다. 같은 날, 마우스를 지시된 용량으로 CDH19 BiTE 2G6 또는 비특이적 대조군 BiTE(MEC14)로 복강내 처리했다. 투여는 종양 접종 후 최초 10일 동안 매일 계속했다.

종양 용적 및 체중은 각각 캘리퍼스 및 분석 규모를 사용하여 1주 2회 측정했다.

Colo699 또는 CHL-1 종양 세포를 사용한 실험 결과는 도 8 및 9에 제시한다.

실시예 11

세포독성 활성

비자극 인간 T-세포를 사용한 화상계 세포독성 검정

효과기 세포

정제된 천연 인간 T 세포는 올셀즈 엘엘씨(AllCells LLC, Alameda, USA)로부터 입수했다.

화상 기반 분석

이 검정은 흑색종 세포의 T 세포 매개된 용해를 측정한다. 3000 A2058 세포(CDH19 양성) 또는 2500 LOX IMVI 세포(CDH19 음성)를 384 웰 플레이트의 웰에서 1:10의 비로 천연 인간 T 세포와 조합시킨다. BiTE 분자를 표적화하는 CDH19의 일련의 희석물 뿐만 아니라 이중특이적 음성 대조군(무관 표적 항원을 인식하는 CD3-계 이중특이적 항체)의 첨가 후, 세포를 37℃에서 48시간 동안 배양한다. 이어서, 샘플은 모든 세포의 핵을 염색하기 위해 30μM의 훽스트(Hoechst) 33342로 및 사멸 세포를 동정하기 위해 2μM 요오드화프로피듐(PI)으로 2시간 동안 처리했다.

화상 획득 및 분석은 10x 대물렌즈로 ThermoFisher ArrayScan 상에서 수행했다. 두 채널에 대한 데이터를 386nm(훽스트 33342) 및 549nm(요오드화프로피듐)에서 수집한다.

살아 있는 세포는 훽스트 양성, PI 음성 사상으로서, 사멸 세포는 훽스트 음성, PI 양성으로서 동정된다.

세포독성의 백분율은 실시예 7에 기재된 바와 같이 측정한다. 대표적인 결과는 도 10에 제시한다.

실시예 12

이중특이적 결합제의 도메인 특이성 및 생화학적 친화성 측정

번역후 변형이 결여된 CDH19 서브-도메인의 정제

G4S 링커 및 폴리-히스티딘 태그를 즉시 선행하는 CDH19 서브-도메인 단백질 A= huCDH19(서열번호 944의 140-367)를 코딩하는 뉴클레오티드 서열이 후속하는 메티오닌 개시 코돈을 적합한 pET 벡터로 클로닝하는 반면; 서브-도메인 단백질 B= huCDH19(서열번호 944의 44-367) 및 C= rhCDH19(서열번호 1457의 44-367)를 코딩하는 뉴클레오티드는 당해 기술 분야에 공지된 방법에 의해 pET-SUMO 벡터(Life Technologies, Invitrogen)로 클로닝했다. 각각은 이. 콜라이(E. coli)에서 발현시키고, 가용성 분획으로부터 분리시키고, 금속 킬레이트 친화성 크로마토그래피, 이어서 음이온 교환, 및 HEPES 완충된 식염수, 3mM CaCl2, pH 8 중의 크기 배제 크로마토그래피에 의해 균일성으로 정제시켰다. 서브-도메인 단백질 A는 이의 링커 및 C 말단 폴리히스티딘 태그를 유지시키지만, 단백질 B 및 C의 N 말단에 대한 His-SUMO 태그 성분은 음이온 교환 이전에 SUMO 프로테아제(Life Technologies, Invitrogen)에 의한 소화로 제거했다. 모든 단백질은 ESI LC/MS에 의해 이들의 예상된 분자량을 갖는 것으로 측정되었다. 이하 기재된 결합 실험에 사용된 단백질은 당해 기술 분야에 공지된 전형적인 방법에 의해 무작위로 비오티닐화했다.

번역후 변형을 갖는 CDH19 서브-도메인의 정제

각각 pSURETech235b 벡터(Selexis)로 클로닝된 G4S 링커 및 폴리-히스티딘 태그가 즉시 선행된 CDH19 서브-도메인 단백질 D= huCDH19(서열번호 944의 44-367), 및 E= rhCDH19(서열번호 1457의 44-367)는 각각의 아미노산 잔기 1-367을 코딩하는 뉴클레오티드 서열을 pSURETech235b 벡터(Selexis)로 코딩함으로써 생성하였고, CHO-S 세포(Life Technologies, Invitrogen)로 형질감염시키고, 안정한 풀은 당해 기술분야에 공지된 방법에 의한 하이그로마이신 선택에 따라 생성했다. 안정한 풀을 확장시키고, 조정 배지를 혈청 비함유 배지에서 7일 배양 후 수집했다. CM은 1평방피트 10K PES 펠리컨 2 막을 사용하여 UF/DF에 의해 5 다이아볼륨(diavolumes) HEPES 완충 식염수 + CaCl2로 교환하고, 상기한 바와 같이 균일성으로 정제했다. CDH19 서브-도메인 단백질 D 및 E는 구성 링커 및 C 말단 폴리히스티딘 태그를 유지시켰다. 각 단백질의 N 말단 서열은 예상된 바와 같이 G44인 것으로 측정된 반면, PNGase F 소화를 실시한 동일한 것과 비교하여 정제된 단백질의 ESI LC/MS는 N- 및 O-결합된 글리칸 둘 다의 존재를 나타냈다. 이하 기재된 결합 실험에 사용된 단백질은 당해 기술분야에 익히 공지된 방법에 의해 무작위로 비오티닐화했다.

옥테트에 의한 결합 친화성 측정 방법

옥테트 RED384 바이오센서를 단백질-단백질 상호작용의 동역학 및 친화성을 특성화하기 위해 사용했다. 최소 비오티닐화 CDH19 도메인 표적 단백질 A-E를 기계에서 스트렙타비딘 팁에 결합시키고, 그 동안 분석물 이중특이적 결합제 단백질의 일련의 희석물을 96-웰 또는 384-웰 플레이트 중에서 제조했다. 실험적 표적물 적재 조건은 2nm 신호를 제공하기 위해 10 내지 20nM 표적물 농도 및 600초 동안 적재인 것으로 밝혀졌다. 결합 실험은 컬럼당 2개의 참조 웰이 완충제만을 갖도록 하면서 각각의 분석물의 30nM 출발 농도로부터 6-점(표 7-9) 또는 3-점(표 10) 1:3 일련의 희석물로 플레이트를 설정함으로써 수행했다. 옥테트 완충제: 10mM HEPES (pH 7.5), 150mM NaCl, +/- 1mM CaCl2, 0.13% 트리톤(Triton) X-100 및 0.10mg/ml BSA. 플레이트 내의 추가의 기준선 및 해리 웰은 또한 완충제만을 함유했다. 결합 방법은 다음과 같다: ForteBio 옥테트 스트렙타비딘 팁을 (1) 10분 동안 완충제에 침지시키고; (2) 플레이트 기준선 웰로 이동시키고 5분 동안 배양하고; (3) 표적물 적재 웰로 이동시키고 10분 동안 배양하고; (4) 플레이트 기준선 웰로 이동시키고 5분 동안 배양하고; (5) 샘플 웰로 이동시키고 5분(표 9) 또는 20분(표 7, 8, 10) 동안 배양하고; (6) 해리 웰로 이동시키고 8.3분(표 9) 또는 1.5시간(표 7, 8, 10) 동안 배양했다. 미가공 데이터는 다음 방식으로 처리했다: (a) 참조 선단 곡선을 평균하고 샘플 곡선으로부터 차감하였고; (b) 회합 및 해리 곡선을 분리시키고, Y축으로 정렬시키고; (c) 회합 및 해리 단계간을 정렬시키고; (d) 사비츠키-골레이(Savitzky-Golay) 여과를 시행하여 신호 노이즈를 감소시키고, (e) 각 샘플-표적 상호작용에 대한 생성되는 회합 및 해리 곡선의 세트를 평행 해리 상수(KD)를 계산하기 위한 회합(Ka) 및 해리(Kd) 속도 상수의 측정된 값을 결정하기 위해 단일 1:1 결합 모델로 전세계적으로 적합화했다.

이중 특이적 결합제 대 번역후 변형이 결여된 분리된 인간 CDH19 단백질 도메인의 도메인 특이성 및 생화학적 친화성

A = huCDH19 (140-367) 이 콜라이 B = huCDH19 (44-367) 이 콜라이
클론 ID 이중특이적 결합제 ID KD (nM) ka
(M-1s-1 )
kd
(s-1)
KD (pM) ka
(M-1s-1)
kd
(s-1)
예측된 에피토프 영역
2G6 65254 < 0.03 3.37E +05 < 1.0E-05 < 0.04 2.31E +05 < 1.0E-05 250-364
빈 B.1
26F12 65251 (-) (-) (-) 0.20 3.86E +05 7.56E -05 44-114
빈 A.2
(-) 음성 결합, 20분 회합, 1.5시간 해리

범례 표 7

번역후 변형이 결여된 인간CDH19 단백질 도메인

A = 이. 콜라이 발현된 huCDH19(서열번호 944의 140-367)

B = 이. 콜라이 발현된 huCDH19(서열번호 944의 44-367)

표 7에 개략된 데이터는 이중특이적 결합제의 CDH19 에피토프 영역 특이성을 확인하고, 이들의 상대적 친화성 순위를 허용한다.

이중특이적 결합제 대 번역후 변형이 결여된 분리된 인간 및 마카크 CDH19 단백질 도메인의 칼슘 변조된 생화학적 친화성

B=huCDH19(44-367) 이. 콜라이 C = rhCDH19(44-367) 이. 콜라이
클론 ID, 피토프 빈 이중특이적 결합제 ID KD (nM) ka
(M-1s-1)
kd
(s-1)
KD (nM) ka
(M-1s-1)
kd
(s-1)
CaCl 2
2G6, 빈 B.1 65254 < 0.06 1.66E+05 < 1.0E-05 < 0.03 2.97E+05 < 1.0 E-05 1mM
26F12, 빈 A.2 65251 0.31 2.91E+05 9.0E-05 0.17 8.19E+05 1.36E -04 1mM
2G6, 빈 B.1 65254 (-) (-) (-) (-) (-) (-) 부재
26F12, 빈 A.2 65251 2.56 1.21E+05 3.08E-04 1.16 4.68E+05 5.44E -04 부재
(-) 음성 결합, 20분 회합, 1.5시간 해리

범례 표 8

번역후 변형이 결여된 CDH19 단백질 도메인

B = 이. 콜라이 발현된 huCDH19(서열번호 944의 44-367)

C = 이. 콜라이 발현된 rhCDH19(서열번호 1457의 44-367)

표 8에 개략된 데이터는 이중특이적 결합제의 칼슘 감수성의 측정 및 이들의 상대적 친화성 순위를 가능하게 한다. 데이터는 추가로 입체구조 에피토프를 시사하고, 빈 B.1이 에피토프 빈 A.2보다 CDH19/Ca2+에 더 의존적이다.

이중특이적 결합제 대 번역후 변경이 결여된 분리된 인간 및 마카크 CDH19 단백질 도메인

B = huCDH19 (44-367) 이. 라이 C = rhCDH19(44-367) 이. 콜라이
클론 ID 이중특이적 결합제 ID KD (nM) ka
(M-1s-1)
kd
(s-1)
KD (nM) ka
(M-1s-1)
kd
(s-1)
2G6 65254 < 0.3 3.11E +05 < 1.0E-04 < 0.3 3.69E+05 < 1.0E-04
2G6.001 65254.001 < 0.4 2.21E +05 < 1.0E-04 < 0.4 2.42E+05 < 1.0E-04
2G6.003 65254.003 < 0.5 1.80E +05 < 1.0E-04 < 0.5 1.91E+05 < 1.0E-04
2G6.007 65254.007 0.57 2.95E +05 1.69E-04 0.55 3.53E+05 1.94E-04
4A2.002 65238.002 < 0.2 5.48E +05 < 1.0E-04 < 0.1 9.13E+05 < 1.0E-04
4B10.002 65240.002 < 0.2 5.02E +05 < 1.0E-04 < 0.1 7.48E+05 < 1.0E-04
4B10.003 65240.003 < 0.2 3.87E +05 < 1.0E-04 < 0.2 5.06E+05 < 1.0E-04
4B10.005 65240.005 < 0.2 4.41E +05 < 1.0E-04 < 0.2 6.00E+05 < 1.0E-04
19B5.1.002 65235.002 1.74 3.74E +05 6.49E-04 1.02 4.94E+05 5.02E-04
19B5.1.003 65235.003 2.44 3.09E +05 7.54E-04 1.63 3.97E+05 6.45E-04
23A10.001 (B1) 65237.001 < 0.4 2.55E +05 < 1.0E-04 < 0.3 3.16E+05 < 1.0E-04
23A10.001 (B2) 65237b.001 0.57 2.95E +05 1.69E-04 0.55 3.53E+05 1.94E-04
23A10.002 65237.002 < 0.3 2.86E +05 < 1.0E-04 < 0.3 3.61E+05 < 1.0E-04
26D1.1.003 65250.003 0.66 3.64E +05 2.41E-04 0.50 5.20E+05 2.62E-04
26D1.1.004 65250.004 1.08 3.39E +05 3.67E-04 0.65 4.66E+05 3.02E-04
26D1.1.005 65250.005 2.65 3.19E +05 8.44E-04 1.42 4.42E+05 6.25E-04
26F12.002 65251.002 0.97 3.25E +05 3.16E-04 1.70 4.33E+05 7.36E-04
26F12.004 65251.004 1.04 2.90E +05 3.00E-04 1.85 3.46E+05 6.38E-04
26F12.006 65251.006 3.96 4.10E +05 1.62E-03 5.39 5.95E+05 3.21E-03
26F12.008 65251.008 3.77 4.87E +05 1.84E-03 5.14 7.45E+05 3.83E-03
1mM CaCl 2 , 5분 회합, 8.3분 해리

범례 표 9

번역후 변형이 결여된 CDH19 단백질 도메인

B = 이. 콜라이 발현된 huCDH19(서열번호 944의 44-367)

C = 이. 콜라이 발현된 rhCDH19(서열번호 1457의 44-367)

표 9에 개략된 데이터는 이중특이적 결합제 대 글리코실화가 결여된 인간 및 비인간 영장류 CDH19 도메인의 상대적 친화성 순위를 가능하게 한다.

이중특이적 결합제 대 분리된 글리코실화 인간 및 마카크 CDH19 단백질 도메인의 칼슘 변조된 생화학적 친화성

D = huCDH19(44-367) CHO E = rhCDH19(44-367) CHO
클론 ID, 에피토프 빈 이중특이적 결합제 ID KD (nM) ka
(M-1s-1)
kd
(s-1)
KD (nM) ka
(M-1s-1)
kd
(s-1)
CaCl 2
2G6, 빈 B.1 65254 < 0.041 2.44E+05 < 1.0E-05 < 0.031 3.19E+05 < 1.0E-05 1mM
2G6.003, 빈 B.1 65254.003 < 0.099 1.01E+05 < 1.0E-05 < 0.09 1.10E+05 < 1.0E-05 1mM
4B10 .003, 빈 B.2 65240.003 0.24 2.08E+05 4.91E-05 0.29 2.70E+05 7.88E -05 1mM
19B5 .1.003, 빈 A.2 65235.003 1.01 4.02E+05 4.07E-04 0.27 7.12E+05 1.93E -04 1mM
23A10.002, 빈 B.1 65237.002 < 0.036 2.75E+05 < 1.0E-05 < 0.035 2.82E+05 < 1.0E-05 1mM
26D1 .1.005, 빈 A.2 65250.005 0.97 3.13E+05 3.04E-04 0.37 4.64E+05 1.74E -04 1mM
26F12, 빈 A.2 65251 0.28 5.28E+05 1.50E-04 0.22 8.72E+05 1.94E -04 1mM
26F12.006, 빈 A.2 65251.006 1.24 4.92E+05 6.07E-04 1.13 6.94E+05 7.86E -04 1mM
2G6, 빈 B.1 65254 (-) (-) (-) (-) (-) (-) 부재
2G6.003, 빈 B.1 65254.003 (-) (-) (-) (-) (-) (-) 부재
4B10 .003, 빈 B.2 65240.003 (-) (-) (-) (-) (-) (-) 부재
19B5 .1.003, 빈 A.2 65235.003 3.49 2.90E+05 1.01E-03 3.28 2.65E+05 8.68E -04 부재
23A10.002, 빈 B.1 65237.002 (-) (-) (-) (-) (-) (-) 부재
26D1 .1.005, 빈 A.2 65250.005 0.86 4.12E+05 3.56E-04 2.58 3.26E+05 8.41E -04 부재
26F12, 빈 A.2 65251 1.91 2.66E+05 5.09E-04 1.09 5.38E+05 5.88E -04 부재
26F12.006, 빈 A.2 65251.006 0.79 6.29E+05 4.95E-04 18.53 3.36E+05 6.22E -03 부재
(-) 음성 결합, 20분 회합, 1.5시간 해리

범례 표 10

글리코실화 CDH19 단백질 도메인

D =CHO 발현된 huCDH19(서열번호 944의 44-367)

E = CHO 발현된 rhCDH19(서열번호 1457의 44-367)

표 10에 개략된 데이터는 이중특이적 결합제의 칼슘 감수성의 측정 및 글리코실화 인간 및 비인간 영장류 CDH19 도메인 단백질에 대한 상대적 친화성 순위를 가능하게 한다. 표 8의 데이터와 비교하여, 친화성은 번역후 변형이 결여된 도메인의 것과 유사하다. 데이터는 추가로 입체구조 에피토프를 시사하고, 에피토프 빈 B.1 및 B.2가 에피토프 빈 A.2보다 CDH19/Ca2+ 회합에 더욱 의존적이다.

실시예 13

이중특이적 결합 및 종간 교차-반응성:

인간 CDH19 및 인간 CD3에 대한 결합을 확인하기 위해, 이중특이적 항체는 지시된 세포주를 사용하여 유동 세포분석에 의해 시험했다. 인간 CDH19(실시예 14 참조) 및 CD3-발현 인간 T 세포 백혈병 세포주 HPB-ALL(DSMZ, Braunschweig, ACC483)로 형질감염시킨 HEK293을 항원 양성 세포주로서 사용했다.

유동 세포분석을 위해 개개 세포중의 200,000개 세포는 100㎕의 BiTE 함유 세포 배양 상청액과 함께 아이스 상에서 30분 동안 배양했다. 세포를 PBS/2% FCS에서 2회 세척하고, 작제물의 결합을 뮤린 항-CD3scFv 항체(3E5.A5, Amgen; 2㎍/ml PBS/2% FCS로 희석)으로 검출했다. 세척 후, 결합된 항-CD3scFv 항체를 PBS/2% FCS에서 1:100으로 희석한 피코에리트린에 접합된 Fc 감마-특이적 항체(Dianova)로 검출했다. 샘플은 FACSCanto II 장치 상에서 유동 세포분석에 의해 측정하고, FACSDiva 소프트웨어(둘 다 Becton Dickinson사 제품)로 분석했다.

CDH19/CD3 이중특이적 항체 염색된 HEK293 세포를 인간 및 마카크 T 세포 뿐만 아니라 인간 CDH19로 형질감염시켰다(도 19 참조).

실시예 14

세포독성 활성

자극된 인간 T 세포를 사용한 크롬 방출 검정

효과기 세포의 분리

페트리 접시(145mm 직경, Greiner bio-one GmbH, Kremsmunster)를 상업적으로 시판되는 항-CD3 특이적 항체(OKT3, Orthoclone)를 사용하여 1㎍/ml의 최종 농도로 1시간 동안 37℃에서 코팅했다. 결합되지 않은 단백질은 PBS를 사용한 1회 세척 단계에 의해 제거했다. 3 내지 5×107 인간 PBMC를 안정화된 글루타민/10% FCS/IL-2 20U/ml(Proleukin?, Chiron)와 함께 120ml의 RPMI 1640에서 코팅전 페트리 접시에 첨가하고, 2일 동안 자극시켰다. 3일차에, 세포를 수집하고, RPMI 1640으로 1회 세척했다. IL-2를 20U/ml의 최종 농도로 첨가하고, 세포를 상기와 동일한 세포 배양 배지에서 1일 동안 다시 배양했다.

CD4 + 및 CD56 + 세포의 고갈

CD8+ 세포독성 T 림프구(CTL)는 제조업자의 프로토콜에 따라 다이날-비드(Dynal-bead)를 사용하여 CD4+ T 세포 및 CD56+ NK 세포의 고갈에 의해 농축시켰다.

51 Cr 방출 기반 분석

인간 CDH19-형질감염된 HEK293 표적 세포(제조는 실시예 14 참조)를 PBS로 2회 세척하고, 60분 동안 37℃에서 50㎕ 보충된 RPMI의 최종 용적으로 11.1 MBq 51Cr로 표지했다. 이어서, 표지된 표적 세포를 5ml RPMI로 3회 세척한 다음, 세포독성 검정에 사용했다. 검정은 200㎕ 보충된 RPMI의 최종 용적으로 10:1의 E:T 비로 96-웰 플레이트에서 수행했다. 출발 농도 0.1 내지 1㎍/ml의 정제된 이중특이적 항체 및 이의 3배 희석물을 사용했다. 검정을 위한 배양 시간은 18시간이었다. 세포독성은 최대 용개(트리톤-X의 첨가) 및 자발적 용해(효과기 세포 부재하) 사이의 차이와 비교하여 상청액 중의 방출된 크롬의 상대 농도로서 측정했다. 모든 측정은 4회 수행했다. 상청액 중의 크롬 활성의 측정은 위자드(Wizard) 3" 감마 계수기(Perkin Elmer Life Sciences GmbH, K?ln, Germany)에서 수행했다. 결과의 분석은 원도우용의 프리즘(Prism) 6으로 수행했다(버젼 6.02, GraphPad Software Inc., San Diego, California, USA). 시그모이드 용량 반응 곡선으로부터 분석 프로그램에 의해 계산된 EC50 값은 세포독성 활성의 비교를 위해 사용했다(도 20 참조).

실시예 15

BiTE 항체의 생성 및 정제

CDH19 BiTE 항체의 표준화 연구 규모 생성은 롤러 병에서 실시했다. 수거된 배양 상청액은 여과 후 고정 금속 친화성 크로마토그래피(IMAC) 포획 및 이어서 크기 배제 크로마토그래피(SEC)에 기반하여 2단계 BiTE 항체 정제에 제공했다.

15.1 BiTE 항체의 IMAC 포획 단계

유니콘(Unicorn?) 소프트웨어에 의해 조절되는 Akta? 익스플로러 시스템(Explorer Systems)(GE Healthcare)을 크로마토그래피에 사용했다. 고정화 금속 친화성 크로마토그래피(IMAC)는 제조업자에 의해 제공된 프로토콜에 따라 ZnCl2가 적재된 프락토겔(Fractogel) EMD 킬레이트(chelate?)(Merck, Darmstadt)를 사용하여 실시했다. 컬럼은 완충제 A(20mM 인산나트륨 완충제, 0.1M NaCl, 10mM 이미다졸, pH 7.2)로 평형화하고, 세포 배양 상청액(1000ml)은 4ml/분의 유속에서 컬럼(10ml 팩킹 용적)에 적용했다. 컬럼을 완충제 A로 세척하여 결합되지 않은 샘플을 제거했다. 결합된 단백질은 하기 절차에 따라 완충제 B(20mM 인산나트륨 완충제, 0.1M NaCl, 0.5M 이미다졸, pH 7.2)의 2단계 구배를 사용하여 용출시켰다:

단계 1: 5 컬럼 용적 중의 10% 완충제 B

단계 2: 5 컬럼 용적 중의 100% 완충제 B

단계 2로부터의 용출된 단백질 분획을 추가 정제를 위해 풀링하고, PES 막 및 10kDa의 분자량 컷-오프를 갖는 비바스핀(Vivaspin)(Sartorius-Stedim, Gottingen-Germany) 원심분리 장치를 사용하여 3ml 최종 용적으로 농축시켰다. 모든 화합물은 연구 등급의 것이고, 머크(Merck)(Darmstadt, Germany)로부커 구입했다. 도 11

15.2 BiTE 항체의 단백질_A 포획

유니콘(Unicorn?) 소프트웨어에 의해 조절된 Akta? 익스플로러 시스템(GE Life Sciences)을 크로마토그래피에 사용했다. 공유 결합된 단백질_A를 갖는 비드를 함유하는 친화성 컬럼은 포획 단계에 사용했다. 컬럼은 평형 완충제(pH 7.4)로 평형화시키고, 세포 배양 상청액을 적용했다. 컬럼을 3 컬럼 용적의 평형 완충제로 세척하여 결합되지 않은 샘플을 세척 제거한 후, 결합된 BiTE 항체는 pH 3.0에서 용출 완충제의 적용에 의해 용출시켰다. 용출 용액은 분획 수집기 중의 분별 튜브에 이미 함유된 트리스하이드록시메틸아민 트리스 용액(pH 8.0)에 의해 pH를 즉시 중화시켰다.

단계 2로부터 용출된 단백질 분획은 추가의 정제를 위해 풀링하고, PES 막 및 10kDa의 분자량 컷-오프를 갖는 비바스핀(Sartorius-Stedim, Gottingen-Germany) 원심분리 장치를 사용하여 3ml 최종 용적으로 농축시켰다. 모든 화합물은 연구 등급의 것이고, 머크(Darmstadt, Germany)사로부터 구입했다. 도 12

15.3 크기 배제 크로마토그래피

크기 배제 크로마토그래피는 1ml/분의 유속에서 SEC 완충제(20mM NaCl, 30mM NaH2PO4, 100mM L-아르기닌, pH 7.0)로 평형된 HiLoad 16/60 수퍼덱스(Superdex) 200 프렙 등급 컬럼(GE Healthcare) 상에서 수행했다. BiTE 항체 단량체 및 이량체 분획을 풀링하고, 24% 트레할로즈 저장 용액을 첨가하여 4%의 최종 트레할로즈 농도에 도달시켰다. 용출된 단백질 샘플은 분석을 위해 환원 SDS-PAGE 및 항 His TAG 웨스턴 블롯에 제공했다.

단백질 풀은 1cm 광로(Eppendorf, Hamburg-Germany)를 사용하여 폴리카보네이트 큐벳에서 280nm에서 측정하고, 단백질 농도는 각각의 단백질에 대해 벡터 NTI 서열 분석 소프트웨어 산출 인자에 기반하여 계산했다.

BiTE 단량체 풀은 추가의 BiTE 제형 완충제(20mM NaCl, 30mM NaH2PO4, 100mM L-아르기닌, 4% 트레할로즈, pH 7.0)를 사용하여 250㎍/ml로 조정했다. 각각의 BiTE에 대해 최소 600㎍의 양을 취하고, 실시예 16에 기재된 즉시 단백질 분석을 위해 이동시켰다.

BiTE 항체 단량체 및 BiTE 항체 이량체의 나머지 단백질 풀은 15 및 50㎍ 단백질 분량으로 등분하고, 액체 질소에 충격 동결시켰다. 사용할 때까지의 추가 저장은 생물학적 활성 및 친화성 측정시까지 -80℃에서 수행했다. 도 13

분리된 BiTE 항체 단량체의 순도는 SDS-PAGE에 의해 >95%인 것으로 측정되었다. 예상된 바와 같이, 정제된 단량체 BiTE 항체는 54 내지 56kDa의 분자량 범위에서 단백질 밴드로서 나타났다. 도 14

실시예 16

단백질 특성

실시예 15에서 생성된 새롭게 제조한 BiTE 단량체 용액을 다음 분석 방법에 적용했다.

ㆍ 250㎍/ml 및 37℃에서 1주간 배양한 후 초기 단량체 CDH19 BiTE 항체의 고성능 크기 배제 크로마토그래피(HP-SEC)

ㆍ 3회 동결/해동 사이클에 의해 BiTE 단량체의 이량체로의 BiTE 단량체 전환, 이어서 HP-SEC

ㆍ 고분해능 분석 양이온 교환

ㆍ 세포로즈 옥틸 FF 매트릭스 상에서 소수성 상호작용 크로마토그래피

ㆍ 2500㎍/ml로 농축, 이어서 밤새 저장 및 혼탁도 측정

ㆍ 가열된 동적 광 산란 측정에 의한 응집 온도 TA 측정

16.1 7일 동안 배양에 의한 이량체로의 BiTE 단량체 전환

250㎍/ml의 농도로 15㎍의 단량체성 CDH19 BiTE 항체를 37℃에서 7일 동안 배양했다.

고분해능 SEC 컬럼 TSK 겔 G3000 SWXL(Tosoh,Tokyo-Japan)를 A905 오토샘플러가 장착된 Akta 정제기 10 FPLC(GE Lifesciences)에 접속시켰다. 100mM KH2PO4-200mM Na2SO4로 이루어진 컬럼 평형 및 작동 완충제는 pH 6.6으로 조정했다. 배양 7일 후, BiTE 항체 용액(15㎍ 단백질)을 평형 컬럼에 적용하고, 용출은 7MPa의 최대 압력에서 0.75ml/분의 유속으로 수행했다. 전체 작동은 280, 254 및 210nm 광학 흡광도에서 모니터링했다. 분석은 Akta 유니콘 소프트웨어 실행 평가 시트에서 기록된 210nm 신호의 피크 적분에 의해 수행했다. 이량체 함량은 이량체 피크의 면적을 단량체 및 이량체 피크의 전체 면적으로 나누어 계산했다. 도 15

16.2. 3회 동결/해동 사이클에 의한 이량체로의 BiTE 단량체 전환

250㎍/ml에서 15㎍의 단량체성 BiTe 항체를 30분 동안 -80℃에서 동결시킨 다음, 실온에서 30분 동안 해동시켰다. 3회의 동결/해동 사이클 후, 이량체 함량은 실시예 16.1에 기재된 바와 같이 HP-SEC에 의해 측정했다. 도 16

CDH19 BiTE CH19 2G6 302 × I2C SA21: 0.50% 이량체 함량

16.3 고분해능 분석 이온 교환 크로마토그래피

고체 비드에 커플링된 설프프로필 그룹을 갖는 YMC(YMC Europe GmbH, Dinslaken-Germany)에 의해 제조된 1ml BioPro SP 컬럼을 Akta 마이크로 FPLC(GE Healthcare) 장치에 접속했다.

컬럼 평형, 샘플 희석 및 세정을 위해, 수산화나트륨으로 pH 5.5로 조정된 20mM 인산이수소나트륨 및 30mM 염화나트륨으로 이루어진 완충제를 사용했다.

용출을 위해, 수산화나트륨으로 pH 5.5로 조정된 20mM NaH2PO4 및 1000mM NaCl로 이루어진 완충제를 사용했다.

50㎍의 BiTE 항체 단량체를 50ml 최종 용적으로 희석 완충제로 희석시켰다.

컬럼 평형 후, 40ml의 희석 단백질 용액을 컬럼에 적용한 다음, 세척 단계에 적용했다.

용출은 200 컬럼 용적에 상응하는 전체 용적에 걸쳐 0 내지 100의 용출 완충제로 꾸준하게 증가하는 구배에 의해 수행했다. 전체 작동은 280(청색 라인) 및 254nm(적색 라인) 광학 흡광도에서 모니터링했다.

주요 피크의 비율은 주요 피크의 피크 면적으로 모든 검출된 피크의 피크 면적의 합계로 나눈 다음 계수 100을 곱하여 계산했다. 도 17

CDH19 BiTE CH19 2G6 302 × I2C SA21: 89.3% 주요 피크 비율

16.4 세파로즈 옥틸 FF

단량체 BiTE 항체의 용출은 1ml 겔 용적을 갖는 소수성 상호작용 크로마토그래피 C8 세파로즈 옥틸 FF 컬럼(GE Healthcare) 상에서 평가했다.

50㎍의 BiTE 항체 단량체 단백질을 완충제(10mM 시트르산 - 75mM 리신 × HCl - 4% 트레할로즈 - pH 7.2)로 300㎕의 최종 용적으로 충전시켰다. 컬럼을 Akta 정제기 10 시스템(GE Healthcare)에 접속시켰다. 500㎕ 샘플 루프를 시스템에 접속시켰다. 시스템 및 컬럼은 작동 완충제(10mM 시트르산 - 75mM 리신 × HCl - 200mM NaCl - pH 7.2)로 평형화시켰다.

완전 샘플은 샘플 루프에 주입하고, 샘플 루프의 내용물을 컬럼에 적용했다. 샘플 주입 후, 10ml 용적의 작동 완충제를 0.2ml/분의 유속으로 컬럼에 적용하면서, 도전성과 함께 254 및 280nm에서의 광학 흡광도를 기록했다. 도 18

CDH19 BiTE CH19 2G6 302 × I2C SA21: 신속 및 완전 용출

16.5 2500㎍/ml까지 BiTE 단량체의 농축, 이어서 밤새 저장 및 혼탁도 측정

1000㎕의 CDH19 BiTE 단량체를 10kDa PES 막을 갖는 2개의 비바스핀(Vivaspin) 500 원심분리 장치(Sartorius-Stedim, G?ttingen-Germany)에서 100㎕의 최종 용적으로 농축시켰다. 이 용적을 밤새 5℃에서 냉각 캐비넷에서 저장했다. 혼탁도는 340nm 광학 파장 흡광도에서 3회 측정했다. 이어서, 3회 측정치의 평균 값을 계산했다.

CDH19 BiTE CH19 2G6 302 × I2C SA21의 OD340 혼탁도: 0.034

16.6 가열된 동적 광 산란 측정에 의한 응집 온도 TA 측정

250㎍/ml에서 40㎕ 용적의 단량체 BiTE 항체를 휴대가능한 플라스틱 큐벳의 내부 코어로 이동시켰다. 보다 깊게 위치한 외부 코어는 범용 BiTE 제형 완충제로 충전시켰다. 큐벳의 상부를 고무로 밀봉하여 샘플 가열의 프로세스에서 증발에 의한 액체 손실을 방지했다.

큐벳을 나노스타(Nanostar) 동적 광 산란 장치(Wyatt)에 넣고, 0.5℃/분의 가열 증분으로 40℃에서 70℃로 가열시켰다.

응집 상태는 영구적으로 모니터링하고, 전체 가열 프로세스에서 기록했다. 평가는 장치 제조업자에 의해 공급된 소프트웨어 팩키지로 실행했다.

CDH19 BiTE CH19 2G6 302 × I2C SA21의 응집 온도: 52.4℃

16.7 CysLoop를 사용한 BiTE 항체의 PEG화(PEGylation)

c-말단 CysLoop를 함유하는 단량체 BiTE 항체(체계 상세는 WO 2006/008096 참조)를 트리스/NaCl 완충제(pH 7.4)에 대해 투석하고, 새로 개봉한 CysLoop의 2개의 환원된 시스테인을 생성하기 위해 환원제 트리스(2-카복시에틸)포스핀 TCEP(Perbio Pierce)의 첨가에 의해 환원시켰다.

TCEP는 투석에 의해 제거했다. 환원된 시스테인에 결합할 수 있는 PEG 말레이미드를 몰 과량으로 첨가하고, 실온에서 3시간 동안 배양했다.

세파로즈 SP 컬럼 교환 컬럼(GE Healthcare)을 Akta FPLC 시스템에 접속시키고, 결합 완충제(pH 5.0의 낮은 몰농도 인산염/NaCl 완충제)로 평형화시켰다.

단백질 용액을 pH 5.0으로 조정된 결합 완충제로 희석하여 양이온 교환 컬럼에 대한 BiTE 단백질의 결합을 가능하게 했다. 결합되지 않은 PEG는 10개 컬럼 용적에 걸쳐 추가의 결합 완충제(pH 5.0)으로 세척 단계에서 제거했다. 결합된 단백질은 용출 완충제 20mM 인산염 1M NaCl의 선형 증가 비율에 의해 용출시켰다.

낮은 몰농도의 용출 완충제로 용출시킨 PEG화 BiTE 항체를 변형되지 않은 BiTE 항체와 비교했다.

서열 표:

Ia: 중쇄 CDR

Ab 유형 CDR 1 CDR 2 CDR 3
1D10
2C12
NA AGCTATGGCATGCAC GTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGGC AGGGCCGGTATAATAGGAACTACAGGCTACTACTACGGTATGGACGTC
서열번호 1 서열번호 2 서열번호 3
AA SYGMH VIWYDGSNKYYADSVKG RAGIIGTTGYYYGMDV
서열번호 4 서열번호 5 서열번호 6
1F10 NA AGTGGTGGTTACTACTGGAGC TACATCTATTACAGTGGGAGCACCTACTACAACCCGTCCCTCACGAGT GATGGAAGCAGTGGCTGGTACTTCCAGCAC
서열번호 7 서열번호 8 서열번호 9
AA SGGYYWS YIYYSGSTYYNPSLTS DGSSGWYFQH
서열번호 10 서열번호 11 서열번호 12
2C12_LC#1 NA AGCTATGGCATGCAC GTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGGC AGGGCCGGTATAATAGGAACTACAGGCTACTACTACGGTATGGACGTC
서열번호 13 서열번호 14 서열번호 15
AA SYGMH VIWYDGSNKYYADSVKG RAGIIGTTGYYYGMDV
서열번호 16 서열번호 17 서열번호 18
2G6_LC#1 NA AGCTATGGCATGCAC TTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGAC AGGGCCGGTATAATAGGAACTATAGGCTACTACTACGGTATGGACGTC
서열번호 19 서열번호 20 서열번호 21
AA SYGMH FIWYDGSNKYYADSVKD RAGIIGTIGYYYGMDV
서열번호 22 서열번호 23 서열번호 24
2G6 NA AGCTATGGCATGCAC TTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGAC AGGGCCGGTATAATAGGAACTATAGGCTACTACTACGGTATGGACGTC
서열번호 25 서열번호 26 서열번호 27
AA SYGMH FIWYDGSNKYYADSVKD RAGIIGTIGYYYGMDV
서열번호 28 서열번호 29 서열번호 30
2H12 NA AGCTATGGCATGCAC GTTATATGGTATGATGGAAGTAATAAATACTATACAGACTCCGTGAAGGGC AGGGCCGGTATAATAGGAACTACAGGCTACTACTACGGTATGGACGTC
서열번호 31 서열번호 32 서열번호 33
AA SYGMH VIWYDGSNKYYTDSVKG RAGIIGTTGYYYGMDV
서열번호 34 서열번호 35 서열번호 36
2H12_LC#2 NA AGCTATGGCATGCAC GTTATATGGTATGATGGAAGTAATAAATACTATACAGACTCCGTGAAGGGC AGGGCCGGTATAATAGGAACTACAGGCTACTACTACGGTATGGACGTC
서열번호 37 서열번호 38 서열번호 39
AA SYGMH VIWYDGSNKYYTDSVKG RAGIIGTTGYYYGMDV
서열번호 40 서열번호 41 서열번호 42
4A2
5B4
5C5
NA AGTAGTGGTTACTACTGGAGC TACATCTATTACACTGGGAGCGCCTACTACAACCCGTCCCTCAAGAGT GATGGAAGCAGTGGCTGGTACTTCCAGTAT
서열번호 43 서열번호 44 서열번호 45
AA SSGYYWS YIYYTGSAYYNPSLKS DGSSGWYFQY
서열번호 46 서열번호 47 서열번호 48
4A9 NA GGTTACTACTGGAGC TATTTCTCTTACAGTGGGAGCACCAACTACAACCCCTCCCTCAAGAGT AACTGGGCCTTCCACTTTGACTTC
서열번호 49 서열번호 50 서열번호 51
AA GYYWS YFSYSGSTNYNPSLKS NWAFHFDF
서열번호 52 서열번호 53 서열번호 54
4B10
4C2
NA AGCTATGACATGCAC GTTATATCATATGATGGAACTAATGAATACTATGCAGACTCCGTGAAGGGC GAACGATATTTTGACTGGTCTTTTGACTAC
서열번호 55 서열번호 56 서열번호 57
AA SYDMH VISYDGTNEYYADSVKG ERYFDWSFDY
서열번호 58 서열번호 59 서열번호 60
4D2 NA AGTTATGACATGCAC GTTATATCATATGATGGAACTAATGAATACTATGCAGACTCCGTGAAGGGC GAACGATATTTTGACTGGTCTTTTGACTAC
서열번호 61 서열번호 62 서열번호 63
AA SYDMH VISYDGTNEYYADSVKG ERYFDWSFDY
서열번호 64 서열번호 65 서열번호 66
4D3
4F3
NA AGCTATGACATGGAC GTTATATGGTATGATGGAAGTAATAAAtacTATGCAGACTCCGTGAGGGGC GAAACTGGGGAGGgCTGGTACTTCGAtctc
서열번호 67 서열번호 68 서열번호 69
AA SYDMD VIWYDGSNKYYADSVRG ETGEGWYFDL
서열번호 70 서열번호 71 서열번호 72
4E10 NA AGCTATGACATGCAC GTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGGC GAGTATAGGTACAGCTGGTACTTTGACTAC
서열번호 73 서열번호 74 서열번호 75
AA SYDMH VIWYDGSNKYYADSVKG EYRYSWYFDY
서열번호 76 서열번호 77 서열번호 78
4F7 NA AGTTACTCCTGGAGC TATATCTATTACAGTGGGAGCACCAACTACAACCCCTCCCTCAAGAGT AACTGGGCCTTCCACTTTGACTAC
서열번호 79 서열번호 80 서열번호 81
AA SYSWS YIYYSGSTNYNPSLKS NWAFHFDY
서열번호 82 서열번호 83 서열번호 84
5E3 NA AGCTATAGCATGCAC TCCATTAGTAGTAGTAGTAGTTACATATACTACGCAGACTCAGTGAAGGGC GGGGAAACTGGAACTAACTACTACTACTACGGTATGGACGTC
서열번호 85 서열번호 86 서열번호 87
AA SYSMH SISSSSSYIYYADSVKG GETGTNYYYYGMDV
서열번호 88 서열번호 89 서열번호 90
17H8
23B6
28D10
NA AGTTACTACTGGAGC TATATCTATTACATTGGGAGCACCAACTACAACCCCTCCCTCAAGAGT GATTCCCGGTATAGAAGTGGCTGGTACGATGCTTTTGATATC
서열번호 91 서열번호 92 서열번호 93
AA SYYWS YIYYIGSTNYNPSLKS DSRYRSGWYDAFDI
서열번호 94 서열번호 95 서열번호 96
16C1 NA GGTTACTACTGGAGC TATATCTATTACATTGGGAGCACCAACTACAACCCCTCCCTCAAGAGT GATGGGAGCAGTGGCTGGTACCGGTGGTTCGACCCC
서열번호 97 서열번호 98 서열번호 99
AA GYYWS YIYYIGSTNYNPSLKS DGSSGWYRWFDP
서열번호 100 서열번호 101 서열번호 102
16A4 NA AGTTACTACTGGAGC TATATCTATTACAGTGGGAGCACCAATTACAACCCCTCCCTCAAGAGT GATCAAAGGCGGATAGCAGCAGCTGGTACCCACTTCTACGGTATGGACGTC
서열번호 103 서열번호 104 서열번호 105
AA SYYWS YIYYSGSTNYNPSLKS DQRRIAAAGTHFYGMDV
서열번호 106 서열번호 107 서열번호 108
16E2
17E10
20B12
NA AGCTATGGCATGCAC GTGATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGGC GACGGGTGGGAGCTGTCCTTTGACTAC
서열번호 109 서열번호 110 서열번호 111
AA SYGMH VIWYDGSNKYYADSVKG DGWELSFDY
서열번호 112 서열번호 113 서열번호 114
22G10 NA AGTTATGCCATGAAC ACTATTAGTGGTGGTGGTGCTAACACATACTACGCAGACTCCGTGAAGGGC GGGGGAATGGGGGGATACTACTACGGTATGGACGTC
서열번호 115 서열번호 116 서열번호 117
AA SYAMN TISGGGANTYYADSVKG GGMGGYYYGMDV
서열번호 118 서열번호 119 서열번호 120
16H2
20D3
23E7
NA AGCTACTTTATTCAC ATAATCAACCCTATTAGTGTTAGCACAAGCTACGCACAGAAGTTCCAGGGC GGGGGGATACAGCTATGGTTACATTTTGACTAC
서열번호 121 서열번호 122 서열번호 123
AA SYFIH IINPISVSTSYAQKFQG GGIQLWLHFDY
서열번호 124 서열번호 125 서열번호 126
22D1 NA AGCTACTTTATTCAC ATAATCAACCCTATTAGTGTTAGCACAAGCTACGCACAGAAGTTCCAGGGC GGGGGGATACAGCTATGGTTACATTTGGACTAC
서열번호 127 서열번호 128 서열번호 129
AA SYFIH IINPISVSTSYAQKFQG GGIQLWLHLDY
서열번호 130 서열번호 131 서열번호 132
25F8 NA AGCTACTATATTCAC ATAATCAACCCCAGTGGTGGTAGCACAAGGTACGCACAGAAGTTCCAGGGC GGGGGAATACAGCTATGGTTACATTttGACTAC
서열번호 133 서열번호 134 서열번호 135
AA SYYIH IINPSGGSTRYAQKFQG GGIQLWLHFDY
서열번호 136 서열번호 137 서열번호 138
26F12
27B3
NA AACTACTATATGTCC ATAATCAACCCTAGTGGTGGTGACTCAACCTACGCACAGAAGTTCCAGGGC GGGGGGATACAACTATGGTTACATTTTGACTAC
서열번호 139 서열번호 140 서열번호 141
AA NYYMS IINPSGGDSTYAQKFQG GGIQLWLHFDY
서열번호 142 서열번호 143 서열번호 144
26D1 NA AGCTACTATATGTCC ATAATCCACCCTAGTGGTGGTGACACAACCTACGCACAGAAGTTCCAGGGC GGGGGGATAAAACTATGGTTACATTTTGACTAT
서열번호 145 서열번호 146 서열번호 147
AA SYYMS IIHPSGGDTTYAQKFQG GGIKLWLHFDY
서열번호 148 서열번호 149 서열번호 150
25G10 NA GGTTACTACTGGAGC TATATCTATTACATTGGGAGCACCAACTACAACCCCTCCCTCAAGAGT GATGGGAGCAGTGGCTGGTACCGGTGGTTCGACCCC
서열번호 151 서열번호 152 서열번호 153
AA GYYWS YIYYIGSTNYNPSLKS DGSSGWYRWFDP
서열번호 154 서열번호 155 서열번호 156
23A10 NA CGCTATGGCATACAC GTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGGC AGGGCCGGTATACCTGGAACTACGGGCTACTACTATGGTATGGACGTC
서열번호 157 서열번호 158 서열번호 159
AA RYGIH VIWYDGSNKYYADSVKG RAGIPGTTGYYYGMDV
서열번호 160 서열번호 161 서열번호 162
19B5 NA AGCTACTTTATTCAC ATTATCAACCCTATTAGTGTTAGCACAAGCTACGCACAGAAGTTCCAGGGC GGGGGGATACAGCTATGGTTACATTTGGACTAC
서열번호 163 서열번호 164 서열번호 165
AA SYFIH IINPISVSTSYAQKFQG GGIQLWLHLDY
서열번호 166 서열번호 167 서열번호 168

표 Ib: 경쇄CDR

Ab 유형 CDR 1 CDR 2 CDR 3
1D10
2C12
NA TCTGGAGATAGATTGGGGGAAAAATATACTTGC CAAGATACCAAGCGGCCCTCA CAGGCGTGGGACAGCAGCACTGTGGTA
서열번호 169 서열번호 170 서열번호 171
AA SGDRLGEKYTC QDTKRPS QAWDSSTVV
서열번호 172 서열번호 173 서열번호 174
1F10 NA AGGGCCAGTCGGAGTATTAGCAGCAGCTACTTAGCC GGTCCATCCAGCAGGGCCACT CAGCAGTATGGTAGCTCATTCACT
서열번호 175 서열번호 176 서열번호 177
AA RASRSISSSYLA GPSSRAT QQYGSSFT
서열번호 178 서열번호 179 서열번호 180
2C12_LC#1 NA AGGtCTAGTCAAAGcctcgtaTACAGTGATGGAAACAcctACTTGAAT AAGGTTTCTAACTGGGactct ATGCAAGGTATAGTGTGGCCGTGCAGT
서열번호 181 서열번호 182 서열번호 183
AA RSSQSLVYSDGNTYLN KVSNWDS MQGIVWPCS
서열번호 184 서열번호 185 서열번호 186
2G6_LC#1 NA AGGTCTAGTCAAAGCCTCGTATACAGTGATGGAAACACCTACTTGAAT CAGGTTTCTAACTGGGACTCT ATGCAAGATACACTGTGGCCGTGCAGT
서열번호 187 서열번호 188 서열번호 189
AA RSSQSLVYSDGNTYLN QVSNWDS MQDTLWPCS
서열번호 190 서열번호 191 서열번호 192
2G6 NA TCTGGAGATAGGTTGGGGGAAAAATATACTTGC CAAGATACCAAGCGGCCCTCA CAGGCGTGGGACAGCAGCACTGTGGTA
서열번호 193 서열번호 194 서열번호 195
AA SGDRLGEKYTC QDTKRPS QAWDSSTVV
서열번호 196 서열번호 197 서열번호 198
2H12 NA TCTGGAGATAGATTGGGGGAAAAATATACTTGC CAAGATACCAAGCGGCCCTCA CAGGCGTGGGACAGCAGCACTGTGGTA
서열번호 199 서열번호 200 서열번호 201
AA SGDRLGEKYTC QDTKRPS QAWDSSTVV
서열번호 202 서열번호 203 서열번호 204
2H12_LC#2 NA AGGTCTAGTCAAAGCCTCGTATACAGTGATGGAAACACCTACTTGAAT AAGGTTTCTAACTGGGACTCT ATGCAAGATACACTGTGGCCGTGCAGT
서열번호 205 서열번호 206 서열번호 207
AA RSSQSLVYSDGNTYLN KVSNWDS MQDTLWPCS
서열번호 208 서열번호 209 서열번호 210
4A2
5B4
5C5
NA AGGgcCAGTCGGAATATTAGCAGCAGCTACttaGCC GGTCCATCCAGCAGGGccaCT CAGCAGTATGGtagctCATTCACT
서열번호 211 서열번호 212 서열번호 213
AA RASRNISSSYLA GPSSRAT QQYGSSFT
서열번호 214 서열번호 215 서열번호 216
4A9 NA ACTGGGAGCAGCTCCAACATCGGGACAGGTTATGCTGTACAC GGTAACAACAATCGGCCCTCA CAGTCCTATGACAGCagACTGAGTGGTTGGGTG
서열번호 217 서열번호 218 서열번호 219
AA TGSSSNIGTGYAVH GNNNRPS QSYDSRLSGWV
서열번호 220 서열번호 221 서열번호 222
4B10
4C2
NA AGGGCCAGTCAGAGTGTTAGCAACACCTACTTAGCC GGTGCATCCAGCAGGGCCACT CAGCAGTACAGTAACTCgtgGACG
서열번호 223 서열번호 224 서열번호 225
AA RASQSVSNTYLA GASSRAT QQYSNSWT
서열번호 226 서열번호 227 서열번호 228
4D2 NA AGGGCCAGTCAGAGTGTTAGCAACACCTACTTAGCC GGTGCATCCAGCAGGGCCGCT CagcagTATAGTAacTcgtgGACG
서열번호 229 서열번호 230 서열번호 231
AA RASQSVSNTYLA GASSRAA QQYSNSWT
서열번호 232 서열번호 233 서열번호 234
4D3
4F3
NA AGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCC GGTGCATCCAGCAGGGCCACT CAGCAGTATGGTAGCTCGTGGACG
서열번호 235 서열번호 236 서열번호 237
AA RASQSVSSSYLA GASSRAT QQYGSSWT
서열번호 238 서열번호 239 서열번호 240
4E10 NA AGGGCCAGTCAGAGTGTTGGCAGCAGCTACTTAGCC GGTGCATCCAGCAGGGTCACT CAGCAATATAGTAACTCGTGGACG
서열번호 241 서열번호 242 서열번호 243
AA RASQSVGSSYLA GASSRVT QQYSNSWT
서열번호 244 서열번호 245 서열번호 246
4F7 NA ACTGGGAGCAGCTCCAATATCGGGACAGGTTATGATGTACAC GGTAACAGCAATCGGCCCTCA CAGTCCTATGACAGCAGTCTGAGTGGTTGGGTG
서열번호 247 서열번호 248 서열번호 249
AA TGSSSNIGTGYDVH GNSNRPS QSYDSSLSGWV
서열번호 250 서열번호 251 서열번호 252
5E3 NA TCTGGAGATAAATTGGGGGATGAATATGCTTGC CAAGATAGCAAGCGGCCCTCA CAGGCGTGGGACAGCAGCACTGTGGTA
서열번호 253 서열번호 254 서열번호 255
AA SGDKLGDEYAC QDSKRPS QAWDSSTVV
서열번호 256 서열번호 257 서열번호 258
17H8
23B6
28D10
NA AGGGCCAGTCAGAGTGTTGCCGGCAGCTACCTAGCC GGTGCATCCAGCAGGGCCACT CAGCAGTATGGTAAATCACCGATCACC
서열번호 259 서열번호 260 서열번호 261
AA RASQSVAGSYLA GASSRAT QQYGKSPIT
서열번호 262 서열번호 263 서열번호 264
16C1 NA AGGGCCAGCCAGAGTGTTAGCAGCAGCTACTTAGCC GGTGCATCCAGCAGGGCCACT CAGCAGTATGGTAACTCACCGCTCACT
서열번호 265 서열번호 266 서열번호 267
AA RASQSVSSSYLA GASSRAT QQYGNSPLT
서열번호 268 서열번호 269 서열번호 270
16A4 NA AGGGCCAGTCAGAGTGTTAGCAGCAGTTATTTAGCC GGTACATCCAGCAGGGCCACT CAGCAGTACGGTAGCTCACCTTTCACT
서열번호 271 서열번호 272 서열번호 273
AA RASQSVSSSYLA GTSSRAT QQYGSSPFT
서열번호 274 서열번호 275 서열번호 ***276
16E2
17E10
20B12
NA CGGGCGAGTCAGGGCATTAGCAATTATTTAGCC GCTGCATCCAGTTTGCAAAGT CAACACTATTTTACTTACCCTCGGACG
서열번호 277 서열번호 278 서열번호 279
AA RASQGISNYLA AASSLQS QHYFTYPRT
서열번호 280 서열번호 281 서열번호 282
22G10 NA AGGGCCAGTCAGAGTATTAGCAGCAACTTAGCC GGTGCATTTACCAGGGCCACT CAGCAGTATAATTACTGGCCGCTCACT
서열번호 283 서열번호 284 서열번호 285
AA RASQSISSNLA GAFTRAT QQYNYWPLT
서열번호 286 서열번호 287 서열번호 288
16H2
20D3
23E7
NA TCTGGAAGCAGCTCCAACATCGGAAGTAATTTTGTAAAC ACTAATAATCAGCGGCCCTCA GCAACATGGGATGACAGCCTGAATGGTTGGGTG
서열번호 289 서열번호 290 서열번호 291
AA SGSSSNIGSNFVN TNNQRPS ATWDDSLNGWV
서열번호 292 서열번호 293 서열번호 294
22D1 NA TCTGGAAGCAGCTCCAACATCGGAAGCAATTTTGTAAAC ACTAATAATCAGCGGCCCTCA GCAACATGGGATGACAGTATGAATGGTTGGGTG
서열번호 295 서열번호 296 서열번호 297
AA SGSSSNIGSNFVN TNNQRPS ATWDDSMNGWV
서열번호 298 서열번호 299 서열번호 300
25F8 NA TCTGGAAGCAGCTCCAACATCGGAAGGAATTTTGTAAAC ACTAATAATCAGCGGCCCTCA GCAGCATGGGATGACAGCCTGAATGGTTGGGTG
서열번호 301 서열번호 302 서열번호 303
AA SGSSSNIGRNFVN TNNQRPS AAWDDSLNGWV
서열번호 304 서열번호 305 서열번호 306
26F12
27B3
NA TCTGGAAGCCGCTCCAACATCGGAAGTAATTTTGTAAAC ACTAATTATCAGCGGCCCTCA GCAGTATGGGATGACAGCCTGAATGGTTGGGTG
서열번호 307 서열번호 308 서열번호 309
AA SGSRSNIGSNFVN TNYQRPS AVWDDSLNGWV
서열번호 310 서열번호 311 서열번호 312
26D1 NA TCTGGAAGCCGCTCCAACATCGGAAGTAATTTTGTAAAC ACTAATAATCAGCGGCCCTCA GCAGTATGGGATGACAGCCTGAATGGTTGGGTG
서열번호 313 서열번호 314 서열번호 315
AA SGSRSNIGSNFVN TNNQRPS AVWDDSLNGWV
서열번호 316 서열번호 317 서열번호 318
25G10 NA AGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCC GGTGCATCCAGCAGGGCCACT CAGCAGTATGGTAACTCACCGCTCACT
서열번호 319 서열번호 320 서열번호 321
AA RASQSVSSSYLA GASSRAT QQYGNSPLT
서열번호 322 서열번호 323 서열번호 324
23A10 NA TCTGGAGATAGATTGGGGGAGAAATATGTTTGC CAAGATAATAAGTGGCCCTCA CAGGCGTGGGACAGCAGcacTGTGGTA
서열번호 325 서열번호 326 서열번호 327
AA SGDRLGEKYVC QDNKWPS QAWDSSTVV
서열번호 328 서열번호 329 서열번호 330
19B5 NA TCTGGAAGCAGGTCCAACATCGGAAGCAATTTTGTAAAC ACTAATAATCAGCGGCCCTCA GCAACATGGGATGACAGTATGAATGGTTGGGTG
서열번호 331 서열번호 332 서열번호 333
AA SGSRSNIGSNFVN TNNQRPS ATWDDSMNGWV
서열번호 334 서열번호 335 서열번호 336

항- CDH19 가변 영역 아미노산 서열 및 폴리뉴클레오티드 서열

IIa: 중쇄 가변 영역 폴리뉴클레오티드 및 아미노산 서열

서열번호 명칭 공급원 유형 서열
337 17H8
23B6
28D10
인공 nt CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGACCCTGTCCCTCACGTGCACTGTCTCTGGTGGCTCCATCAATAGTTACTACTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGTATATCTATTACATTGGGAGCACCAACTACAACCCCTCCCTCAAGAGTCGCGTCACCATATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCTGCGGACACGGCCCTGTATTACTGTGCGAGAGATTCCCGGTATAGAAGTGGCTGGTACGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCA
338 17H8
23B6
28D10
인공 aa QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTALYYCARDSRYRSGWYDAFDIWGQGTMVTVSS
339 4A2
5B4
5C5
인공 nt CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCACAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGCAGTAGTGGTTACTACTGGAGCTGGATCCGCCAGCACCCAGGGAAGGGCCTGGAGTGGATTGGGTACATCTATTACACTGGGAGCGCCTACTACAACCCGTCCCTCAAGAGTCGAGTTACCATATCAGTAGACACGTCTAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACTGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGATGGAAGCAGTGGCTGGTACTTCCAGTATTGGGGCCAGGGCACCCTGGTCACCGTCTCCTCA
340 4A2
5B4
5C5
인공 aa QVQLQESGPGLVKPSQTLSLTCTVSGGSISSSGYYWSWIRQHPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYFQYWGQGTLVTVSS
341 16H2
20D3
23E7
인공 nt CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTTTCCTGCAAGGTTTCTGGATACACCTTCACCAGCTACTTTATTCACTGGGTGCGCCAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCAACCCTATTAGTGTTAGCACAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGGGACACGTCCACGAGCACAGTCTTCATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGCGAGGGGGGATACAGCTATGGTTACATTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA
342 16H2
20D3
23E7
인공 aa QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS
343 26F12
27B3
인공 nt CAGGTGCAGTTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTTTCCTGCAAGGCATCTAGATACACCTTCACCAACTACTATATGTCCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCAACCCTAGTGGTGGTGACTCAACCTACGCACAGAAGTTCCAGGGCAGACTCACCATGACCGGGGACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGAGAGGGGGGATACAACTATGGTTACATTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA
344 26F12
27B3
인공 aa QVQLVQSGAEVKKPGASVKVSCKASRYTFTNYYMSWVRQAPGQGLEWMGIINPSGGDSTYAQKFQGRLTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS
345 4B10
4C2
인공 nt CAGGTGCAGTTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTATGACATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATCATATGATGGAACTAATGAATACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACACTTCCAAGAACACGCTGTATTTGCAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTATATTACTGTGCGAGAGAACGATATTTTGACTGGTCTTTTGACTACTGGGGCCAGGGAACCCTGGTCAGTGTCTCCTCA
346 4B10
4C2
인공 aa QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVISYDGTNEYYADSVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERYFDWSFDYWGQGTLVSVSS
347 4D3
4F3
인공 nt CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCTCCTTCAGTAGCTATGACATGGACTGGGTCCGCCAGACTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAGGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTTTCTGCAAATGAACAGCCTGAGAGTCGAGGACACGGCTGTGTATTACTGTGCGAGAGAAACTGGGGAGGGCTGGTACTTCGATCTCTGGGGCCGTGGCACCCTGGTCACTGTCTCCTCA
348 4D3
4F3
인공 aa QVQLVESGGGVVQPGRSLRLSCAASGFSFSSYDMDWVRQTPGKGLEWVAVIWYDGSNKYYADSVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGWYFDLWGRGTLVTVSS
349 16E2
17E10
20B12
인공 nt CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCATCTTCAGTAGCTATGGCATGCACTGGGTCCGCCAGACTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTGATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACATTTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGTCGAGGACACGGCTGTGTATTACTGTGCGAGAGACGGGTGGGAGCTGTCCTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA
350 16E2
17E10
20B12
인공 aa QVQLVESGGGVVQPGRSLRLSCAASGFIFSSYGMHWVRQTPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDISKNTLYLQMNSLRVEDTAVYYCARDGWELSFDYWGQGTLVTVSS
351 1D10
2C12
인공 nt CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAGCTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGTCAGTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAATAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGCGCGAGAAGGGCCGGTATAATAGGAACTACAGGCTACTACTACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA
352 1D10
2C12
인공 aa QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARRAGIIGTTGYYYGMDVWGQGTTVTVSS
353 16C1 인공 nt CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGACCCTGTCCCTCACTTGTACTGTCTCTGGTGGCTCCATCAGTGGTTACTACTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGTATATCTATTACATTGGGAGCACCAACTACAACCCCTCCCTCAAGAGTCGAGTCACCATGTCAATAGACACGTCCAAGAACCAGTTCTCCCTGACGCTGAGCTCTTTGACCGCTGCGGACACGGCCGTGTATTTCTGTGCGAGAGATGGGAGCAGTGGCTGGTACCGGTGGTTCGACCCCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA
354 16C1 인공 aa QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLTLSSLTAADTAVYFCARDGSSGWYRWFDPWGQGTLVTVSS
355 25G10 인공 nt CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTGGTTACTACTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGTATATCTATTACATTGGGAGCACCAACTACAACCCCTCCCTCAAGAGTCGAGTCACCATGTCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCTGCGGACACGGCCGTGTATTACTGTGCGAGAGATGGGAGCAGTGGCTGGTACCGGTGGTTCGACCCCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA
356 25G10 인공 aa QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYRWFDPWGQGTLVTVSS
357 16A4 인공 nt CAGGTGCAGCTGCAGGAGTCgGGCCCAGGACTGGCGAAgccttcGGAGACcctgtccctcacctgCACTGTCTCTGGTGACTCCATCACTAGTTACTACTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGTATATCTATTACAGTGGGAGCACCAATTACAACCCCTCCCTCAAGAGTCGAGTCACCATATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGTTCTGTGACCGCTGCGGACACGGCCGTGTATTACTGTGCGAGAGATCAAAGGCGGATAGCAGCAGCTGGTACCCACTTCTACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA
358 16A4 인공 aa QVQLQESGPGLAKPSETLSLTCTVSGDSITSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDQRRIAAAGTHFYGMDVWGQGTTVTVSS
359 1F10 인공 nt CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCACAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGCAGTGGTGGTTACTACTGGAGCTGGATCCGCCAGCACCCAGGGAAGGGCCTGGAGTGGATTGGGTACATCTATTACAGTGGGAGCACCTACTACAACCCGTCCCTCACGAGTCGAGTTACCATATCAGTAGACACGTCTAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACTGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGATGGAAGCAGTGGCTGGTACTTCCAGCACTGGGGCCAGGGCACCCTGGTCACCGTCTCCTCA
360 1F10 인공 aa QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLTSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYFQHWGQGTLVTVSS
361 4A9 인공 nt CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTGGTTACTACTGGAGCTGGATCCGGCAGCCCCCAGGAAAGGGACTGGAGTGGTTTGCATATTTCTCTTACAGTGGGAGCACCAACTACAACCCCTCCCTCAAGAGTCGAGTCACCTTATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCTGCGGACACGGCCGTGTATTACTGTGCGAGGAACTGGGCCTTCCACTTTGACTTCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA
362 4A9 인공 aa QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWFAYFSYSGSTNYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDFWGQGTLVTVSS
363 4F7 인공 nt CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTTACTCCTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGTATATCTATTACAGTGGGAGCACCAACTACAACCCCTCCCTCAAGAGTCGAGTCACCATATCATTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCTGCGGACACGGCCGTGTATTACTGTGCGAGGAACTGGGCCTTCCACTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA
364 4F7 인공 aa QVQLQESGPGLVKPSETLSLTCTVSGGSISSYSWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDYWGQGTLVTVSS
365 22D1 인공 nt CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAGGGTTTCCTGCAAGGTTTCTGGATACACCTTCACCAGCTACTTTATTCACTGGGTACGCCAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCAACCCTATTAGTGTTAGCACAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGGGACACGTCCACGAGCACAGTCTTCATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGCGAGGGGGGATACAGCTATGGTTACATTTGGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA
366 22D1 인공 aa QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSS
367 19B5 인공 nt CAGGTGCAGTTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTTTCCTGCAAGGTTTCTGGATACACCTTCACCAGCTACTTTATTCACTGGGTGCGCCAGGCCCCTGGACAAGGGCTTGAATGGATGGGAATTATCAACCCTATTAGTGTTAGCACAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGGGACACGTCCACGAGCACAGTCTTCATGGAGCTGAGCAGcCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGCGAGGGGGGATACAGCTATGGTTACATTTGGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA
368 19B5 인공 aa QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSS
369 25F8 인공 nt CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATATTCACTGGGTGCGCCAGGCCCCTGGACAAGGACTTGAGTGGATGGGAATAATCAACCCCAGTGGTGGTAGCACAAGGTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGGGACACGTCCACGAGCACAGTCTTCATGGAGCTGAGCagcctGAGATCTGAGGACACGGCCGTGTATTACTGTGCGCGAGGGGGAATACAGCTATGGTTACATTttGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA
370 25F8 인공 aa QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS
371 26D1 인공 nt CAGGTGCAGTTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTTTCCTGTAAGGCATCTAGATACACCTTCACCAGCTACTATATGTCCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCCACCCTAGTGGTGGTGACACAACCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCGGGGACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGAGAGGGGGGATAAAACTATGGTTACATTTTGACTATTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA
372 26D1 인공 aa QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSS
373 4D2 인공 nt CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGTTATGACATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATCATATGATGGAACTAATGAATACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACACTTCCAAGAACACGCTGTATTTGCAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTATATTACTGTGCGAGAGAACGATATTTTGACTGGTCTTTTGACTACTGGGGCCAGGGAACCCTGGTCAGTGTCTCCTCA
374 4D2 인공 aa QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVISYDGTNEYYADSVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERYFDWSFDYWGQGTLVSVSS
375 4E10 인공 nt CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAGCTATGACATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCACGAACACGCTGCATCTGCAAATGAACAGCCCGAGAGCCGAGGACACGGCTGTGTACTACTGTGCGAGAGAGTATAGGTACAGCTGGTACTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA
376 4E10 인공 aa QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSTNTLHLQMNSPRAEDTAVYYCAREYRYSWYFDYWGQGTLVTVSS
377 22G10 인공 nt GAGGTGCAACTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGCAGTTATGCCATGAACTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAACTATTAGTGGTGGTGGTGCTAACACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCTCCAGTGACAATTCCAAGAGCACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGCGGACACGGCCGTATATCACTGTGCGAAAGGGGGAATGGGGGGATACTACTACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA
378 22G10 인공 aa EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISSDNSKSTLYLQMNSLRAADTAVYHCAKGGMGGYYYGMDVWGQGTTVTVSS
379 2C12_LC#1 인공 nt CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAGCTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGTCAGTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAATAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGCGCGAGAAGGGCCGGTATAATAGGAACTACAGGCTACTACTACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA
380 2C12_LC#1 인공 aa QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARRAGIIGTTGYYYGMDVWGQGTTVTVSS
381 2H12_LC#2 인공 nt CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAGCTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATGGTATGATGGAAGTAATAAATACTATACAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAATAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGTGCGAGAAGGGCCGGTATAATAGGAACTACAGGCTACTACTACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA
382 2H12_LC#2 인공 aa QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYTDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARRAGIIGTTGYYYGMDVWGQGTTVTVSS
383 2G6_LC#1 인공 nt CAGGTGCAGTTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAGCTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCATTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGACCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAAAAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGTGCGAGAAGGGCCGGTATAATAGGAACTATAGGCTACTACTACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA
384 2G6_LC#1 인공 aa QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIWYDGSNKYYADSVKDRFTISRDNSKNTLYLQMKSLRAEDTAVYYCARRAGIIGTIGYYYGMDVWGQGTTVTVSS
385 2H12 인공 nt CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAGCTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATGGTATGATGGAAGTAATAAATACTATACAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAATAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGTGCGAGAAGGGCCGGTATAATAGGAACTACAGGCTACTACTACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA
386 2H12 인공 aa QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYTDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARRAGIIGTTGYYYGMDVWGQGTTVTVSS
387 2G6 인공 nt CAGGTGCAGTTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAGCTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCATTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGACCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAAAAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGTGCGAGAAGGGCCGGTATAATAGGAACTATAGGCTACTACTACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA
388 2G6 인공 aa QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIWYDGSNKYYADSVKDRFTISRDNSKNTLYLQMKSLRAEDTAVYYCARRAGIIGTIGYYYGMDVWGQGTTVTVSS
389 23A10 인공 nt CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTCGCTATGGCATACACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCTAATGAACAGCCTGAGAGCCGAGGACTCGGCTGTGTATTACTGTGCGAGAAGGGCCGGTATACCTGGAACTACGGGCTACTACTATGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA
390 23A10 인공 aa QVQLVESGGGVVQPGRSLRLSCAASGFTFSRYGIHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLLMNSLRAEDSAVYYCARRAGIPGTTGYYYGMDVWGQGTTVTVSS
391 5E3 인공 nt GAGGTGCAGTTGGTGGAGTCTGGGGGAGGCCTGGTCAAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTATAGCATGCACTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCATCCATTAGTAGTAGTAGTAGTTACATATACTACGCAGACTCAGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCACTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGGGGAAACTGGAACTAACTACTACTACTACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA
392 5E3 인공 aa EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMHWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGETGTNYYYYGMDVWGQGTTVTVSS

IIB: 경쇄 가변 영역 폴리뉴클레오티드 및 아미노산 서열

서열번호 명칭 공급원 유형 서열
393 17H8
23B6
28D10
인공 nt GACATTGTATTGACGCAGtctCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTGCCGGCAGCTACCTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTCTGGTGCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAGTATGGTAAATCACCGATCACCTTCGGCCAAGGGACACGACTGGAGATGAAAGGA
394 17H8
23B6
28D10
인공 aa DIVLTQSPGTLSLSPGERATLSCRASQSVAGSYLAWYQQKPGQAPRLLISGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGKSPITFGQGTRLEMKG
395 4A2
5B4
5C5
인공 nt GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCTTGCAGGGCCAGTCGGAATATTAGCAGCAGCTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTCCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTACAGTGTATTACTGTCAGCAGTATGGTAGCTCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAACGA
396 4A2
5B4
5C5
인공 aa EIVLTQSPGTLSLSPGERATLSCRASRNISSSYLAWYQQKPGQAPRLLIYGPSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFTVYYCQQYGSSFTFGPGTKVDIKR
397 16H2
20D3
23E7
인공 nt CAGTCTGCGCTGACTCAGCCACCCTCAGCGACTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGAAGCAGCTCCAACATCGGAAGTAATTTTGTAAACTGGTACAAACAACTCCCAGGAACGGCCCCCAAAGTCCTCATCTATACTAATAATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGTCTGATTATTACTGTGCAACATGGGATGACAGCCTGAATGGTTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTAGGT
398 16H2
20D3
23E7
인공 aa QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCATWDDSLNGWVFGGGTKLTVLG
399 26F12
27B3
인공 nt CAGTCTGTGCTGACTCAGTCACCCTCAGCGTCTGGGACCCCCGGGCAGAAGGTCACCATCTCTTGTTCTGGAAGCCGCTCCAACATCGGAAGTAATTTTGTAAACTGGTACCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTATACTAATTATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGGCTGATTATTACTGTGCAGTATGGGATGACAGCCTGAATGGTTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTAGGT
400 26F12
27B3
인공 aa QSVLTQSPSASGTPGQKVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNYQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVWDDSLNGWVFGGGTKLTVLG
401 4B10
4C2
인공 nt GAAATTGTATTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAACACCTACTTAGCCTGGTACCATCAGAGACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGCAGGGCCACTGGCATCCCAGACAGATTCAGTGGCAGTGGGTCTGGGACAGACTTCGCTCTCACCATCAGCAGTCTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAGTACAGTAACTCgtgGACGTTCGGCCAAGGGACCAAGGTGGAAATCAaacGA
402 4B10
4C2
인공 aa EIVLTQSPGTLSLSPGERATLSCRASQSVSNTYLAWYHQRPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFALTISSLEPEDFAVYYCQQYSNSWTFGQGTKVEIKR
403 4D3
4F3
인공 nt GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGACTGGAACCTGAGGATTTTGCAGTGTATTACTGTCAGCAGTATGGTAGCTCGTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGA
404 4D3
4F3
인공 aa EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSWTFGQGTKVEIKR
405 16E2
17E10
20B12
인공 nt GACATCCAGATGACCCAGTCTCCATCCTCACTGTCTGCATCTGTAGGAGACAGAGTCACCATCACTTGTCGGGCGAGTCAGGGCATTAGCAATTATTTAGCCTGGTTACAGCAGAAACCAGGGAAAGCCCCTAAGTCCCTGATCTATGCTGCATCCAGTTTGCAAAGTGGGGTCCCATCAAAGTTCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGCCAACACTATTTTACTTACCCTCGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGA
406 16E2
17E10
20B12
인공 aa DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWLQQKPGKAPKSLIYAASSLQSGVPSKFSGSGSGTDFTLTISSLQPEDFATYYCQHYFTYPRTFGQGTKVEIKR
407 1D10
2C12
인공 nt TCCTATGCGCTGACTCAGCCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCAGCCTCACCTGCTCTGGAGATAGATTGGGGGAAAAATATACTTGCTGGTATCAGCAGAGGCCAGGCCAGTCCCCTTTGCTGGTCATCTATCAAGATACCAAGCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCACCTCTGGTAACACAGCCACTCTGACCATCAGCGGGACCCAGGCTATGGATGAGGCTGACTATTACTGTCAGGCGTGGGACAGCAGCACTGTGGTATTCGGCGGAGGGACCAAGCTGACCGTCCTAGGT
408 1D10
2C12
인공 aa SYALTQPPSVSVSPGQTASLTCSGDRLGEKYTCWYQQRPGQSPLLVIYQDTKRPSGIPERFSGSTSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVLG
409 16C1 인공 nt GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGCCAGAGTGTTAGCAGCAGCTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTTTGGTGCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCGGACTGGAGCCTGAAGATTTTGCAGTGTATCACTGTCAGCAGTATGGTAACTCACCGCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAACGA
410 16C1 인공 aa EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISGLEPEDFAVYHCQQYGNSPLTFGGGTKVEIKR
411 25G10 인공 nt GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTTTGGTGCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGactTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATCACTGTCAGCAGTATGGTAACTCACCGCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAACGA
412 25G10 인공 aa EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYHCQQYGNSPLTFGGGTKVEIKR
413 16A4 인공 nt GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCtCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGTTATTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTACATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTATTGTCAGCAGTACGGTAGCTCACCTTTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAACGA
414 16A4 인공 aa EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGTSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPFTFGGGTKVEIKR
415 1F10 인공 nt GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCGGAGTATTAGCAGCAGCTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTCCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAGTATGGTAGCTCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAACGA
416 1F10 인공 aa EIVLTQSPGTLSLSPGERATLSCRASRSISSSYLAWYQQKPGQAPRLLIYGPSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSFTFGPGTKVDIKR
417 4A9 인공 nt CAGTCTGTGCTGACGCAGCCGCCCTCAGTGTCTGGGGCCCCAGGACAGAGGGTCACCATCTCCTGCACTGGGAGCAGCTCCAACATCGGGACAGGTTATGCTGTACACTGGTACCAGCAGTTTCCAGGAACAGCCCCCAAACTCCTCATCTATGGTAACAACAATCGGCCCTCAGGGGTTCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCACTGGGCTCCAGGCTGAGGATGAGGCTGATTATTACTGCCAGTCCTATGACAGCAGACTGAGTGGTTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTAGGT
418 4A9 인공 aa QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYAVHWYQQFPGTAPKLLIYGNNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSRLSGWVFGGGTKLTVLG
419 4F7 인공 nt CAGTCTGTgcTGACGCAGCCGCCCTCAGTGTCTGGGGCCCCAGGGCAGAGGGTCACCATCTCCTGCACTGGGAGCAGCTCCAATATCGGGACAGGTTATGATGTACACTGGTATCAGCAGcttcCAGGAACAGCCCCCAAACTCCTCATCCATGGTAACAGCAATCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCACTGGGCTCCAGGCTGAGGATGAGGCTGATTATTACTGCCAGTCCTATGACAGCAGTCTGAGTGGTTGGGTGTTCGGCGGAGGGACCAGGTTGACCGTCCTAGGT
420 4F7 인공 aa QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYDVHWYQQLPGTAPKLLIHGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGWVFGGGTRLTVLG
421 22D1 인공 nt CAGTCTGCGCTGACTCAGCCACCCTCAGCGACTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGAAGCAGCTCCAACATCGGAAGCAATTTTGTAAACTGGTACAAGCAGCTCCCAGGAACGGCCCCCAAAGTCCTCATCTATACTAATAATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGTCTGATTATTACTGTGCAACATGGGATGACAGTATGAATGGTTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTAGGT
422 22D1 인공 aa QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCATWDDSMNGWVFGGGTKLTVLG
423 19B5 인공 nt CAGTCTGCGCTGACTCAGCCACCCTCAACGACTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGAAGCAGGTCCAACATCGGAAGCAATTTTGTAAACTGGTACAAGCAGCTCCCAGGAACGGCCCCCAAAGTCCTCATCTATACTAATAATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGTCTGATTATTACTGCGCAACATGGGATGACAGTATGAATGGTTGGGTGTTCGGCGGAGGGACCAAACTGACCGTCCTAGGT
424 19B5 인공 aa QSALTQPPSTTGTPGQRVTISCSGSRSNIGSNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCATWDDSMNGWVFGGGTKLTVLG
425 25F8 인공 nt CAGTCTGCGCTGactCAGCCACCCTCAGCGACTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGAAGCAGCTCCAACATCGGAAGGAATTTTGTAAACTGGTATAAGCAGCTCCCAGGAACGGCCCCCAAAGTCCTCATTTATACTAATAATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGTCTGATTATTACTGTGCAGCATGGGATGACAGCCTGAATGGTTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTAGGT
426 25F8 인공 aa QSALTQPPSATGTPGQRVTISCSGSSSNIGRNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCAAWDDSLNGWVFGGGTKLTVLG
427 26D1 인공 nt CACTCTGTGCTGACTCAGTCACCCTCAGCGTCTGGGACCCCCGGACAGAGGGTCACCATCTCTTGTTCTGGAAGCCGCTCCAACATCGGAAGTAATTTTGTAAACTGGTACCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTATACTAATAATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGGCTGATTATTACTGTGCAGTATGGGATGACAGCCTGAATGGTTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTAGGT
428 26D1 인공 aa HSVLTQSPSASGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVWDDSLNGWVFGGGTKLTVLG
429 4D2 인공 nt GAAATTGTATTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAACACCTACTTAGCCTGGTACCATCAGAGACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGCAGGGCCGCTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAGTATAGTAACTCGTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGA
430 4D2 인공 aa EIVLTQSPGTLSLSPGERATLSCRASQSVSNTYLAWYHQRPGQAPRLLIYGASSRAAGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYSNSWTFGQGTKVEIKR
431 4E10 인공 nt GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTGGCAGCAGCTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGCAGGGTCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGATTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAATATAGTAACTCGTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGA
432 4E10 인공 aa EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGASSRVTGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYSNSWTFGQGTKVEIKR
433 22G10 인공 nt GAAATAGTGATGACGCAGTCTCCAGTCACCCTGTCTCTGTCTCTAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTATTAGCAGCAACTTAGCCTGGTTCCAGCAGAAACCTGGCCAGGCTCCCAGACTCCTCATCTATGGTGCATTTACCAGGGCCACTGGTATCCCAGCCAGGGTCAGTGGCAGTGGGTCTGGGACAGAGTTCACTCTCACCATCAGCAGCCTGCAGTCTGAAGATTTTGCAGTTTATTACTGTCAGCAGTATAATTACTGGCCGCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAGCGA
434 22G10 인공 aa EIVMTQSPVTLSLSLGERATLSCRASQSISSNLAWFQQKPGQAPRLLIYGAFTRATGIPARVSGSGSGTEFTLTISSLQSEDFAVYYCQQYNYWPLTFGGGTKVEIKR
435 2C12_LC#1 인공 nt GATGTTGTGATGactCAGtCTccActctccctgcCCGTCACCCTTGGACAGCCGGcctCCAtctcctgCAGGtCTAGTCAAAGcctcgtaTACAGTGATGGAAACAcctACTTGAATTGGTTTCAGCAGAGGCCAGGCCAATCTCCAAGGcgcctaATTTATAAGGTTTCTAACTGGGactctGGGGtCCCAGACAGATTCAGCgGCAGTGGGTCAGGCActGATTTCACactGAAAAtCAGCAGGGTGGaggctgaGGATGTTGGGGTTTATTactgCATGCAAGGTATAGTGTGGCCGTGCAGTTTTGGCCAGGGGACCAAGCTGGAGATCAAaCgA
436 2C12_LC#1 인공 aa DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNWDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIVWPCSFGQGTKLEIKR
437 2H12_LC#2 인공 nt GATGTTGTGATGACTCAGTCTCCACTCTCCCTGCCCGTCACCCTTGGACAGCCGGCCTCCATCTCCTGCAGGTCTAGTCAAAGCCTCGTATACAGTGATGGAAACACCTACTTGAATTGGTTTCAGCAGAGGCCAGGCCAATCTCCAAGGCGCCTAATTTATAAGGTTTCTAACTGGGACTCTGGGGTCCCAGACAGAATCAGCGGCAGTGGGTCAGGCACCGATTTCACACTGAAAATCAGCAGGGTGGAGGCTGAGGATGTTGGGGTTTATTACTGCATGCAAGATACACTGTGGCCGTGCAGTTTTGGCCAGGGGACCAAGCTGGAGATCAAACGA
438 2H12_LC#2 인공 aa DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNWDSGVPDRISGSGSGTDFTLKISRVEAEDVGVYYCMQDTLWPCSFGQGTKLEIKR
439 2G6_LC#1 인공 nt GaTGTTGTGATGACTCagtctccACTCTCCCTGCCCGTCACCCttggacaGCCGGCCTccaTCTCCTGCAGGTCTAGTCAAAGCCTCGTATACAGTGATGGAAACACCTACTTGAATTGGTTTCAGCAGAGGCCAGGCCAATCTCCACGGCGCCTAATTTATCAGGTTTCTAACTGGGACTCTGGGGTCCCAGACAGATTCAGCGGCAGTGGGTCAGGCACTGATTTCACACTGAAAATCAGCAGGGTGGAGGCTGAGGATGTTGGGATTTATTACTGCATGCAAGATACACTGTGGCCGTGCAGTTTTGGCCAGGGGACCAAGCTGGAGATCAAACGA
440 2G6_LC#1 인공 aa DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYQVSNWDSGVPDRFSGSGSGTDFTLKISRVEAEDVGIYYCMQDTLWPCSFGQGTKLEIKR
441 2H12 인공 nt TCCTATGAGCTGACTCAGCCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCAGCATCACCTGCTCTGGAGATAGATTGGGGGAAAAATATACTTGCTGGTATCAGCAGAGGCCAGGCCAGTCCCCTTTGCTGGTCATCTATCAAGATACCAAGCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGTAACACAGCCACTCTGACCATCAGCGGGACCCAGCCTATGGATGAGGCTGACTATTACTGTCAGGCGTGGGACAGCAGCACTGTGGTATTCGGCGGAGGGACCAAGCTGACCGTCCtAGGT
442 2H12 인공 aa SYELTQPPSVSVSPGQTASITCSGDRLGEKYTCWYQQRPGQSPLLVIYQDTKRPSGIPERFSGSNSGNTATLTISGTQPMDEADYYCQAWDSSTVVFGGGTKLTVLG
443 2G6 인공 nt TCCTATGAACTGACTCAGCCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCAGCATCACCTGCTCTGGAGATAGGTTGGGGGAAAAATATACTTGCTGGTATCAGCAGAGGCCAGGCCAGTCCCCTTTGCTGGTCATCTATCAAGATACCAAGCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGTAACACAGCCACTCTGACCATCAGCGGGACCCAGGCTATGGATGAGGCTGACTATTACTGTCAGGCGTGGGACAGCAGCACTGTGGTATTCGGCGGAGGGACCAAGCTGACCGTCCTAGGT
444 2G6 인공 aa SYELTQPPSVSVSPGQTASITCSGDRLGEKYTCWYQQRPGQSPLLVIYQDTKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVLG
445 23A10 인공 nt TCCTATGAGCTGACTCAGCCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCAGCATCACCTGCTCTGGAGATAGATTGGGGGAGAAATATGTTTGCTGGTATCAGCAGAAGCCAGGCCAGTCCCCTATACTGGTCATCTATCAAGATAATAAGTGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACAGCCACTCTGACCATCAGCGGGACCCAGGCTATGGATGAGGCTGACTATTACTGTCAGGCGTGGGACAGCAGCACTGTGGTATTCGGCGGGGGGACCAAGCTGACCGTCCTAGGT
446 23A10 인공 aa SYELTQPPSVSVSPGQTASITCSGDRLGEKYVCWYQQKPGQSPILVIYQDNKWPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVLG
447 5E3 인공 nt TCCTATGAGCTGACTCAGCCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCAGCATCACCTGCTCTGGAGATAAATTGGGGGATGAATATGCTTGCTGGTATCAGCAGAAGCCAGGCCAGTCCCCTGTGCTGGTCATCTATCAAGATAGCAAGCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACAGCCACTCTGACCATCAGCGGGACCCAGGCTATGGATGAGGCTGACTATTACTGTCAGGCGTGGGACAGCAGCACTGTGGTATTCGGCGGAGGGACCAAGCTGACCGTCCTAGGT
448 5E3 인공 aa SYELTQPPSVSVSPGQTASITCSGDKLGDEYACWYQQKPGQSPVLVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVLG

IIc : 중쇄 가변 영역 폴리뉴틀레오티드 및 아미노산 서열

13586_HC [ hu 항-< huCDH19 > 4F3 VH ]

QVQLVESGGGVVQPGRSLRLSCAASGFSFSSYDMDWVRQTPGKGLEWVAVIWYDGSNKYYADSVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGWYFDLWGRGTLVTVSS

서열번호 449

 

13589_HC [ hu 항-< huCDH19 > 4A9 VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWFAYFSYSGSTNYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDFWGQGTLVTVSS

서열번호 450

 

13590_HC [ hu 항-< huCDH19 > 4B10 VH ]

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVISYDGTNEYYADSVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERYFDWSFDYWGQGTLVSVSS

서열번호 451

 

13874_HC [ hu 항-< huCDH19 > 17H8 .2 VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTALYYCARDSRYRSGWYDAFDIWGQGTMVTVSS

서열번호 452

 

13875_HC [ hu 항-< huCDH19 > 16C1 .1 VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLTLSSLTAADTAVYFCARDGSSGWYRWFDPWGQGTLVTVSS

서열번호 453

 

13876_HC [ hu 항-< huCDH19 > 16A4.1 VH ]

 

QVQLQESGPGLAKPSETLSLTCTVSGDSITSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDQRRIAAAGTHFYGMDVWGQGTTVTVSS

서열번호 454

 

13877_HC [ hu 항-< huCDH19 > 22G10.1 VH ]

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISSDNSKSTLYLQMNSLRAADTAVYHCAKGGMGGYYYGMDVWGQGTTVTVSS

서열번호 455

 

13878_HC [ hu 항-< huCDH19 > 20D3 .1 VH ]

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS

서열번호 456

 

13879_HC [ hu 항-< huCDH19 > 22D1 .1 VH ]

QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSS

서열번호 457

 

13880_HC [ hu 항-< huCDH19 > 25F8.1 VH ]

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS

서열번호 458

 

13881_HC [ hu 항-< huCDH19 > 26F12.1 VH ]

QVQLVQSGAEVKKPGASVKVSCKASRYTFTNYYMSWVRQAPGQGLEWMGIINPSGGDSTYAQKFQGRLTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS

서열번호 459

 

13882_HC [ hu 항-< huCDH19 > 26D1 .1 VH ]

QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSS

서열번호 460

 

13883_HC [ hu 항-< huCDH19 > 25G10.1 VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYRWFDPWGQGTLVTVSS

서열번호 461

 

13885_HC [ hu 항-< huCDH19 > 19B5 .1 VH ]

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSS

서열번호 462

 

14022_HC [ hu 항-< huCDH19 > 4A2 VH ]

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSSGYYWSWIRQHPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYFQYWGQGTLVTVSS

서열번호 463

 

14024_HC [ hu 항-< huCDH19 > 4A2 (1-472)( Q17E,H47P ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISSSGYYWSWIRQPPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYFQYWGQGTLVTVSS

서열번호 464

 

14025_HC [ hu 항-< huCDH19 > 4A2 VH ]

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSSGYYWSWIRQHPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYFQYWGQGTLVTVSS

서열번호 465

 

14026_HC [ hu 항-< huCDH19 > 4A2 (1-472)( Q17E,H47P ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISSSGYYWSWIRQPPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYFQYWGQGTLVTVSS

서열번호 466

 

14027_HC [ hu 항-< huCDH19 > 4A2 (1-472)( Q17E,H47P,D111E ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISSSGYYWSWIRQPPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAREGSSGWYFQYWGQGTLVTVSS

서열번호 467

 

14028_HC [ hu 항-< huCDH19 > 4A2 (1-472)( Q17E,H47P,D111E,W134Y ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISSSGYYWSWIRQPPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAREGSSGYYFQYWGQGTLVTVSS

서열번호 468

 

14029_HC [ hu 항-< huCDH19 > 4A2 VH ]

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSSGYYWSWIRQHPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYFQYWGQGTLVTVSS

서열번호 469

 

14030_HC [ hu 항-< huCDH19 > 4F3 (1-471)( R17G ) VH ]

QVQLVESGGGVVQPGGSLRLSCAASGFSFSSYDMDWVRQTPGKGLEWVAVIWYDGSNKYYADSVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGWYFDLWGRGTLVTVSS

서열번호 470

 

14031_HC [ hu 항-< huCDH19 > 4F3 (1-471)( R17G,T47A ) VH ]

QVQLVESGGGVVQPGGSLRLSCAASGFSFSSYDMDWVRQAPGKGLEWVAVIWYDGSNKYYADSVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGWYFDLWGRGTLVTVSS

서열번호 471

 

14032_HC [ hu 항-< huCDH19 > 4F3 (1-471)( R17G,T47A,R141Q ) VH ]

QVQLVESGGGVVQPGGSLRLSCAASGFSFSSYDMDWVRQAPGKGLEWVAVIWYDGSNKYYADSVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGWYFDLWGQGTLVTVSS

서열번호 472

 

14033_HC [ hu 항-< huCDH19 > 4F3 (1-471)( R17G,T47A,D61E,D72E,R141Q ) VH ]

QVQLVESGGGVVQPGGSLRLSCAASGFSFSSYDMDWVRQAPGKGLEWVAVIWYEGSNKYYAESVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGWYFDLWGQGTLVTVSS

서열번호 473

 

14034_HC [ hu 항-< huCDH19 > 4F3 (1-471)(R17G,T47A,D61E,D72E,W134Y,R141Q) VH ]

QVQLVESGGGVVQPGGSLRLSCAASGFSFSSYDMDWVRQAPGKGLEWVAVIWYEGSNKYYAESVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGYYFDLWGQGTLVTVSS

서열번호 474

 

14039_HC [ hu 항-< huCDH19 > 2G6 (1-477)( R17G,D61E,D72E,K94N ) VH ]

QVQLVESGGGVVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIWYEGSNKYYAESVKDRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARRAGIIGTIGYYYGMDVWGQGTTVTVSS

서열번호 475

 

14040_HC [ hu 항-< huCDH19 > 16C1 .1 VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLTLSSLTAADTAVYFCARDGSSGWYRWFDPWGQGTLVTVSS

서열번호 476

 

14041_HC [ hu 항-< huCDH19 > 16C1 .1 (1-469)( T92K ) VH ]

 

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLKLSSLTAADTAVYFCARDGSSGWYRWFDPWGQGTLVTVSS

서열번호 477

 

14042_HC [ hu 항-< huCDH19 > 16C1 .1 (1-469)( T92K,D109E ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLKLSSLTAADTAVYFCAREGSSGWYRWFDPWGQGTLVTVSS

서열번호 478

 

14043_HC [ hu 항-< huCDH19 > 16C1 .1 (1-469)( T92K,W132Y,W135Y ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLKLSSLTAADTAVYFCARDGSSGYYRYFDPWGQGTLVTVSS

서열번호 479

 

14044_HC [ hu 항-< huCDH19 > 16C1 .1 (1-469)( T92K ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLKLSSLTAADTAVYFCARDGSSGWYRWFDPWGQGTLVTVSS

서열번호 480

 

14045_HC [ hu 항-< huCDH19 > 17H8 .2 VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTALYYCARDSRYRSGWYDAFDIWGQGTMVTVSS

서열번호 481

 

14046_HC [ hu 항-< huCDH19 > 17H8 .2 (1-471)( D109E ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTALYYCARESRYRSGWYDAFDIWGQGTMVTVSS

서열번호 482

 

14047_HC [ hu 항-< huCDH19 > 17H8 .2 (1-471)( D109E,W132Y ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTALYYCARESRYRSGYYDAFDIWGQGTMVTVSS

서열번호 483

 

14048_HC [ hu 항-< huCDH19 > 17H8 .2 (1-471)( D109E ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTALYYCARESRYRSGWYDAFDIWGQGTMVTVSS

서열번호 484

 

14049_HC [ hu 항-< huCDH19 > 4F7 VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISSYSWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDYWGQGTLVTVSS

서열번호 485

 

14050_HC [ hu 항-< huCDH19 > 4F7 VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISSYSWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDYWGQGTLVTVSS

서열번호 486

 

14051_HC [ hu 항-< huCDH19 > 4F7 (1-468)( W113Y ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISSYSWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAVYYCARNYAFHFDYWGQGTLVTVSS

서열번호 487

 

14052_HC [ hu 항-< huCDH19 > 4B10 (1-471)( R17G,D61E,D72E,W134Y ) VH ]

QVQLVESGGGVVQPGGSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVISYEGTNEYYAESVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERYFDYSFDYWGQGTLVSVSS

서열번호 488

 

14053_HC [ hu 항-< huCDH19 > 4B10 VH ]

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVISYDGTNEYYADSVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERYFDWSFDYWGQGTLVSVSS

서열번호 489

 

14054_HC [ hu 항-< huCDH19 > 4B10 (1-471)( R17G ) VH ]

QVQLVESGGGVVQPGGSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVISYDGTNEYYADSVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERYFDWSFDYWGQGTLVSVSS

서열번호 490

 

14055_HC [ hu 항-< huCDH19 > 4B10 (1-471)( R17G,D61E,D72E ) VH ]

QVQLVESGGGVVQPGGSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVISYEGTNEYYAESVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERYFDWSFDYWGQGTLVSVSS

서열번호 491

 

14056_HC [ hu 항-< huCDH19 > 4A9 VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWFAYFSYSGSTNYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDFWGQGTLVTVSS

서열번호 492

 

14057_HC [ hu 항-< huCDH19 > 4A9 (1-468)( F55I,A56G ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYFSYSGSTNYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDFWGQGTLVTVSS

서열번호 493

 

14058_HC [ hu 항-< huCDH19 > 4A9 (1-468)( F55I,A56G ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYFSYSGSTNYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDFWGQGTLVTVSS

서열번호 494

 

14059_HC [ hu 항-< huCDH19 > 4A9 (1-468)( F55I,A56G,W113Y ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYFSYSGSTNYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCARNYAFHFDFWGQGTLVTVSS

서열번호 495

 

14060_HC [ hu 항-< huCDH19 > 20D3 .1 VH ]

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS

서열번호 496

 

14061_HC [ hu 항-< huCDH19 > 20D3 .1 VH ]

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS

서열번호 497

 

14062_HC [ hu 항-< huCDH19 > 20D3 .1 (1-469)( W133Y ) VH ]

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHFDYWGQGTLVTVSS

서열번호 498

 

14063_HC [ hu 항-< huCDH19 > 20D3 .1 (1-469)( W133Y ) VH ]

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHFDYWGQGTLVTVSS

서열번호 499

 

14064_HC [ hu 항-< huCDH19 > 20D3 .1 (1-469)( W133Y ) VH ]

 

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHFDYWGQGTLVTVSS

서열번호 500

 

14065_HC [ hu 항-< huCDH19 > 22G10.1 (1-470)( S82R,A99E ) VH ]

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISRDNSKSTLYLQMNSLRAEDTAVYHCAKGGMGGYYYGMDVWGQGTTVTVSS

서열번호 501

 

14066_HC [ hu 항-< huCDH19 > 22G10.1 (1-470)( A99E,H105Y ) VH ]

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISSDNSKSTLYLQMNSLRAEDTAVYYCAKGGMGGYYYGMDVWGQGTTVTVSS

서열번호 502

 

14067_HC [ hu 항-< huCDH19 > 22G10.1 (1-470)( A99E ) VH ]

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISSDNSKSTLYLQMNSLRAEDTAVYHCAKGGMGGYYYGMDVWGQGTTVTVSS

서열번호 503

 

14068_HC [ hu 항-< huCDH19 > 22G10.1 (1-470)( A99E ) VH ]

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISSDNSKSTLYLQMNSLRAEDTAVYHCAKGGMGGYYYGMDVWGQGTTVTVSS

서열번호 504

 

14069_HC [ hu 항-< huCDH19 > 22G10.1 (1-470)( D72E,A99E ) VH ]

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYAESVKGRFTISSDNSKSTLYLQMNSLRAEDTAVYHCAKGGMGGYYYGMDVWGQGTTVTVSS

서열번호 505

 

14070_HC [ hu 항-< huCDH19 > 22G10.1 (1-470)( H105Y ) VH ]

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISSDNSKSTLYLQMNSLRAADTAVYYCAKGGMGGYYYGMDVWGQGTTVTVSS

서열번호 506

 

14071_HC [ hu 항-< huCDH19 > 16A4.1 (1-474)( T144L ) VH ]

QVQLQESGPGLAKPSETLSLTCTVSGDSITSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDQRRIAAAGTHFYGMDVWGQGTLVTVSS

서열번호 507

 

14072_HC [ hu 항-< huCDH19 > 19B5 .1 VH ]

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSS

서열번호 508

 

14073_HC [ hu 항-< huCDH19 > 19B5 .1 (1-469)( W133Y ) VH ]

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHLDYWGQGTLVTVSS

서열번호 509

 

14074_HC [ hu 항-< huCDH19 > 19B5 .1 VH ]

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSS

서열번호 510

 

14075_HC [ hu 항-< huCDH19 > 19B5 .1 VH ]

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSS

서열번호 511

 

14076_HC [ hu 항-< huCDH19 > 19B5 .1 (1-469)( W133Y ) VH ]

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHLDYWGQGTLVTVSS

서열번호 512

 

14077_HC [ hu 항-< huCDH19 > 23A10.3 (1-474)( L92Q ) VH ]

QVQLVESGGGVVQPGRSLRLSCAASGFTFSRYGIHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDSAVYYCARRAGIPGTTGYYYGMDVWGQGTTVTVSS

서열번호 513

 

14078_HC [ hu 항-< huCDH19 > 23A10.3 (1-474)( R17G,L92Q ) VH ]

QVQLVESGGGVVQPGGSLRLSCAASGFTFSRYGIHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDSAVYYCARRAGIPGTTGYYYGMDVWGQGTTVTVSS

서열번호 514

 

14079_HC [ hu 항-< huCDH19 > 23A10.3 (1-474)( R17G,D61E,D72E,L92Q ) VH ]

QVQLVESGGGVVQPGGSLRLSCAASGFTFSRYGIHWVRQAPGKGLEWVAVIWYEGSNKYYAESVKGRFTISRDNSKNTLYLQMNSLRAEDSAVYYCARRAGIPGTTGYYYGMDVWGQGTTVTVSS

서열번호 515

 

14080_HC [ hu 항-< huCDH19 > 23A10.3 VH ]

QVQLVESGGGVVQPGRSLRLSCAASGFTFSRYGIHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLLMNSLRAEDSAVYYCARRAGIPGTTGYYYGMDVWGQGTTVTVSS

서열번호 516

 

14081_HC [ hu 항-< huCDH19 > 25G10.1 VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYRWFDPWGQGTLVTVSS

서열번호 517

 

14082_HC [ hu 항-< huCDH19 > 25G10.1 (1-469)( D109E,W132Y,W135Y ) VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAREGSSGYYRYFDPWGQGTLVTVSS

서열번호 518

 

14083_HC [ hu 항-< huCDH19 > 26D1 .1 VH ]

QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSS

서열번호 519

 

14084_HC [ hu 항-< huCDH19 > 26D1 .1 VH ]

QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSS

서열번호 520

 

14085_HC [ hu 항-< huCDH19 > 26D1 .1 VH ]

QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSS

서열번호 521

 

14086_HC [ hu 항-< huCDH19 > 26D1 .1 VH ]

QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSS

서열번호 522

 

14087_HC [ hu 항-< huCDH19 > 26D1 .1 (1-469)( W133Y ) VH ]

QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLYLHFDYWGQGTLVTVSS

서열번호 523

 

14088_HC [ hu 항-< huCDH19 > 26D1 .1 (1-469)( R27G,G82R ) VH ]

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSS

서열번호 524

 

14089_HC [ hu 항-< huCDH19 > 26F12.1 VH ]

QVQLVQSGAEVKKPGASVKVSCKASRYTFTNYYMSWVRQAPGQGLEWMGIINPSGGDSTYAQKFQGRLTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS

서열번호 525

 

14090_HC [ hu 항-< huCDH19 > 26F12.1 VH ]

QVQLVQSGAEVKKPGASVKVSCKASRYTFTNYYMSWVRQAPGQGLEWMGIINPSGGDSTYAQKFQGRLTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS

서열번호 526

 

14091_HC [ hu 항-< huCDH19 > 26F12.1 (1-469)( W133Y ) VH ]

QVQLVQSGAEVKKPGASVKVSCKASRYTFTNYYMSWVRQAPGQGLEWMGIINPSGGDSTYAQKFQGRLTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIQLYLHFDYWGQGTLVTVSS

서열번호 527

 

14092_HC [ hu 항-< huCDH19 > 26F12.1 (1-469)( W133Y ) VH ]

QVQLVQSGAEVKKPGASVKVSCKASRYTFTNYYMSWVRQAPGQGLEWMGIINPSGGDSTYAQKFQGRLTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIQLYLHFDYWGQGTLVTVSS

서열번호 528

 

14093_HC [ hu 항-< huCDH19 > 25F8.1 VH ]

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS

서열번호 529

 

14094_HC [ hu 항-< huCDH19 > 25F8.1 VH ]

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS

서열번호 530

 

14095_HC [ hu 항-< huCDH19 > 25F8.1 (1-469)( F90Y ) VH ]

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS

서열번호 531

 

14096_HC [ hu 항-< huCDH19 > 25F8.1 (1-469)( F90Y ) VH ]

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSS

서열번호 532

 

14097_HC [ hu 항-< huCDH19 > 25F8.1 (1-469)( F90Y,W133Y ) VH ]

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGIQLYLHFDYWGQGTLVTVSS

서열번호 533

 

14098_HC [ hu 항-< huCDH19 > 22D1 .1 VH ]

QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSS

서열번호 534

 

14099_HC [ hu 항-< huCDH19 > 22D1 .1 VH ]

QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSS

서열번호 535

 

14100_HC [ hu 항-< huCDH19 > 22D1 .1 (1-469)( W133Y ) VH ]

QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHLDYWGQGTLVTVSS

서열번호 536

 

14101_HC [ hu 항-< huCDH19 > 22D1 .1 (1-469)( W133Y ) VH ]

QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHLDYWGQGTLVTVSS

서열번호 537

 

14102_HC [ hu 항-< huCDH19 > 22D1 .1 (1-469)( F90Y ) VH ]

QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSS

서열번호 538

 

13591_HC [ hu 항-< huCDH19 > 4F7 VH ]

QVQLQESGPGLVKPSETLSLTCTVSGGSISSYSWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDYWGQGTLVTVSS

서열번호 539

 

14301_HC [ hu 항-< huCDH19 > 2G6 VH ]

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIWYDGSNKYYADSVKDRFTISRDNSKNTLYLQMKSLRAEDTAVYYCARRAGIIGTIGYYYGMDVWGQGTTVTVSS

서열번호 540

 

14302_HC [ hu 항-< huCDH19 > 2G6 (1-477)( R17G,K94N ) VH ]

QVQLVESGGGVVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIWYDGSNKYYADSVKDRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARRAGIIGTIGYYYGMDVWGQGTTVTVSS

 서열번호 541

14303_HC [ hu 항-< huCDH19 > 2G6 (1-477)( D61E,D72E ) VH ]

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIWYEGSNKYYAESVKDRFTISRDNSKNTLYLQMKSLRAEDTAVYYCARRAGIIGTIGYYYGMDVWGQGTTVTVSS

서열번호 542

 

14304_HC [ hu 항-< huCDH19 > 2G6 (1-477)( R17G ) VH ]

QVQLVESGGGVVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIWYDGSNKYYADSVKDRFTISRDNSKNTLYLQMKSLRAEDTAVYYCARRAGIIGTIGYYYGMDVWGQGTTVTVSS

서열번호 543

IId : 경쇄 가변 영역 아미노산 서열

13586_LC [ hu 항-< huCDH19 > 4F3 VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSWTFGQGTKVEIKR

서열번호 544

 

13589_LC [ hu 항-< huCDH19 > 4A9 VL ]

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYAVHWYQQFPGTAPKLLIYGNNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSRLSGWVFGGGTKLTVLG

서열번호 545

 

13590_LC [ hu 항-< huCDH19 > 4B10 VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSNTYLAWYHQRPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFALTISSLEPEDFAVYYCQQYSNSWTFGQGTKVEIKR

서열번호 546

 

13874_LC [ hu 항-< huCDH19 > 17H8 .2 VL ]

DIVLTQSPGTLSLSPGERATLSCRASQSVAGSYLAWYQQKPGQAPRLLISGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGKSPITFGQGTRLEMKG

서열번호 547

 

13875_LC [ hu 항-< huCDH19 > 16C1 .1 VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISGLEPEDFAVYHCQQYGNSPLTFGGGTKVEIKR

서열번호 548

 

13876_LC [ hu 항-< huCDH19 > 16A4.1 VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGTSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPFTFGGGTKVEIKR

서열번호 549

 

13877_LC [ hu 항-< huCDH19 > 22G10.1 VL ]

EIVMTQSPVTLSLSLGERATLSCRASQSISSNLAWFQQKPGQAPRLLIYGAFTRATGIPARVSGSGSGTEFTLTISSLQSEDFAVYYCQQYNYWPLTFGGGTKVEIKR

서열번호 552

 

13878_LC [ hu 항-< huCDH19 > 20D3 .1 VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCATWDDSLNGWVFGGGTKLTVLG

서열번호 554

 

13879_LC [ hu 항-< huCDH19 > 22D1 .1 VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCATWDDSMNGWVFGGGTKLTVLG

서열번호 555

 

13880_LC [ hu 항-< huCDH19 > 25F8.1 VL ]

 

QSALTQPPSATGTPGQRVTISCSGSSSNIGRNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCAAWDDSLNGWVFGGGTKLTVLG

서열번호 556

 

13881_LC [ hu 항-< huCDH19 > 26F12.1 VL ]

QSVLTQSPSASGTPGQKVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNYQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVWDDSLNGWVFGGGTKLTVLG

서열번호 557

 

13882_LC [ hu 항-< huCDH19 > 26D1 .1 VL ]

HSVLTQSPSASGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVWDDSLNGWVFGGGTKLTVLG

서열번호 555

 

13883_LC [ hu 항-< huCDH19 > 25G10.1 VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYHCQQYGNSPLTFGGGTKVEIKR

서열번호 556

 

13885_LC [ hu 항-< huCDH19 > 19B5 .1 VL ]

QSALTQPPSTTGTPGQRVTISCSGSRSNIGSNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCATWDDSMNGWVFGGGTKLTVLG

서열번호 557

 

14022_LC [ hu 항-< huCDH19 > 4A2 (1-236)( N30Q ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASRQISSSYLAWYQQKPGQAPRLLIYGPSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFTVYYCQQYGSSFTFGPGTKVDIKR

서열번호 558

 

14024_LC [ hu 항-< huCDH19 > 4A2 (1-236)( N30Q,T102A,P141Q ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASRQISSSYLAWYQQKPGQAPRLLIYGPSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSFTFGQGTKVDIKR

서열번호 559

 

14025_LC [ hu 항-< huCDH19 > 4A2 (1-236)( N30Q,T102A ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASRQISSSYLAWYQQKPGQAPRLLIYGPSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSFTFGPGTKVDIKR

서열번호 560

 

14026_LC [ hu 항-< huCDH19 > 4A2 (1-236)( N30Q,T102A ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASRQISSSYLAWYQQKPGQAPRLLIYGPSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSFTFGPGTKVDIKR

서열번호 561

 

14027_LC [ hu 항-< huCDH19 > 4A2 (1-236)( N30Q,T102A,P141Q ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASRQISSSYLAWYQQKPGQAPRLLIYGPSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSFTFGQGTKVDIKR

서열번호 562

 

14028_LC [ hu 항-< huCDH19 > 4A2 (1-236)( N30Q,T102A,P141Q ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASRQISSSYLAWYQQKPGQAPRLLIYGPSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSFTFGQGTKVDIKR

서열번호 563

 

14029_LC [ hu 항-< huCDH19 > 4A2 (1-236)( R29Q,N30S ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSISSSYLAWYQQKPGQAPRLLIYGPSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFTVYYCQQYGSSFTFGPGTKVDIKR

서열번호 564

 

14030_LC [ hu 항-< huCDH19 > 4F3 VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSWTFGQGTKVEIKR

서열번호 565

 

14031_LC [ hu 항-< huCDH19 > 4F3 VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSWTFGQGTKVEIKR

서열번호 566

 

14032_LC [ hu 항-< huCDH19 > 4F3 VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSWTFGQGTKVEIKR

서열번호 567

 

14033_LC [ hu 항-< huCDH19 > 4F3 VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSWTFGQGTKVEIKR

서열번호 568

 

14034_LC [ hu 항-< huCDH19 > 4F3 VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSWTFGQGTKVEIKR

서열번호 569

 

14039_LC [ hu 항-< huCDH19 > 2G6 (1-234)( C42S,D110E ) VL ]

SYELTQPPSVSVSPGQTASITCSGDRLGEKYTSWYQQRPGQSPLLVIYQDTKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWESSTVVFGGGTKLTVLG

서열번호 570

 

14040_LC [ hu 항-< huCDH19 > 16C1 .1 (1-235)( H105Y ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISGLEPEDFAVYYCQQYGNSPLTFGGGTKVEIKR

서열번호 571

 

14041_LC [ hu 항-< huCDH19 > 16C1 .1 (1-235)( H105Y ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISGLEPEDFAVYYCQQYGNSPLTFGGGTKVEIKR

서열번호 572

 

14042_LC [ hu 항-< huCDH19 > 16C1 .1 (1-235)( H105Y ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISGLEPEDFAVYYCQQYGNSPLTFGGGTKVEIKR

서열번호 573

 

14043_LC [ hu 항-< huCDH19 > 16C1 .1 (1-235)( H105Y ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISGLEPEDFAVYYCQQYGNSPLTFGGGTKVEIKR

서열번호 574

 

14044_LC [ hu 항-< huCDH19 > 16C1 .1 (1-235)( G95R,H105Y,G141Q ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGNSPLTFGQGTKVEIKR

서열번호 575

 

14045_LC [ hu 항-< huCDH19 > 17H8 .2 (1-235)( G149R ) VL ]

DIVLTQSPGTLSLSPGERATLSCRASQSVAGSYLAWYQQKPGQAPRLLISGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGKSPITFGQGTRLEMKR

서열번호 576

 

14046_LC [ hu 항-< huCDH19 > 17H8 .2 (1-235)( G149R ) VL ]

DIVLTQSPGTLSLSPGERATLSCRASQSVAGSYLAWYQQKPGQAPRLLISGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGKSPITFGQGTRLEMKR

서열번호 577

 

14047_LC [ hu 항-< huCDH19 > 17H8 .2 (1-235)( G149R ) VL ]

DIVLTQSPGTLSLSPGERATLSCRASQSVAGSYLAWYQQKPGQAPRLLISGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGKSPITFGQGTRLEMKR

서열번호 578

 

14048_LC [ hu 항-< huCDH19 > 17H8 .2 (1-235)( S57Y,G149R ) VL ]

DIVLTQSPGTLSLSPGERATLSCRASQSVAGSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGKSPITFGQGTRLEMKR

서열번호 579

 

14049_LC [ hu 항-< huCDH19 > 4F7 (1-239)( H57Y ) VL ]

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGWVFGGGTRLTVLG

서열번호 580

 

14050_LC [ hu 항-< huCDH19 > 4F7 (1-239)( H57Y,D110E ) VL ]

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQS존재SLSGWVFGGGTRLTVLG

서열번호 581

 

14051_LC [ hu 항-< huCDH19 > 4F7 (1-239)( D110E ) VL ]

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYDVHWYQQLPGTAPKLLIHGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQS존재SLSGWVFGGGTRLTVLG

서열번호 582

 

14052_LC [ hu 항-< huCDH19 > 4B10 (1-236)( H45Q,A90T ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSNTYLAWYQQRPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQQYSNSWTFGQGTKVEIKR

서열번호 583

 

14053_LC [ hu 항-< huCDH19 > 4B10 (1-236)( H45Q,A90T ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSNTYLAWYQQRPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQQYSNSWTFGQGTKVEIKR

서열번호 584

 

14054_LC [ hu 항-< huCDH19 > 4B10 (1-236)( H45Q,A90T ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSNTYLAWYQQRPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQQYSNSWTFGQGTKVEIKR

서열번호 585

 

14055_LC [ hu 항-< huCDH19 > 4B10 (1-236)( H45Q,A90T ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSNTYLAWYQQRPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQQYSNSWTFGQGTKVEIKR

서열번호 586

 

14056_LC [ hu 항-< huCDH19 > 4A9 (1-239)( F47L ) VL ]

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYAVHWYQQLPGTAPKLLIYGNNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSRLSGWVFGGGTKLTVLG

서열번호 587

 

14057_LC [ hu 항-< huCDH19 > 4A9 (1-239)( F47L ) VL ]

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYAVHWYQQLPGTAPKLLIYGNNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSRLSGWVFGGGTKLTVLG

서열번호 588

 

14058_LC [ hu 항-< huCDH19 > 4A9 (1-239)( F47L,D110E ) VL ]

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYAVHWYQQLPGTAPKLLIYGNNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQS존재RLSGWVFGGGTKLTVLG

서열번호 589

 

14059_LC [ hu 항-< huCDH19 > 4A9 (1-239)( F47L,D110E ) VL ]

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYAVHWYQQLPGTAPKLLIYGNNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQS존재RLSGWVFGGGTKLTVLG

서열번호 590

 

14060_LC [ hu 항-< huCDH19 > 20D3 .1 (1-235)( S102A ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATWDDSLNGWVFGGGTKLTVLG

서열번호 591

 

14061_LC [ hu 항-< huCDH19 > 20D3 .1 (1-235)( K45Q,S102A ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATWDDSLNGWVFGGGTKLTVLG

서열번호 592

 

14062_LC [ hu 항-< huCDH19 > 20D3 .1 (1-235)( K45Q,S102A ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATWDDSLNGWVFGGGTKLTVLG

서열번호 593

 

14063_LC [ hu 항-< huCDH19 > 20D3 .1 (1-235)( K45Q,S102A,D111E,N135Q ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATWDESLQGWVFGGGTKLTVLG

서열번호 594

 

14064_LC [ hu 항-< huCDH19 > 20D3 .1 (1-235)( W109Y ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCATYDDSLNGWVFGGGTKLTVLG

서열번호 595

 

14065_LC [ hu 항-< huCDH19 > 22G10.1 VL ]

EIVMTQSPVTLSLSLGERATLSCRASQSISSNLAWFQQKPGQAPRLLIYGAFTRATGIPARVSGSGSGTEFTLTISSLQSEDFAVYYCQQYNYWPLTFGGGTKVEIKR

서열번호 596

 

14066_LC [ hu 항-< huCDH19 > 22G10.1 VL ]

EIVMTQSPVTLSLSLGERATLSCRASQSISSNLAWFQQKPGQAPRLLIYGAFTRATGIPARVSGSGSGTEFTLTISSLQSEDFAVYYCQQYNYWPLTFGGGTKVEIKR

서열번호 597

 

14067_LC [ hu 항-< huCDH19 > 22G10.1 (1-234)( Q97E,S98P ) VL ]

EIVMTQSPVTLSLSLGERATLSCRASQSISSNLAWFQQKPGQAPRLLIYGAFTRATGIPARVSGSGSGTEFTLTISSLEPEDFAVYYCQQYNYWPLTFGGGTKVEIKR

서열번호 598

 

14068_LC [ hu 항-< huCDH19 > 22G10.1 (1-234)( V78F,Q97E,S98P ) VL ]

EIVMTQSPVTLSLSLGERATLSCRASQSISSNLAWFQQKPGQAPRLLIYGAFTRATGIPARFSGSGSGTEFTLTISSLEPEDFAVYYCQQYNYWPLTFGGGTKVEIKR

서열번호 599

 

14069_LC [ hu 항-< huCDH19 > 22G10.1 (1-234)( V78F,Q97E,S98P ) VL ]

EIVMTQSPVTLSLSLGERATLSCRASQSISSNLAWFQQKPGQAPRLLIYGAFTRATGIPARFSGSGSGTEFTLTISSLEPEDFAVYYCQQYNYWPLTFGGGTKVEIKR

서열번호 600

 

14070_LC [ hu 항-< huCDH19 > 22G10.1 VL ]

EIVMTQSPVTLSLSLGERATLSCRASQSISSNLAWFQQKPGQAPRLLIYGAFTRATGIPARVSGSGSGTEFTLTISSLQSEDFAVYYCQQYNYWPLTFGGGTKVEIKR

서열번호 601

 

14071_LC [ hu 항-< huCDH19 > 16A4.1 (1-235)( G141Q ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGTSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPFTFGQGTKVEIKR

서열번호 602

 

14072_LC [ hu 항-< huCDH19 > 19B5 .1 (1-235)( K45Q,S102A ) VL ]

QSALTQPPSTTGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATWDDSMNGWVFGGGTKLTVLG

서열번호 603

 

14073_LC [ hu 항-< huCDH19 > 19B5 .1 (1-235)( K45Q,S102A ) VL ]

QSALTQPPSTTGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATWDDSMNGWVFGGGTKLTVLG

서열번호 604

 

14074_LC [ hu 항-< huCDH19 > 19B5 .1 (1-235)( T11V,K45Q,S102A ) VL ]

QSALTQPPSVTGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATWDDSMNGWVFGGGTKLTVLG

서열번호 605

 

14075_LC [ hu 항-< huCDH19 > 19B5 .1 (1-235)( T11V,K45Q,S102A,D111E,N135Q ) VL ]

QSALTQPPSVTGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATWDESMQGWVFGGGTKLTVLG

서열번호 606

 

14076_LC [ hu 항-< huCDH19 > 19B5 .1 (1-235)(T11V,K45Q,S102A,W109Y,D111E,N135Q) VL ]

QSALTQPPSVTGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATYDESMQGWVFGGGTKLTVLG

서열번호 607

 

14077_LC [ hu 항-< huCDH19 > 23A10.3 (1-231)( C42S ) VL ]

SYELTQPPSVSVSPGQTASITCSGDRLGEKYVSWYQQKPGQSPILVIYQDNKWPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVLG

서열번호 608

 

14078_LC [ hu 항-< huCDH19 > 23A10.3 (1-231)( C42S ) VL ]

SYELTQPPSVSVSPGQTASITCSGDRLGEKYVSWYQQKPGQSPILVIYQDNKWPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVLG

서열번호 609

 

14079_LC [ hu 항-< huCDH19 > 23A10.3 (1-231)( C42S,D110E ) VL ]

SYELTQPPSVSVSPGQTASITCSGDRLGEKYVSWYQQKPGQSPILVIYQDNKWPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWESSTVVFGGGTKLTVLG

서열번호 610

 

14080_LC [ hu 항-< huCDH19 > 23A10.3 (1-231)( C42Y ) VL ]

SYELTQPPSVSVSPGQTASITCSGDRLGEKYVYWYQQKPGQSPILVIYQDNKWPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVLG

서열번호 611

 

14081_LC [ hu 항-< huCDH19 > 25G10.1 (1-235)( H105Y ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGNSPLTFGGGTKVEIKR

서열번호 612

 

14082_LC [ hu 항-< huCDH19 > 25G10.1 (1-235)( H105Y ) VL ]

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGNSPLTFGGGTKVEIKR

서열번호 613

 

14083_LC [ hu 항-< huCDH19 > 26D1 .1 (1-235)( S7P ) VL ]

 

HSVLTQPPSASGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVWDDSLNGWVFGGGTKLTVLG

서열번호 614

 

14084_LC [ hu 항-< huCDH19 > 26D1 .1 (1-235)( H1Q,S7P ) VL ]

QSVLTQPPSASGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVWDDSLNGWVFGGGTKLTVLG

서열번호 615

 

14085_LC [ hu 항-< huCDH19 > 26D1 .1 (1-235)( H1Q,S7P,W109Y ) VL ]

QSVLTQPPSASGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVYDDSLNGWVFGGGTKLTVLG

서열번호 616

 

14086_LC [ hu 항-< huCDH19 > 26D1 .1 (1-235)( H1Q,S7P,W109Y,D111E,N135Q ) VL ]

QSVLTQPPSASGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVYDESLQGWVFGGGTKLTVLG

서열번호 617

 

14087_LC [ hu 항-< huCDH19 > 26D1 .1 (1-235)( H1Q,S7P,W109Y,D111E,N135Q ) VL ]

QSVLTQPPSASGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVYDESLQGWVFGGGTKLTVLG

서열번호 618

 

14088_LC [ hu 항-< huCDH19 > 26D1 .1 (1-235)( H1Q,S7P ) VL ]

QSVLTQPPSASGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVWDDSLNGWVFGGGTKLTVLG

서열번호 619

 

14089_LC [ hu 항-< huCDH19 > 26F12.1 (1-235)( S7P ) VL ]

QSVLTQPPSASGTPGQKVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNYQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVWDDSLNGWVFGGGTKLTVLG

서열번호 620

 

14090_LC [ hu 항-< huCDH19 > 26F12.1 (1-235)( S7P,D111E ) VL ]

QSVLTQPPSASGTPGQKVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNYQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVWDESLNGWVFGGGTKLTVLG

서열번호 621

 

14091_LC [ hu 항-< huCDH19 > 26F12.1 (1-235)( S7P,D111E ) VL ]

QSVLTQPPSASGTPGQKVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNYQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVWDESLNGWVFGGGTKLTVLG

서열번호 622

 

14092_LC [ hu 항-< huCDH19 > 26F12.1 (1-235)( S7P,W109Y,D111E,N135Q ) VL ]

QSVLTQPPSASGTPGQKVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNYQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVYDESLQGWVFGGGTKLTVLG

서열번호 623

 

14093_LC [ hu 항-< huCDH19 > 25F8.1 (1-235)( K45Q ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGRNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCAAWDDSLNGWVFGGGTKLTVLG

서열번호 624

 

14094_LC [ hu 항-< huCDH19 > 25F8.1 (1-235)( K45Q,S102A ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGRNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGWVFGGGTKLTVLG

서열번호 625

 

14095_LC [ hu 항-< huCDH19 > 25F8.1 (1-235)( K45Q,S102A ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGRNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGWVFGGGTKLTVLG

서열번호 626

 

14096_LC [ hu 항-< huCDH19 > 25F8.1 (1-235)( K45Q,S102A,D111E ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGRNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDESLNGWVFGGGTKLTVLG

서열번호 627

 

14097_LC [ hu 항-< huCDH19 > 25F8.1 (1-235)( K45Q,S102A,D111E,N135Q ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGRNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDESLQGWVFGGGTKLTVLG

서열번호 628

 

14098_LC [ hu 항-< huCDH19 > 22D1 .1 (1-235)( K45Q,S102A ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATWDDSMNGWVFGGGTKLTVLG

서열번호 629

 

14099_LC [ hu 항-< huCDH19 > 22D1 .1 (1-235)( K45Q,S102A,D111E,N135Q ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATWDESMQGWVFGGGTKLTVLG

서열번호 630

 

14100_LC [ hu 항-< huCDH19 > 22D1 .1 (1-235)(K45Q,S102A,W109Y,D111E,N135Q) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATYDESMQGWVFGGGTKLTVLG

서열번호 631

 

14101_LC [ hu 항-< huCDH19 > 22D1 .1 (1-235)( K45Q,S102A,W109Y ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATYDDSMNGWVFGGGTKLTVLG

서열번호 632

 

14102_LC [ hu 항-< huCDH19 > 22D1 .1 (1-235)( K45Q,S102A ) VL ]

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYQQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATWDDSMNGWVFGGGTKLTVLG

서열번호 633

 

13591_LC [ hu 항-< huCDH19 > 4F7 VL ]

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYDVHWYQQLPGTAPKLLIHGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGWVFGGGTRLTVLG

서열번호 634

 

14301_LC [ hu 항-< huCDH19 > 2G6 (1-234)( D110E ) VL ]

SYELTQPPSVSVSPGQTASITCSGDRLGEKYTCWYQQRPGQSPLLVIYQDTKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWESSTVVFGGGTKLTVLG

서열번호 635

 

14302_LC [ hu 항-< huCDH19 > 2G6 (1-234)( C42S,D110E ) VL ]

SYELTQPPSVSVSPGQTASITCSGDRLGEKYTSWYQQRPGQSPLLVIYQDTKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWESSTVVFGGGTKLTVLG

서열번호 636

 

14303_LC [ hu 항-< huCDH19 > 2G6 (1-234)( C42S,D110E ) VL ]

SYELTQPPSVSVSPGQTASITCSGDRLGEKYTSWYQQRPGQSPLLVIYQDTKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWESSTVVFGGGTKLTVLG

서열번호 637

 

14304_LC [ hu 항-< huCDH19 > 23A10.3 (1-231)( C42S ) VL ]

 

SYELTQPPSVSVSPGQTASITCSGDRLGEKYVSWYQQKPGQSPILVIYQDNKWPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVLG

서열번호 638

항- CDH19 가변 영역 및 불변 영역 폴리뉴클레오티드 및 아미노산 서열

IIIa : 중쇄 가변 영역 및 불변 영역 폴리뉴클레오티드 및 아미노산 서열

2G6

AACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 639

 

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIWYDGSNKYYADSVKDRFTISRDNSKNTLYLQMKSLRAEDTAVYYCARRAGIIGTIGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 640

 

4A2

CAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 641

 

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSSGYYWSWIRQHPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYFQYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 642

 

4A9

CCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 643

 

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWFAYFSYSGSTNYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 644

 

4B10

AGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 645

 

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVISYDGTNEYYADSVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERYFDWSFDYWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 646

 

4F3

AGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 647

 

QVQLVESGGGVVQPGRSLRLSCAASGFSFSSYDMDWVRQTPGKGLEWVAVIWYDGSNKYYADSVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGWYFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 648

 

4F7

CCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 649

 

QVQLQESGPGLVKPSETLSLTCTVSGGSISSYSWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 650

 

16A4

AACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 651

 

QVQLQESGPGLAKPSETLSLTCTVSGDSITSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDQRRIAAAGTHFYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 652

 

16C1

CAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 653

 

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLTLSSLTAADTAVYFCARDGSSGWYRWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 654

 

17H8

CAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 655

 

QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTALYYCARDSRYRSGWYDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 656

 

19B5

CAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 657

 

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 658

 

20D3

CAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 659

 

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 660

 

22D1

CAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 661

 

QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 662

 

22G10

AGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 663

 

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISSDNSKSTLYLQMNSLRAADTAVYHCAKGGMGGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 664

 

23A10

AACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 665

 

QVQLVESGGGVVQPGRSLRLSCAASGFTFSRYGIHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLLMNSLRAEDSAVYYCARRAGIPGTTGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 666

 

25F8

CAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 667

 

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 668

 

25G10

CAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 669

 

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYRWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

서열번호 670

 

26D1

CAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 671

 

QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 672

 

26F12

CAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA

서열번호 673

 

QVQLVQSGAEVKKPGASVKVSCKASRYTFTNYYMSWVRQAPGQGLEWMGIINPSGGDSTYAQKFQGRLTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 674

IIIb : 경쇄 가변 영역 및 불변 영역 폴리뉴클레오티드 및 아미노산 서열

2G6

TCCTATGAACTGACTCAGCCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCAGCATCACCTGCTCTGGAGATAGGTTGGGGGAAAAATATACTTGCTGGTATCAGCAGAGGCCAGGCCAGTCCCCTTTGCTGGTCATCTATCAAGATACCAAGCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGTAACACAGCCACTCTGACCATCAGCGGGACCCAGGCTATGGATGAGGCTGACTATTACTGTCAGGCGTGGGACAGCAGCACTGTGGTATTCGGCGGAGGGACCAAGCTGACCGTCCTAGGTCAGCCCAAGGCCAACCCCACTGTCACTCTGTTCCCGCCCTCCTCTGAGGAGCTCCAAGCCAACAAGGCCACACTAGTGTGTCTGATCAGTGACTTCTACCCGGGAGCTGTGACAGTGGCCTGGAAGGCAGATGGCAGCCCCGTCAAGGCGGGAGTGGAGACCACCAAACCCTCCAAACAGAGCAACAACAAGTACGCGGCCAGCAGCTACCTGAGCCTGACGCCCGAGCAGTGGAAGTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCATGA

서열번호 675

 

SYELTQPPSVSVSPGQTASITCSGDRLGEKYTCWYQQRPGQSPLLVIYQDTKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

서열번호 676

 

4A2

GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCGGAATATTAGCAGCAGCTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTCCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTACAGTGTATTACTGTCAGCAGTATGGTAGCTCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAACGTACGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTGA

서열번호 677

 

EIVLTQSPGTLSLSPGERATLSCRASRNISSSYLAWYQQKPGQAPRLLIYGPSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFTVYYCQQYGSSFTFGPGTKVDIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

서열번호 678

 

4A9

CAGTCTGTGCTGACGCAGCCGCCCTCAGTGTCTGGGGCCCCAGGACAGAGGGTCACCATCTCCTGCACTGGGAGCAGCTCCAACATCGGGACAGGTTATGCTGTACACTGGTACCAGCAGTTTCCAGGAACAGCCCCCAAACTCCTCATCTATGGTAACAACAATCGGCCCTCAGGGGTTCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCACTGGGCTCCAGGCTGAGGATGAGGCTGATTATTACTGCCAGTCCTATGACAGCAGACTGAGTGGTTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTAGGTCAGCCCAAGGCCAACCCCACTGTCACTCTGTTCCCGCCCTCCTCTGAGGAGCTCCAAGCCAACAAGGCCACACTAGTGTGTCTGATCAGTGACTTCTACCCGGGAGCTGTGACAGTGGCCTGGAAGGCAGATGGCAGCCCCGTCAAGGCGGGAGTGGAGACCACCAAACCCTCCAAACAGAGCAACAACAAGTACGCGGCCAGCAGCTACCTGAGCCTGACGCCCGAGCAGTGGAAGTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCATGA

서열번호 679

 

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYAVHWYQQFPGTAPKLLIYGNNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSRLSGWVFGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

서열번호 680

 

4B10

GAAATTGTATTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAACACCTACTTAGCCTGGTACCATCAGAGACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGCAGGGCCACTGGCATCCCAGACAGATTCAGTGGCAGTGGGTCTGGGACAGACTTCGCTCTCACCATCAGCAGTCTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAGTACAGTAACTCGTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTGA

서열번호 681

 

EIVLTQSPGTLSLSPGERATLSCRASQSVSNTYLAWYHQRPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFALTISSLEPEDFAVYYCQQYSNSWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

서열번호 682

 

4F3

GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGACTGGAACCTGAGGATTTTGCAGTGTATTACTGTCAGCAGTATGGTAGCTCGTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGTACGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTGA

서열번호 683

 

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

서열번호 684

 

4F7

CAGTCTGTGCTGACGCAGCCGCCCTCAGTGTCTGGGGCCCCAGGGCAGAGGGTCACCATCTCCTGCACTGGGAGCAGCTCCAATATCGGGACAGGTTATGATGTACACTGGTATCAGCAGCTTCCAGGAACAGCCCCCAAACTCCTCATCCATGGTAACAGCAATCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCACTGGGCTCCAGGCTGAGGATGAGGCTGATTATTACTGCCAGTCCTATGACAGCAGTCTGAGTGGTTGGGTGTTCGGCGGAGGGACCAGGTTGACCGTCCTAGGTCAGCCCAAGGCCAACCCCACTGTCACTCTGTTCCCGCCCTCCTCTGAGGAGCTCCAAGCCAACAAGGCCACACTAGTGTGTCTGATCAGTGACTTCTACCCGGGAGCTGTGACAGTGGCCTGGAAGGCAGATGGCAGCCCCGTCAAGGCGGGAGTGGAGACCACCAAACCCTCCAAACAGAGCAACAACAAGTACGCGGCCAGCAGCTACCTGAGCCTGACGCCCGAGCAGTGGAAGTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCATGA

서열번호 685

 

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYDVHWYQQLPGTAPKLLIHGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGWVFGGGTRLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

서열번호 686

 

16A4

GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGTTATTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTACATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTATTGTCAGCAGTACGGTAGCTCACCTTTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAACGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGTACCGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTGA

서열번호 687

 

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGTSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPFTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

서열번호 688

 

16C1

GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGCCAGAGTGTTAGCAGCAGCTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTTTGGTGCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCGGACTGGAGCCTGAAGATTTTGCAGTGTATCACTGTCAGCAGTATGGTAACTCACCGCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAACGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGTACCGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTGA

서열번호 689

 

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISGLEPEDFAVYHCQQYGNSPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

서열번호 690

 

17H8

GACATTGTATTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTGCCGGCAGCTACCTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTCTGGTGCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAGTATGGTAAATCACCGATCACCTTCGGCCAAGGGACACGACTGGAGATGAAAGGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGTACCGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTGA

서열번호 691

 

DIVLTQSPGTLSLSPGERATLSCRASQSVAGSYLAWYQQKPGQAPRLLISGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGKSPITFGQGTRLEMKGTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

서열번호 692

 

19B5

CAGTCTGCGCTGACTCAGCCACCCTCAACGACTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGAAGCAGGTCCAACATCGGAAGCAATTTTGTAAACTGGTACAAGCAGCTCCCAGGAACGGCCCCCAAAGTCCTCATCTATACTAATAATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGTCTGATTATTACTGCGCAACATGGGATGACAGTATGAATGGTTGGGTGTTCGGCGGAGGGACCAAACTGACCGTCCTAGGTCAGCCCAAGGCTGCCCCCTCGGTCACTCTGTTCCCACCCTCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACTGGTGTGTCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGTGGCCTGGAAGGCAGATAGCAGCCCCGTCAAGGCGGGAGTGGAGACCACCACACCCTCCAAACAAAGCAACAACAAGTACGCGGCCAGCAGCTATCTGAGCCTGACGCCTGAGCAGTGGAAGTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCATGA

서열번호 693

 

QSALTQPPSTTGTPGQRVTISCSGSRSNIGSNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCATWDDSMNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

서열번호 694

 

20D3

CAGTCTGCGCTGACTCAGCCACCCTCAGCGACTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGAAGCAGCTCCAACATCGGAAGCAATTTTGTAAACTGGTACAAGCAGCTCCCAGGAACGGCCCCCAAAGTCCTCATCTATACTAATAATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGTCTGATTATTACTGTGCAACATGGGATGACAGCCTGAATGGTTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTAGGTCAGCCCAAGGCTGCCCCCTCGGTCACTCTGTTCCCACCCTCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACTGGTGTGTCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGTGGCCTGGAAGGCAGATAGCAGCCCCGTCAAGGCGGGAGTGGAGACCACCACACCCTCCAAACAAAGCAACAACAAGTACGCGGCCAGCAGCTATCTGAGCCTGACGCCTGAGCAGTGGAAGTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCATGA

서열번호 695

 

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCATWDDSLNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

서열번호 696

 

22D1

CAGTCTGCGCTGACTCAGCCACCCTCAGCGACTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGAAGCAGCTCCAACATCGGAAGCAATTTTGTAAACTGGTACAAGCAGCTCCCAGGAACGGCCCCCAAAGTCCTCATCTATACTAATAATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGTCTGATTATTACTGTGCAACATGGGATGACAGTATGAATGGTTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTAGGTCAGCCCAAGGCTGCCCCCTCGGTCACTCTGTTCCCACCCTCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACTGGTGTGTCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGTGGCCTGGAAGGCAGATAGCAGCCCCGTCAAGGCGGGAGTGGAGACCACCACACCCTCCAAACAAAGCAACAACAAGTACGCGGCCAGCAGCTATCTGAGCCTGACGCCTGAGCAGTGGAAGTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCATGA

서열번호 697

 

QSALTQPPSATGTPGQRVTISCSGSSSNIGSNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCATWDDSMNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

서열번호 698

 

22G10

GAAATAGTGATGACGCAGTCTCCAGTCACCCTGTCTCTGTCTCTAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTATTAGCAGCAACTTAGCCTGGTTCCAGCAGAAACCTGGCCAGGCTCCCAGACTCCTCATCTATGGTGCATTTACCAGGGCCACTGGTATCCCAGCCAGGGTCAGTGGCAGTGGGTCTGGGACAGAGTTCACTCTCACCATCAGCAGCCTGCAGTCTGAAGATTTTGCAGTTTATTACTGTCAGCAGTATAATTACTGGCCGCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAGCGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGTACCGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTGA

서열번호 699

 

EIVMTQSPVTLSLSLGERATLSCRASQSISSNLAWFQQKPGQAPRLLIYGAFTRATGIPARVSGSGSGTEFTLTISSLQSEDFAVYYCQQYNYWPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

서열번호 700

 

23A10

TCCTATGAGCTGACTCAGCCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCAGCATCACCTGCTCTGGAGATAGATTGGGGGAGAAATATGTTTGCTGGTATCAGCAGAAGCCAGGCCAGTCCCCTATACTGGTCATCTATCAAGATAATAAGTGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACAGCCACTCTGACCATCAGCGGGACCCAGGCTATGGATGAGGCTGACTATTACTGTCAGGCGTGGGACAGCAGCACTGTGGTATTCGGCGGGGGGACCAAGCTGACCGTCCTAGGTCAGCCCAAGGCTGCCCCCTCGGTCACTCTGTTCCCACCCTCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACTGGTGTGTCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGTGGCCTGGAAGGCAGATAGCAGCCCCGTCAAGGCGGGAGTGGAGACCACCACACCCTCCAAACAAAGCAACAACAAGTACGCGGCCAGCAGCTATCTGAGCCTGACGCCTGAGCAGTGGAAGTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCATGA

서열번호 701

 

SYELTQPPSVSVSPGQTASITCSGDRLGEKYVCWYQQKPGQSPILVIYQDNKWPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

서열번호 702

 

25F8

CAGTCTGCGCTGACTCAGCCACCCTCAGCGACTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGAAGCAGCTCCAACATCGGAAGGAATTTTGTAAACTGGTATAAGCAGCTCCCAGGAACGGCCCCCAAAGTCCTCATTTATACTAATAATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGTCTGATTATTACTGTGCAGCATGGGATGACAGCCTGAATGGTTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTAGGTCAGCCCAAGGCTGCCCCCTCGGTCACTCTGTTCCCACCCTCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACTGGTGTGTCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGTGGCCTGGAAGGCAGATAGCAGCCCCGTCAAGGCGGGAGTGGAGACCACCACACCCTCCAAACAAAGCAACAACAAGTACGCGGCCAGCAGCTATCTGAGCCTGACGCCTGAGCAGTGGAAGTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCATGA

서열번호 703

 

QSALTQPPSATGTPGQRVTISCSGSSSNIGRNFVNWYKQLPGTAPKVLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDESDYYCAAWDDSLNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

서열번호 704

 

25G10

GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTTTGGTGCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATCACTGTCAGCAGTATGGTAACTCACCGCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAACGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGTACCGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTGA

서열번호 705

 

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYHCQQYGNSPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

서열번호 706

 

26D1

CACTCTGTGCTGACTCAGTCACCCTCAGCGTCTGGGACCCCCGGACAGAGGGTCACCATCTCTTGTTCTGGAAGCCGCTCCAACATCGGAAGTAATTTTGTAAACTGGTACCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTATACTAATAATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGGCTGATTATTACTGTGCAGTATGGGATGACAGCCTGAATGGTTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTAGGTCAGCCCAAGGCTGCCCCCTCGGTCACTCTGTTCCCACCCTCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACTGGTGTGTCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGTGGCCTGGAAGGCAGATAGCAGCCCCGTCAAGGCGGGAGTGGAGACCACCACACCCTCCAAACAAAGCAACAACAAGTACGCGGCCAGCAGCTATCTGAGCCTGACGCCTGAGCAGTGGAAGTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCATGA

서열번호 707

 

HSVLTQSPSASGTPGQRVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVWDDSLNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

서열번호 708

 

26F12

CAGTCTGTGCTGACTCAGTCACCCTCAGCGTCTGGGACCCCCGGGCAGAAGGTCACCATCTCTTGTTCTGGAAGCCGCTCCAACATCGGAAGTAATTTTGTAAACTGGTACCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTATACTAATTATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGGCTGATTATTACTGTGCAGTATGGGATGACAGCCTGAATGGTTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTAGGTCAGCCCAAGGCTGCCCCCTCGGTCACTCTGTTCCCACCCTCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACTGGTGTGTCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGTGGCCTGGAAGGCAGATAGCAGCCCCGTCAAGGCGGGAGTGGAGACCACCACACCCTCCAAACAAAGCAACAACAAGTACGCGGCCAGCAGCTATCTGAGCCTGACGCCTGAGCAGTGGAAGTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCATGA

서열번호 709

 

QSVLTQSPSASGTPGQKVTISCSGSRSNIGSNFVNWYQQLPGTAPKLLIYTNYQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAVWDDSLNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

서열번호 710

IIIc : 중쇄 가변 영역 및 불변 영역 폴리뉴클레오티드 및 아미노산 서열

13586_HC [ hu 항-< huCDH19 > 4F3 VH ]:: huIgG1z

QVQLVESGGGVVQPGRSLRLSCAASGFSFSSYDMDWVRQTPGKGLEWVAVIWYDGSNKYYADSVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGWYFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 711

 

13589_HC [ hu 항-< huCDH19 > 4A9 VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWFAYFSYSGSTNYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 712

 

13590_HC [ hu 항-< huCDH19 > 4B10 VH ]:: huIgG1z

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVISYDGTNEYYADSVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERYFDWSFDYWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 713

 

13874_HC [ hu 항-< huCDH19 > 17H8 .2 VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTALYYCARDSRYRSGWYDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 714

 

13875_HC [ hu 항-< huCDH19 > 16C1 .1 VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLTLSSLTAADTAVYFCARDGSSGWYRWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 715

 

13876_HC [ hu 항-< huCDH19 > 16A4.1 VH ]:: huIgG1z

QVQLQESGPGLAKPSETLSLTCTVSGDSITSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDQRRIAAAGTHFYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 716

 

13877_HC [ hu 항-< huCDH19 > 22G10.1 VH ]:: huIgG1z

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISSDNSKSTLYLQMNSLRAADTAVYHCAKGGMGGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 717

 

13878_HC [ hu 항-< huCDH19 > 20D3 .1 VH ]:: huIgG1z

 

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 718

 

13879_HC [ hu 항-< huCDH19 > 22D1 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 719

 

13880_HC [ hu 항-< huCDH19 > 25F8.1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 720

 

13881_HC [ hu 항-< huCDH19 > 26F12.1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASRYTFTNYYMSWVRQAPGQGLEWMGIINPSGGDSTYAQKFQGRLTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 721

 

13882_HC [ hu 항-< huCDH19 > 26D1 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 722

 

13883_HC [ hu 항-< huCDH19 > 25G10.1 VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYRWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 723

 

13885_HC [ hu 항-< huCDH19 > 19B5 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 724

 

14022_HC [ hu 항-< huCDH19 > 4A2 VH ]:: huIgG1z

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSSGYYWSWIRQHPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYFQYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 725

 

14024_HC [ hu 항-< huCDH19 > 4A2 (1-472)( Q17E,H47P ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISSSGYYWSWIRQPPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYFQYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 726

 

14025_HC [ hu 항-< huCDH19 > 4A2 VH ]:: huIgG1z

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSSGYYWSWIRQHPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYFQYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 727

 

14026_HC [ hu 항-< huCDH19 > 4A2 (1-472)( Q17E,H47P ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISSSGYYWSWIRQPPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYFQYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 728

 

14027_HC [ hu 항-< huCDH19 > 4A2 (1-472)( Q17E,H47P,D111E ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISSSGYYWSWIRQPPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAREGSSGWYFQYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 729

 

14028_HC [ hu 항-< huCDH19 > 4A2 (1-472)( Q17E,H47P,D111E,W134Y ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISSSGYYWSWIRQPPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAREGSSGYYFQYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 730

 

14029_HC [ hu 항-< huCDH19 > 4A2 VH ]:: huIgG1z

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSSGYYWSWIRQHPGKGLEWIGYIYYTGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYFQYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 731

 

14030_HC [ hu 항-< huCDH19 > 4F3 (1-471)( R17G ) VH ]:: huIgG1z

QVQLVESGGGVVQPGGSLRLSCAASGFSFSSYDMDWVRQTPGKGLEWVAVIWYDGSNKYYADSVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGWYFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 732

 

14031_HC [ hu 항-< huCDH19 > 4F3 (1-471)( R17G,T47A ) VH ]:: huIgG1z

QVQLVESGGGVVQPGGSLRLSCAASGFSFSSYDMDWVRQAPGKGLEWVAVIWYDGSNKYYADSVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGWYFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 733

 

14032_HC [ hu 항-< huCDH19 > 4F3 (1-471)( R17G,T47A,R141Q ) VH ]:: huIgG1z

QVQLVESGGGVVQPGGSLRLSCAASGFSFSSYDMDWVRQAPGKGLEWVAVIWYDGSNKYYADSVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGWYFDLWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 734

 

14033_HC [ hu 항-< huCDH19 > 4F3 (1-471)( R17G,T47A,D61E,D72E,R141Q ) VH ]:: huIgG1z

QVQLVESGGGVVQPGGSLRLSCAASGFSFSSYDMDWVRQAPGKGLEWVAVIWYEGSNKYYAESVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGWYFDLWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 735

 

14034_HC [ hu 항-< huCDH19 > 4F3 (1-471)(R17G,T47A,D61E,D72E,W134Y,R141Q) VH ]:: huIgG1z

QVQLVESGGGVVQPGGSLRLSCAASGFSFSSYDMDWVRQAPGKGLEWVAVIWYEGSNKYYAESVRGRFTISRDNSKNTLFLQMNSLRVEDTAVYYCARETGEGYYFDLWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 736

 

14039_HC [ hu 항-< huCDH19 > 2G6 (1-477)( R17G,D61E,D72E,K94N ) VH ]:: huIgG1z

QVQLVESGGGVVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIWYEGSNKYYAESVKDRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARRAGIIGTIGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 737

 

14040_HC [ hu 항-< huCDH19 > 16C1 .1 VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLTLSSLTAADTAVYFCARDGSSGWYRWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 738

 

14041_HC [ hu 항-< huCDH19 > 16C1 .1 (1-469)( T92K ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLKLSSLTAADTAVYFCARDGSSGWYRWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 739

 

14042_HC [ hu 항-< huCDH19 > 16C1 .1 (1-469)( T92K,D109E ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLKLSSLTAADTAVYFCAREGSSGWYRWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 740

 

14043_HC [ hu 항-< huCDH19 > 16C1 .1 (1-469)( T92K,W132Y,W135Y ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLKLSSLTAADTAVYFCARDGSSGYYRYFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 741

 

14044_HC [ hu 항-< huCDH19 > 16C1 .1 (1-469)( T92K ) VH ]:: huIgG1z

 

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSIDTSKNQFSLKLSSLTAADTAVYFCARDGSSGWYRWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 742

 

14045_HC [ hu 항-< huCDH19 > 17H8 .2 VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTALYYCARDSRYRSGWYDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 743

 

14046_HC [ hu 항-< huCDH19 > 17H8 .2 (1-471)( D109E ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTALYYCARESRYRSGWYDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 744

 

14047_HC [ hu 항-< huCDH19 > 17H8 .2 (1-471)( D109E,W132Y ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTALYYCARESRYRSGYYDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 745

 

14048_HC [ hu 항-< huCDH19 > 17H8 .2 (1-471)( D109E ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTALYYCARESRYRSGWYDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 746

 

14049_HC [ hu 항-< huCDH19 > 4F7 VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISSYSWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 747

 

14050_HC [ hu 항-< huCDH19 > 4F7 VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISSYSWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 748

 

14051_HC [ hu 항-< huCDH19 > 4F7 (1-468)( W113Y ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISSYSWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAVYYCARNYAFHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 749

 

14052_HC [ hu 항-< huCDH19 > 4B10 (1-471)( R17G,D61E,D72E,W134Y ) VH ]:: huIgG1z

QVQLVESGGGVVQPGGSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVISYEGTNEYYAESVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERYFDYSFDYWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 750

 

14053_HC [ hu 항-< huCDH19 > 4B10 VH ]:: huIgG1z

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVISYDGTNEYYADSVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERYFDWSFDYWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 751

 

14054_HC [ hu 항-< huCDH19 > 4B10 (1-471)( R17G ) VH ]:: huIgG1z

QVQLVESGGGVVQPGGSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVISYDGTNEYYADSVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERYFDWSFDYWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 752

 

14055_HC [ hu 항-< huCDH19 > 4B10 (1-471)( R17G,D61E,D72E ) VH ]:: huIgG1z

QVQLVESGGGVVQPGGSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVAVISYEGTNEYYAESVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERYFDWSFDYWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 753

 

14056_HC [ hu 항-< huCDH19 > 4A9 VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWFAYFSYSGSTNYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 754

 

14057_HC [ hu 항-< huCDH19 > 4A9 (1-468)( F55I,A56G ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYFSYSGSTNYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 755

 

14058_HC [ hu 항-< huCDH19 > 4A9 (1-468)( F55I,A56G ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYFSYSGSTNYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 756

 

14059_HC [ hu 항-< huCDH19 > 4A9 (1-468)( F55I,A56G,W113Y ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYFSYSGSTNYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCARNYAFHFDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 757

 

14060_HC [ hu 항-< huCDH19 > 20D3 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 758

 

14061_HC [ hu 항-< huCDH19 > 20D3 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 759

 

14062_HC [ hu 항-< huCDH19 > 20D3 .1 (1-469)( W133Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 760

 

14063_HC [ hu 항-< huCDH19 > 20D3 .1 (1-469)( W133Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 761

 

14064_HC [ hu 항-< huCDH19 > 20D3 .1 (1-469)( W133Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 762

 

14065_HC [ hu 항-< huCDH19 > 22G10.1 (1-470)( S82R,A99E ) VH ]:: huIgG1z

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISRDNSKSTLYLQMNSLRAEDTAVYHCAKGGMGGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 763

 

14066_HC [ hu 항-< huCDH19 > 22G10.1 (1-470)( A99E,H105Y ) VH ]:: huIgG1z

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISSDNSKSTLYLQMNSLRAEDTAVYYCAKGGMGGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 764

 

14067_HC [ hu 항-< huCDH19 > 22G10.1 (1-470)( A99E ) VH ]:: huIgG1z

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISSDNSKSTLYLQMNSLRAEDTAVYHCAKGGMGGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 765

 

14068_HC [ hu 항-< huCDH19 > 22G10.1 (1-470)( A99E ) VH ]:: huIgG1z

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISSDNSKSTLYLQMNSLRAEDTAVYHCAKGGMGGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 766

 

14069_HC [ hu 항-< huCDH19 > 22G10.1 (1-470)( D72E,A99E ) VH ]:: huIgG1z

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYAESVKGRFTISSDNSKSTLYLQMNSLRAEDTAVYHCAKGGMGGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 767

 

14070_HC [ hu 항-< huCDH19 > 22G10.1 (1-470)( H105Y ) VH ]:: huIgG1z

EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSTISGGGANTYYADSVKGRFTISSDNSKSTLYLQMNSLRAADTAVYYCAKGGMGGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 768

 

14071_HC [ hu 항-< huCDH19 > 16A4.1 (1-474)( T144L ) VH ]:: huIgG1z

QVQLQESGPGLAKPSETLSLTCTVSGDSITSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDQRRIAAAGTHFYGMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 769

 

14072_HC [ hu 항-< huCDH19 > 19B5 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 770

 

14073_HC [ hu 항-< huCDH19 > 19B5 .1 (1-469)( W133Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 771

 

14074_HC [ hu 항-< huCDH19 > 19B5 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 772

 

14075_HC [ hu 항-< huCDH19 > 19B5 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 773

 

14076_HC [ hu 항-< huCDH19 > 19B5 .1 (1-469)( W133Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 774

 

14077_HC [ hu 항-< huCDH19 > 23A10.3 (1-474)( L92Q ) VH ]:: huIgG1z

QVQLVESGGGVVQPGRSLRLSCAASGFTFSRYGIHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDSAVYYCARRAGIPGTTGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 775

 

14078_HC [ hu 항-< huCDH19 > 23A10.3 (1-474)( R17G,L92Q ) VH ]:: huIgG1z

QVQLVESGGGVVQPGGSLRLSCAASGFTFSRYGIHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDSAVYYCARRAGIPGTTGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 776

 

14079_HC [ hu 항-< huCDH19 > 23A10.3 (1-474)( R17G,D61E,D72E,L92Q ) VH ]:: huIgG1z

QVQLVESGGGVVQPGGSLRLSCAASGFTFSRYGIHWVRQAPGKGLEWVAVIWYEGSNKYYAESVKGRFTISRDNSKNTLYLQMNSLRAEDSAVYYCARRAGIPGTTGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 777

 

14080_HC [ hu 항-< huCDH19 > 23A10.3 VH ]:: huIgG1z

QVQLVESGGGVVQPGRSLRLSCAASGFTFSRYGIHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLLMNSLRAEDSAVYYCARRAGIPGTTGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 778

 

14081_HC [ hu 항-< huCDH19 > 25G10.1 VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARDGSSGWYRWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 779

 

14082_HC [ hu 항-< huCDH19 > 25G10.1 (1-469)( D109E,W132Y,W135Y ) VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISGYYWSWIRQPPGKGLEWIGYIYYIGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAREGSSGYYRYFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 780

 

14083_HC [ hu 항-< huCDH19 > 26D1 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 781

 

14084_HC [ hu 항-< huCDH19 > 26D1 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 782

 

14085_HC [ hu 항-< huCDH19 > 26D1 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 783

 

14086_HC [ hu 항-< huCDH19 > 26D1 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 784

 

14087_HC [ hu 항-< huCDH19 > 26D1 .1 (1-469)( W133Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASRYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIKLYLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 785

 

14088_HC [ hu 항-< huCDH19 > 26D1 .1 (1-469)( R27G,G82R ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMSWVRQAPGQGLEWMGIIHPSGGDTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGIKLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 786

 

14089_HC [ hu 항-< huCDH19 > 26F12.1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASRYTFTNYYMSWVRQAPGQGLEWMGIINPSGGDSTYAQKFQGRLTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 787

 

14090_HC [ hu 항-< huCDH19 > 26F12.1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASRYTFTNYYMSWVRQAPGQGLEWMGIINPSGGDSTYAQKFQGRLTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 788

 

14091_HC [ hu 항-< huCDH19 > 26F12.1 (1-469)( W133Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASRYTFTNYYMSWVRQAPGQGLEWMGIINPSGGDSTYAQKFQGRLTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIQLYLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 789

 

14092_HC [ hu 항-< huCDH19 > 26F12.1 (1-469)( W133Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASRYTFTNYYMSWVRQAPGQGLEWMGIINPSGGDSTYAQKFQGRLTMTGDTSTSTVYMELSSLRSEDTAVYYCARGGIQLYLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 790

 

14093_HC [ hu 항-< huCDH19 > 25F8.1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 791

 

14094_HC [ hu 항-< huCDH19 > 25F8.1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 792

 

14095_HC [ hu 항-< huCDH19 > 25F8.1 (1-469)( F90Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 793

 

14096_HC [ hu 항-< huCDH19 > 25F8.1 (1-469)( F90Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 794

 

14097_HC [ hu 항-< huCDH19 > 25F8.1 (1-469)( F90Y,W133Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPSGGSTRYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGIQLYLHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 795

 

14098_HC [ hu 항-< huCDH19 > 22D1 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 796

 

14099_HC [ hu 항-< huCDH19 > 22D1 .1 VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 797

 

14100_HC [ hu 항-< huCDH19 > 22D1 .1 (1-469)( W133Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 798

 

14101_HC [ hu 항-< huCDH19 > 22D1 .1 (1-469)( W133Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVFMELSSLRSEDTAVYYCARGGIQLYLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 799

 

14102_HC [ hu 항-< huCDH19 > 22D1 .1 (1-469)( F90Y ) VH ]:: huIgG1z

QVQLVQSGAEVKKPGASVRVSCKVSGYTFTSYFIHWVRQAPGQGLEWMGIINPISVSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGIQLWLHLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 800

 

13591_HC [ hu 항-< huCDH19 > 4F7 VH ]:: huIgG1z

QVQLQESGPGLVKPSETLSLTCTVSGGSISSYSWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAVYYCARNWAFHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 801

 

14301_HC [ hu 항-< huCDH19 > 2G6 VH ]:: huIgG1z

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIWYDGSNKYYADSVKDRFTISRDNSKNTLYLQMKSLRAEDTAVYYCARRAGIIGTIGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 802

 

14302_HC [ hu 항-< huCDH19 > 2G6 (1-477)( R17G,K94N ) VH ]:: huIgG1z

QVQLVESGGGVVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIWYDGSNKYYADSVKDRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARRAGIIGTIGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 803

 

14303_HC [ hu 항-< huCDH19 > 2G6 (1-477)( D61E,D72E ) VH ]:: huIgG1z

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIWYEGSNKYYAESVKDRFTISRDNSKNTLYLQMKSLRAEDTAVYYCARRAGIIGTIGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 804

 

14304_HC [ hu 항-< huCDH19 > 2G6 (1-477)( R17G ) VH ]:: huIgG1z

QVQLVESGGGVVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIWYDGSNKYYADSVKDRFTISRDNSKNTLYLQMKSLRAEDTAVYYCARRAGIIGTIGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

서열번호 805

IIId : 경쇄 가변 영역 및 불변 영역 폴리뉴클레오티드 및 아미노산 서열

13586_LC [ hu 항-< huCDH19 > 4F3 VL ]:: huKLC

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

서열번호 806

 

13589_LC [ hu 항-< huCDH19 > 4A9 VL ]:: huLLC -C1

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGTGYAVHWYQQFPGTAPKLLIYGNNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSRLSGWVFGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

서열번호 807

 

13590_LC [ hu 항-< huCDH19 > 4B10 VL ]:: huKLC

EIVLTQSPGTLSLSPGERATLSCRASQSVSNTYLAWYHQRPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFALTISSLEPEDFAVYYCQQYSNSWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

서열번호 808

 

13874_LC [ hu 항-< huCDH19 > 17H8 .2 VL ]:: huKLC

DIVLTQSPGTLSLSPGERATLSCRASQSVAGSYLAWYQQKPGQAPRLLISGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGKSPITFGQGTRLEMKGTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

서열번호 809

 

13875_LC [ hu 항-< huCDH19 > 16C1 .1 VL ]:: huKLC

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIFGASSRATGIPDRFSGSGSGTDFTLTISGLEPEDFAVYHCQQYGNSPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

서열번호 810

 

13876_LC [ hu 항-< huCDH19 > 16A4.1 VL ]:: huKLC

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGTSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPFTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

서열번호 811