KR102168747B1 - Monoclonal Antibodies for detecting Foot and Mouth Disease Virus and using the same - Google Patents

Monoclonal Antibodies for detecting Foot and Mouth Disease Virus and using the same Download PDF

Info

Publication number
KR102168747B1
KR102168747B1 KR1020180143947A KR20180143947A KR102168747B1 KR 102168747 B1 KR102168747 B1 KR 102168747B1 KR 1020180143947 A KR1020180143947 A KR 1020180143947A KR 20180143947 A KR20180143947 A KR 20180143947A KR 102168747 B1 KR102168747 B1 KR 102168747B1
Authority
KR
South Korea
Prior art keywords
seq
chain variable
variable region
antibody
complementarity determining
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
KR1020180143947A
Other languages
Korean (ko)
Other versions
KR20200059381A (en
Inventor
구복경
나진주
유소윤
신문균
위성환
장상호
서승관
박경민
박성진
이은선
민동숙
오진식
정광면
Original Assignee
주식회사 메디안디노스틱
대한민국(농림축산식품부 농림축산검역본부장)
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 메디안디노스틱, 대한민국(농림축산식품부 농림축산검역본부장) filed Critical 주식회사 메디안디노스틱
Priority to KR1020180143947A priority Critical patent/KR102168747B1/en
Publication of KR20200059381A publication Critical patent/KR20200059381A/en
Application granted granted Critical
Publication of KR102168747B1 publication Critical patent/KR102168747B1/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • C07K16/1009Picornaviridae, e.g. hepatitis A virus
    • C07K16/106
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/10Cells modified by introduction of foreign genetic material
    • C12N5/12Fused cells, e.g. hybridomas
    • C12N5/16Animal cells
    • C12N5/163Animal cells one of the fusion partners being a B or a T lymphocyte
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56983Viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • C12N2510/02Cells for production
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/005Assays involving biological materials from specific organisms or of a specific nature from viruses
    • G01N2333/08RNA viruses
    • G01N2333/085Picornaviridae, e.g. coxsackie virus, echovirus, enterovirus
    • G01N2333/09Foot-and-mouth disease virus

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Biomedical Technology (AREA)
  • Genetics & Genomics (AREA)
  • Biotechnology (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Urology & Nephrology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • Hematology (AREA)
  • Cell Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • General Engineering & Computer Science (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Communicable Diseases (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

본 발명은 구제역 바이러스 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 를 모두 감지할 수 있는 특이 단일클론항체 및 이를 이용한 구제역 바이러스 탐지용 조성물 및 키트에 관한 것으로, 구제역 바이러스 혈청형과 상관없이 구제역 발병 시 질병의 확산 방지를 위한 신속하고 정확한 초기 예방 조치를 수행할 수 있다.The present invention relates to a specific monoclonal antibody capable of detecting both foot-and-mouth disease virus serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3, and a composition and kit for detecting foot-and-mouth disease virus using the same, correlated with foot-and-mouth disease virus serotype Without foot-and-mouth disease, rapid and accurate initial preventive measures can be performed to prevent the spread of the disease.

Figure R1020180143947
Figure R1020180143947

Description

구제역 바이러스 탐지용 단일클론항체 및 이의 용도{Monoclonal Antibodies for detecting Foot and Mouth Disease Virus and using the same}Monoclonal Antibodies for detecting Foot and Mouth Disease Virus and using the same}

본 발명은 구제역 바이러스(Foot and Mouth Disease Virus; 이하, FMDV) 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 동시 탐지용 단일클론항체, 상기 단일클론항체를 이용한 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 동시 탐지 방법 및 상기 단일클론항체를 이용한 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 동시 탐지용 키트에 관한 것이다. The present invention is a monoclonal antibody for simultaneous detection of Foot and Mouth Disease Virus (FMDV) serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3, FMDV serotypes O, A using the monoclonal antibody. , Asia1, C, SAT1, SAT2 and SAT3 simultaneous detection method and a kit for simultaneous detection of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 using the monoclonal antibody.

구제역 바이러스(Foot and Mouth Disease Virus; 이하, FMDV)는 Picornaviridae, aphthovirus에 속하는 RNA 바이러스로써 전세계적으로 7종의 혈청형(O, A, Asia1, C, SAT1, SAT2, SAT3)과 70여종의 아형 바이러스가 분포하고 있다. FMDV에 감염된 개체(우제류 등)는 혀, 점막, 발굽 사이에 수포 및 가피를 형성하며 이병율이 높아 OIE에서 List A질병으로 분류하고 있고, 국내에서도 제 1종 법정 전염병으로 분류하고 있다. Foot and Mouth Disease Virus (FMDV) is an RNA virus belonging to Picornaviridae and aphthovirus, with 7 serotypes (O, A, Asia1, C, SAT1, SAT2, SAT3) and 70 subtypes worldwide. Viruses are spreading. Individuals infected with FMDV (e.g., cowfish) form blisters and crusts between the tongue, mucous membranes, and hoofs, and are classified as List A diseases by the OIE because of their high morbidity rate, and are classified as type 1 legal infectious diseases in Korea.

국내에서는 2000년 이후 2 내지 5년을 주기로 8차례 구제역이 발생하여 막대한 경제적 피해(예를 들어, 2010년 안동에서 발생된 경우 직접적 피해규모 약 3조원 추정)가 초래되었으며, 가장 최근에는 2014년 12월부터 2015년 4월까지 7개 시도에서 약 185건, 2016년도 1월 내지 3월 사이 21건의 구제역이 발생된 바 있다.In Korea, foot-and-mouth disease occurred 8 times every 2 to 5 years after 2000, causing enormous economic damage (for example, if it occurred in Andong in 2010, the amount of direct damage was estimated to be about 3 trillion won), and most recently, 12 in 2014. There were about 185 cases of foot-and-mouth disease in 7 provinces from May to April 2015, and 21 cases between January and March 2016.

현재 구제역 바이러스 항원을 진단하는 방법으로는 크게 유전자 검출 방법과 바이러스 단백질 항원을 검출하는 방법으로 나눌 수 있다. 유전자 검출방법으로는 리얼타임 RT-PCR 또는 일반적인 RT-PCR 등이 있으며, 단백질을 검출하는 방법으로는 항원 효소면역측정법(Antigen detecting Enzyme Linked Immunosorbent Assay, Ag-ELISA), 래피드 키트(immunochromatographic assay) 등을 들 수 있다.Currently, methods for diagnosing foot-and-mouth disease virus antigens can be largely divided into gene detection methods and viral protein antigen detection methods. Gene detection methods include real-time RT-PCR or general RT-PCR, and proteins detection methods include Antigen detecting Enzyme Linked Immunosorbent Assay (Ag-ELISA), and rapid kit (immunochromatographic assay). Can be mentioned.

리얼타임 RT-PCR의 경우, 구제역 바이러스 검출 민감도가 가장 높은 방법으로써, 감염의심 시료(혈액, 타액, 정액, 조직 등)를 실험실로 수송하여, 특수 차폐 실험실 내(생물안전 3등급 실험실)에서 시료로부터 총 RNA를 채취하여, 형광 검출 리얼타임 PCR 기기로 구제역 바이러스 특이 유전자 증폭을 수행하여, 구제역 양성 여부를 확인하는데 사용되나, RNA 추출부터 리얼타임 PCR을 작동하는 단계까지 상당한 숙련된 연구자가 요구되며, 특수 실험실 및 고가의 시약과 장비가 필요하다.In the case of real-time RT-PCR, it is the method with the highest sensitivity to detection of foot-and-mouth disease virus, and transports suspicious samples (blood, saliva, semen, tissue, etc.) to the laboratory and samples in a special shielded laboratory (Biosafety Level 3 laboratory). It is used to confirm whether foot-and-mouth disease is positive by collecting total RNA from and performing amplification of foot-and-mouth disease virus-specific genes with a fluorescence detection real-time PCR device.However, considerable skilled researchers are required from RNA extraction to the step of operating real-time PCR. In addition, special laboratories and expensive reagents and equipment are required.

항원항체 반응을 이용하는 효소면역측정법(ELISA,Enymne Linked Immunosorbent Assay)의 경우, 구제역 양성을 판정함과 동시에 혈청형까지 분석할 수 있는 방법으로써 다량의 검체를 동시에 진단할 수 있어 herd 진단에 유용하다. 현재 우리나라를 포함한 전세계적으로 사용되고 있는 OIE 표준 항원 ELISA 키트(Pirbright, IZSLER사)는 두당 약 10만원 상당의 아주 고가이며, 공급이 원활하지 못해 현재 지방자치단체 구제역 정밀진단기관에서 사용이 어려운 실정이다.In the case of the enzyme immunoassay (ELISA, Enymne Linked Immunosorbent Assay), which uses an antigen-antibody reaction, it is a method that can detect positive foot-and-mouth disease and analyze serotypes at the same time, and it is useful for diagnosing herd because it can simultaneously diagnose a large number of samples. The OIE standard antigen ELISA kit (Pirbright, IZSLER), which is currently used worldwide, including Korea, is very expensive, worth about KRW 100,000 per head, and it is difficult to use in the current local government foot-and-mouth disease precision diagnosis agency due to insufficient supply. .

구제역 바이러스는 7종의 혈청형으로 뚜렷이 구분되어 혈청형 상호 방어가 되지 않는 특성이 있어, 질병의 확산 방지를 위한 신속한 초기 예방 조치를 위한 적정한 백신 선정을 위해서는, 혈청형 분석까지 가능한 혈청형 감별 진단키트 개발이 매우 시급한 실정이다.Foot-and-mouth disease virus is distinguished into 7 types of serotypes, so serotypes cannot be mutually protected.In order to select an appropriate vaccine for rapid initial preventive measures to prevent the spread of the disease, serotype differential diagnosis is possible, including serotype analysis. Kit development is very urgent.

본 발명자들은 구제역 바이러스(Foot and Mouth Disease Virus; 이하, FMDV)의 혈청형(serotype) O, A, Asia1, C, SAT1, SAT2 및 SAT3를 동시에 높은 민감도로 감지할 수 있는 단클론항체를 개발하였으며, 이는 구제역 바이러스 검출용 현장진단키트 및 효소면역측정법에 매우 유용하게 적용될 수 있을 것으로 사료된다.The present inventors have developed a monoclonal antibody capable of simultaneously detecting serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 of Foot and Mouth Disease Virus (FMDV) with high sensitivity, It is thought that this can be very usefully applied to a field diagnosis kit for detection of foot-and-mouth disease virus and an enzyme immunoassay method.

이에, 본 발명의 목적은 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체 또는 그의 항원 결합 단편을 제공하는 것이다.Accordingly, an object of the present invention is to provide an antibody or antigen-binding fragment thereof that specifically binds all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3.

본 발명의 다른 목적은 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체의 중쇄 가변 영역 및 경쇄 가변 영역을 코딩하는 폴리뉴클레오티드를 제공하는 것이다.Another object of the present invention is to provide a polynucleotide encoding a heavy chain variable region and a light chain variable region of an antibody that specifically binds all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3.

본 발명의 또 다른 목적은 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체의 경쇄 가변영역을 코딩하는 폴리뉴클레오티드 및 중쇄 가변영역을 코딩하는 폴리뉴클레오티드를 포함하는 재조합 벡터를 제공하는 것이다.Another object of the present invention is to provide a polynucleotide encoding a light chain variable region and a polynucleotide encoding a heavy chain variable region of an antibody that specifically binds to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3. It is to provide a recombinant vector containing.

본 발명의 또 다른 목적은 FMDV 혈청형 O, A, Asia1, SAT1, C, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체의 경쇄 가변영역을 코딩하는 폴리뉴클레오티드 및 중쇄 가변영역을 코딩하는 폴리뉴클레오티드를 포함하는 재조합 벡터로 형질전환된 숙주세포를 제공하는 것이다.Another object of the present invention is to provide a polynucleotide encoding a light chain variable region and a polynucleotide encoding a heavy chain variable region of an antibody that specifically binds to all of FMDV serotypes O, A, Asia1, SAT1, C, SAT2 and SAT3. It is to provide a host cell transformed with the containing recombinant vector.

본 발명의 또 다른 목적은 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 항원 탐지용 키트를 제공하는 것이다.Another object of the present invention is to provide a kit for detecting FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 antigens.

본 발명의 또 다른 목적은 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3를 동시에 탐지하는 방법을 제공하는 것이다.Another object of the present invention is to provide a method for simultaneously detecting FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3.

본 발명은 구제역 바이러스(Foot and Mouth Disease Virus; FMDV) 혈청형(serotype) O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체 또는 그의 항원 결합 단편 및 그 용도에 관한 것이다.The present invention relates to an antibody or antigen-binding fragment thereof that specifically binds all of Foot and Mouth Disease Virus (FMDV) serotype O, A, Asia1, C, SAT1, SAT2 and SAT3, and uses thereof. will be.

이하 본 발명을 더욱 자세히 설명하고자 한다.Hereinafter, the present invention will be described in more detail.

본 발명의 일 예는 구제역 바이러스(Foot and Mouth Disease Virus; FMDV) 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 단일클론항체에 관한 것이다.One example of the present invention relates to a monoclonal antibody that specifically binds to all of Foot and Mouth Disease Virus (FMDV) serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3.

구제역 바이러스는 피코르나바이러스과 아프터바이러스(Aphthovirus)속에 속하며, 여과성 병원체로서 처음 발견된 동물바이러스로서 소 등 우제류 동물에 감염된다. 바이러스의 입자는 직경이 22 내지 28nm이고, 외피(envelope)가 없이 4종류의 구성 단백질 60분자로 구성된 캡시드(Capsid)단백질이 5′말단에 VPg 단백질이 공유 결합된 외가닥의 (+)RNA를 둘러싸고 있다.Foot-and-mouth disease virus belongs to the genus Picornavirus family Aphthovirus, and is an animal virus first discovered as a filterable pathogen and infects cows and other bovine animals. Virus particles have a diameter of 22 to 28 nm, and a capsid protein composed of 60 molecules of four types of constituent proteins without an envelope surrounds the (+) RNA of the single strand covalently bonded to the VPg protein at the 5′ end. have.

구제역 바이러스는 7종의 혈청형인 O, A, Asia1, C, SAT1, SAT2 및 SAT3으로 구성되며, 혈청형 간 상호 방어 면역이 형성되지 않는다. 예를 들어, 감수성 동물에 구제역 바이러스 혈청형 O에 대한 백신을 접종하여 적정한 방어 면역이 형성되었더라도, 구제역 바이러스 혈청형 Asia1이 침입하게 되면 방어되지 못하고 구제역이 발생하게 된다. Foot-and-mouth disease virus consists of seven serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3, and mutual protective immunity between serotypes is not formed. For example, even if an appropriate protective immunity is formed by inoculating susceptible animals with a vaccine against foot-and-mouth disease serotype O, when foot-and-mouth disease serotype Asia1 invades, it cannot be protected and foot-and-mouth disease occurs.

구제역의 확산 방지를 위한 신속한 초기 예방 조치로서 상기 7종의 혈청형 모두를 민감하게 탐지할 수 있는 진단키트 개발이 방역 현장에서 우선적으로 필요한 상황이다.As a rapid initial preventive measure to prevent the spread of foot-and-mouth disease, the development of a diagnostic kit capable of sensitively detecting all of the seven serotypes is a priority in the quarantine field.

완전한 항체는 2개의 전장(full length) 경쇄 및 2개의 전장 중쇄를 가지는 구조이며, 각각의 경쇄는 중쇄와 이황화 결합으로 연결되어 있다. 항체의 불변 영역은 중쇄 불변 영역과 경쇄 불변 영역으로 나눠지며, 중쇄 불변 영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 및 엡실론(ε) 타입을 가지고, 서브클래스로 감마1(γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 및 알파2(α2)를 가진다. 경쇄의 불변 영역은 카파(

Figure 112018115846198-pat00001
) 및 람다(
Figure 112018115846198-pat00002
) 타입을 가진다.A complete antibody is a structure having two full-length light chains and two full-length heavy chains, and each light chain is linked to a heavy chain by a disulfide bond. The constant region of an antibody is divided into a heavy chain constant region and a light chain constant region, and the heavy chain constant region has gamma (γ), mu (μ), alpha (α), delta (δ) and epsilon (ε) types, and subclasses It has gamma 1 (γ1), gamma 2 (γ2), gamma 3 (γ3), gamma 4 (γ4), alpha 1 (α1) and alpha 2 (α2). The constant region of the light chain is kappa (
Figure 112018115846198-pat00001
) And lambda (
Figure 112018115846198-pat00002
) Has a type.

용어, "단일클론항체"는 상기 항체 분자가 단일 분자로 구성되도록 제조된 것을 의미한다. 단일클론항체는 동일한 에피토프를 갖는 항원에 대해서만 반응하는 특이성을 가지며, 또한 특정 에피토프에 대해서만 친화성을 나타낸다.The term "monoclonal antibody" means that the antibody molecule is prepared to consist of a single molecule. Monoclonal antibodies have specificity to react only to antigens having the same epitope, and also exhibit affinity only to specific epitopes.

상기 단일클론항체는 수탁번호 KCTC 18621P인 하이브리도마 세포에서 생산되는 것일 수 있다.The monoclonal antibody may be produced in hybridoma cells with accession number KCTC 18621P.

상기 하이브리도마 세포는 당업계에 공지된 방법을 사용하여 제조할 수 있다. 구체적으로, 상기 하이브리도마 세포는 면역원인 FMDV 혈청형 A(IRAQ)을 동물에 면역시키고, 상기 피면역 동물로부터 유래된 항체 생산세포인 B 세포를 골수종세포와 융합시켜서 하이브리도마를 제조한 다음, 그 중에서 구제역 바이러스 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3에 모두 결합하는 단일클론항체를 생산하는 하이브리도마를 선택하는 방법으로 제조할 수 있다. The hybridoma cells can be prepared using a method known in the art. Specifically, the hybridoma cells are immunized with FMDV serotype A (IRAQ), which is an immunogen, to animals, and B cells, which are antibody-producing cells derived from the immunized animal, are fused with myeloma cells to prepare a hybridoma. , Among them, it can be prepared by a method of selecting a hybridoma producing a monoclonal antibody that binds all of the foot-and-mouth disease serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3.

상기 피면역 동물은 실시예에서 사용된 마우스뿐만 아니라 염소, 양, 모르모트, 래트 또는 토끼와 같은 동물을 사용할 수 있다.The animals to be immunized may be animals such as goats, sheep, mormons, rats or rabbits as well as the mice used in the examples.

상기 피면역 동물을 면역시키는 방법으로서는 당업계에 이미 공지된 방법을 사용할 수 있다. 예를 들어, 마우스를 면역시키는 경우 1회에 1 내지 100 ㎍의 면역원을 동량의 생리 식염수 및/또는 프로인드 어주번트(Freund's adjuvant) 등의 항원 보조제로 유화시켜, 상기 피면역원 동물의 복부의 피하 또는 복강 내에 2 내지 5주마다 2 내지 6회 접종시키는 방법으로 수행될 수 있다. 피면역 동물을 면역시킨 후에는 최종 면역 3 내지 5일 후 비장 또는 림프절을 적출하여 당업계에서 이미 공지되어 있는 세포 융합법에 따라서, 융합 촉진제의 존재 하에 이들의 조직에 포함되어 있는 B 세포를 골수종세포와 융합시키게 된다. 상기 융합 촉진제는 예를 들어, 폴리에틸렌 글리콜(PEG)과 같은 물질을 사용할 수 있다. As a method of immunizing the immunized animal, a method already known in the art can be used. For example, when immunizing a mouse, 1 to 100 μg of immunogen is emulsified at a time with an equal amount of physiological saline and/or an antigen adjuvant such as Freund's adjuvant, and subcutaneously in the abdomen of the immunized animal. Alternatively, it may be performed by inoculating 2 to 6 times every 2 to 5 weeks in the abdominal cavity. After immunization of the immunized animals, the spleen or lymph nodes are excised 3 to 5 days after the final immunization, and according to the cell fusion method already known in the art, B cells contained in their tissues in the presence of a fusion promoter are treated with myeloma. It fuses with the cell. The fusion accelerator may be, for example, a material such as polyethylene glycol (PEG).

상기 골수종세포는 예를 들어, P3U1, NS-1, P3x63. Ag 8.653, Sp2/0-Ag14와 같은 마우스 유래 세포, AG1, AG2와 같은 래트 유래 세포를 사용할 수 있으나, 이에 한정하지 않는다. The myeloma cells are, for example, P3U1, NS-1, P3x63. Mouse-derived cells such as Ag 8.653 and Sp2/0-Ag14, and rat-derived cells such as AG1 and AG2 may be used, but are not limited thereto.

또한, 상기 당업계에 공지된 세포 융합법은 예를 들어, B세포와 골수종세포를 1:1 내지 10:1의 비율로 혼합시켜, 이에 분자량 1,000 내지 6,000의 PEG를 10 내지 80%의 농도로 첨가하여, 30 내지 37℃에서 1 내지 10분 동안 배양하는 방법으로 수행될 수 있다. In addition, the cell fusion method known in the art is, for example, by mixing B cells and myeloma cells in a ratio of 1:1 to 10:1, and PEG having a molecular weight of 1,000 to 6,000 is mixed at a concentration of 10 to 80%. In addition, it can be carried out by incubating for 1 to 10 minutes at 30 to 37 ℃.

또한, 상기 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 단일클론항체를 생산하는 하이브리도마는, 예를 들어, 하이브리도마만이 생존 가능한 HAT 배지 등의 선택 배지에서 배양하고, 하이브리도마 배양 상층액 중의 항체 활성을 ELISA 등의 방법을 이용하여 측정하여 선택할 수 있다. In addition, hybridomas that produce monoclonal antibodies that specifically bind to all of the FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 are, for example, HAT medium in which only hybridomas can survive. It can be cultured in a selection medium such as, and selected by measuring the antibody activity in the hybridoma culture supernatant using a method such as ELISA.

최종적으로, FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 단일클론항체를 생산하는 하이브리도마는, 예를 들어, FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 단일클론항체를 생산하는 하이브리도마에 대하여, 한계 희석 등의 방법에 의해 클로닝을 반복함으로써 선별될 수 있다.Finally, hybridomas producing monoclonal antibodies that specifically bind to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 are, for example, FMDV serotypes O, A, Asia1, Hybridomas that produce monoclonal antibodies that specifically bind to all of C, SAT1, SAT2 and SAT3 can be selected by repeating cloning by a method such as limiting dilution.

한편, 상기 단일클론항체는 IgG1, IgG2a, IgG2b, IgG3, IgA 또는 IgM 타입일 수 있으며, 예를 들어, IgG1 타입일 수 있다. Meanwhile, the monoclonal antibody may be an IgG 1 , IgG 2a , IgG 2b , IgG 3 , IgA or IgM type, for example, an IgG 1 type.

또한, 상기 항체의 경쇄 불변 영역은

Figure 112018115846198-pat00003
또는
Figure 112018115846198-pat00004
형일 수 있다.In addition, the light chain constant region of the antibody is
Figure 112018115846198-pat00003
or
Figure 112018115846198-pat00004
It could be an older brother.

본 발명의 다른 일 예는 서열번호 1, 서열번호 2 및 서열번호 3으로 이루어진 군으로부터 선택되는 하나 이상의 중쇄 CDR(complementarity determining region) 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 5, 서열번호 6 및 서열번호 7로 이루어진 군으로부터 선택되는 하나 이상의 경쇄 CDR 아미노산 서열을 포함하는 경쇄 가변 영역을 포함하는 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체 또는 그의 항원 결합 단편에 관한 것이다.Another example of the present invention is a heavy chain variable region comprising at least one heavy chain complementarity determining region (CDR) amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 5, SEQ ID NO: 6, and An antibody that specifically binds to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 comprising a light chain variable region comprising at least one light chain CDR amino acid sequence selected from the group consisting of SEQ ID NO: 7 or its It relates to an antigen binding fragment.

상기 항체 또는 그의 항원 결합 단편은 서열번호 1, 서열번호 2 및 서열번호 3으로 각각 표시되는 중쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2) 및 CDR3(complementarity determining region 3) 아미노산 서열을 포함하는 중쇄 가변 영역; 및 서열번호 5, 서열번호 6 및 서열번호 7로 각각 표시되는 경쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2) 및 CDR3(complementarity determining region 3) 아미노산 서열을 포함하는 경쇄 가변 영역;을 포함하는 것일 수 있다.The antibody or antigen-binding fragment thereof is a heavy chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2) and CDR3 (complementarity determining region 3) amino acid sequences represented by SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3, respectively. A heavy chain variable region comprising; And a light chain variable region comprising amino acid sequences of light chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2) and CDR3 (complementarity determining region 3) represented by SEQ ID NO: 5, SEQ ID NO: 6 and SEQ ID NO: 7, respectively; It may be included.

또한, 상기 중쇄 가변 영역은 서열번호 4의 아미노산 서열로 이루어지고, 상기 경쇄 가변 영역은 서열번호 8의 아미노산 서열로 이루어진 것일 수 있다.In addition, the heavy chain variable region may be composed of the amino acid sequence of SEQ ID NO: 4, and the light chain variable region may be composed of the amino acid sequence of SEQ ID NO: 8.

용어 "항체(antibody)"는 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 반응하는 특이 항체로서, FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하며, 완전한 항체 형태뿐만 아니라 항체 분자의 항원 결합 단편을 포함한다. 완전한 항체에 대한 설명은 상기 언급한 바와 같다.The term "antibody" refers to a specific antibody that responds to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3, and to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3. It specifically binds and includes antigen-binding fragments of antibody molecules as well as complete antibody forms. The description of the complete antibody is as mentioned above.

용어, "중쇄(heavy chain)"는 항원에 특이성을 부여하기 위해 충분한 가변 영역 서열을 갖는 아미노산 서열을 포함하는 가변 영역 도메인 VH 및 3 개의 불변 영역 도메인 CH1, CH2 및 CH3를 포함하는 전장 중쇄 및 이의 단편을 모두 포함하는 의미로 해석된다. The term "heavy chain" includes a variable region domain V H and three constant region domains C H1 , C H2 and C H3 comprising an amino acid sequence having a sufficient variable region sequence to confer antigen specificity. It is interpreted to include both full-length heavy chains and fragments thereof.

용어 "경쇄(light chain)"는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변 영역 도메인 VL 및 불변 영역 도메인 CL을 포함하는 전장 경쇄 및 이의 단편을 모두 포함하는 의미로 해석된다.The term "light chain (light chain)" is to include both the full-length light chain and fragments thereof containing the variable region domain, V L, and a constant region domain, C L comprises an amino acid sequence having sufficient variable region sequence to impart specificity to the antigen Interpreted as meaning.

용어, "CDR(complementarity determining region)"은 면역글로불린의 중쇄 및 경쇄의 고가변 영역(hypervariable region)의 아미노산 서열을 의미한다. 중쇄 및 경쇄는 각각 3개의 CDR을 포함할 수 있다(CDRH1, CDRH2, CDRH3 및 CDRL1, CDRL2, CDRL3). 상기 CDR은 항체가 항원 또는 에피토프에 결합하는 데 있어서 주요한 접촉 잔기를 제공할 수 있다.The term "complementarity determining region (CDR)" refers to an amino acid sequence of a hypervariable region of an immunoglobulin heavy and light chain. Each of the heavy and light chains may comprise three CDRs (CDRH1, CDRH2, CDRH3 and CDRL1, CDRL2, CDRL3). The CDRs can provide key contact residues for the antibody to bind to an antigen or epitope.

용어, "항원 결합 단편"은 면역글로불린 전체 구조에 대한 그의 단편으로, 항원이 결합할 수 있는 부분을 포함하는 폴리펩티드의 일부를 의미한다. 예를 들어, F(ab')2, Fab', Fab, Fv 또는 scFv일 수 있으나, 이에 한정하지 않는다. 상기 항원 결합 단편 중 Fab는 경쇄 및 중쇄의 가변영역과 경쇄의 불변 영역 및 중쇄의 첫 번째 불변 영역(CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C-말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 디설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변부위 및 경쇄 가변부위만을 가지고 있는 최소의 항체조각으로 Fv 단편을 생성하는 재조합 기술은 당업계에 널리 공지되어 있다. 이중쇄 Fv(two-chain Fv)는 비공유 결합으로 중쇄 가변부위와 경쇄 가변부위가 연결되어 있고 단쇄 Fv(single-chain Fv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변 영역과 단쇄의 가변 영역이 공유 결합으로 연결되거나 또는 C-말단에서 바로 연결되어 있어서 이중쇄 Fv와 같이 다이머와 같은 구조를 이룰 수 있다. 상기 항원 결합 단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고(예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 유전자 재조합 기술을 통하여 제작할 수 있다. The term "antigen-binding fragment" refers to a fragment thereof for the entire structure of an immunoglobulin, and refers to a portion of a polypeptide comprising a portion to which an antigen can bind. For example, it may be F(ab') 2 , Fab', Fab, Fv, or scFv, but is not limited thereto. Among the antigen-binding fragments, Fab has a structure having a variable region of a light chain and a heavy chain, a constant region of a light chain, and a first constant region of a heavy chain (C H1 ), and has one antigen-binding site. Fab' differs from Fab in that it has a hinge region containing at least one cysteine residue at the C-terminus of the heavy chain C H1 domain. F(ab') 2 antibodies are produced by disulfide bonds between cysteine residues in the hinge region of Fab'. Fv is the smallest antibody fragment having only the heavy chain variable region and the light chain variable region. Recombination techniques for generating Fv fragments are well known in the art. The double-chain Fv (two-chain Fv) is a non-covalent bond where the heavy chain variable region and the light chain variable region are connected, and the single-chain Fv (single-chain Fv) is generally shared by the variable region of the heavy chain and the variable region of the single chain through a peptide linker. It is linked by a bond or is directly linked at the C-terminus to form a dimer-like structure such as a double-chain Fv. The antigen-binding fragment can be obtained using proteolytic enzymes (e.g., Fab can be obtained by restriction digestion of the whole antibody with papain, and F(ab') 2 fragment can be obtained by digestion with pepsin), It can be produced through gene recombination technology.

상기 항체는 단일클론항체, 이특이적 항체, 비-인간 항체, 인간 항체, 인간화 항체, 키메릭 항체, 단쇄 Fvs(scFV), 단쇄 항체, Fab 단편, F(ab')단편, 다이설파이드-결합 Fvs(sdFV) 및 항-이디오타입(항-Id) 항체, 그리고 상기 항체들의 에피토프-결합 단편을 포함하나 이에 한정되는 것은 아니다.The antibodies include monoclonal antibodies, bispecific antibodies, non-human antibodies, human antibodies, humanized antibodies, chimeric antibodies, single chain Fvs (scFV), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-binding Fvs (sdFV) and anti-idiotype (anti-Id) antibodies, and epitope-binding fragments of the antibodies, but are not limited thereto.

상기 항체는 인간화 항체(humanized antibody) 또는 인간 항체(human antibody)일 수 있다. 비-인간, 예를 들어, 마우스의 인간화 항체는 마우스의 면역글로불린으로부터 유도되는 최소 서열을 포함하는 키메릭 면역글로불린, 면역글로불린의 쇄 또는 그의 단편, 예를 들어, Fv, Fab, Fab', F(ab')2 또는 항체의 기타 항원-결합 서브서열일 수 있다. The antibody may be a humanized antibody or a human antibody. Humanized antibodies from non-human, e.g., mice, are chimeric immunoglobulins, chains of immunoglobulins or fragments thereof, e.g., Fv, Fab, Fab', F containing the minimal sequence derived from the immunoglobulins of the mouse. (ab') 2 or other antigen-binding subsequence of the antibody.

비-인간 항체를 인간화시키는 방법은 당업계에 널리 공지되어 있다. 일반적으로, 인간화 항체는 비-인간인 공급원으로부터 도입된 하나 이상의 아미노산 잔기를 갖는다. 인간화는 필수적으로 설치류 동물의 CDR 또는 CDR 서열을 인간 항체에 상응하는 서열 대신 치환시켜 수행될 수 있다. 따라서, 이러한 인간화 항체는 키메릭 항체이며, 실질적으로 온전한 인간 항체의 가변 영역보다 적은 영역이 비-인간 종으로부터 상응하는 서열에 의해 치환될 수 있다. 예를 들어, 인간화 항체는 일부 CDR 잔기 및 가능하게는 일부 골격(framework, FR) 잔기가 설치류 동물의 항체에 있는 유사 부위로부터의 잔기로 대체된 인간화 항체일 수 있다.Methods of humanizing non-human antibodies are well known in the art. In general, humanized antibodies have one or more amino acid residues introduced from a source that is non-human. Humanization can be performed essentially by substituting the CDR or CDR sequences of rodents for sequences corresponding to human antibodies. Thus, such humanized antibodies are chimeric antibodies, and regions less than the variable regions of a substantially intact human antibody can be substituted by the corresponding sequence from a non-human species. For example, a humanized antibody may be a humanized antibody in which some CDR residues and possibly some framework (FR) residues have been replaced with residues from similar sites in the antibody of a rodent.

상기 인간 항체는 중쇄 및 경쇄의 가변 및 불변영역의 서열이 인간으로부터 유래한 항체를 의미하며, 인간 항체는 파아지 디스플레이 라이브러리를 포함한 당업자에게 널리 알려진 다양한 기술, 예를 들어, 유전적 재조합 기술과 세포공학 기술을 이용하여 생성될 수 있다.The human antibody refers to an antibody in which the sequences of the variable and constant regions of the heavy and light chains are derived from humans, and the human antibody is a variety of techniques well known to those skilled in the art including phage display libraries, such as genetic recombination technology and cell engineering. It can be created using technology.

용어 "키메릭"은 항체 또는 항원-결합 부위가 2 개의 상이한 종으로부터 유래한 서열들을 포함하는 것을 의미한다.The term “chimeric” means that the antibody or antigen-binding site comprises sequences derived from two different species.

상기 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체 또는 그의 항원 결합 단편은, FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 인식할 수 있는 범위 내에서 첨부한 서열번호에 기재된 아미노산 서열의 변이체를 포함할 수 있다. The FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 antibodies or antigen-binding fragments thereof that specifically bind to all of the, FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 It may include variants of the amino acid sequence described in the attached SEQ ID NO: within the range that can be specifically recognized.

예를 들면, 항체의 결합 친화도 및/또는 기타 생물학적 특성을 개선시키기 위하여 항체의 아미노산 서열에 변화를 줄 수 있다. 이러한 변형은, 예를 들어, 항체의 아미노산 서열 잔기의 결실, 삽입 및/또는 치환을 포함한다. 이러한 아미노산의 변이는 아미노산 곁사슬 치환체의 상대적 유사성, 예를 들어, 소수성, 친수성, 전하, 크기와 같은 특성에 기초하여 이루어진다. 예를 들어, 아르기닌, 라이신과 히스티딘은 모두 양전하를 띤 잔기이고, 알라닌, 글리신과 세린은 유사한 크기를 가지며, 페닐알라닌, 트립토판과 티로신은 유사한 모양을 갖는다. 따라서, 상기 고려 사항에 기초하여, 아르기닌, 라이신과 히스티딘; 알라닌, 글리신과 세린; 및 페닐알라닌, 트립토판과 티로신은 생물학적으로 기능 균등물이라 할 수 있다.For example, changes can be made to the amino acid sequence of an antibody to improve its binding affinity and/or other biological properties. Such modifications include, for example, deletions, insertions and/or substitutions of amino acid sequence residues of the antibody. These amino acid variations are made based on the relative similarity of the amino acid side chain substituents, such as hydrophobicity, hydrophilicity, charge, and size. For example, arginine, lysine and histidine are all positively charged residues, alanine, glycine and serine have similar sizes, and phenylalanine, tryptophan and tyrosine have similar shapes. Thus, based on the above considerations, arginine, lysine and histidine; Alanine, glycine and serine; And phenylalanine, tryptophan and tyrosine may be referred to as biologically functional equivalents.

한편, 분자의 활성을 전체적으로 변경시키지 않는 단백질에서의 아미노산 교환은 당해 분야에 공지되어 있다. 가장 통상적으로 일어나는 교환은 아미노산 잔기 Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly 간의 교환이다. 상기 생물학적 균등 활성을 갖는 변이를 고려한다면, 상기 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체 또는 그의 항원 결합 단편은 서열번호에 기재된 서열과 실질적인 동일성(substantial identity)을 나타내는 서열도 포함하는 것으로 해석될 수 있다. On the other hand, amino acid exchange in proteins that do not change the activity of the molecule as a whole is known in the art. The most commonly occurring exchanges are amino acid residues Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/ It is an exchange between Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly. Considering the mutation having the biologically equivalent activity, the antibody or antigen-binding fragment thereof that specifically binds all of the FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 has substantial identity to the sequence described in SEQ ID NO: It can be interpreted as including a sequence representing (substantial identity).

상기의 실질적인 동일성은, 상기한 서열번호의 아미노산 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인된 서열을 분석한 경우에, 최소 60%의 상동성, 최소 70%의 상동성, 최소 80%의 상동성 또는 최소 90%의 상동성을 나타내는 서열일 수 있다. The actual identity is at least 60% when the amino acid sequence of the above sequence number and any other sequence are aligned to correspond as much as possible, and the aligned sequence is analyzed using an algorithm commonly used in the art. It may be a sequence showing homology of, at least 70%, at least 80%, or at least 90% of homology.

서열의 비교를 위한 얼라인먼트 방법은 당업계에 공지되어 있다. 예를 들어, NCBI Basic Local Alignment Search Tool (BLAST)를 통해, 인터넷 상에서 blastp, blastx, tblastn 및 tblastx와 같은 서열 분석 프로그램을 이용할 수 있다.Alignment methods for comparison of sequences are known in the art. For example, through the NCBI Basic Local Alignment Search Tool (BLAST), sequence analysis programs such as blastp, blastx, tblastn and tblastx can be used on the Internet.

본 발명의 또 다른 일 예는 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체의 중쇄 가변 영역 및/또는 경쇄 가변 영역을 코딩하는 폴리뉴클레오티드에 관한 것이다.Another example of the invention relates to a polynucleotide encoding a heavy chain variable region and/or a light chain variable region of an antibody that specifically binds all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3. .

일 양태로서 상기 중쇄 가변 영역을 코딩하는 폴리뉴클레오티드는 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체의 서열번호 4의 아미노산 서열로 이루어진 중쇄 가변 영역을 코딩하는 폴리뉴클레오티드인 것일 수 있다. In one embodiment, the polynucleotide encoding the heavy chain variable region is a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 4 of an antibody that specifically binds to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3. It may be an encoding polynucleotide.

상기 중쇄 가변 영역을 코딩하는 폴리뉴클레오티드는 서열번호 12의 뉴클레오티드 서열로 이루어진 것일 수 있다.The polynucleotide encoding the heavy chain variable region may be composed of the nucleotide sequence of SEQ ID NO: 12.

일 양태로서 상기 경쇄 가변 영역을 코딩하는 폴리뉴클레오티드는 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체의 서열번호 8의 아미노산 서열로 이루어진 경쇄 가변 영역을 코딩하는 폴리뉴클레오티드인 것일 수 있다.In one embodiment, the polynucleotide encoding the light chain variable region is a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 8 of an antibody that specifically binds to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3. It may be an encoding polynucleotide.

상기 경쇄 가변 영역을 코딩하는 폴리뉴클레오티드는 서열번호 16의 뉴클레오티드 서열로 이루어진 것일 수 있다.The polynucleotide encoding the light chain variable region may be composed of the nucleotide sequence of SEQ ID NO: 16.

용어 "폴리뉴클레오티드(polynucleotide)"는 단일가닥 또는 이중가닥 형태로 존재하는 디옥시리보뉴클레오티드 또는 리보뉴클레오티드의 중합체이다. RNA 게놈 서열, DNA(gDNA 및 cDNA) 및 이로부터 전사되는 RNA 서열을 포괄하며, 특별하게 다른 언급이 없는 한 천연의 폴리뉴클레오티드의 유사체를 포함한다. The term "polynucleotide" refers to a polymer of deoxyribonucleotides or ribonucleotides present in single-stranded or double-stranded form. It encompasses RNA genomic sequences, DNA (gDNA and cDNA) and RNA sequences transcribed therefrom, and unless specifically stated otherwise, includes analogs of natural polynucleotides.

상기 폴리뉴클레오티드는 상기 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체의 중쇄 가변 영역 또는 경쇄 가변 영역의 아미노산 서열을 코딩하는 뉴클레오티드 서열뿐만 아니라, 그 서열에 상보적인(complementary) 서열도 포함한다. The polynucleotide is not only a nucleotide sequence encoding an amino acid sequence of a heavy chain variable region or a light chain variable region of an antibody that specifically binds to all of the FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3, but also the sequence thereof. Also includes sequences that are complementary to.

상기 상보적인 서열은 완벽하게 상보적인 서열뿐만 아니라, 실질적으로 상보적인 서열도 포함하며, 이는 당업계에 공지된 엄격 조건(stringent conditions) 하에서, 예를 들어, 상기 구제역 바이러스(Foot and Mouth Disease Virus; FMDV) 혈청형(serotype) O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체의 중쇄 가변 영역 또는 경쇄 가변 영역의 아미노산 서열을 코딩하는 뉴클레오티드 서열의 뉴클레오티드 서열과 혼성화될 수 있는 서열을 의미한다.The complementary sequence includes not only a perfectly complementary sequence, but also a substantially complementary sequence, which under stringent conditions known in the art, for example, the foot and mouth disease virus (Foot and Mouth Disease Virus; FMDV) serotype O, A, Asia1, C, SAT1, SAT2 and SAT3 to be hybridized with the nucleotide sequence of the nucleotide sequence encoding the amino acid sequence of the heavy chain variable region or the light chain variable region of an antibody that specifically binds to all. It means a sequence that can be.

또한, 상기 중쇄 가변영역 및/또는 경쇄 가변영역의 아미노산 서열을 코딩하는 뉴클레오티드 서열은 변형될 수 있다. 상기 변형은 뉴클레오티드의 추가, 결실 또는 비보존적 치환 또는 보존적 치환을 포함한다. In addition, the nucleotide sequence encoding the amino acid sequence of the heavy chain variable region and/or light chain variable region may be modified. Such modifications include additions, deletions or non-conservative substitutions or conservative substitutions of nucleotides.

상기 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체의 중쇄 가변 영역 및/또는 경쇄 가변 영역의 아미노산 서열을 코딩하는 폴리뉴클레오티드는 상기 뉴클레오티드 서열에 대하여 실질적인 동일성을 나타내는 뉴클레오티드 서열도 포함하는 것으로 해석된다. The polynucleotide encoding the amino acid sequence of the heavy chain variable region and/or the light chain variable region of an antibody that specifically binds to all of the FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 is substantial with respect to the nucleotide sequence. It is interpreted to include a nucleotide sequence showing identity.

상기의 실질적인 동일성은, 상기 뉴클레오티드 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인된 서열을 분석한 경우에, 최소 80%의 상동성, 최소 90%의 상동성 또는 최소 95%의 상동성을 나타내는 서열일 수 있다.The actual identity is at least 80% homology when the nucleotide sequence and any other sequence are aligned to correspond as much as possible, and the aligned sequence is analyzed using an algorithm commonly used in the art, It may be a sequence showing at least 90% homology or at least 95% homology.

본 발명의 또 다른 목적은 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체의 경쇄 가변영역을 코딩하는 폴리뉴클레오티드 및 중쇄 가변영역을 코딩하는 폴리뉴클레오티드를 포함하는 재조합 벡터를 제공하는 것이다.Another object of the present invention is to provide a polynucleotide encoding a light chain variable region and a polynucleotide encoding a heavy chain variable region of an antibody that specifically binds to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3. It is to provide a recombinant vector containing.

상기 경쇄 가변영역은 서열번호 8의 아미노산서열로 이루어진 경쇄 가변영역인 것일 수 있으며, 상기 중쇄 가변영역은 서열번호 4의 아미노산 서열로 이루어진 중쇄 가변영역인 것일 수 있다.The light chain variable region may be a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 8, and the heavy chain variable region may be a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 4.

상기 경쇄 가변영역을 코딩하는 폴리뉴클레오티드는 서열번호 16의 뉴클레오티드 서열로 이루어지고, 상기 중쇄 가변영역을 코딩하는 폴리뉴클레오티드는 서열번호 12의 뉴클레오티드 서열로 이루어진 것일 수 있다.The polynucleotide encoding the light chain variable region may be composed of the nucleotide sequence of SEQ ID NO: 16, and the polynucleotide encoding the heavy chain variable region may be composed of the nucleotide sequence of SEQ ID NO: 12.

용어 "벡터"는 숙주 세포에서 목적 유전자를 발현시키기 위한 수단을 의미한다. 예를 들어, 플라스미드 벡터, 코즈미드 벡터 및 박테리오파아지 벡터, 아데노바이러스 벡터, 레트로바이러스 벡터 및 아데노-연관 바이러스 벡터와 같은 바이러스 벡터를 포함한다. 상기 재조합 벡터로 사용될 수 있는 벡터는 당업계에서 종종 사용되는 플라스미드 (예를 들면, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8/9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14, pGEX 시리즈, pET 시리즈 및 pUC19 등), 파지 (예를 들면,

Figure 112018115846198-pat00005
gt4
Figure 112018115846198-pat00006
B,
Figure 112018115846198-pat00007
-Charon,
Figure 112018115846198-pat00008
Figure 112018115846198-pat00009
z1 및 M13 등) 또는 바이러스 (예를 들명, SV40 등)를 조작하여 제작될 수 있다. The term “vector” refers to a means for expressing a gene of interest in a host cell. For example, plasmid vectors, cosmid vectors and bacteriophage vectors, adenovirus vectors, retroviral vectors, and viral vectors such as adeno-associated viral vectors. Vectors that can be used as the recombinant vector include plasmids often used in the art (e.g., pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8/9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14 , pGEX series, pET series and pUC19, etc.), phage (e.g.,
Figure 112018115846198-pat00005
gt4
Figure 112018115846198-pat00006
B,
Figure 112018115846198-pat00007
-Charon,
Figure 112018115846198-pat00008
Figure 112018115846198-pat00009
z1 and M13, etc.) or a virus (eg, SV40, etc.).

상기 재조합 벡터에서 상기 중쇄 가변영역 및 경쇄 가변영역의 아미노산 서열을 코딩하는 폴리뉴클레오티드는 프로모터에 작동적으로 연결될 수 있다. 용어 "작동적으로 연결된(operatively linked)"은 뉴클레오티드 발현 조절 서열(예: 프로모터 서열)과 다른 뉴클레오티드 서열 사이의 기능적인 결합을 의미한다. 따라서, 이에 의해 상기 조절 서열은 상기 다른 뉴클레오티드 서열의 전사 및/또는 해독을 조절할 수 있다.In the recombinant vector, the polynucleotide encoding the amino acid sequence of the heavy chain variable region and the light chain variable region may be operably linked to a promoter. The term “operatively linked” refers to a functional linkage between a nucleotide expression control sequence (eg, a promoter sequence) and another nucleotide sequence. Thus, thereby the regulatory sequence can regulate the transcription and/or translation of the other nucleotide sequence.

상기 재조합 벡터는, 전형적으로 클로닝을 위한 벡터 또는 발현을 위한 벡터로서 구축될 수 있다. 상기 발현용 벡터는 당업계에서 식물, 동물 또는 미생물에서 외래의 단백질을 발현하는 데 사용되는 통상의 것을 사용할 수 있다. 상기 재조합 벡터는 당업계에 공지된 다양한 방법을 통해 구축될 수 있다.The recombinant vector can be typically constructed as a vector for cloning or as a vector for expression. The expression vector may be a conventional one used in the art to express foreign proteins in plants, animals or microorganisms. The recombinant vector can be constructed through various methods known in the art.

상기 재조합 벡터는 원핵 세포 또는 진핵 세포를 숙주로 하여 구축될 수 있다. 예를 들어, 사용되는 벡터가 발현 벡터이고, 원핵 세포를 숙주로 하는 경우에는, 전사를 진행시킬 수 있는 강력한 프로모터 (예컨대, pL

Figure 112018115846198-pat00010
프로모터, trp 프로모터, lac 프로모터, tac 프로모터, T7 프로모터 등), 해독의 개시를 위한 라이보좀 결합 자리 및 전사/해독 종결 서열을 포함하는 것이 일반적이다. 진핵 세포를 숙주로 하는 경우에는, 벡터에 포함되는 진핵 세포에서 작동하는 복제원점은 f1 복제원점, SV40 복제원점, pMB1 복제원점, 아데노 복제원점, AAV 복제원점 및 BBV 복제원점 등을 포함하나, 이에 한정되는 것은 아니다. The recombinant vector can be constructed using prokaryotic or eukaryotic cells as a host. For example, when the vector used is an expression vector and a prokaryotic cell is used as a host, a strong promoter capable of proceeding transcription (eg, p L
Figure 112018115846198-pat00010
Promoter, trp promoter, lac promoter, tac promoter, T7 promoter, etc.), a ribosome binding site for initiation of translation, and a transcription/translation termination sequence. In the case of eukaryotic cells as a host, the origin of replication operating in eukaryotic cells included in the vector includes the f1 origin of replication, SV40 origin of replication, pMB1 origin of replication, adeno origin of replication, AAV origin of replication, BBV origin of replication, etc. It is not limited.

또한, 포유동물 세포의 게놈으로부터 유래된 프로모터 (예를 들어, 메탈로티오닌 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터 (예를 들어, 아데노바이러스 후기 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스 프로모터 및 HSV의 tk 프로모터)가 이용될 수 있으며, 전사 종결 서열로서 폴리아데닐화 서열을 일반적으로 갖는다.In addition, a promoter derived from the genome of a mammalian cell (e.g., metallotionine promoter) or a promoter derived from mammalian virus (e.g., adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, The cytomegalovirus promoter and the tk promoter of HSV) can be used and generally have a polyadenylation sequence as the transcription termination sequence.

한편, 상기 항체의 중쇄 가변영역 및 경쇄 가변영역을 발현할 수 있는 벡터는 중쇄 가변영역 및 경쇄 가변영역이 하나의 벡터에서 동시에 발현되는 벡터 시스템이거나 또는 중쇄 가변영역 및 경쇄 가변영역을 각각 별도의 벡터에서 발현시키는 시스템 모두 가능하다. 후자의 경우, 두 벡터는 동시 형질전환 (co-transfomation) 및 표적 형질전환 (targeted transformation)을 통하여 숙주 세포로 도입될 수 있다.Meanwhile, the vector capable of expressing the heavy and light chain variable regions of the antibody is a vector system in which the heavy chain variable region and the light chain variable region are simultaneously expressed in one vector, or the heavy chain variable region and the light chain variable region are each separate vector Any system expressed in is possible. In the latter case, both vectors can be introduced into host cells through co-transfomation and targeted transformation.

본 발명의 또 다른 일 예는 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체의 경쇄 가변영역을 코딩하는 폴리뉴클레오티드 및 중쇄 가변영역을 코딩하는 폴리뉴클레오티드를 포함하는 재조합 벡터로 형질전환된 숙주세포에 관한 것이다.Another example of the present invention is a polynucleotide encoding a light chain variable region and a polynucleotide encoding a heavy chain variable region of an antibody that specifically binds to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3. It relates to a host cell transformed with a recombinant vector comprising a.

상기 숙주세포는 서열번호 4의 아미노산 서열로 이루어진 중쇄 가변영역을 코딩하는 폴리뉴클레오티드; 및 서열번호 8의 아미노산 서열로 이루어진 경쇄 가변영역을 코딩하는 폴리뉴클레오티드를 포함하는 재조합 벡터로 형질전환된 것일 수 있다.The host cell comprises a polynucleotide encoding a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 4; And it may be transformed with a recombinant vector comprising a polynucleotide encoding the light chain variable region consisting of the amino acid sequence of SEQ ID NO: 8.

즉, 상기 숙주세포는 서열번호 4의 아미노산 서열로 이루어진 중쇄 가변영역을 코딩하는 폴리뉴클레오티드; 및 서열번호 8의 아미노산 서열로 이루어진 경쇄 가변영역을 코딩하는 폴리뉴클레오티드를 숙주 세포의 게놈 상에 포함하거나, 또는 상기 폴리뉴클레오티드 서열이 포함된 재조합 벡터를 포함하는 것이다.That is, the host cell is a polynucleotide encoding the heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 4; And a polynucleotide encoding a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 8 on the genome of a host cell, or a recombinant vector containing the polynucleotide sequence.

상기 중쇄 가변 영역을 코딩하는 폴리뉴클레오티드는 서열번호 12의 뉴클레오티드 서열로 이루어진 것일 수 있다.The polynucleotide encoding the heavy chain variable region may be composed of the nucleotide sequence of SEQ ID NO: 12.

상기 경쇄 가변 영역을 코딩하는 폴리뉴클레오티드는 서열번호 16의 뉴클레오티드 서열로 이루어진 것일 수 있다.The polynucleotide encoding the light chain variable region may be composed of the nucleotide sequence of SEQ ID NO: 16.

상기 재조합 벡터를 안정되면서 연속적으로 클로닝 또는 발현시킬 수 있는 숙주 세포는 당업계에 공지된 어떠한 숙주 세포도 이용할 수 있으며, 원핵 세포로는, 예를 들어, E. coli JM109, E. coli BL21, E. coli RR1, E. coli LE392, E. coli B, E. coli X 1776, E. coli W3110, 바실러스 서브틸리스, 바실러스 츄린겐시스와 같은 바실러스 속 균주, 그리고 살모넬라 티피무리움, 세라티아 마르세슨스 및 다양한 슈도모나스 종과 같은 장내균과 균주 등이 있으며, 진핵 세포에 형질 전환시키는 경우에는 숙주 세포로서, 효모(Saccharomyce cerevisiae), 곤충 세포, 식물 세포 및 동물 세포, 예를 들어, Sp2/0, CHO(Chinese hamster ovary) K1, CHO DG44, PER.C6, W138, BHK, COS-7, 293, HepG2, Huh7, 3T3, RIN 및 MDCK 세포주 등이 이용될 수 있다.Any host cell known in the art may be used as a host cell capable of stably and continuously cloning or expressing the recombinant vector. Examples of prokaryotic cells include E. coli JM109, E. coli BL21, E. coli RR1, E. coli LE392, E. coli B, E. coli X 1776, E. coli W3110, Bacillus subtilis, Bacillus thuringiensis, and Salmonella typhimurium, Serratia marcessons And enterobacteriaceae strains such as various Pseudomonas species, and the like, when transforming into eukaryotic cells, as host cells, yeast ( Saccharomyce cerevisiae ), insect cells, plant cells and animal cells, such as Sp2/0, CHO ( Chinese hamster ovary) K1, CHO DG44, PER.C6, W138, BHK, COS-7, 293, HepG2, Huh7, 3T3, RIN and MDCK cell lines, and the like can be used.

상기 폴리뉴클레오티드 또는 이를 포함하는 재조합 벡터의 숙주 세포 내로의 운반은, 당업계에 널리 알려진 운반 방법을 사용할 수 있다. 상기 운반 방법은 예를 들어, 숙주 세포가 원핵 세포인 경우, CaCl2 방법 또는 전기 천공 방법 등을 사용할 수 있고, 숙주 세포가 진핵 세포인 경우에는, 미세 주입법, 칼슘 포스페이트 침전법, 전기 천공법, 리포좀-매개 형질감염법 및 유전자 밤바드먼트 등을 사용할 수 있으나, 이에 한정하지는 않는다.Transport of the polynucleotide or a recombinant vector containing the same into a host cell may use a transport method well known in the art. For example, when the host cell is a prokaryotic cell, a CaCl 2 method or an electroporation method may be used, and when the host cell is a eukaryotic cell, a microinjection method, a calcium phosphate precipitation method, an electroporation method, Liposome-mediated transfection method and gene bombardment may be used, but are not limited thereto.

E. coli 등의 미생물을 이용하는 경우 생산성은 동물세포 등에 비하여 높은 편이나 당화(glycosylation) 문제로 인해 인택트(intact)한 Ig 형태의 항체 생산에는 적당하지 않지만, Fab 및 Fv와 같은 항원 결합 단편의 생산에는 사용될 수 있다. In the case of using microorganisms such as E. coli , the productivity is higher than that of animal cells, but it is not suitable for the production of intact Ig antibodies due to glycosylation problems, but antigen-binding fragments such as Fab and Fv Can be used in production.

상기 형질 전환된 숙주 세포를 선별하는 방법은 선택 표지에 의해 발현되는 표현형을 이용하여, 당업계에 널리 알려진 방법에 따라 용이하게 실시할 수 있다. 예를 들어, 상기 선택 표지가 특정 항생제 내성 유전자인 경우에는, 상기 항생제가 함유된 배지에서 형질전환체를 배양함으로써 형질전환체를 용이하게 선별할 수 있다.The method of selecting the transformed host cell can be easily carried out according to a method well known in the art using a phenotype expressed by a selection label. For example, when the selection marker is a specific antibiotic resistance gene, the transformant can be easily selected by culturing the transformant in a medium containing the antibiotic.

본 발명의 또 다른 일 예는 구제역 바이러스(Foot and Mouth Disease Virus; FMDV) 혈청형(serotype) O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 단일클론항체를 생산하는 하이브리도마 세포에 관한 것이다.Another example of the present invention is to produce monoclonal antibodies that specifically bind to both Foot and Mouth Disease Virus (FMDV) serotype O, A, Asia1, C, SAT1, SAT2 and SAT3. It relates to hybridoma cells.

상기 하이프리도마 세포는 수탁번호 KCTC 18621P인 것인 하이브리도마 세포일 수 있다.The hypridoma cells may be hybridoma cells with accession number KCTC 18621P.

상기 하이브리도마 세포는 한국생명공학연구원 KCTC(Korean Collection for Type Cultures)에 2017년 09월 27일자로 수탁번호 KCTC 18621P로 기탁하였다.The hybridoma cells were deposited with the Korea Research Institute of Bioscience and Biotechnology KCTC (Korean Collection for Type Cultures) on September 27, 2017 under the accession number KCTC 18621P.

한편 기탁된 하이브라도마 세포는 미생물 기탁에 대한 부다페스트 조약의 규정에 따라 보관되고 상기 수탁 번호를 참조하여 일반인들에게 분양이 가능하다. 즉, 기탁물들은 기탁 시료 관리를 위한 가장 최근의 요청 이후 적어도 5년의 기간 동안, 어떤 경우에는 기탁일 이후 적어도 30년의 기간 동안 또는 그 기탁물의 개시를 공표하는 어느 특허의 강제 가능한 시기 동안, 그 기탁물의 생존을 유지하고 오염되지 않도록 모든 주의를 다하여 보관한다. On the other hand, the deposited Hybradoma cells are stored in accordance with the provisions of the Budapest Treaty on the deposit of microorganisms and can be distributed to the general public by referring to the accession number. That is, the deposits shall be for a period of at least five years after the most recent request for management of a deposit sample, in some cases for a period of at least 30 years after the date of deposit, or for an enforceable period of any patent promulgating the commencement of the deposit, All precautions should be taken to maintain the survival of the deposit and avoid contamination.

기탁자에게는 기탁물의 상태 때문에 요청 시 수탁기관이 시료를 분양할 수 없을 경우에는 그 기탁물을 대체해야 하는 의무가 있다. 대상이 되는 기탁물에 대한 일반인의 입수 가능성을 제한하는 모든 제약들은 그 기탁물을 개시하고 있는 특허가 허여되면 완전히 없어지게 된다.The depositor is obligated to replace the deposit if the depositary organization cannot sell the sample upon request due to the condition of the deposit. Any restrictions that limit the public's availability of the subject deposit will be completely eliminated once the patent disclosing the deposit is granted.

상기 하이브리도마 세포의 제조 방법은 상기한 바와 같다.The method for producing the hybridoma cells is as described above.

본 발명의 또 다른 일 예는 구제역 바이러스(Foot and Mouth Disease Virus; FMDV) 혈청형(serotype) O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 단일클론항체를 포함하는 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 항원 탐지용 키트에 관한 것이다.Another example of the present invention comprises a monoclonal antibody that specifically binds to all of Foot and Mouth Disease Virus (FMDV) serotype O, A, Asia1, C, SAT1, SAT2 and SAT3. It relates to a kit for detection of FMDV serotype O, A, Asia1, C, SAT1, SAT2 and SAT3 antigens.

상기 키트는 효소결합제(conjugate)를 포함하는 것 일 수 있으나, 이에 한정되는 것은 아니다.The kit may include an enzyme-linking agent (conjugate), but is not limited thereto.

상기 효소결합제(conjugate)는 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 단일클론항체와 효소가 공유 결합된 것일 수 있다.The enzyme conjugate may be a monoclonal antibody that specifically binds all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2, and SAT3, and an enzyme covalently linked.

상기 단일클론항체는 서열번호 1, 서열번호 2 및 서열번호 3으로 각각 표시되는 중쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2) 및 CDR3(complementarity determining region 3) 아미노산 서열을 포함하는 중쇄 가변 영역; 및 서열번호 5, 서열번호 6 및 서열번호 7로 각각 표시되는 경쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2) 및 CDR3(complementarity determining region 3) 아미노산 서열을 포함하는 경쇄 가변 영역;을 포함하는 것일 수 있다.The monoclonal antibody is a heavy chain comprising the amino acid sequences of the heavy chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2) and CDR3 (complementarity determining region 3) represented by SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3, respectively. Variable region; And a light chain variable region comprising amino acid sequences of light chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2) and CDR3 (complementarity determining region 3) represented by SEQ ID NO: 5, SEQ ID NO: 6 and SEQ ID NO: 7, respectively; It may be included.

또한, 상기 단일클론항체는 서열번호 4의 아미노산 서열로 이루어진 중쇄 가변 영역, 서열번호 8의 아미노산 서열로 이루어진 경쇄 가변영역을 포함하는 것일 수 있다.In addition, the monoclonal antibody may include a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 4 and a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 8.

또한, 상기 단일클론항체는 수탁번호 KCTC 18621P인 하이브리도마 세포에 의해 생산되는 단일클론항체인 것일 수 있다.In addition, the monoclonal antibody may be a monoclonal antibody produced by hybridoma cells with accession number KCTC 18621P.

상기 단일클론항체는 서열번호 1, 서열번호 2 및 서열번호 3으로 각각 표시되는 중쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2) 및 CDR3(complementarity determining region 3) 아미노산 서열을 포함하는 중쇄 가변 영역; 및 서열번호 5, 서열번호 6 및 서열번호 7로 각각 표시되는 경쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2) 및 CDR3(complementarity determining region 3) 아미노산 서열을 포함하는 경쇄 가변 영역;을 포함하는 것일 수 있다.The monoclonal antibody is a heavy chain comprising the amino acid sequences of the heavy chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2) and CDR3 (complementarity determining region 3) represented by SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3, respectively. Variable region; And a light chain variable region comprising amino acid sequences of light chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2) and CDR3 (complementarity determining region 3) represented by SEQ ID NO: 5, SEQ ID NO: 6 and SEQ ID NO: 7, respectively; It may be included.

또한, 상기 단일클론항체는 서열번호 4의 아미노산 서열로 이루어진 중쇄 가변 영역, 서열번호 8의 아미노산 서열로 이루어진 경쇄 가변영역을 포함하는 것일 수 있다.In addition, the monoclonal antibody may include a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 4 and a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 8.

또한, 상기 단일클론항체는 수탁번호 KCTC 18621P인 하이브리도마 세포에 의해 생산되는 단일클론항체인 것일 수 있다.In addition, the monoclonal antibody may be a monoclonal antibody produced by hybridoma cells with accession number KCTC 18621P.

상기 키트는 효소면역측정법에 사용되는 것일 수 있으나, 이에 한정되는 것은 아니다.The kit may be used in an enzyme immunoassay method, but is not limited thereto.

본 발명의 효소면역측정법은 일반적으로 항원-항체 반응을 이용하여 각종 질병의 검사를 가능하게 하는 진단법으로서 특이항체와 효소가 결합되어있는 특이항체(conjugate)를 이용하여 다수의 검체로부터 검사하고자 하는 항원을 감지할 수 있는 면역검사법의 일종이다. The enzyme immunoassay method of the present invention is a diagnostic method that enables the examination of various diseases using an antigen-antibody reaction in general, and an antigen to be tested from a plurality of samples using a specific antibody (conjugate) in which a specific antibody and enzyme are bound. It is a kind of immunological test that can detect.

본 발명의 키트는 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 높은 친화도를 가지면서 반응하는 단클론 항체를 이용하여 구제역 바이러스에 감염된 동물 개체에서 유래한 다양한 시료에서 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3의 감염을 모두 특이적으로 진단할 수 있게 한다.The kit of the present invention uses a monoclonal antibody that reacts with high affinity to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3, and uses FMDV serum from various samples derived from animal individuals infected with foot-and-mouth disease virus. All infections of types O, A, Asia1, C, SAT1, SAT2 and SAT3 can be diagnosed specifically.

본 발명의 또 다른 일 예는 구제역 바이러스(Foot and Mouth Disease Virus; FMDV) 혈청형(serotype) O, A, Asia1, C, SAT1, SAT2 및 SAT3을 동시에 탐지하는 방법에 관한 것이다.Another example of the present invention relates to a method for simultaneously detecting Foot and Mouth Disease Virus (FMDV) serotype O, A, Asia1, C, SAT1, SAT2 and SAT3.

본 발명은 구제역 바이러스(Foot and Mouth Disease Virus; 이하, FMDV) 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 동시 탐지용 단일클론항체, 상기 단일클론항체를 이용한 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 동시 탐지 방법 및 상기 단일클론항체를 이용한 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 동시 탐지용 키트에 관한 것으로, 구제역 바이러스 7종의 혈청형을 모두 감지할 수 있어, 구제역 확산 방지를 위한 보다 신속한 초기 예방 조치 수행이 가능하다.The present invention is a monoclonal antibody for simultaneous detection of Foot and Mouth Disease Virus (FMDV) serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3, FMDV serotypes O, A using the monoclonal antibody. , Asia1, C, SAT1, SAT2 and SAT3 simultaneous detection method and a kit for simultaneous detection of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 using the monoclonal antibody. Serum of 7 types of foot-and-mouth disease virus Since all types can be detected, it is possible to take early precautions more quickly to prevent the spread of foot-and-mouth disease.

도 1은 본 발명의 일 실시예에 따른 하이브리도마 배양액 스크리닝을 위한 효소면역측정법의 원리를 보여주는 모식도이다.
도 2a 내지 도 2e는 본 발명의 일 실시예에 따른 FMDV 혈청형에 모두 반응하는 단일클론항체 7종을 이용한 capture/detector matching test 결과이다.
도 3은 본 발명의 일 실시예에 따라 단클론항체 1E58의 FMDV 혈청형 7종에 대한 반응성 결과이다.
도 4는 본 발명의 일 실시예에 따라 단클론항체 1E58을 이용한 구제역 바이러스 항원진단용 효소면역측정법의 원리를 나타내는 모식도이다.
도 5는 본 발명의 일 실시예에 따라 단클론항체 1E58을 이용한 구제역 바이러스 항원진단용 효소면역측정법의 반응 최적화 결과이다.
도 6은 본 발명의 일 실시예에 따라 단클론항체 1E58을 이용한 구제역 바이러스 항원진단용 효소면역측정법의 민감성을 타사 상용화키트와 비교한 결과이다.
도 7은 본 발명의 일 실시예에 따라 단클론항체 1E58을 이용한 구제역 바이러스 항원진단용 효소면역측정법의 특이성을 확인한 결과이다.
1 is a schematic diagram showing the principle of an enzyme immunoassay method for screening a hybridoma culture medium according to an embodiment of the present invention.
2A to 2E are the results of a capture/detector matching test using seven monoclonal antibodies that respond to all FMDV serotypes according to an embodiment of the present invention.
3 is a result of the reactivity of the monoclonal antibody 1E58 against 7 FMDV serotypes according to an embodiment of the present invention.
4 is a schematic diagram showing the principle of an enzyme immunoassay method for diagnosis of foot-and-mouth disease virus antigen using a monoclonal antibody 1E58 according to an embodiment of the present invention.
5 is a reaction optimization result of an enzyme immunoassay for diagnosis of foot-and-mouth disease virus antigen using a monoclonal antibody 1E58 according to an embodiment of the present invention.
6 is a result of comparing the sensitivity of an enzyme immunoassay method for diagnosis of foot-and-mouth disease virus antigen using a monoclonal antibody 1E58 according to an embodiment of the present invention with other commercial kits.
7 is a result of confirming the specificity of an enzyme immunoassay method for diagnosis of foot-and-mouth disease virus antigen using a monoclonal antibody 1E58 according to an embodiment of the present invention.

이하, 본 발명을 하기의 실시예에 의하여 더욱 상세히 설명한다. 그러나 이들 실시예는 본 발명을 예시하기 위한 것일 뿐이며, 본 발명의 범위가 이들 실시 예에 의하여 한정되는 것은 아니다.Hereinafter, the present invention will be described in more detail by the following examples. However, these examples are for illustrative purposes only, and the scope of the present invention is not limited by these examples.

실시예 1. 하이브리도마의 제작, 단일클론항체 생산 및 성능 평가Example 1. Preparation of hybridomas, production of monoclonal antibodies, and performance evaluation

1-1. 면역원 준비1-1. Preparation of the immunogen

FMDV A (IRAQ)을 BHK21 세포에 접종 후 37도에서 24시간 배양을 통해 증폭된 FMDV A (IRAQ) 를 수거하였다. 그 다음, 바이너리 에칠렌이민(Binary Ethylenimine; BEI)을 0.003N 농도로 처리한 후 37도에서 24시간 동안 진탕배양하여 불활화 후, 티오황산나트륨(sodium thiosulfate) 0.002N을 첨가하여 중화시킨다. 불활화 배양 상층액에 PEG6000(Poly Ethylene Glycol; PEG)과 염화나트륨(sodium chloride; NaCl)을 각각 7.5%, 2.3% 첨가하고 24시간 동안 4도에서 stirring incubation한다. PEG6000 처리 상층액은 11,000RPM에서 20분간 원심 분리한 후 pellet을 TN buffer(pH 7.6)로 다시 풀어준다. 11,000RPM에서 20분간 다시 원심 분리하여 상층액을 설탕 밀도 기울기 원심 분리법(sucrose density gradient centrifugation)으로 초원심 분리(30,000rpm, 4시간)하여 순도 높은 FMDV Asia1 분획을 수득하였다.FMDV A (IRAQ) was inoculated into BHK21 cells, and then amplified FMDV A (IRAQ) was collected through culture at 37 degrees for 24 hours. Then, binary ethylenimine (BEI) was treated at a concentration of 0.003N and inactivated by shaking culture at 37°C for 24 hours, and then neutralized by adding 0.002N sodium thiosulfate. 7.5% and 2.3% of PEG6000 (Poly Ethylene Glycol; PEG) and sodium chloride (NaCl) were added to the inactivated culture supernatant, respectively, followed by stirring incubation at 4 degrees for 24 hours. The PEG6000-treated supernatant was centrifuged at 11,000RPM for 20 minutes, and then the pellet was re-dissolved with TN buffer (pH 7.6). Centrifugation was performed again at 11,000 RPM for 20 minutes, and the supernatant was ultracentrifuged (30,000 rpm, 4 hours) by sucrose density gradient centrifugation to obtain a high purity FMDV Asia1 fraction.

1-2. 면역화1-2. Immunization

1-1에서 수득한 불활화된 FMDV A (IRAQ)을 이용하여 실험동물(balb/c mouse)에 면역(immunization)을 실시하였다. 구체적으로, 항원으로서 불활화 FMDV A (IRAQ)을 0.25 mg/ml 농도로 200ul 준비하고 Freund's Adjuvant(FA) 200ul와 혼합하여 마우스(㈜오리엔트바이오) 복강에 2주 간격으로 1-3차 면역을 실시하였다. 퓨전 면역 검사를 위해 3차 면역 1주 후, 마우스 혈청을 이용하여 간접(indirect) ELISA 검사를 실시하였다. 최종 부스팅을 위해 불활화 FMDV A (IRAQ) 100ul를 복강으로 면역하고 4일 후 세포융합에 사용하였다. Immunization was performed on experimental animals (balb/c mice) using the inactivated FMDV A (IRAQ) obtained in 1-1. Specifically, 200ul of inactivated FMDV A (IRAQ) as an antigen was prepared at a concentration of 0.25 mg/ml, mixed with 200ul of Freund's Adjuvant (FA), and subjected to 1-3 immunization in the abdominal cavity of a mouse (Orient Bio Co., Ltd.) every 2 weeks. I did. For the fusion immunity test, one week after the third immunization, an indirect ELISA test was performed using mouse serum. For final boosting, 100 ul of inactivated FMDV A (IRAQ) was immunized intraperitoneally and used for cell fusion after 4 days.

1-3. 세포융합 및 하이브리도마 제조1-3. Cell fusion and hybridoma manufacturing

면역화된 마우스 몸통 좌측에 위치한 비장(spleen)을 적출하여 DMEM(Dulbecco's modified Eagle's medium) 배지에 부유시켰다. 적출한 비장을 메쉬로 갈아서 세포를 분리하고, 배양배지 DMEM과 혼합하여 비장세포 현탁액을 제조하였다. 그 다음, 상기 현탁액을 1,200rpm에서 5분 동안 원심 분리하여 상층액을 제거하고, 비장세포와 골수세포주(SP2/0 Ag14 (ATCC, USA))를 1:5의 세포 수 비율로 혼합한 후, 1,200rpm에서 5분 동안 원심 분리하여 세포를 침전시켜 상층액은 제거하였다. 원심 분리된 세포를 천천히 분산시킨 후 폴리에틸렌 글리콜 1500(PEG1500, Roche) 1.0 ml을 처리하고, 37℃에서 1분 동안 유지시킨 후 DMEM 1ml을 첨가하였다. 그 다음, DMEM 10 ml을 1분 동안 서서히 첨가하고, 37℃의 물에서 5분 동안 반응시킨 후 50.0 ml로 맞추고, 1,200rpm에서 5분 동안 원심 분리하였다. 세포침전물을 분리배지(HAT배지)에 1 X 105 내지 2 X 105 cells/ml 농도로 재현탁시키고, 96웰 플레이트에 0.1 ml씩 분주한 후 37℃ 이산화탄소 배양기에서 배양하여 하이브리도마 세포를 제조하였다.The spleen located on the left side of the body of the immunized mouse was excised and suspended in DMEM (Dulbecco's modified Eagle's medium) medium. The extracted spleen was ground with a mesh to separate cells, and mixed with a culture medium DMEM to prepare a splenocyte suspension. Then, the suspension was centrifuged at 1,200 rpm for 5 minutes to remove the supernatant, and the splenocytes and bone marrow cell line (SP2/0 Ag14 (ATCC, USA)) were mixed at a cell number ratio of 1:5, The cells were precipitated by centrifugation at 1,200 rpm for 5 minutes, and the supernatant was removed. After the centrifuged cells were slowly dispersed, 1.0 ml of polyethylene glycol 1500 (PEG1500, Roche) was treated and maintained at 37° C. for 1 minute, and 1 ml of DMEM was added. Then, 10 ml of DMEM was slowly added for 1 minute, reacted in water at 37° C. for 5 minutes, adjusted to 50.0 ml, and centrifuged at 1,200 rpm for 5 minutes. Cell sediment is separated from 1 X 10 5 to the medium (HAT medium) Resuspended at a concentration of 2 X 10 5 cells/ml, dispensed into 96-well plates by 0.1 ml, and cultured in a carbon dioxide incubator at 37° C. to prepare hybridoma cells.

1- 4. 하이브리도마 세포의 선별1- 4. Selection of hybridoma cells

상기 제조한 하이브리도마 세포군 중에서 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 반응하는 하이브리도마 세포를 선별하기 위하여, 도 1과 같이 ELISA 분석 방법을 사용하였다.In order to select hybridoma cells that specifically respond to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 among the prepared hybridoma cell groups, an ELISA assay method as shown in FIG. 1 was used. .

구체적으로, 목적으로 하는 불활화 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3을 96웰 마이크로플레이트의 한 웰당 각각 100 ul(0.5 ug/ml)씩 가하여 플레이트 표면에 부착시키고, 반응하지 않은 항원은 세척하여 제거하였다. 그 다음, 0.1% casein-PBS 블로킹(blocking) 용액을 웰 당 100ul씩 분주한 후 37℃에서 2 시간 동안 반응 후, 인산 완충용액-트윈 20(0.05%(v/v) 트윈 20이 포함되어있는 인산완충용액, pH 7.4); 이하 PBS-T)로 3회 세척하였다. Specifically, the target inactivated FMDV serotypes O, A, Asia1, C, SAT1, SAT2, and SAT3 were each added to each well of a 96-well microplate 100 ul (0.5 ug/ml), attached to the plate surface, and reacted. The unantigen was removed by washing. Then, after dispensing 100ul of 0.1% casein-PBS blocking solution per well and reacting for 2 hours at 37°C, phosphate buffer solution-Tween 20 (0.05% (v/v) Tween 20 is included) Phosphate buffer solution, pH 7.4); It was washed 3 times with PBS-T).

그 다음, 하이브리도마 세포의 배양액을 각 웰에 100 ul씩을 가하여 1시간 동안 실온에서 반응시킨 후, PBS-T 용액으로 3회 세척하여 반응하지 않은 배양액을 제거하였다. 여기에 염소 항-마우스 IgG-호스레디쉬 퍼옥시다제(Goat anti-mouse IgG-HRP)를 가하여 1시간 동안 실온에서 반응시킨 다음, PBS-T 용액으로 3회 세척하였다. 세척한 후 퍼옥시다제의 기질용액(TMB)을 가하여 반응시키고, 황산 0.5 M를 플레이트 각 웰에 50 ul씩 분주한 뒤 Sunrise ELISA reader(Tecan)를 이용하여 450 nm에서 흡광도를 측정하여 목적으로 하는 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 에 모두 반응성이 높은 항체를 분비하는 하이브리도마 세포주들을 선별하였다.Then, 100 ul of the hybridoma cell culture solution was added to each well and reacted at room temperature for 1 hour, followed by washing three times with PBS-T solution to remove the unreacted culture solution. Goat anti-mouse IgG-HRP was added thereto, reacted at room temperature for 1 hour, and then washed three times with PBS-T solution. After washing, a peroxidase substrate solution (TMB) was added to react, and 0.5 M of sulfuric acid was dispensed into each well of the plate by 50 ul, and the absorbance was measured at 450 nm using a Sunrise ELISA reader (Tecan). Hybridoma cell lines secreting antibodies highly reactive to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 were selected.

선별된 하이브리도마 세포주를 제한 희석하여 클로닝을 진행하여 단일클론화 하였고, 이후 위와 같은 방법으로 목적 항체를 분비하는 하이브리도마 세포주를 선별하여, 그 결과를 표 1에 나타내었다. The selected hybridoma cell line was subjected to limited dilution and cloning to be monocloned, and then hybridoma cell lines secreting the target antibody were selected by the same method as above, and the results are shown in Table 1.

NoNo Clone nameClone name IsotypeIsotype 1One 8C238C23 IgG1, kIgG1, k 22 8E728E72 IgG1, kIgG1, k 33 9D69D6 IgG1, kIgG1, k 44 10C5910C59 IgG1, kIgG1, k 55 1E581E58 IgG1, kIgG1, k 66 9G219G21 IgG1, kIgG1, k 77 10D210D2 IgG1, kIgG1, k

표 1에서 확인할 수 있듯이, 불활화 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 반응하는 7종의 단일클론항체를 선발하였다.As can be seen in Table 1, 7 types of monoclonal antibodies that respond to all of the inactivated FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 were selected.

1-5. 복수제작 및 정제1-5. Multiple production and refinement

FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 반응하는 7종 하이브리도마를 이용하여 생산된 복수(ascitic fluids)를 0.45um 여과 후, 단백질 G 컬럼(GE, Sweden)에 바인딩 시켰으며, 용출 버퍼(100mM glycin HClr, pH 2.8)를 이용하여 단일클론항체만 용출한 후 투석(MWCO 12,000 내지 14,000)을 통해 PBS(pH 7.0)로 버퍼 교환하였다. 정제된 단일클론항체는 -70℃ 에 보관하였다. FMDV serotypes O, A, Asia1, C, SAT1, SAT2, and ascitic fluids produced using 7 hybridomas that specifically react to all of SAT3 were filtered 0.45 um, and then protein G column (GE, Sweden), and after eluting only monoclonal antibodies using an elution buffer (100mM glycin HClr, pH 2.8), the buffer was exchanged with PBS (pH 7.0) through dialysis (MWCO 12,000 to 14,000). The purified monoclonal antibody was stored at -70°C.

1-6. FMDV 혈청형 O, A, Asia1, SAT1, SAT2 및 SAT3 특이 단클론항체 선별 (교차반응성 평가)1-6. Selection of FMDV serotypes O, A, Asia1, SAT1, SAT2 and SAT3 specific monoclonal antibodies (cross reactivity evaluation)

FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 반응하는 단클론항체를 선별하기 위하여 ELISA 및 면역크로마토그래피 분석 방법을 사용하였다. In order to select monoclonal antibodies that specifically respond to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3, ELISA and immunochromatographic analysis methods were used.

ELISA의 경우 구체적으로, 목적으로 하는 불활화 FMDV O, A, Asia1과의 교차반응성을 확인하기 위해 불활화 FMDV O, A, Asia1을 각각 96웰 마이크로플레이트의 한 웰 당 각각 100 ul(0.5 ug/ml)씩 가하여 플레이트 표면에 부착시키고, 반응하지 않은 항원은 세척하여 제거하였다. 0.1% casein-PBS 블로킹 용액을 웰 당 100ul씩 분주한 후 37℃에서 2 시간 동안 반응 후 PBS-T 용액으로 3회 세척하였다. In the case of ELISA, specifically, inactivated FMDV O, A, and Asia1 were each 100 ul (0.5 ug/well) per well of a 96-well microplate to confirm cross-reactivity with the target inactivated FMDV O, A, and Asia1. ml) was added and attached to the plate surface, and unreacted antigens were washed away. 100ul of 0.1% casein-PBS blocking solution was dispensed per well, reacted at 37° C. for 2 hours, and washed 3 times with PBS-T solution.

그 다음, 하이브리도마 세포의 배양액을 각 웰에 100 ul씩을 가하여 1시간 동안 실온에서 반응시킨 후, PBS-T 용액으로 3회 세척하여 반응하지 않은 배양액을 제거하였다. 여기에 염소 항-마우스 IgG-호스레디쉬 퍼옥시다제(Goat anti-mouse IgG-HRP)를 가하여 1시간 동안 실온에서 반응시킨 다음, PBS-T 용액으로 3회 세척하였다. 세척한 후 퍼옥시다제의 기질용액(TMB)을 가하여 반응시키고, 황산 0.5 M를 플레이트 각 웰에 50 ul씩 분주한 뒤 Sunrise ELISA reader(Tecan)를 이용하여 450 nm에서 흡광도를 측정하여 항원에 대한 반응성 및 교차반응성을 측정하여, 그 결과를 표 2에 나타내었다. Then, 100 ul of the hybridoma cell culture solution was added to each well and reacted at room temperature for 1 hour, followed by washing three times with PBS-T solution to remove the unreacted culture solution. Goat anti-mouse IgG-HRP was added thereto, reacted at room temperature for 1 hour, and then washed three times with PBS-T solution. After washing, a substrate solution (TMB) of peroxidase was added to react, and 0.5 M of sulfuric acid was dispensed into each well of the plate by 50 ul, and the absorbance was measured at 450 nm using a Sunrise ELISA reader (Tecan). Reactivity and cross-reactivity were measured, and the results are shown in Table 2.

No.No. Clone NameClone Name ELISA screening plate (O.D)ELISA screening plate (O.D) OO AA Asia1Asia1 1One 8C238C23 2.012.01 1.991.99 1.501.50 22 8E728E72 2.022.02 1.981.98 2.002.00 33 9D69D6 1.861.86 2.062.06 1.301.30 44 10C5910C59 2.022.02 1.881.88 1.811.81 55 1E581E58 2.022.02 2.132.13 1.931.93 66 9G219G21 1.771.77 2.082.08 1.231.23 77 10D210D2 2.252.25 2.132.13 1.971.97

면역크로마토그래피 의 경우 구체적으로, 목적으로 하는 불활화된 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3와의 교차반응성을 확인하기 위하여, 표 1의 7종의 단클론항체가 각각 2mg/ml의 농도로 부동화 되어있는 니트로섬유소막을 준비하였으며, 상기 7종의 단클론항체를 각각 약 40nm의 금나노입자에 축합하여 7종의 단클론항체-금나노입자 축합체를 제조하여 불활화된 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3를 모두 감지하는 캡쳐(capture) 항체와 디텍터(detector) 항체를 선별하고, 항체의 반응성을 분석하여, 그 결과를 도 2 및 도3에 나타내었다. In the case of immunochromatography, specifically, in order to confirm the cross-reactivity with the target inactivated FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3, the 7 monoclonal antibodies of Table 1 were each 2mg/ A nitrofiber membrane immobilized at a concentration of ml was prepared, and the 7 types of monoclonal antibodies were condensed into gold nanoparticles of about 40 nm each to prepare 7 types of monoclonal antibody-gold nanoparticle condensates, and inactivated FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 detection (capture) antibodies and detector (detector) antibodies were selected, and the reactivity of the antibody was analyzed, and the results are shown in FIGS. 2 and 3 .

도 2 및 도 3에서 확인할 수 있듯이, 1E58 단클론항체가 FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3에 모두 반응하는 것으로 확인 되었다.As can be seen in Figures 2 and 3, it was confirmed that the 1E58 monoclonal antibody responds to all of FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3.

실시예 2. FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3를Example 2. FMDV serotypes O, A, Asia1, C, SAT1, SAT2 and SAT3 모두 감지할 수 있는 단클론항체 1E58을 이용한 구제역 바이러스 항원진단용 효소면역측정법 반응 최적화Optimization of enzyme immunoassay reaction for diagnosis of foot-and-mouth disease virus antigen using monoclonal antibody 1E58 that can detect all

2-1. 단일클론항체 부동화(immobilization)2-1. Immobilization of monoclonal antibodies

1E58 단클론항체를 96웰 마이크로플레이트의 한 웰 당 각각 100 ul(1~8 ug/ml)씩 가하여 플레이트 표면에 부착시키고, 반응하지 않은 단클론항체는 세척하여 제거하였다. 0.1% casein-PBS 블로킹 용액을 웰 당 100ul씩 분주한 후 37℃에서 2 시간 동안 반응 후 PBS-T 용액으로 3회 세척하였다. 100 ul (1-8 ug/ml) of 1E58 monoclonal antibody was added to each well of a 96-well microplate and attached to the plate surface, and the unreacted monoclonal antibody was washed away. 100ul of 0.1% casein-PBS blocking solution was dispensed per well, reacted at 37° C. for 2 hours, and washed 3 times with PBS-T solution.

2-2. 효소-단일클론항체 1E58 컨쥬게이트 제조 2-2. Preparation of enzyme-monoclonal antibody 1E58 conjugate

상용화 HRP 컨쥬게이션 키트 (Roche, cat. no. 11 829 696 001)를 이용하여 사용자 메뉴얼에 따라 HRP 커플링을 수행하였다.HRP coupling was performed according to the user's manual using a commercial HRP conjugation kit (Roche, cat. no. 11 829 696 001).

2-3. 검체 희석버퍼 (specimen dilution buffer) 2-3. Specimen dilution buffer

검역본부에서 준비된 FMDV 배양액을 희석하기 위한 검체 희석버퍼는 0.1M 카보네이트(carbonate), 1% BSA, 0.1% 트윈 20, 0.05% NaCl, 0.1% 아지드화 나트륨(sodium azide), pH 9.6으로 제작하였다.The sample dilution buffer for diluting the FMDV culture solution prepared by the Quarantine Division was prepared with 0.1M carbonate, 1% BSA, 0.1% Tween 20, 0.05% NaCl, 0.1% sodium azide, and pH 9.6. .

2-4. 효소면역측정법 반응 최적화 시험2-4. Enzyme immunoassay reaction optimization test

1E58 단일클론항체가 1~8ug/ml로 코팅되어있는 96웰 마이크로플레이트에 구제역 바이러스 혈청형 O 배양액(cal1~cal4)을 각 웰에 100 ul씩을 가하여 1시간 동안 실온에서 반응시킨 후, PBS-T 용액으로 3회 세척하여 반응하지 않은 배양액을 제거하였다. 여기에 효소-단일클론항체 1E58 컨쥬게이트를 다양한 농도(0.2ug/ml ~ 0.8ug/ml)로 가하여 1시간 동안 실온에서 반응시킨 다음, PBS-T 용액으로 3회 세척하였다. 세척한 후 퍼옥시다제의 기질용액(TMB)을 가하여 반응시키고, 황산 0.5 M를 플레이트 각 웰에 50 ul씩 분주한 뒤 Sunrise ELISA reader(Tecan)를 이용하여 450 nm에서 흡광도를 측정하여 항원에 대한 반응성을 측정하여, 그 결과를 도 5 및 표 3에 나타내었다.In a 96-well microplate coated with 1E58 monoclonal antibody at 1-8 ug/ml, 100 ul of foot-and-mouth disease virus serotype O culture solution (cal1~cal4) was added to each well and reacted at room temperature for 1 hour, followed by PBS-T. The unreacted culture was removed by washing three times with the solution. Here, enzyme-monoclonal antibody 1E58 conjugate was added at various concentrations (0.2ug/ml ~ 0.8ug/ml), reacted at room temperature for 1 hour, and then washed 3 times with PBS-T solution. After washing, a substrate solution (TMB) of peroxidase was added to react, and 0.5 M of sulfuric acid was dispensed into each well of the plate by 50 ul, and the absorbance was measured at 450 nm using a Sunrise ELISA reader (Tecan). Reactivity was measured, and the results are shown in FIG. 5 and Table 3.

coating
conc.
coating
conc.
1 ug/ml1 ug/ml 2 ug/ml2 ug/ml 4 ug/ml4 ug/ml 8 ug/ml8 ug/ml
detector
conc.
(ug/ml)
detector
conc.
(ug/ml)
0.80.8 0.60.6 0.40.4 0.20.2 0.80.8 0.60.6 0.40.4 0.20.2 0.80.8 0.60.6 0.40.4 0.20.2 0.80.8 0.60.6 0.40.4 0.20.2
  O.D O.D O.DO.D O.DO.D O.DO.D O.DO.D O.DO.D O.DO.D O.DO.D O.DO.D O.DO.D O.DO.D O.DO.D O.DO.D O.DO.D O.DO.D O.DO.D cal1cal1 3.213.21 2.982.98 2.432.43 1.811.81 4.004.00 3.683.68 3.873.87 3.123.12 4.004.00 4.004.00 3.153.15 3.473.47 4.004.00 3.273.27 3.183.18 2.352.35 cal2cal2 1.971.97 1.551.55 1.401.40 1.061.06 3.673.67 3.423.42 2.492.49 1.801.80 3.753.75 3.473.47 3.083.08 2.092.09 4.004.00 1.841.84 1.851.85 1.241.24 cal3cal3 1.171.17 0.830.83 0.770.77 0.540.54 2.082.08 1.891.89 1.371.37 0.980.98 2.652.65 2.152.15 1.781.78 1.141.14 1.311.31 1.131.13 0.960.96 0.620.62 cal4cal4 1.071.07 0.740.74 0.650.65 0.500.50 1.051.05 0.870.87 0.560.56 0.620.62 1.461.46 1.111.11 0.880.88 0.630.63 0.590.59 0.620.62 0.390.39 0.270.27

도 5 및 표 3에서 확인할 수 있듯이, 코팅 농도는 4ug/ml, 효소-단일클론항체 1E58 컨쥬게이트 (detector)의 농도는 0.8ug/ml로 결정하였다.As can be seen in Figure 5 and Table 3, the coating concentration was 4ug / ml, the concentration of the enzyme-monoclonal antibody 1E58 conjugate (detector) was determined to be 0.8ug / ml.

실시예 3. 단클론항체 1E58을 이용한 구제역 바이러스Example 3. Foot-and-mouth disease virus using monoclonal antibody 1E58 항원진단용 효소면역측정법의 구제역 바이러스 민감성 및 특이도 평가Evaluation of the sensitivity and specificity of foot-and-mouth disease virus by enzyme immunoassay for antigen diagnosis

3-1. 효소면역측정법 민감성 및 특이도 평가 시험3-1. Enzyme immunoassay sensitivity and specificity evaluation test

1E58 단일클론항체가 4ug/ml로 코팅되어있는 96웰 마이크로플레이트에 구제역 바이러스 배양액 및 특이성 검증용 시료(소타액, 돼지타액, 소설, 돈설, 소족, 돈족, 숙주세포(BHK21) 배양액) 각 50 ul과 검체 희석버퍼 50 ul를 섞어 각 웰에 100 ul을 가하여 1시간 동안 실온에서 반응시킨 후, PBS-T 용액으로 3회 세척하여 반응하지 않은 배양액을 제거하였다. 여기에 효소-단일클론항체 1E58 컨쥬게이트를 0.3ug/ml 농도로 가하여 1시간 동안 실온에서 반응시킨 다음, PBS-T 용액으로 3회 세척하였다. 세척한 후 퍼옥시다제의 기질용액(TMB)을 가하여 반응시키고, 황산 0.5 M를 플레이트 각 웰에 50 ul씩 분주한 뒤 Sunrise ELISA reader(Tecan)를 이용하여 450 nm에서 흡광도를 측정하여 항원에 대한 반응성 측정하여, 그 결과를 도 6 및 표 4에 나타내었다. Foot-and-mouth disease virus culture solution and specificity verification sample in 96-well microplate coated with 1E58 monoclonal antibody at 4 ug/ml (bovine saliva, pig saliva, novel, pig tongue, small foot, pig foot, host cell (BHK21) culture solution) And 50 ul of the sample dilution buffer were mixed, 100 ul was added to each well, reacted at room temperature for 1 hour, and washed 3 times with PBS-T solution to remove unreacted culture. Here, the enzyme-monoclonal antibody 1E58 conjugate was added at a concentration of 0.3ug/ml, reacted at room temperature for 1 hour, and then washed three times with PBS-T solution. After washing, a substrate solution (TMB) of peroxidase was added to react, and 0.5 M of sulfuric acid was dispensed into each well of the plate by 50 ul, and the absorbance was measured at 450 nm using a Sunrise ELISA reader (Tecan). Reactivity was measured, and the results are shown in Figs.

구제역바이러스
혈청형
Foot-and-mouth disease virus
Serotype
Strain 명Strain name O.D (450nm)O.D (450nm) 비고Remark
1E58
효소면역측정법
1E58
Enzyme immunoassay
타사 상용화
효소면역측정법
Commercialization of other companies
Enzyme immunoassay
OO PrimorskyPrimorsky 4.0004.000 1.3531.353 ManisaManisa 4.0004.000 0.6160.616 Taiwan97Taiwan97 4.0004.000 0.4990.499 CamposCampos 3.9573.957 0.6300.630 BFSBFS 3.7633.763 0.4680.468 양주liquor 4.0004.000 0.4490.449 진천Jincheon 4.0004.000 0.7080.708 합천Hapcheon 3.9943.994 0.6210.621 김제Gimje 4.0004.000 0.8760.876 보은1차Boeun 1st 3.6433.643 0.2240.224 정읍Jeongeup 3.8613.861 0.4130.413 AA Malaysia97Malaysia97 4.0004.000 2.2182.218 Iran05Iran05 4.0004.000 2.9862.986 A22iraqA22iraq 3.7933.793 1.5631.563 포천Pocheon 3.8743.874 0.5950.595 연천Yeoncheon 3.4953.495 0.6160.616 Asia1Asia1 MOGMOG 3.8473.847 0.9940.994 CAMCAM 4.0004.000 0.7240.724 ShamirShamir 4.0004.000 0.4710.471 SATSAT SAT1SAT1 2.2192.219 3.2203.220 SAT2SAT2 1.9491.949 1.1911.191 SAT3SAT3 3.6003.600 0.0000.000 CC C3C3 3.7553.755 1.3201.320

도 6 및 표 4에서 확인할 수 있듯이, SAT1 바이러스 배양액를 제외한 모든 바이러스에서 타사키트보다 반응성이 높았다. SAT3 바이러스 배양액의 경우, 타사키트의 반응결과가 없어 도 6에서 누락되었다.As can be seen in Figure 6 and Table 4, all viruses except for the SAT1 virus culture medium were more reactive than other kits. In the case of the SAT3 virus culture solution, there was no reaction result of the other company kit, so it was omitted from FIG. 6.

테스트된 구제역 항원 측정용 효소면역측정법 성능평가용 구제역 바이러스 목록은 하기 표 5에 나열되어있다.The list of foot-and-mouth disease viruses for evaluation of the performance of the enzyme immunoassay method for measuring the tested foot-and-mouth disease antigen is listed in Table 5 below.

No.No. SerotypeSerotype StrainStrain Topotype/LineageTopotype/Lineage YearYear TiterTiter 1One AA 포천주Pocheonju Asia/Sea-97Asia/Sea-97 20102010 4.14×10^64.14×10^6 22 AA 연천주Yeoncheonju Asia/Sea-97Asia/Sea-97 20172017 1.50×10^61.50×10^6 33 AA Malaysia97Malaysia97 Asia/Sea-97Asia/Sea-97 2.00×10^62.00×10^6 44 AA Iran05Iran05 Asia/Iran-05Asia/Iran-05 6.32×10^56.32×10^5 55 AA A22 IraqA22 Iraq Asia/G-IVAsia/G-IV 20062006 1.12×10^71.12×10^7 66 Asia1Asia1 MOG/05MOG/05 G-VG-V 20052005 1.50×10^71.50×10^7 77 Asia1Asia1 CAM/9/80CAM/9/80 G-VG-V 20062006 8.43×10^68.43×10^6 88 Asia1Asia1 ShamirShamir G-VG-V 20092009 1.50×10^61.50×10^6 99 CC C3/Resende/BRA/55C3/Resende/BRA/55 Euro-SAEuro-SA 20062006 1.12×10^61.12×10^6 1010 OO Yang-JuYang-Ju SEA/Mya-98SEA/Mya-98 20102010 6.32×10^66.32×10^6 1111 OO 진천Jincheon SEA/Mya-98SEA/Mya-98 20142014 1.50×10^61.50×10^6 1212 OO O/Hapcheon/KOR/2014O/Hapcheon/KOR/2014 SEA/Mya-98SEA/Mya-98 20142014 1.12×10^61.12×10^6 1313 OO 김제Gimje SEA/Mya-98SEA/Mya-98 20162016 1.50×10^61.50×10^6 1414 OO 보은 1차Boeun 1st ME-SA/ind-2001dME-SA/ind-2001d 20172017 1.12×10^61.12×10^6 1515 OO 정읍Jeongeup ME-SA/ind-2001dME-SA/ind-2001d 20172017 3.56×10^63.56×10^6 1616 OO O1 ManisaO1 Manisa ME-SAME-SA 백신주Vaccine stock 1.12×10^61.12×10^6 1717 OO O1/BFS/860/UK/67O1/BFS/860/UK/67 Euro-SAEuro-SA 20012001 1.50×10^61.50×10^6 1818 OO Yunlin/Taiwan/97Yunlin/Taiwan/97 CathayCathay 2.00×10^62.00×10^6 1919 OO PrimorskyPrimorsky SEA/Mya-98SEA/Mya-98 20142014 3.56×10^53.56×10^5 2020 OO CamposCampos Euro-SAEuro-SA 2.00×10^82.00×10^8 2121 SAT1SAT1 SAT1/BOT/1/68SAT1/BOT/1/68 WZ(III)WZ(III) 20062006 2.00×10^72.00×10^7 2222 SAT2SAT2 SAT2/ZIM/5/81SAT2/ZIM/5/81 WZ(II)WZ(II) 20062006 6.32×10^66.32×10^6 2323 SAT3SAT3 SAT3/ZIM/4/81SAT3/ZIM/4/81 WZ(I)WZ(I) 20062006 8.43×10^68.43×10^6

또한, 도 7 및 표 6에서 확인할 수 있듯이, 1E58을 이용한 효소면역측정법은 소, 돼지 타액 및 조직(설, 족), 세포배양액(BHK21) 등과 반응하지 않는 것으로 확인 되었다. In addition, as can be seen in Figure 7 and Table 6, it was confirmed that the enzyme immunoassay method using 1E58 did not react with cattle and pig saliva and tissues (seol, foot), cell culture solution (BHK21), and the like.

구제역바이러스
음성 검체
Foot-and-mouth disease virus
Negative sample
1E58 효소면역측정법
O.D (450nm)
1E58 Enzyme Immunoassay
OD (450nm)
구제역바이러스
음성 검체
Foot-and-mouth disease virus
Negative sample
1E58 효소면역측정법
O.D (450nm)
1E58 Enzyme Immunoassay
OD (450nm)
PC(Positive Control)PC(Positive Control) 1.091.09 우설상피1Right tongue epithelium 1 0.0470.047 NC(Negative Control)NC(Negative Control) 0.0320.032 우설상피2Right tongue epithelium 2 0.0890.089 돈설상피1Pigtail epithelium 1 0.0620.062 우설상피3Right tongue epithelium 3 0.0600.060 돈설상피2Pigtail epithelium 2 0.0560.056 우설상피4Right tongue epithelium 4 0.0870.087 돈설상피3Pigtail epithelium 3 0.0770.077 우설상피5Right tongue epithelium 5 0.0660.066 돈설상피4Dorsal epithelium 4 0.0800.080 우족상피1Right foot epithelium 1 0.0600.060 돈설상피5Pigtail epithelium 5 0.0730.073 우족상피2Right foot epithelium 2 0.0520.052 돈족상피1Pigskin epithelium 1 0.0710.071 우족상피3Right foot epithelium 3 0.0480.048 돈족상피2Pigskin epithelium 2 0.0520.052 우족상피4Right foot epithelium 4 0.0510.051 돈족상피3Pigskin epithelium 3 0.0500.050 우족상피5Right foot epithelium 5 0.0510.051 돈족상피4Pigskin epithelium 4 0.0510.051 우타액1Right saliva 1 0.0450.045 돈족상피5Pigskin epithelium 5 0.0550.055 우타액2Right saliva2 0.0480.048 돈타액1Money saliva 1 0.0470.047 우타액3Right saliva 3 0.0530.053 돈타액2Money saliva 2 0.0440.044 우타액4Right saliva 4 0.0490.049 돈타액3Money saliva 3 0.0470.047 우타액5Right saliva 5 0.0620.062 돈타액4Money saliva 4 0.0490.049 BHK21 cell 배양액BHK21 cell culture medium 0.0530.053 돈타액5Money saliva 5 0.0460.046

* 돈설상피: 돼지 혀 상피조직, 돈족상피: 돼지 발 상피조직, 돈타액: 돼지 타액(침)* 우설상피: 소 혀 상피조직, 우족상피: 소 발 상피조직, 우타액: 소 타액(침)* Pig tongue epithelium: pig tongue epithelium, pig foot epithelium: pig foot epithelial tissue, pig saliva: pig saliva (saliva)

* PC: 불활화 구제역바이러스 혈청형 O, NC: 검체희석버퍼 * PC: inactivated foot and mouth disease serotype O, NC: sample dilution buffer

* BHK21 세포 배양액: 구제역바이러스 숙주세포 배양액

그리고, 1E58 단클론항체의 서열번호 1, 서열번호 2 및 서열번호 3으로 각각 표시되는 중쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2), CDR3(complementarity determining region 3) 아미노산 서열, 및 서열번호 4로 표시되는 중쇄 가변영역의 아미노산 서열과 서열번호 5, 서열번호 6 및 서열번호 7로 각각 표시되는 경쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2) 및 CDR3(complementarity determining region 3) 아미노산 서열, 및 서열번호 8로 표시되는 경쇄 가변 영역의 아미노산 서열을 하기 표 7에 나타내었다.
서열
번호
명명 서열 비고
1 HCDR 1_1E58 GHTFTTYT 2 HCDR 2_1E58 FNPNNGGA 3 HCDR 3_1E58 AYGNYVNFDY 4 1E58 Heavy chain V-region EFQLQQSRPELAKPGASVKISCKTSGHTFTTYTMHWVKQSHVKSLEWIGCFNPNNGGATYNQKFKGKATLTMDKSSNTAYVEVRSLTSDDSAVYYCAYGNYVNFDYWGQGTTLTVSS 5 LCDR 1_1E58 KSVSTSGYSY 6 LCDR 2_1E58 LVS 7 LCDR 3_1E58 QHIRELT 8 1E58 Light chain V-region DIVLTQSPASLAVSLGQRATISYRASKSVSTSGYSYMHWNQQKPGQPPRLLIYLVSNLESGVPARFSGSGSGTDFTLNIHPVEEEDAATYYCQHIRELTRSEGGPSWK*N


그리고, 1E58 단클론항체의 서열번호 1, 서열번호 2, 서열번호 3으로 각각 표시되는 중쇄 CDR1, CDR2, CDR3을 각각 코딩하는 서열번호 9 내지 11의 폴리뉴클레오티드, 및 서열번호 4의 아미노산 서열로 이루어진 중쇄 가변 영역을 코딩하는 서열번호 12의 폴리뉴클레오티드와 서열번호 5, 서열번호 6, 서열번호 7으로 각각 표시되는 경쇄 CDR1, CDR2, CDR3을 각각 코딩하는 서열번호 13 내지 15의 폴리뉴클레오티드, 및 서열번호 8의 아미노산 서열로 이루어진 경쇄 가변 영역을 코딩하는 서열번호 16의 폴리뉴클레오티드 서열을 하기 표 8에 나타내었다.
서열
번호
명명 서열 비고
9 HCDR 1_1E58 GGGCACACATTCACTACATACACC 10 HCDR 2_1E58 TTTAATCCTAATAATGGTGGTGCT 11 HCDR 3_1E58 GCCTATGGTAACTACGTAAACTTTGACTAC 12 1E58 Heavy chain V-region GAATTCCAGCTGCAACAGTCTAGACCTGAGTTGGCGAAGCCTGGGGCTTCAGTGAAGATATCCTGCAAGACTTCTGGGCACACATTCACTACATACACCATGCACTGGGTGAAGCAGAGCCATGTAAAGAGCCTTGAGTGGATTGGATGTTTTAATCCTAATAATGGTGGTGCTACTTACAACCAGAAGTTCAAGGGCAAGGCCACACTGACTATGGACAAGTCCTCCAATACAGCCTACGTGGAGGTCCGCAGCCTGACATCTGATGATTCTGCAGTCTATTACTGTGCCTATGGTAACTACGTAAACTTTGACTACTGGGGCCAAGGCACCACTCTCACAGTCTCATCAG 13 LCDR 1_1E58 AAAAGTGTCAGTACATCTGGCTATAGTTAT 14 LCDR 2_1E58 CTTGTATCC 15 LCDR 3_1E58 CAGCACATTAGGGAGCTTACACG 16 1E58 Light chain V-region GACATTGTGCTGACACAGTCTCCTGCTTCCTTAGCTGTATCTCTGGGGCAGAGGGCCACCATCTCATACAGGGCCAGCAAAAGTGTCAGTACATCTGGCTATAGTTATATGCACTGGAACCAACAGAAACCAGGACAGCCACCCAGACTCCTCATCTATCTTGTATCCAACCTAGAATCTGGGGTCCCTGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACCCTCAACATCCATCCTGTGGAGGAGGAGGATGCTGCAACCTATTACTGTCAGCACATTAGGGAGCTTACACGTTCGGAGGGGGGACCAAGCTGGAAATAAAAC

* BHK21 cell culture solution: foot and mouth disease host cell culture solution

And, the heavy chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2), CDR3 (complementarity determining region 3) amino acid sequence represented by SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3, respectively, of the 1E58 monoclonal antibody. The amino acid sequence of the heavy chain variable region represented by number 4 and the light chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2) and CDR3 (complementarity determining region 3) represented by SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7, respectively. ) The amino acid sequence and the amino acid sequence of the light chain variable region represented by SEQ ID NO: 8 are shown in Table 7 below.
order
number
denomination order Remark
One HCDR 1_1E58 GHTFTTYT 2 HCDR 2_1E58 FNPNNGGA 3 HCDR 3_1E58 AYGNYVNFDY 4 1E58 Heavy chain V-region EFQLQQSRPELAKPGASVKISCKTSGHTFTTYTMHWVKQSHVKSLEWIGCFNPNNGGATYNQKFKGKATLTMDKSSNTAYVEVRSLTSDDSAVYYCAYGNYVNFDYWGQGTTLTVSS 5 LCDR 1_1E58 KSVSTSGYSY 6 LCDR 2_1E58 LVS 7 LCDR 3_1E58 QHIRELT 8 1E58 Light chain V-region DIVLTQSPASLAVSLGQRATISYRASKSVSTSGYSYMHWNQQKPGQPPRLLIYLVSNLESGVPARFSGSGSGTDFTLNIHPVEEEDAATYYCQHIRELTRSEGGPSWK*N


And, the heavy chain of SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3 of the 1E58 monoclonal antibody, respectively, the heavy chains of SEQ ID NOs: 9 to 11 encoding the CDR1, CDR2, and CDR3, respectively, and a heavy chain consisting of the amino acid sequence of SEQ ID NO: The polynucleotide of SEQ ID NO: 12 encoding the variable region and the polynucleotides of SEQ ID NO: 13 to 15 each encoding the light chain CDR1, CDR2, and CDR3 represented by SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7, and SEQ ID NO: 8 The polynucleotide sequence of SEQ ID NO: 16 encoding the light chain variable region consisting of the amino acid sequence of is shown in Table 8 below.
order
number
denomination order Remark
9 HCDR 1_1E58 GGGCACACATTCACTACATACACC 10 HCDR 2_1E58 TTTAATCCTAATAATGGTGGTGCT 11 HCDR 3_1E58 GCCTATGGTAACTACGTAAACTTTGACTAC 12 1E58 Heavy chain V-region GAATTCCAGCTGCAACAGTCTAGACCTGAGTTGGCGAAGCCTGGGGCTTCAGTGAAGATATCCTGCAAGACTTCTGGGCACACATTCACTACATACACCATGCACTGGGTGAAGCAGAGCCATGTAAAGAGCCTTGAGTGGATTGGATGTTTTAATCCTAATAATGGTGGTGCTACTTACAACCAGAAGTTCAAGGGCAAGGCCACACTGACTATGGACAAGTCCTCCAATACAGCCTACGTGGAGGTCCGCAGCCTGACATCTGATGATTCTGCAGTCTATTACTGTGCCTATGGTAACTACGTAAACTTTGACTACTGGGGCCAAGGCACCACTCTCACAGTCTCATCAG 13 LCDR 1_1E58 AAAAGTGTCAGTACATCTGGCTATAGTTAT 14 LCDR 2_1E58 CTTGTATCC 15 LCDR 3_1E58 CAGCACATTAGGGAGCTTACACG 16 1E58 Light chain V-region GACATTGTGCTGACACAGTCTCCTGCTTCCTTAGCTGTATCTCTGGGGCAGAGGGCCACCATCTCATACAGGGCCAGCAAAAGTGTCAGTACATCTGGCTATAGTTATATGCACTGGAACCAACAGAAACCAGGACAGCCACCCAGACTCCTCATCTATCTTGTATCCAACCTAGAATCTGGGGTCCCTGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACCCTCAACATCCATCCTGTGGAGGAGGAGGATGCTGCAACCTATTACTGTCAGCACATTAGGGAGCTTACACGTTCGGAGGGGGGACCAAGCTGGAAATAAAAC

한국생명공학연구원 생물자원센터Korea Research Institute of Bioscience and Biotechnology Biological Resource Center KCTC18621PKCTC18621P 2017092620170926

<110> MEDIAN Diagnostics Inc. REPUBLIC OF KOREA(Animal and Plant Quarantine Agency) <120> Monoclonal Antibodies for detecting Foot and Mouth Disease Virus and using the same <130> PN180409 <160> 16 <170> KoPatentIn 3.0 <210> 1 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> HCDR 1_1E58 <400> 1 Gly His Thr Phe Thr Thr Tyr Thr 1 5 <210> 2 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> HCDR 2_1E58 <400> 2 Phe Asn Pro Asn Asn Gly Gly Ala 1 5 <210> 3 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> HCDR 3_1E58 <400> 3 Ala Tyr Gly Asn Tyr Val Asn Phe Asp Tyr 1 5 10 <210> 4 <211> 117 <212> PRT <213> Artificial Sequence <220> <223> 1E58 Heavy chain V-region <400> 4 Glu Phe Gln Leu Gln Gln Ser Arg Pro Glu Leu Ala Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Ile Ser Cys Lys Thr Ser Gly His Thr Phe Thr Thr Tyr 20 25 30 Thr Met His Trp Val Lys Gln Ser His Val Lys Ser Leu Glu Trp Ile 35 40 45 Gly Cys Phe Asn Pro Asn Asn Gly Gly Ala Thr Tyr Asn Gln Lys Phe 50 55 60 Lys Gly Lys Ala Thr Leu Thr Met Asp Lys Ser Ser Asn Thr Ala Tyr 65 70 75 80 Val Glu Val Arg Ser Leu Thr Ser Asp Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Ala Tyr Gly Asn Tyr Val Asn Phe Asp Tyr Trp Gly Gln Gly Thr Thr 100 105 110 Leu Thr Val Ser Ser 115 <210> 5 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> LCDR 1_1E58 <400> 5 Lys Ser Val Ser Thr Ser Gly Tyr Ser Tyr 1 5 10 <210> 6 <211> 3 <212> PRT <213> Artificial Sequence <220> <223> LCDR 2_1E58 <400> 6 Leu Val Ser 1 <210> 7 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> LCDR 3_1E58 <400> 7 Gln His Ile Arg Glu Leu Thr 1 5 <210> 8 <211> 109 <212> PRT <213> Artificial Sequence <220> <223> 1E58 Light chain V-region <400> 8 Asp Ile Val Leu Thr Gln Ser Pro Ala Ser Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala Thr Ile Ser Tyr Arg Ala Ser Lys Ser Val Ser Thr Ser 20 25 30 Gly Tyr Ser Tyr Met His Trp Asn Gln Gln Lys Pro Gly Gln Pro Pro 35 40 45 Arg Leu Leu Ile Tyr Leu Val Ser Asn Leu Glu Ser Gly Val Pro Ala 50 55 60 Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Asn Ile His 65 70 75 80 Pro Val Glu Glu Glu Asp Ala Ala Thr Tyr Tyr Cys Gln His Ile Arg 85 90 95 Glu Leu Thr Arg Ser Glu Gly Gly Pro Ser Trp Lys Asn 100 105 <210> 9 <211> 24 <212> DNA <213> Artificial Sequence <220> <223> HCDR 1_1E58 <400> 9 gggcacacat tcactacata cacc 24 <210> 10 <211> 24 <212> DNA <213> Artificial Sequence <220> <223> HCDR 2_1E58 <400> 10 tttaatccta ataatggtgg tgct 24 <210> 11 <211> 30 <212> DNA <213> Artificial Sequence <220> <223> HCDR 3_1E58 <400> 11 gcctatggta actacgtaaa ctttgactac 30 <210> 12 <211> 352 <212> DNA <213> Artificial Sequence <220> <223> 1E58 Heavy chain V-region <400> 12 gaattccagc tgcaacagtc tagacctgag ttggcgaagc ctggggcttc agtgaagata 60 tcctgcaaga cttctgggca cacattcact acatacacca tgcactgggt gaagcagagc 120 catgtaaaga gccttgagtg gattggatgt tttaatccta ataatggtgg tgctacttac 180 aaccagaagt tcaagggcaa ggccacactg actatggaca agtcctccaa tacagcctac 240 gtggaggtcc gcagcctgac atctgatgat tctgcagtct attactgtgc ctatggtaac 300 tacgtaaact ttgactactg gggccaaggc accactctca cagtctcatc ag 352 <210> 13 <211> 30 <212> DNA <213> Artificial Sequence <220> <223> LCDR 1_1E58 <400> 13 aaaagtgtca gtacatctgg ctatagttat 30 <210> 14 <211> 9 <212> DNA <213> Artificial Sequence <220> <223> LCDR 2_1E58 <400> 14 cttgtatcc 9 <210> 15 <211> 23 <212> DNA <213> Artificial Sequence <220> <223> LCDR 3_1E58 <400> 15 cagcacatta gggagcttac acg 23 <210> 16 <211> 330 <212> DNA <213> Artificial Sequence <220> <223> 1E58 Light chain V-region <400> 16 gacattgtgc tgacacagtc tcctgcttcc ttagctgtat ctctggggca gagggccacc 60 atctcataca gggccagcaa aagtgtcagt acatctggct atagttatat gcactggaac 120 caacagaaac caggacagcc acccagactc ctcatctatc ttgtatccaa cctagaatct 180 ggggtccctg ccaggttcag tggcagtggg tctgggacag acttcaccct caacatccat 240 cctgtggagg aggaggatgc tgcaacctat tactgtcagc acattaggga gcttacacgt 300 tcggaggggg gaccaagctg gaaataaaac 330 <110> MEDIAN Diagnostics Inc. REPUBLIC OF KOREA (Animal and Plant Quarantine Agency) <120> Monoclonal Antibodies for detecting Foot and Mouth Disease Virus and using the same <130> PN180409 <160> 16 <170> KoPatentIn 3.0 <210> 1 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> HCDR 1_1E58 <400> 1 Gly His Thr Phe Thr Thr Tyr Thr 1 5 <210> 2 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> HCDR 2_1E58 <400> 2 Phe Asn Pro Asn Asn Gly Gly Ala 1 5 <210> 3 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> HCDR 3_1E58 <400> 3 Ala Tyr Gly Asn Tyr Val Asn Phe Asp Tyr 1 5 10 <210> 4 <211> 117 <212> PRT <213> Artificial Sequence <220> <223> 1E58 Heavy chain V-region <400> 4 Glu Phe Gln Leu Gln Gln Ser Arg Pro Glu Leu Ala Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Ile Ser Cys Lys Thr Ser Gly His Thr Phe Thr Thr Tyr 20 25 30 Thr Met His Trp Val Lys Gln Ser His Val Lys Ser Leu Glu Trp Ile 35 40 45 Gly Cys Phe Asn Pro Asn Asn Gly Gly Ala Thr Tyr Asn Gln Lys Phe 50 55 60 Lys Gly Lys Ala Thr Leu Thr Met Asp Lys Ser Ser Asn Thr Ala Tyr 65 70 75 80 Val Glu Val Arg Ser Leu Thr Ser Asp Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Ala Tyr Gly Asn Tyr Val Asn Phe Asp Tyr Trp Gly Gln Gly Thr Thr 100 105 110 Leu Thr Val Ser Ser 115 <210> 5 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> LCDR 1_1E58 <400> 5 Lys Ser Val Ser Thr Ser Gly Tyr Ser Tyr 1 5 10 <210> 6 <211> 3 <212> PRT <213> Artificial Sequence <220> <223> LCDR 2_1E58 <400> 6 Leu Val Ser One <210> 7 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> LCDR 3_1E58 <400> 7 Gln His Ile Arg Glu Leu Thr 1 5 <210> 8 <211> 109 <212> PRT <213> Artificial Sequence <220> <223> 1E58 Light chain V-region <400> 8 Asp Ile Val Leu Thr Gln Ser Pro Ala Ser Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala Thr Ile Ser Tyr Arg Ala Ser Lys Ser Val Ser Thr Ser 20 25 30 Gly Tyr Ser Tyr Met His Trp Asn Gln Gln Lys Pro Gly Gln Pro Pro 35 40 45 Arg Leu Leu Ile Tyr Leu Val Ser Asn Leu Glu Ser Gly Val Pro Ala 50 55 60 Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Asn Ile His 65 70 75 80 Pro Val Glu Glu Glu Asp Ala Ala Thr Tyr Tyr Cys Gln His Ile Arg 85 90 95 Glu Leu Thr Arg Ser Glu Gly Gly Pro Ser Trp Lys Asn 100 105 <210> 9 <211> 24 <212> DNA <213> Artificial Sequence <220> <223> HCDR 1_1E58 <400> 9 gggcacacat tcactacata cacc 24 <210> 10 <211> 24 <212> DNA <213> Artificial Sequence <220> <223> HCDR 2_1E58 <400> 10 tttaatccta ataatggtgg tgct 24 <210> 11 <211> 30 <212> DNA <213> Artificial Sequence <220> <223> HCDR 3_1E58 <400> 11 gcctatggta actacgtaaa ctttgactac 30 <210> 12 <211> 352 <212> DNA <213> Artificial Sequence <220> <223> 1E58 Heavy chain V-region <400> 12 gaattccagc tgcaacagtc tagacctgag ttggcgaagc ctggggcttc agtgaagata 60 tcctgcaaga cttctgggca cacattcact acatacacca tgcactgggt gaagcagagc 120 catgtaaaga gccttgagtg gattggatgt tttaatccta ataatggtgg tgctacttac 180 aaccagaagt tcaagggcaa ggccacactg actatggaca agtcctccaa tacagcctac 240 gtggaggtcc gcagcctgac atctgatgat tctgcagtct attactgtgc ctatggtaac 300 tacgtaaact ttgactactg gggccaaggc accactctca cagtctcatc ag 352 <210> 13 <211> 30 <212> DNA <213> Artificial Sequence <220> <223> LCDR 1_1E58 <400> 13 aaaagtgtca gtacatctgg ctatagttat 30 <210> 14 <211> 9 <212> DNA <213> Artificial Sequence <220> <223> LCDR 2_1E58 <400> 14 cttgtatcc 9 <210> 15 <211> 23 <212> DNA <213> Artificial Sequence <220> <223> LCDR 3_1E58 <400> 15 cagcacatta gggagcttac acg 23 <210> 16 <211> 330 <212> DNA <213> Artificial Sequence <220> <223> 1E58 Light chain V-region <400> 16 gacattgtgc tgacacagtc tcctgcttcc ttagctgtat ctctggggca gagggccacc 60 atctcataca gggccagcaa aagtgtcagt acatctggct atagttatat gcactggaac 120 caacagaaac caggacagcc acccagactc ctcatctatc ttgtatccaa cctagaatct 180 ggggtccctg ccaggttcag tggcagtggg tctgggacag acttcaccct caacatccat 240 cctgtggagg aggaggatgc tgcaacctat tactgtcagc acattaggga gcttacacgt 300 tcggaggggg gaccaagctg gaaataaaac 330

Claims (13)

서열번호 1, 서열번호 2 및 서열번호 3으로 각각 표시되는 중쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2) 및 CDR3(complementarity determining region 3) 아미노산 서열을 포함하는 중쇄 가변 영역; 및
서열번호 5, 서열번호 6 및 서열번호 7로 각각 표시되는 경쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2) 및 CDR3(complementarity determining region 3) 아미노산 서열을 포함하는 경쇄 가변 영역;
을 포함하는 구제역 바이러스(Foot and Mouth Disease Virus; FMDV) 탐지용 항체 또는 그의 항원 결합 단편.
A heavy chain variable region comprising amino acid sequences of heavy chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2) and CDR3 (complementarity determining region 3) represented by SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3, respectively; And
A light chain variable region comprising amino acid sequences of light chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2) and CDR3 (complementarity determining region 3) represented by SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7, respectively;
Foot-and-mouth disease virus (Foot and Mouth Disease Virus; FMDV) detection antibody or antigen-binding fragment thereof comprising a.
제1항에 있어서, 상기 항체는 단일클론 항체인 것인, 항체 또는 그의 항원 결합 단편.The antibody or antigen-binding fragment thereof according to claim 1, wherein the antibody is a monoclonal antibody. 제1항에 있어서, 상기 항체는 수탁번호 KCTC18621P 하이브리도마 세포에서 생산되는 것인, 항체 또는 그의 항원 결합 단편.The antibody or antigen-binding fragment thereof according to claim 1, wherein the antibody is produced in accession number KCTC18621P hybridoma cells. 삭제delete 제1항에 있어서, 상기 중쇄 가변 영역은 서열번호 4의 아미노산 서열로 이루어지고, 상기 경쇄 가변 영역은 서열번호 8의 아미노산 서열로 이루어진 것인, 항체 또는 그의 항원 결합 단편.The antibody or antigen-binding fragment thereof according to claim 1, wherein the heavy chain variable region consists of the amino acid sequence of SEQ ID NO: 4, and the light chain variable region consists of the amino acid sequence of SEQ ID NO: 8. 서열번호 4의 아미노산 서열로 이루어진 중쇄 가변영역을 코딩하는 폴리뉴클레오티드; 및 서열번호 8의 아미노산 서열로 이루어진 경쇄 가변영역을 코딩하는 폴리뉴클레오티드를 포함하는 재조합 벡터. A polynucleotide encoding a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 4; And Recombinant vector comprising a polynucleotide encoding a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 8. 제6항에 있어서, 상기 중쇄 가변영역을 코딩하는 폴리뉴클레오티드는 서열번호 12의 뉴클레오티드 서열로 이루어지고, 상기 경쇄 가변영역을 코딩하는 폴리뉴클레오티드는 서열번호 16의 뉴클레오티드 서열로 이루어진 것인 재조합 벡터.The recombinant vector of claim 6, wherein the polynucleotide encoding the heavy chain variable region consists of the nucleotide sequence of SEQ ID NO: 12, and the polynucleotide encoding the light chain variable region consists of the nucleotide sequence of SEQ ID NO: 16. 서열번호 4의 아미노산 서열로 이루어진 중쇄 가변영역을 코딩하는 폴리뉴클레오티드; 및 서열번호 8의 아미노산 서열로 이루어진 경쇄 가변영역을 코딩하는 폴리뉴클레오티드를 포함하는 숙주세포.A polynucleotide encoding a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 4; And a polynucleotide encoding a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 8. 서열번호 1, 서열번호 2 및 서열번호 3으로 각각 표시되는 중쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2) 및 CDR3(complementarity determining region 3) 아미노산 서열을 포함하는 중쇄 가변 영역; 및
서열번호 5, 서열번호 6 및 서열번호 7로 각각 표시되는 경쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2) 및 CDR3(complementarity determining region 3) 아미노산 서열을 포함하는 경쇄 가변 영역;
을 포함하는 구제역 바이러스(Foot and Mouth Disease Virus; FMDV) 탐지용 항체를 생산하는 수탁번호 KCTC18621P인 하이브리도마 세포.
A heavy chain variable region comprising amino acid sequences of heavy chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2) and CDR3 (complementarity determining region 3) represented by SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3, respectively; And
A light chain variable region comprising amino acid sequences of light chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2) and CDR3 (complementarity determining region 3) represented by SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7, respectively;
Foot-and-mouth disease virus (Foot and Mouth Disease Virus; FMDV) comprising a hybridoma cell accession number KCTC18621P to produce an antibody for detection.
서열번호 1, 서열번호 2 및 서열번호 3으로 각각 표시되는 중쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2) 및 CDR3(complementarity determining region 3) 아미노산 서열을 포함하는 중쇄 가변 영역; 및
서열번호 5, 서열번호 6 및 서열번호 7로 각각 표시되는 경쇄 CDR1(complementarity determining region 1), CDR2(complementarity determining region 2) 및 CDR3(complementarity determining region 3) 아미노산 서열을 포함하는 경쇄 가변 영역;
을 포함하는 구제역 바이러스(Foot and Mouth Disease Virus; FMDV) 혈청형(serotype) O, A, Asia1, C, SAT1, SAT2 및 SAT3 모두에 특이적으로 결합하는 항체 또는 그의 항원 결합 단편을 포함하는, FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 항원 탐지용 키트.
A heavy chain variable region comprising amino acid sequences of heavy chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2) and CDR3 (complementarity determining region 3) represented by SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3, respectively; And
A light chain variable region comprising amino acid sequences of light chain CDR1 (complementarity determining region 1), CDR2 (complementarity determining region 2) and CDR3 (complementarity determining region 3) represented by SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7, respectively;
Foot and Mouth Disease Virus (FMDV) serotype O, A, Asia1, C, SAT1, SAT2 and SAT3, including an antibody or antigen-binding fragment thereof that specifically binds all, FMDV Kit for detection of serotype O, A, Asia1, C, SAT1, SAT2 and SAT3 antigens.
삭제delete 제10항에 있어서, 상기 항체는 서열번호 4의 아미노산 서열로 이루어진 중쇄 가변 영역, 서열번호 8의 아미노산 서열로 이루어진 경쇄 가변영역을 포함하는 것인, FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 항원 탐지용 키트.The method of claim 10, wherein the antibody comprises a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 4, and a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 8, FMDV serotype O, A, Asia1, C, SAT1 , SAT2 and SAT3 antigen detection kit. 제10항에 있어서, 상기 항체는 수탁번호 KCTC18621P인 하이브리도마 세포에 의해 생산되는 항체인 것인, FMDV 혈청형 O, A, Asia1, C, SAT1, SAT2 및 SAT3 항원 탐지용 키트.The kit for detecting FMDV serotype O, A, Asia1, C, SAT1, SAT2 and SAT3 antigens according to claim 10, wherein the antibody is an antibody produced by hybridoma cells with accession number KCTC18621P.
KR1020180143947A 2018-11-20 2018-11-20 Monoclonal Antibodies for detecting Foot and Mouth Disease Virus and using the same Active KR102168747B1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1020180143947A KR102168747B1 (en) 2018-11-20 2018-11-20 Monoclonal Antibodies for detecting Foot and Mouth Disease Virus and using the same

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020180143947A KR102168747B1 (en) 2018-11-20 2018-11-20 Monoclonal Antibodies for detecting Foot and Mouth Disease Virus and using the same

Publications (2)

Publication Number Publication Date
KR20200059381A KR20200059381A (en) 2020-05-29
KR102168747B1 true KR102168747B1 (en) 2020-10-23

Family

ID=70912236

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020180143947A Active KR102168747B1 (en) 2018-11-20 2018-11-20 Monoclonal Antibodies for detecting Foot and Mouth Disease Virus and using the same

Country Status (1)

Country Link
KR (1) KR102168747B1 (en)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN116535502B (en) * 2023-01-05 2024-09-20 北京纳百生物科技有限公司 Application of monoclonal antibody specifically binding to foot-and-mouth disease virus type O in preparation of detection kit
CN116589564B (en) * 2023-03-30 2024-01-09 恺佧生物科技(上海)有限公司 anti-AAV5 antibody and ELISA kit for rapid AAV5 titer determination

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2016132629A (en) * 2015-01-16 2016-07-25 国立研究開発法人農業・食品産業技術総合研究機構 Antibodies that react with foot-and-mouth disease virus

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2016132629A (en) * 2015-01-16 2016-07-25 国立研究開発法人農業・食品産業技術総合研究機構 Antibodies that react with foot-and-mouth disease virus

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
Biologicals, Vol. 42, pp. 339-345(2014)
JOURNAL OF CLINICAL MICROBIOLOGY, Vol. 47, No. 11, pp. 3663-3668(2009.11.)
PLoS ONE, Vol. 10, No. 8, e0134931(2015)

Also Published As

Publication number Publication date
KR20200059381A (en) 2020-05-29

Similar Documents

Publication Publication Date Title
CN112812178B (en) PCV3Cap protein epitope peptide, monoclonal antibody for resisting PCV3Cap protein, preparation method and application thereof
CN113493508A (en) Double-antibody sandwich ELISA kit for detecting new coronavirus N protein
CN115724958B (en) Monoclonal antibody of anti-norovirus GII genomic capsid protein VP1 and application thereof
CN116589564B (en) anti-AAV5 antibody and ELISA kit for rapid AAV5 titer determination
CN114621343B (en) Japanese encephalitis virus antibody 2G1 and application thereof
KR101996660B1 (en) Monoclonal Antibodies for detecting Foot and Mouth Disease Virus serotype Asia1 and using the same
KR101960968B1 (en) Monoclonal Antibodies for detecting Foot and Mouth Disease Virus serotype A and using the same
KR102243371B1 (en) Monoclonal Antibody specific for Canine Parvovirus and use thereof
KR102191896B1 (en) Monoclonal Antibodies for detecting the structural protein antibodies against Foot and Mouth Disease Virus serotype O and using the same
KR101996659B1 (en) Monoclonal Antibodies for detecting Foot and Mouth Disease Virus serotype O and using the same
KR101631054B1 (en) Antibody or Antigen Binding Fragment Binding to CFP-10 or Ag85B from Mycobacteria
KR102168747B1 (en) Monoclonal Antibodies for detecting Foot and Mouth Disease Virus and using the same
US10577418B2 (en) Monoclonal anti-GPC-1 antibodies and uses thereof
CN113004413B (en) Monoclonal antibody of porcine IgG3, epitope peptide specifically recognized by monoclonal antibody and application of epitope peptide
KR102078879B1 (en) Monoclonal Antibody specific for Porcine Parvovirus and using the same
KR102029394B1 (en) Monoclonal antibody for diagnosis of chikungunya virus infection, hybribodma producing the monoclonal antibody, and diagnosis method using the same
KR102243368B1 (en) Monoclonal Antibody specific for Porcine Parvovirus and use thereof
KR102652398B1 (en) Monoclonal antibody specific to spike protein of Porcine epidemic diarrhea virus and use thereof
KR102614002B1 (en) Antibody exhibiting immunoreactivity to foot and mouth disease virus type A, composition for detecting foot and mouth disease virus type A antibody comprising the same, and method for detecting foot and mouth disease virus type A antibody using the same
KR102241520B1 (en) An antibody having immune reactivity to Foot-and-Mouth Disease Virus type O and composition for detecting FMDV type O comprising the same
KR20230123066A (en) Antibody or antigen binding fragment thereof specifically binding to structural protein VP0 site of foot-and-mouth disease virus and uses thereof
JP2020186172A (en) ANTI-TGF-β1 ANTIBODIES
KR102604669B1 (en) Monoclonal antibody specific to HA of avian influenza virus and use thereof
CN119529084B (en) Anti-human MNDA protein monoclonal antibody, hybridoma cell strain and application thereof
KR102269281B1 (en) Monoclonal Antibody specific for Canine influenza virus and Use thereof

Legal Events

Date Code Title Description
PA0109 Patent application

Patent event code: PA01091R01D

Comment text: Patent Application

Patent event date: 20181120

PA0201 Request for examination
PE0902 Notice of grounds for rejection

Comment text: Notification of reason for refusal

Patent event date: 20200210

Patent event code: PE09021S01D

PG1501 Laying open of application
E701 Decision to grant or registration of patent right
PE0701 Decision of registration

Patent event code: PE07011S01D

Comment text: Decision to Grant Registration

Patent event date: 20201013

PR0701 Registration of establishment

Comment text: Registration of Establishment

Patent event date: 20201016

Patent event code: PR07011E01D

PR1002 Payment of registration fee

Payment date: 20201016

End annual number: 3

Start annual number: 1

PG1601 Publication of registration
PR1001 Payment of annual fee

Payment date: 20240927

Start annual number: 5

End annual number: 5