KR101876920B1 - Antimicrobial peptides with high synergistic effect with antibiotics against Escherichia coli, Acinetobater Baumannii, and their multidrug resistant bacteria and their uses - Google Patents

Antimicrobial peptides with high synergistic effect with antibiotics against Escherichia coli, Acinetobater Baumannii, and their multidrug resistant bacteria and their uses Download PDF

Info

Publication number
KR101876920B1
KR101876920B1 KR1020160120307A KR20160120307A KR101876920B1 KR 101876920 B1 KR101876920 B1 KR 101876920B1 KR 1020160120307 A KR1020160120307 A KR 1020160120307A KR 20160120307 A KR20160120307 A KR 20160120307A KR 101876920 B1 KR101876920 B1 KR 101876920B1
Authority
KR
South Korea
Prior art keywords
antibiotic
papma
antimicrobial
peptide
seq
Prior art date
Application number
KR1020160120307A
Other languages
Korean (ko)
Other versions
KR20180031527A (en
Inventor
김양미
전다솜
Original Assignee
건국대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 건국대학교 산학협력단 filed Critical 건국대학교 산학협력단
Priority to KR1020160120307A priority Critical patent/KR101876920B1/en
Priority to PCT/KR2017/006650 priority patent/WO2017222335A1/en
Priority to CN201780039278.1A priority patent/CN109415412B/en
Priority to US16/311,028 priority patent/US11214594B2/en
Publication of KR20180031527A publication Critical patent/KR20180031527A/en
Application granted granted Critical
Publication of KR101876920B1 publication Critical patent/KR101876920B1/en

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K20/00Accessory food factors for animal feeding-stuffs
    • A23K20/10Organic substances
    • A23K20/142Amino acids; Derivatives thereof
    • A23K20/147Polymeric derivatives, e.g. peptides or proteins
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K20/00Accessory food factors for animal feeding-stuffs
    • A23K20/10Organic substances
    • A23K20/189Enzymes
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L3/00Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs
    • A23L3/34Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs by treatment with chemicals
    • A23L3/3454Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs by treatment with chemicals in the form of liquids or solids
    • A23L3/3463Organic compounds; Microorganisms; Enzymes
    • A23L3/34635Antibiotics
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/17Amino acids, peptides or proteins
    • A23L33/18Peptides; Protein hydrolysates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/10Peptides having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00Cosmetics or similar toiletry preparations
    • A61K8/18Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64Proteins; Peptides; Derivatives or degradation products thereof
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Polymers & Plastics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Food Science & Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • Nutrition Science (AREA)
  • Public Health (AREA)
  • Animal Husbandry (AREA)
  • Zoology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Medicinal Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Mycology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Birds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

본 발명은 그람음성 다제내성균에 대하여 항균 활성을 가지는 항균 펩타이드에 관한 것으로, 보다 상세하게는 상기 항균 펩타이드를 항생제와 함께 병용투여하여 대장균과 아시네토박터균 및 그 다제내성균에 대한 상승적 항균 효과를 나타낼 수 있는 항균용 약학적 조성물, 식품 첨가제, 사료 첨가제, 방부용 조성물 및 항균용 의약외품 조성물에 관한 것이다. 본 발명의 항생 펩타이드는 그람음성균에 대하여 유의적인 항균 활성을 나타낼 뿐 아니라, 그람양성균에만 강한 항균 활성을 나타내고 그람음성균에는 항균활성을 가지지 않거나 낮은 항균활성을 가지는 항생제와 본 발명의 항생 펩타이드를 혼합 처리하였을 때 유의적인 시너지 효과를 나타내어, 그람양성균 뿐 아니라 그람음성균중 대장균과 아시네토박터균과 이들의 항생제 내성균에 대하여 우수한 항균효과를 나타낼 수 있다.The present invention relates to an antimicrobial peptide having antimicrobial activity against Gram negative multidrug-resistant bacteria. More particularly, the present invention relates to an antimicrobial peptide having antimicrobial activity against Escherichia coli, Acinetobacter bacteria and multidrug-resistant bacteria by co- A food additive, a feed additive, a composition for an antimicrobial, and a composition for quasi-antimicrobial use. The antibiotic peptide of the present invention not only exhibits significant antimicrobial activity against Gram-negative bacteria but also exhibits a strong antimicrobial activity only against Gram-positive bacteria and an antibiotic which does not have antimicrobial activity against gram-negative bacteria or has a low antimicrobial activity and the antibiotic peptide of the present invention , It is possible to exhibit an excellent antimicrobial effect against Gram - positive bacteria as well as Escherichia coli and Acinetobacter bacteria and their antibiotic - resistant bacteria as well as Gram - positive bacteria.

Description

대장균과 아세네토박터균 및 그 다제내성균에 대해 항생제와 높은 상승적 항균효과를 가지는 항생 펩타이드 및 이의 용도{Antimicrobial peptides with high synergistic effect with antibiotics against Escherichia coli, Acinetobater Baumannii, and their multidrug resistant bacteria and their uses}Antibiotics and antimicrobial peptides having high synergistic antimicrobial activity against Escherichia coli and Acinetobacter bacteria and multidrug-resistant bacteria and antimicrobial peptides with high synergistic effect with antibiotics against Escherichia coli, Acinetobacter baumannii, and their multidrug resistant bacteria and their uses

본 발명은 그람음성 다제내성균에 대하여 항균 활성을 가지는 항생 펩타이드에 관한 것으로, 보다 상세하게는 상기 항생 펩타이드를 아세네토박터균항균용 약학적 조성물, 식품 첨가제, 사료 첨가제, 방부용 조성물 및 항균용 의약외품 조성물의 유효성분으로 사용하기 위한 용도에 관한 것이다.The present invention relates to an antimicrobial peptide having antimicrobial activity against Gram negative multidrug resistant bacteria, and more particularly to a pharmaceutical composition for antimicrobial use of an acenetobacter antibiotic, a food additive, a feed additive, an antimicrobial composition, To the use of the composition as an active ingredient.

세균의 감염은 인간의 질병에서 가장 흔하고 치명적인 원인 중의 하나이다. 페니실린(penicillin) 이후 수많은 종류의 항생제가 개발되어 생체에 외부침입의 세균 퇴치를 위하여 사용되어 왔다. 그러나 최근에 들어서 이들 항생제에 내성을 가지는 균주들이 등장하여 큰 문제로 여겨진다. 생명에 위협을 가할 수 있는 엔테로코쿠스 패칼리스(Enterococcus faecalis), 마이코박테리움 투버쿨로시스(Mycobacterium tuberculosis) 및 슈도모나스 에루지노사(Pseudomonas aeruginosa) 등의 세균 종들은 지금까지 알려진 모든 항생제에 대한 저항력을 키워왔다(Stuart B. Levy, Scientific American, (1988): 46-53).Bacterial infection is one of the most common and deadly causes of human disease. Numerous antibiotics have been developed since penicillin and have been used to combat bacterial infiltration into the body. Recently, however, strains resistant to these antibiotics have emerged and are regarded as a big problem. The enterococcus faecalis ( Enterococcus bacterium species such as E. faecalis , Mycobacterium tuberculosis and Pseudomonas aeruginosa have developed resistance against all known antibiotics (Stuart B. Levy, Scientific American , 1988 ): 46-53).

항생제에 대한 내성(tolerance)은 항생제에 대한 저항성(resistance)과는 구별되는 현상인데, 1970년대에 뉴모코커스(Pneumococcus sp.)에서 최초로 발견이 되었으며 페니실린의 작용 기작에 대한 중요한 단서를 제공하였다(Tomasz et al., Nature, 227, (1970): 138-140). 페니실린, 세팔로스포린(Cephalosporin)등과 같은 종래의 화학항생제는 미생물의 세포벽 또는 단백질의 합성저해에 의하여 항생작용을 나타낸다. 그러나, 내성을 보이는 종은 통상적인 농도의 항생제 존재하에서는 성장을 멈추지만 결과적으로 죽지는 않는다. 내성은 항생제가 세포벽 합성 효소를 저해할 때 오토라이신(autolysin) 등과 같은 세균의 자가분해(autolytic) 효소의 활성이 일어나지 않기 때문에 생기는데, 이러한 사실은 페니실린이 내인성 가수분해 효소(endogenous hydrolytic enzyme)를 활성화시킴으로써 세균을 죽이며 세균은 또한 이들의 활성을 억제해서 항생제 치료시에도 생존하는 결과를 나타내게 된다. 따라서, 이들 내성균주를 퇴치할 수 있는 새로운 작용 메커니즘을 가지는 항생제의 개발이 시급한 실정이며 종래의 화학 항생제와 상이한 항생기전을 나타내는 항생펩타이드들은 새로운 개념의 차세대 항생제로서 주목을 받고 있다(Zasloff M. Curr Opin Immunol 4 (1992): 3-7; Boman, H. G., Cell, 65.205 (1991); Boman, H. G. J Intern Med . 254.3 (2003): 197-215; Hancock, R. E., & Scott, M. G., Proc . Natl. Acad . Sci . U.S.A . 97 (2000): 8856-8861, Zasloff, M., Nature 415 (2002): 389-395).Tolerance to antibiotics is a distinct phenomenon from resistance to antibiotics, which was first discovered in Pneumococcus sp. In the 1970s and provided important clues to the mechanism of action of penicillin (Tomasz et al., Nature , 227, (1970): 138-140). Conventional chemical antibiotics, such as penicillin, Cephalosporin, etc., exhibit antibiotic action by inhibiting the synthesis of cell walls or proteins of microorganisms. However, tolerant species stop growing in the presence of conventional concentrations of antibiotics, but do not die as a result. Resistance occurs when antibiotics inhibit the cell wall synthetase because autolytic enzymes such as autolysin do not activate. This suggests that penicillin activates the endogenous hydrolytic enzyme By killing bacteria, bacteria also inhibit their activity, resulting in the survival of antibiotics. Therefore, it is urgently required to develop an antibiotic having a new action mechanism capable of eliminating these resistant bacteria. Antibiotic peptides showing different antibiotic mechanisms from conventional chemical antibiotics are attracting attention as a new concept of next generation antibiotics (Zasloff M. et al. Curr Opin Immunol 4 (1992): 3-7; Boman, HG, Cell , 65, 205 (1991); Boman, HG J Intern Med . 254.3 (2003): 197-215; Hancock, RE, & Scott, MG, Proc . Natl. Acad . Sci . USA . 97 (2000): 8856-8861, Zasloff, M., Nature 415 (2002): 389-395).

최근 다제내성균 중 그람음성균인 P. aeruginosa, A. baumannii는 내인성으로 획득내성 또한 가장 빈번하게 일어나는 균종에 속해서 항균제 내성 문제가 심각한 균 종으로 알려져 있다. P. aeruginosa, A.baumannii에서 다제내성은 아미노글리코사이드(Aminoglycoside), 플루오로퀴놀론(Fluoroquinolone), 카바페넴(Carbapenem) 등 3가지 계열의 약제에 모두 내성인 균주를 의미하며, 이런 다제내성 균종은 카바페넴이 거의 유일하게 유효한 항균제였는데, 10여 년간 카바페넴에도 내성인 균주가 증가하면서 항균제 치료에 큰 제한이 생겼다는 공통점을 보인다. 녹농균 또는 슈도모나스 에루지노사(Pseudomonas aeruginosa)는 그람 음성균이며, 흔한 감염성 병원균으로서, 항생제에 대한 감수성이 낮아 자연적으로 쉽게 항균제 내성을 획득할 수 있으며, 인공호흡기를 사용하는 호흡기계 감염, 화상 감염, 낭포성 섬유증 환자의 폐렴, 요로 감염을 유발하는 원인균이며, 인공환기기, 흡인카테터, 고여 있는 오염된 물 등의 감염소에 존재하다가 환자에게 직, 간접적으로 전파되어 정착하게 되는데 진행성의 질환을 가진 환자의 경우에는 치료가 어려워 높은 사망률을 보이는 것으로 알려져 있다.Recently, gram-negative bacteria such as P. aeruginosa and A. baumannii belonging to the most frequently acquired endemic species have been known to be resistant to the antimicrobial resistance. In P. aeruginosa and A. baumannii , multidrug resistance means a strain resistant to all three types of drugs, including aminoglycoside, fluoroquinolone, and carbapenem. Although carbapenem was almost the only effective antimicrobial agent, it has been shown that there has been a great deal of limitation in antimicrobial treatment due to an increase in the number of strains resistant to carbapenem for 10 years. Pseudomonas aeruginosa is a Gram-negative bacterium that is a common infectious pathogen and has low susceptibility to antibiotics. Therefore, it can easily acquire antimicrobial resistance naturally. It is also known that respiratory infections such as respiratory tract infection, burn infection, cyst It is a cause of pneumonia and urinary tract infections in patients with sexually transmitted fibrosis. It is present in infected areas such as artificial ring apparatus, aspiration catheter, and contaminated water, and is directly or indirectly transferred to the patient, Is known to have high mortality due to difficulty in treatment.

아세네토박터균(Acinetobacter baumannii)은 그람음성 호기성 구간균으로 많은 병원에서 병원 내 감염의 중요한 원인이 되고 있는데 특히 최근에는 아미노글리코사이드, 세파로스포린, 플루오로퀴놀론, 베타 락타마아제 억제제(beta-lactamase inhibitors), 그리고 카바페넴에 대해서 내성을 보이는 다제내성 Acinetobacter baumannii(MRAB)에 의한 감염이 증가하고 있는 실정이다. 2010년 동경대학병원에서 아세네토박터균의 감염으로 46명이 감염되고 이중 10명이 숨진 사건은 최근 10년 사이 전 세계적으로 급증하고 있는 항생제 내성이 강한 MRAB에 대한 경각심을 불러일으켰고 항생제개발에 박차를 가하고 있다. 아세네토박터균 자체는 물이나 토양 또는 인간의 피부에도 흔하게 존재하며 건강한 사람의 경우 감염돼도 발병하지 않는다. 하지만, 면역력이 떨어진 사람이 감염될 경우 폐렴이나 패혈증으로 사망할 수 있고 1990년대부터 미국, 유럽 등에서 늘어나기 시작했으며 2000년부터는 거의 어떤 항생제도 듣지 않는 종류까지 나타났다. 통상 다약제내성 아세네토박터균(multi-drug resistant Acinetobacter baumannii, MDRAB)은 아미노글리코사이드, 플루오로퀴놀론, 카바페넴 등 3가지 계열의 약제에 모두 내성인 균주를 의미하며, 이 경우 콜리스틴(Colistin) 정도가 유일하게 감수성으로 남고, 아세네토박터균은 이에 더해서 티게사이클린(Tigecycline)에 감수성일 수 있다. 의료관련 감염의 주요 원인균인 아세네토박터균은 다제내성 때문에 카바페넴이 거의 유일하게 유효한 항균제였으나, 10여 년간 카바페넴에도 내성인 균주가 증가하면서 감염증 치료에 큰 제한이 생겼다. 최근 P. aeruginosa는 내성률이 20% 정도인데 비해 아세네토박터균은 급속히 증가하여 대부분의 대형병원에서 50%를 넘었고 카바페넴 내성율의 증가가 아세네토박터균의 증가로 이어져서 2010년 전국 중환자실 의료관련감염률 조사에서 P. aeruginosa를 제치고, MRSA, Enterococcus sp.에 이어 원인균 빈도 3위를 차지한다. 따라서 국내 중환자 감염 원인균 중 빈도가 높고 치사율이 높아 치료제 개발이 시급하다. Acinetobacter baumannii is a Gram-negative aerobic strain that is a major cause of hospital infection in many hospitals. Recently, it has been reported that aminoglycosides, cephalosporins, fluoroquinolones, beta- lactamase inhibitors, and carbapenem resistant multidrug-resistant Acinetobacter baumannii (MRAB). In 2010, a total of 46 people were infected with Acinetobacter germs at the University of Tokyo Hospital, and 10 of them died, raising awareness about the rapidly increasing antibiotic resistant MRAB in the world in recent 10 years, spurring the development of antibiotics have. Acinetobacter itself is also present in water, soil or human skin, and healthy people do not develop infection even when infected. However, when a person with a weakened immune system is infected, it can die from pneumonia or sepsis. Since the 1990s, it has started to increase in the United States and Europe. From 2000, almost no antibiotics were heard. In general, a multi-drug resistant Acinetobacter baumannii (MDRAB) refers to a strain resistant to all three types of drugs, including aminoglycosides, fluoroquinolones, and carbapenems. In this case, Colistin ) Remain the only susceptible, and Acinetobacter bacteria may be susceptible to Tigecycline. Acetobacter, the major causative agent of medical infection, was the only effective antimicrobial agent because of its resistance to multidrug resistance. However, the number of strains resistant to carbapenem increased for 10 years. Recently, the resistance rate of P. aeruginosa was about 20%, but the acenetobacterium rapidly increased, exceeding 50% in most large hospitals, and the increase of carbapenem resistance rate led to the increase of acenetobacter, In the related infection rate survey, P. aeruginosa is overtaken, followed by MRSA, Enterococcus sp. Therefore, the development of therapeutic agents is urgent because of the high incidence of fatal bacterial infections in Korea and the high mortality rate.

넓은 의미로서 면역반응으로 불리어지는 항원 항체 반응은 인간을 포함한 무척추동물에 있어서 생체방어의 주된 역할을 해 왔다. 그러나 곤충이나 양서류는 항원 항체반응과 같은 후천적 면역기구와는 다른 선천적 면역기구를 강화하는 것으로 자신을 보호하고 있다. 이와 같이 선천적 면역은 곤충, 양서류뿐만 아니라 사람을 포함한 척추동물에 있어서도 초기감염에 대해 중요한 방어계로서 역할을 하고 있다. 선천적 면역기구의 아주 중요한 수단은 다양한 미생물에 대해 살균, 불활성화작용을 가진 항균펩타이드를 획득한다는 것이다. 항균성 펩타이드를 중심으로 한 항미생물작용을 가진 펩타이드나 단백질은 우리 인간을 포함한 가축 등의 질병 방제 및 각종 병원균의 감염에 의해 야기되는 항균제로서 이용 가능성이 높다. 최근 들어 항생제 내성문제가 심각해지면서 이러한 항생 펩타이드를 이용한 새로운 신약 후보 물질에 관심이 늘어나고 있다. 항생 펩타이드는 세균의 막을 타겟으로 하여 항균활성을 가지므로 기존 항생제에 내성을 가진 균주에 대해서도 활성을 유지하는 특징을 가지는 것으로 보여진다. 그러므로 다양한 천연 유래한 항생 펩타이드는 내성 균주의 출연으로 위협받고 있는 기존의 항생제를 대체할 새로운 개념의 항생제 탐색에 중요한 생물자원으로 각광받고 있다.In a broad sense, the antigen-antibody reaction, termed the immune response, has played a major role in biological defense in invertebrates, including humans. However, insects and amphibians protect themselves by enhancing innate immune mechanisms that are different from acquired immune mechanisms such as antigen-antibody reactions. Thus, innate immunity plays an important defense against early infections in insects, amphibians, and vertebrates including humans. The most important means of innate immune mechanisms is to obtain antimicrobial peptides with sterilization and inactivation actions against various microorganisms. Antibacterial peptides and proteins having an antimicrobial action mainly on peptides are highly likely to be used as antimicrobial agents caused by diseases such as livestock including human beings and infection of various pathogens. Recently, antibiotic resistance has become a serious problem, and new antibiotic peptides are attracting interest in new drug candidates. Antibiotic peptides have antimicrobial activity against bacterial membranes, so they appear to retain their activity against strains resistant to existing antibiotics. Therefore, a variety of naturally occurring antibiotic peptides are emerging as important biomarkers for the search for a new concept of antibiotics to replace existing antibiotics, which are threatened by the emergence of resistant strains.

현재까지 발견된 곤충의 항균 단백질 및 펩타이드는 Boman 박사 연구팀에 의해 세크로피아나방에서 세크로핀이 최초로 보고된 이래 약 200여 종이 곤충으로부터 분리되었는데 이들은 구조와 크기에 따라 크게 세크로핀류, 디펜신류, 플로린 및 글리신 아미노산을 많이 포함하고 있는 펩타이드로 나눌 수 있다.The antimicrobial proteins and peptides of the insects discovered so far have been isolated from about 200 insect species since the first report of secrophin by Boman's team in Secopia moth, , And a peptide containing a large amount of a glycine and a glycine amino acid.

세크로핀류는 31 - 39개의 아미노산으로 구성된 염기성 단백질로 최근 본 연구팀이 특허 등록한 호랑나비 유충으로부터의 새로운 항균펩타이드(파필리오신)는 N-말단의 양친매성 나선구조와 C-말단의 소수성 helix를 포함한 α-helix-hinge-α-helix 구조를 가지며 다양한 병원균에 항균활성 및 항염증 활성이 우수하다(비특허문헌 1). 특히 N-말단의 helix 구조를 가지는 영역이 항균활성에 중요한 역할을 함을 규명하여 내성 균주에 대한 뛰어난 항균능력과 항염 활성을 확인하여 공지된 바 있다(특허문헌 1, 비특허문헌 2).Seckropin is a basic protein composed of 31-39 amino acids. A new antimicrobial peptide (papillosin) from the larvae of the tiger butterfly, which the team has recently patented, has a N-terminal amphipathic helix and a hydrophobic helix at the C- Helix-hinge-α-helix structure including the α-helix-hinge-α-helix structure and has excellent antimicrobial activity and anti-inflammatory activity against various pathogens (Non-Patent Document 1). Particularly, it has been known that a region having a helix structure at the N-terminus plays an important role in the antimicrobial activity, thereby confirming the excellent antimicrobial activity and anti-inflammatory activity against resistant strains (Patent Document 1, Non-Patent Document 2).

마가이닌(Magainin 2, MA)은 양서류 유래 양친화성 펩타이드로서 다양한 균에 항균활성을 가지며, 본 연구진은 세크로핀의 N-말단과 마가이닌의 N-말단 펩타이드를 접합시켜 만든 CA-MA 펩타이드의 삼차원구조를 규명하고 항균, 항암활성이 뛰어남을 발표한 바 있다(비특허문헌 3). 또한 최근 파필리오신(Papiliocin)의 N-terminal 영역의 8개 잔기와 마가이닌(Magainin)의 N-말단 잔기 9개의 혼성펩타이드를 연결해 만든 PapMA-1을 설계, 합성하여 뛰어난 그람음성균, 그람양성균 모두에 항균활성이 우수함을 발표한 바 있다(비특허문헌 4).MA-MA is an amphipathic amphipathic peptide that has antimicrobial activity against a variety of bacteria. We have developed a CA-MA peptide which is prepared by conjugating the N-terminal peptide of schepyrin with the N-terminal peptide of magainin Dimensional structure and has been reported to have excellent antimicrobial and anticancer activity (Non-Patent Document 3). In addition, recently, PapMA-1, which was constructed by connecting 8 residues of N-terminal region of Papiliocin and 9 of N-terminal residues of Magainin, was designed and synthesized, and excellent Gram-negative bacteria and Gram- (Non-Patent Document 4).

본 발명에서는 항생 펩타이드인 파필리오신의 N-말단 영역의 잔기 및 마가이닌의 N- 말단 영역의 잔기를 접합한 PapMA-1 항생 펩타이드를 주형으로 하여 항균 활성이 증진될 수 있도록 아미노산 잔기를 치환하여 PapMA-2 내지 PapMA-4의 펩타이드를 설계하였다. 또한, 상기 PapMA-1 내지 PapMA-4의 펩타이드로부터 11번째 아미노산을 라이신으로 치환; 및/또는 15번째 아미노산을 페닐알라닌 또는 라이신으로 치환하여 항생 펩타이드를 설계하였다.In the present invention, a Papami-1 antibiotic peptide conjugated with a residue of the N-terminal region of the antibiotic peptide papillianosin and a residue of the N-terminal region of magainin is used as a template and the amino acid residue is substituted to increase the antimicrobial activity The peptides of PapMA-2 to PapMA-4 were designed. Also, the 11th amino acid from the peptide of PapMA-1 to PapMA-4 is substituted with lysine; And / or the 15th amino acid was substituted with phenylalanine or lysine to design antibiotic peptides.

본 발명자들은 본 발명에서 설계한 항생 펩타이드는 그람음성균 및 그 다제내성균에 대한 항균활성을 나타냄과 동시에, 나아가 항생제와 함께 혼합 처리하였을 때 그람음성균 및 그 다제내성균에 대하여 PapMA-1 내지 PapMA-4 주형 항생 펩타이드와 비교하였을 때 유의적으로 증가한 수준의 시너지 효과로 항균 활성을 나타내므로, 본 발명의 항생 펩타이드는 종래 항생제와 복합제로서 항균용 조성물의 유효성분으로 사용할 수 있음을 확인하여 본 발명을 완성하였다.The present inventors have found that the antibiotic peptides designed in the present invention exhibit antimicrobial activity against Gram-negative bacteria and their multidrug-resistant bacteria, and furthermore, when mixed with an antibiotic, Papami-1 to PapMA- The antibiotic peptide of the present invention can be used as an active ingredient of an antimicrobial composition as a combination with a conventional antibiotic. Thus, the present invention has been completed .

KRKR 10-115028110-1150281 B1B1

Kim, Jin-Kyoung, et al. "Structure and function of papiliocin with antimicrobial and anti-inflammatory activities isolated from the swallowtail butterfly, Papilio xuthus." Journal of Biological Chemistry 286.48 (2011): 41296-41311.  Kim, Jin-Kyoung, et al. "Structure and function of papilocin with antimicrobial and anti-inflammatory activities from the swallowtail butterfly, Papilio xuthus." Journal of Biological Chemistry 286.48 (2011): 41296-41311. Lee, Eunjung, et al. "Functional roles of aromatic residues and helices of papiliocin in its antimicrobial and anti-inflammatory activities." Scientific reports 5 (2015).  Lee, Eunjung, et al. "Functional roles of aromatic residues and helices of papilocin in its antimicrobial and anti-inflammatory activities." Scientific reports 5 (2015). Oh, Donghoon, et al. "Role of the hinge region and the tryptophan residue in the synthetic antimicrobial peptides, cecropin A (1-8)-magainin 2 (1-12) and its analogues, on their antibiotic activities and structures." Biochemistry 39.39 (2000): 11855-11864.  Oh, Donghoon, et al. "Role of the hinge region and the tryptophan residue in the synthetic antimicrobial peptides, cecropin A (1-8) -magainin 2 (1-12) and its analogues, on their antibiotic activities and structures." Biochemistry 39.39 (2000): 11855-11864. Shin, Areum, et al. "Peptoid-Substituted Hybrid Antimicrobial Peptide Derived from Papiliocin and Magainin 2 with Enhanced Bacterial Selectivity and Anti-inflammatory Activity." Biochemistry 54.25 (2015): 3921-3931. Shin, Areum, et al. &Quot; Peptoid-Substituted Hybrid Antimicrobial Peptide Derived from Papiliocin and Magainin 2 with Enhanced Bacterial Selectivity and Anti-inflammatory Activity. &Quot; Biochemistry 54.25 (2015): 3921-3931.

이에, 본 발명에서는 항생 펩타이드인 파필리오신의 N-말단 영역의 잔기 및 마가이닌의 N- 말단 영역의 잔기를 접합한 PapMA-1 항생 펩타이드를 주형으로 하여 항균 활성이 증진될 수 있도록 아미노산 잔기를 치환하여 PapMA-2 내지 PapMA-4의 펩타이드를 설계하였다. 또한, 상기 PapMA-1 내지 PapMA-4의 펩타이드로부터 11번째 아미노산을 라이신으로 치환; 및/또는 15번째 아미노산을 페닐알라닌 또는 라이신으로 치환하여 항생 펩타이드를 설계하였다. 이들 펩타이드를 항생제와 함께 투여하였을 때 유의적인 시너지 효과의 항균 활성을 나타내는 것을 확인함으로써 본 발명을 완성하였다.Thus, in the present invention, a Papami-1 antibiotic peptide conjugated with a residue of the N-terminal region of the antibiotic peptide papphylosin and a residue of the N-terminal region of the maganin is used as a template and an amino acid residue The peptides of PapMA-2 to PapMA-4 were designed by substitution. Also, the 11th amino acid from the peptide of PapMA-1 to PapMA-4 is substituted with lysine; And / or the 15th amino acid was substituted with phenylalanine or lysine to design antibiotic peptides. These peptides were found to exhibit significant synergistic antimicrobial activity when administered together with antibiotics, thereby completing the present invention.

따라서, 본 발명의 목적은 그람음성 다제내성균에 대하여 우수한 항균활성을 나타내는 신규한 항생 펩타이드를 제공하는 것이다.Accordingly, an object of the present invention is to provide a novel antibiotic peptide showing excellent antimicrobial activity against Gram negative multidrug-resistant bacteria.

또한, 본 발명의 또다른 목적은 상기 항생 펩타이드를 유효성분으로 하는 항균용 조성물을 제공하는 것이다.It is still another object of the present invention to provide an antimicrobial composition comprising the antibiotic peptide as an active ingredient.

또한, 본 발명의 또다른 목적은 상기 항생 펩타이드를 항생제와 함께 복합제로 투여하여 그람음성 다제내성균에 대한 우수한 시너지 효과의 항균 활성을 나타내는 항균용 조성물을 제공하는 것이다.Still another object of the present invention is to provide an antimicrobial composition which exhibits antimicrobial activity of an excellent synergistic effect against Gram negative multidrug resistant bacteria by administering the antibiotic peptide together with an antibiotic as a combined agent.

상기 목적을 달성하기 위하여, 본 발명은 서열번호 5 내지 서열번호 10으로 기재되는 아미노산 서열 중 어느 하나로 구성된 신규 펩타이드를 제공한다. 또한, 본 발명은 서열번호 1 내지 서열번호 4로 이루어진 군으로부터 선택되는 어느 하나의 아미노산 서열로부터, 11 번째 아미노산인 페닐알라닌(F)이 류신(L)으로의 치환; 및 15 번째 아미노산인 알라닌(A) 또는 트립토판(W)이 페닐알라닌(F) 또는 류신(L)으로의 치환;으로 이루어진 군으로부터 선택된 적어도 하나 이상의 치환이 이루어진 아미노산 서열로 구성되는, 항생 펩타이드를 제공한다.In order to achieve the above object, the present invention provides a novel peptide comprising any one of the amino acid sequences of SEQ ID NOS: 5 to 10. Also, the present invention provides a method for producing a protein comprising the steps of: substituting phenylalanine (F) as the 11th amino acid with leucine (L) from any one of amino acid sequences selected from the group consisting of SEQ ID NOS: 1 to 4; And wherein the alanine (A) or tryptophan (W) as the 15th amino acid is substituted with phenylalanine (F) or leucine (L) .

본 발명의 바람직한 일실시예에서, 상기 항생 펩타이드는 서열번호 5 내지 10으로 기재되는 아미노산 서열 중 어느 하나로 구성되는 펩타이드일 수 있다.In one preferred embodiment of the present invention, the antibiotic peptide may be a peptide consisting of any one of the amino acid sequences of SEQ ID NOS: 5 to 10.

또한, 본 발명은 서열번호 1 내지 서열번호 4로 이루어진 군으로부터 선택되는 어느 하나의 아미노산 서열로부터, 11 번째 아미노산인 페닐알라닌(F)이 류신(L)으로의 치환; 및 15 번째 아미노산인 알라닌(A) 또는 트립토판(W)이 페닐알라닌(F) 또는 류신(L)으로의 치환;으로 이루어진 군으로부터 선택된 적어도 하나 이상의 치환이 이루어진 아미노산 서열로 구성되는, 항생 펩타이드를 유효성분으로 포함하는, 항균용 약학적 조성물을 제공한다.Also, the present invention provides a method for producing a protein comprising the steps of: substituting phenylalanine (F) as the 11th amino acid with leucine (L) from any one of amino acid sequences selected from the group consisting of SEQ ID NOS: 1 to 4; And wherein the 15th amino acid alanine (A) or tryptophan (W) is substituted with phenylalanine (F) or leucine (L) Or a pharmaceutically acceptable salt thereof.

또한, 본 발명은 상기 항생 펩타이드를 유효성분으로 포함하는, 식품 첨가제를 제공한다.The present invention also provides a food additive comprising the antibiotic peptide as an active ingredient.

또한, 본 발명은 상기 항생 펩타이드를 유효성분으로 포함하는, 사료 첨가제를 제공한다.The present invention also provides a feed additive comprising the antibiotic peptide as an active ingredient.

또한, 본 발명은 상기 항생 펩타이드를 유효성분으로 포함하는, 방부용 조성물을 제공한다.In addition, the present invention provides a composition for oral cavity comprising the antibiotic peptide as an active ingredient.

또한, 본 발명은 상기 항생 펩타이드를 유효성분으로 포함하는, 의약외품 조성물을 제공한다.In addition, the present invention provides a quasi-drug composition comprising the antibiotic peptide as an active ingredient.

아울러, 본 발명은 (a) 서열번호 1 내지 서열번호 4로 이루어진 군으로부터 선택되는 어느 하나의 아미노산 서열로부터,
11 번째 아미노산인 페닐알라닌(F)이 류신(L)으로의 치환; 및 15 번째 아미노산인 알라닌(A) 또는 트립토판(W)이 페닐알라닌(F) 또는 류신(L)으로의 치환;으로 이루어진 군으로부터 선택된 적어도 하나 이상의 치환이 이루어진 아미노산 서열로 구성되는, 항생 펩타이드; 및 (b) 항생제 를 유효성분으로 포함하는, 항균용 약학적 조성물을 제공한다.
또한, 본 발명은 상기 (a) 항생 펩타이드 및 (b) 항생제를 유효성분으로 포함하는, 식품 첨가제를 제공한다.또한, 본 발명은 상기 (a) 항생 펩타이드 및 (b) 항생제를 유효성분으로 포함하는, 사료 첨가제를 제공한다.또한, 본 발명은 상기 (a) 항생 펩타이드 및 (b) 항생제를 유효성분으로 포함하는, 방부용 조성물을 제공한다.또한, 본 발명은 상기 (a) 항생 펩타이드 및 (b) 항생제를 유효성분으로 포함하는, 의약외품 조성물을 제공한다.
본 발명의 바람직한 일실시예에서, 상기 항생 펩타이드는 서열번호 5 내지 10로 기재되는 아미노산 서열 중 어느 하나로 구성되는 것일 수 있다.
The present invention also relates to a method for producing a polypeptide comprising the steps of: (a) selecting from any one of amino acid sequences selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 4,
Substitution of the 11th amino acid phenylalanine (F) with leucine (L); And an alanine (A) or tryptophan (W) as a 15th amino acid is substituted with phenylalanine (F) or leucine (L); And (b) an antibiotic as an active ingredient.
The present invention also provides a food additive comprising (a) an antimicrobial peptide and (b) an antibiotic as an active ingredient. (A) an antibiotic peptide and (b) an antibiotic as an active ingredient. The present invention also provides a composition for an oral cavity, comprising (a) an antibiotic peptide and (b) a quasi-drug composition comprising an antibiotic as an active ingredient.
In one preferred embodiment of the present invention, the antibiotic peptide may be composed of any one of the amino acid sequences of SEQ ID NOS: 5 to 10.

본 발명의 또다른 바람직한 일실시예에서, 상기 항생제는 에리트로마이신(Erythromycin), 암피실린(Ampicillin), 반코마이신(Vancomycin), 리네졸리드(Linezolid), 메티실린(Methicillin), 옥사실린(Oxacillin), 세포탁심(Cefotaxime), 리팜피신(Rifampicin), 아미카신(Amikacin), 겐타마이신(Gentamicin), 아미카신(Amikacin), 카나마이신(Kanamycin), 토브라마이신(Tobramycin), 네오마이신(Neomycin), 에르타페넴(Ertapenem), 도리페넴(Doripenem), 이미페넴/실라스타틴(Imipenem/Cilastatin), 메로페넴(Meropenem), 세프타지딤(Ceftazidime), 세파핌(Cefepime), 세프타로린(Ceftaroline), 세프토비프롤(Ceftobiprole), 아즈트레오남(Aztreonam), 피페라실린(Piperacillin), 폴리믹신 B(Polymyxin B), 콜리스틴(Colistin), 시프로플록사신(Ciprofloxacin), 레보플록사신(Levofloxacin), 목시플록사신(Moxifloxacin), 가티플록사신(Gatifloxacin), 티게사이클린(Tigecycline), 이의 배합체 및 이들의 유도체로 구성된 군으로부터 선택되는 어느 하나 이상일 수 있다.In another preferred embodiment of the present invention, the antibiotic is selected from the group consisting of Erythromycin, Ampicillin, Vancomycin, Linezolid, Methicillin, Oxacillin, It has been found that the compounds of the present invention can be used in combination with other drugs such as Cefotaxime, Rifampicin, Amikacin, Gentamicin, Amikacin, Kanamycin, Tobramycin, Neomycin, (Eg, Ertapenem, Doripenem, Imipenem / Cilastatin, Meropenem, Ceftazidime, Cefepime, Ceftaroline, A drug such as Ceftobiprole, Aztreonam, Piperacillin, Polymyxin B, Colistin, Ciprofloxacin, Levofloxacin, Moxifloxacin, Gatifloxacin, Tigecycline, < RTI ID = 0.0 > And a derivative thereof. In the present invention,

본 발명의 또다른 바람직한 일실시예에서, 상기 항균용 약학적 조성물은 그람 양성균, 그람 음성균 및 이의 항생제 내성균주에 대해 항균 활성을 갖는 것일 수 있다.In another preferred embodiment of the present invention, the antimicrobial pharmaceutical composition may have antimicrobial activity against Gram-positive bacteria, Gram-negative bacteria and antibiotic-resistant bacteria thereof.

본 발명의 또다른 바람직한 일실시예에서, 상기 그람 양성균은 바실러스 서브틸리스(Bacillus subtilis), 스타필로코커스 아우레우스(Staphylococcus aureus) 및 스타필로코커스 에피더미디스(Staphylococcus epidermidis)로 구성된 군으로부터 선택되는 어느 하나 이상일 수 있다.In another preferred embodiment of the present invention, the Gram positive bacteria are selected from the group consisting of Bacillus subtilis , Staphylococcus aureus and Staphylococcus epidermidis . Lt; / RTI >

본 발명의 바람직한 일실시예에서, 상기 그람 음성균은 대장균(Escherichia coli), 슈도모나스 에루지노사(Psedomonas aeruginosa), 아세네토박터 바우마니(Acinetobacter baumannii) 및 살모넬라 타이피뮤리움(Salmonella typhimurium)로 구성된 군으로부터 선택되는 어느 하나 이상일 수 있다.In a preferred embodiment of the present invention, the gram negative bacteria are selected from the group consisting of Escherichia coli , Pseudomonas aeruginosa , Acinetobacter baumannii and Salmonella typhimurium And may be any one or more selected.

따라서, 본 발명은 호랑나비 유충으로부터 분리된 항균펩타이드 파필리오신(Papiliocin, Pap)의 N-terminal 영역과 마가이닌(Magainin 2, MA)의 N-말단 영역잔기들을 연결하여 만든 파필리오신 혼성펩타이드 유도체인 항생 펩타이드 PapMA-1로부터 항균 활성이 증진될 수 있도록 아미노산 잔기를 치환하여 PapMA-2 내지 PapMA-4의 펩타이드를 설계하고, 이로부터 11번째 아미노산을 라이신으로 치환; 및/또는 15번째 아미노산을 페닐알라닌 또는 라이신으로 치환하한 펩타이드 PapMA-5 내지 PapMA-10을 제공한다.Therefore, the present invention relates to a papilliferin hybrid peptide made by linking the N-terminal region of an antimicrobial peptide papillocin (Pap) isolated from a larva of a tiger butterfly with the N-terminal region residues of magainin 2 (MA) A peptide of PapMA-2 to PapMA-4 was designed by substituting an amino acid residue so that antimicrobial activity could be enhanced from the antibiotic peptide PapMA-1 as a derivative, and the 11th amino acid was substituted with lysine; And / or a peptide PapMA-5 to PapMA-10 in which the 15th amino acid is substituted with phenylalanine or lysine.

본 발명의 항생 펩타이드는 그람음성균에 대하여 유의적인 항균 활성을 나타낼 뿐 아니라, 그람양성균에만 강한 항균 활성을 나타내고 그람음성균에는 항균활성을 가지지 않거나 낮은 항균활성을 가지는 항생제와 본 발명의 항생 펩타이드를 혼합 처리하였을 때 유의적인 시너지 효과를 나타내어, 그람양성균 뿐 아니라 그람음성균과 이들의 항생제 내성균에 대하여 우수한 항균효과를 나타낼 수 있다. 따라서, 본 발명의 항생펩타이드를 포함하는 항균용 조성물, 및 본 발명의 항생 펩타이드와 항생제를 포함하는 항균용 약학적 조성물, 식품 첨가제, 사료 첨가제, 방부용 조성물 및 의약외품 조성물은 적은 농도의 화학적 항생제를 포함하고도 상승된 항균 활성을 나타낼 수 있다.The antibiotic peptide of the present invention not only exhibits significant antimicrobial activity against Gram-negative bacteria but also exhibits a strong antimicrobial activity only against Gram-positive bacteria and an antibiotic which does not have antimicrobial activity against gram-negative bacteria or has a low antimicrobial activity and the antibiotic peptide of the present invention , It is possible to exhibit an excellent antimicrobial effect against gram-negative bacteria and their antibiotic-resistant bacteria as well as Gram-positive bacteria. Accordingly, the antimicrobial composition comprising the antibiotic peptide of the present invention, and the antimicrobial pharmaceutical composition, food additive, feed additive, antidote and quasi-drug composition comprising the antibiotic peptide and the antibiotic of the present invention, And may exhibit elevated antimicrobial activity.

도 1은 본 발명의 펩타이드들 8 ㎍/㎖와 상용화되어 있는 항생제들과의 E.coli 및 그 내성균에 대한 항균활성의 시너지효과를 확인한 도이다.
도 2는 본 발명의 펩타이드들 8 ㎍/㎖와 기존 알려진 항생제들과의 A. baumannii균 및 그 내성균에 대한 항균활성의 시너지효과를 확인한 도이다.
Brief Description of the Drawings Fig. 1 shows the synergistic effect of the antibiotic against E. coli and its resistant bacteria against 8 ㎍ / ml of the peptides of the present invention and commercial antibiotics.
Fig. 2 shows the synergistic effect of the antimicrobial activity against A. baumannii and its resistant bacteria against 8 ㎍ / ml of peptides of the present invention and known antibiotics.

이하, 본 발명을 상세히 설명한다.Hereinafter, the present invention will be described in detail.

상술한 바와 같이, 항생제에 대하여 내성을 가지는 다제내성균에 대한 항균활성을 나타내는 항생물질의 개발이 계속 요구되고 있고, 이에 따라 제조된 항생 펩타이드들이 보고되고 있으나, 종래 항생제와 함께 혼합 처리하여 시너지 효과를 나타낼 수 있는 항생 펩타이드에 관하여는 앞으로 더 연구될 필요가 있다.As described above, the development of antibiotics exhibiting antimicrobial activity against multidrug-resistant bacteria having antimicrobial resistance has been continuously required. Antimicrobial peptides thus produced have been reported, but they are mixed with antibiotics in the past to produce synergistic effects Antigenic peptides that can be expressed need to be studied further.

본 발명의 항생 펩타이드 PapMA-5 내지 PapMA-10은 그람음성균에 대하여 유의적인 항균활성을 나타낼 뿐 아니라, 그람양성균에만 효과적인 항균활성을 나타내는 항생제와 혼합 처리하였을 때 그람음성균인 대장균 및 아세네토박터균 및 이의 항생제 내성균에 대하여 항생 펩타이드와 항생제가 우수한 시너지 효과로 항균 활성을 나타내므로, 소량의 항생제를 투여하여도 대장균 및 아세네토박터균 및 이의 다제내성균에 대하여 항균 효과를 나타낼 수 있어 효과적이다.The antibiotic peptides PapMA-5 to PapMA-10 of the present invention exhibit significant antimicrobial activity against Gram-negative bacteria, and when mixed with an antibiotic exhibiting an antibacterial activity that is effective only for Gram-positive bacteria, Escherichia coli and Acinetobacter Since antibiotic peptides and antibiotics exhibit antimicrobial activity with excellent antibiotic resistance against the antibiotic resistant bacteria, they are effective because they can exhibit antibacterial effect against Escherichia coli and Acinetobacter and its multidrug resistant bacteria even if a small amount of antibiotic is administered.

따라서, 본 발명은 서열번호 1 내지 서열번호 4로 이루어진 군으로부터 선택되는 어느 하나의 아미노산 서열로부터, 11 번째 아미노산인 페닐알라닌(F)이 류신(L)으로의 치환; 및 15 번째 아미노산인 알라닌(A) 또는 트립토판(W)이 페닐알라닌(F) 또는 류신(L)으로의 치환;으로 이루어진 군으로부터 선택된 적어도 하나 이상의 치환이 이루어진 아미노산 서열로 구성되는, 신규 합성 펩타이드를 제공한다.Accordingly, the present invention provides a method for producing a protein comprising the steps of: substituting phenylalanine (F), which is the 11th amino acid, with leucine (L) from any one of amino acid sequences selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 4; And at least one substitution amino acid sequence selected from the group consisting of alanine (A) or tryptophan (W) as the 15th amino acid substitution with phenylalanine (F) or leucine (L) do.

또한, 본 발명은 서열번호 1 내지 서열번호 4로 이루어진 군으로부터 선택되는 어느 하나의 아미노산 서열로부터, 11 번째 아미노산인 페닐알라닌(F)이 류신(L)으로의 치환; 및 15 번째 아미노산인 알라닌(A) 또는 트립토판(W)이 페닐알라닌(F) 또는 류신(L)으로의 치환;으로 이루어진 군으로부터 선택된 적어도 하나 이상의 치환이 이루어진 아미노산 서열로 구성되는, 항생 펩타이드를 제공한다.Also, the present invention provides a method for producing a protein comprising the steps of: substituting phenylalanine (F) as the 11th amino acid with leucine (L) from any one of amino acid sequences selected from the group consisting of SEQ ID NOS: 1 to 4; And wherein the alanine (A) or tryptophan (W) as the 15th amino acid is substituted with phenylalanine (F) or leucine (L) .

본 발명의 "서열번호 1로 기재되는 아미노산 서열로 구성되는 펩타이드"는 파필리오신(Papiliocin, Pap)(서열번호 11)의 N-말단 영역의 1 내지 8 영역의 8개 잔기와 마가이닌(Magainin 2, MA)(서열번호 12)의 N-말단 4 내지 12 영역의 잔기 9 개의 펩타이드를 프롤린으로 연결해 만든 18개 잔기로 이루어진 합성 펩타이드인 PapMA-1이다(비특허문헌 4).The "peptide consisting of the amino acid sequence of SEQ ID NO: 1" of the present invention is a peptide consisting of 8 residues of the 1-8 region of the N-terminal region of Papiliocin (Pap) (SEQ ID NO: 11) Papamino-1, a synthetic peptide consisting of 18 residues made by linking 9 peptides of residues 4 to 12 of the N-terminal region of SEQ ID NO: 2 (SEQ ID NO: 12) with proline.

상기 "서열번호 1로 기재되는 아미노산 서열로 구성되는 펩타이드"로부터, 15 번째 아미노산인 알라닌(A)을 트립토판(W)으로 치환; 및/또는 18 번째 아미노산인 페닐알라닌(F)을 트립토판(W)으로 치환할 수 있으며, 바람직하게는 서열번호 2 내지 서열번호 4 중 어느 하나로 기재되는 아미노산 서열의 항생 펩타이드인 것이 바람직하다.From the above-mentioned " peptide consisting of the amino acid sequence of SEQ ID NO: 1 ", alanine (A) as the 15th amino acid is substituted with tryptophan (W) And / or phenylalanine (F) which is the 18th amino acid can be substituted with tryptophan (W), preferably an antibiotic peptide of the amino acid sequence described in any one of SEQ ID NOS: 2 to 4.

본 발명의 항생 펩타이드는, 상기 "서열번호 1 내지 서열번호 4로 기재되는 아미노산 서열로 구성되는 펩타이드"로부터, 11번째 아미노산인 페닐알라닌(F)을 류신(L)으로 치환; 및/또는 15 번째 아미노산인 알라닌(A) 또는 트립토판(W)을 페닐알라닌(F) 또는 류신(L)으로 치환;될 수 있으며, 바람직하게는 서열번호 5 내지 서열번호 10 중 어느 하나로 기재되는 아미노산 서열의 항생 펩타이드인 것이 바람직하다.The antibiotic peptide of the present invention is obtained by substituting the 11th amino acid phenylalanine (F) with leucine (L) from the "peptide consisting of the amino acid sequence of SEQ ID NO: 1 to SEQ ID NO: 4" (A) or tryptophan (W) which is the 15th amino acid can be substituted with phenylalanine (F) or leucine (L), preferably the amino acid sequence of SEQ ID NO: 5 to SEQ ID NO: 10 Of antibiotic peptides.

본 발명의 "펩타이드"의 서열에 있어서, 상기 "페닐알라닌 또는 으로 치환"하는 단계를 통해, 서열번호 1 내지 서열번호 4의 아미노산 서열로 구성되는 펩타이드보다 증가된 항균 활성을 나타내거나 종래 항균제와 혼합 처리시 더 높은 시너지 효과를 가질 수 있도록 서열이 최적화될 수 있다. 양쪽성 구조를 가지는 항균펩타이드의 소수성, 알파 나선형구조의 양, 그리고 양이온성이 높아지면 생체막과의 상호작용이 높아져서 항균활성이 높아진다고 알려져 있으며 이 조건들을 최적화시켜서 펩타이드의 항균활성을 높일수 있다(비특허문헌 2). 본 발명에서는 소수성 잔기들을 치환하여 항균활성 및 종래 항균제와의 시너지 효과를 증가시키고자 하였다. 페닐알라닌은 방향족 아미노산 중에 가장 소수성이 높은 아미노산이며, 류신과 아이소류신이 지방족 아미노산중에서 가장 높은 소수성을 갖는 아미노산이다. 아이소류신의 경우 D-아미노산의 가격이 매우 높아 경제성의 문제 때문에 펩타이드 최적화에는 류신이 많이 사용된다. 따라서 본 발명에서는 지방족 소수성 아미노산 중 낮은 소수성을 가지는 15번째 잔기인 알라닌 위치를 류신이나 페닐알라닌으로 치환하여 항균활성을 높일 수 있다. 또한 펩타이드의 11번째 아미노산인 방향족 소수성 아미노산 페닐알라닌을 지방족 아미노산으로서 소수성이 높은 류신으로 치환하여 항균활성과 종래 항균제와의 시너지 효과를 증가시킬 수 있다.In the sequence of " peptide " of the present invention, through the step of " substitution with phenylalanine or the above ", an antimicrobial activity exhibiting an increased activity over the peptide consisting of the amino acid sequence of SEQ ID NO: 1 to SEQ ID NO: The sequence can be optimized to have a higher synergy. It is known that the antimicrobial activity of antimicrobial peptides having an amphiphilic structure increases as the hydrophobicity of the antimicrobial peptide, the amount of the alpha helical structure, and the cationicity are increased with the biological membrane, and the antibacterial activity of the peptide can be enhanced by optimizing these conditions Document 2). In the present invention, the hydrophobic moieties are substituted to increase the antimicrobial activity and the synergistic effect with the conventional antimicrobial agent. Phenylalanine is the most hydrophobic amino acid among aromatic amino acids, leucine and isoleucine are the highest hydrophobic amino acids among aliphatic amino acids. In the case of isoleucine, the price of D-amino acid is very high, and leucine is often used for peptide optimization because of economic problems. Therefore, in the present invention, it is possible to increase the antimicrobial activity by substituting leucine or phenylalanine for the alanine position which is the 15th residue having low hydrophobicity among the aliphatic hydrophobic amino acids. In addition, it is possible to increase the synergistic effect between antimicrobial activity and conventional antimicrobial agents by replacing the aromatic hydrophobic amino acid phenylalanine, which is the 11th amino acid of the peptide, with leucine having high hydrophobicity as an aliphatic amino acid.

보다 구체적으로, 본 발명의 신규한 항생 펩타이드중, 보다 구체적으로, 본 발명의 신규한 항생 펩타이드 중, 서열번호 5로 기재되는 아미노산 서열로 구성된 항생 펩타이드는 PapMA-5이고, 서열번호 1의 아미노산 서열에서 15 번째 잔기인 알라닌(A)이 페닐알라닌(F)으로 치환된 서열이다.More specifically, among the novel antibiotic peptides of the present invention, among the novel antibiotic peptides of the present invention, the antibiotic peptide consisting of the amino acid sequence represented by SEQ ID NO: 5 is PapMA-5, and the amino acid sequence of SEQ ID NO: (A) is replaced with phenylalanine (F).

서열번호 6으로 기재되는 아미노산 서열로 구성된 항생 펩타이드는 PapMA-6이며, 서열번호 1의 아미노산 서열에서 15 번째 잔기인 알라닌(A)이 류신(L)으로 치환된 서열이다.The antibiotic peptide consisting of the amino acid sequence of SEQ ID NO: 6 is PapMA-6, and alanine (A), which is the 15th residue in the amino acid sequence of SEQ ID NO: 1, is substituted with leucine (L).

서열번호 7로 기재되는 아미노산 서열로 구성된 항생 펩타이드는 PapMA-7이며, 서열번호 1의 아미노산 서열에서 11번째 잔기인 페닐알라닌(F)이 류신(L)으로; 및 15 번째 잔기인 알라닌(A)이 페닐알라닌(F)으로 치환된 서열이다.The antibiotic peptide consisting of the amino acid sequence represented by SEQ ID NO: 7 is PapMA-7, the phenylalanine (F) which is the 11th residue in the amino acid sequence of SEQ ID NO: 1 is leucine (L); And alanine (A) as the 15th residue are substituted with phenylalanine (F).

서열번호 8로 기재되는 아미노산 서열로 구성된 항생 펩타이드는 PapMA-8이고, 서열번호 1의 아미노산 서열에서 11번째 잔기인 페닐알라닌(F)이 류신(L)으로; 및 15 번째 잔기인 알라닌(A)이 류신(L)으로 치환된 서열이다.The antibiotic peptide consisting of the amino acid sequence of SEQ ID NO: 8 is PapMA-8, the phenylalanine (F) which is the 11th residue in the amino acid sequence of SEQ ID NO: 1 is leucine (L); And alanine (A) as the 15th residue are substituted with leucine (L).

서열번호 9로 기재되는 아미노산 서열로 구성된 항생 펩타이드는 PapMA-9이고, 서열번호 2의 아미노산 서열에서 11번째 잔기인 페닐알라닌(F)이 류신(L)으로 치환된 서열이다.The antibiotic peptide consisting of the amino acid sequence shown in SEQ ID NO: 9 is PapMA-9, and phenylalanine (F) which is the 11th residue in the amino acid sequence of SEQ ID NO: 2 is substituted with leucine (L).

서열번호 10으로 기재되는 아미노산 서열로 구성된 항생 펩타이드는 PapMA-10이며, 서열번호 2의 아미노산 서열에서 11 번째 잔기인 페닐알라닌(F)이 류신(L)으로; 및 15 번째 잔기인 알라닌(A)이 류신(L)으로 치환된 서열이다. The antibiotic peptide consisting of the amino acid sequence of SEQ ID NO: 10 is PapMA-10, the phenylalanine (F) which is the 11th residue in the amino acid sequence of SEQ ID NO: 2 is leucine (L); And alanine (A) as the 15th residue are substituted with leucine (L).

삭제delete

삭제delete

삭제delete

삭제delete

삭제delete

상기 "기능적 동등물"은 펩타이드의 아미노산 부가, 치환 또는 결실로 인해, 상기 신규한 항생 펩타이드의 아미노산 서열과 적어도 70% 이상, 바람직하게는 80% 이상, 보다 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상의 서열 상동성을 갖는 것으로,신규한 항생 펩타이드와 실질적으로 동질의 생리활성을 나타내는 펩타이드를 말한다.Is at least 70%, preferably 80% or more, more preferably 90% or more, more preferably 90% or more, more preferably 90% or more, more preferably 90% or more, Refers to a peptide having a homology of at least 95% and exhibiting substantially the same physiological activity as a novel antibiotic peptide.

본 발명의 신규한 항생 펩타이드는 합성 펩타이드로서, 상기 합성을 위한 방법으로 당업계의 통상적인 펩타이드의 화학적 합성 방법(W. H. Freeman and Co., Proteins; structures and molecular principles (1983))으로 합성하는 것이 바람직하며, 구체적으로는 액상 고상법(Solution Phase Peptide synthesis), 고상 고상법(Solid-phase peptide syntheses), 단편 응축법 및 F-moc 또는 T-BOC 화학법으로 합성하는 것이 보다 바람직하고, 더욱 구체적으로는 액상 고상법(Merrifield, RB., J. Am. Chem . Soc ., 85.2149: 196)으로 합성하는 것이 가장 바람직하나, 이에 한정되지 않는다.The novel antimicrobial peptide of the present invention is a synthetic peptide, and it is preferable to synthesize it by a chemical synthesis method (WH Freeman and Co., Proteins; structures and molecular principles (1983)) of a conventional peptide in the art as a method for the above synthesis Specifically, it is more preferable to synthesize by solution phase peptide synthesis, solid-phase peptide syntheses, fractional condensation and F-moc or T-BOC chemical methods, and more specifically, Is most preferably synthesized by the liquid phase solid phase method (Merrifield, RB., J. Am. Chem . Soc ., 85.2149: 196), but is not limited thereto.

본 발명의 "신규한 항생 펩타이드"는 그람 양성균, 그람 음성균 및 이의 항생제 내성균주에 대해 항균 활성을 갖는 것이 바람직하나, 이에 한정되지 않는다. 구체적으로, 상기 그람 양성균은 스타필로코커스 속(Staphylococcus), 리스테리아 속(Listeria), 스트렙토코쿠스 속(Streptococcus), 코리네박테리움 속(Corynebacterium), 락토바실러스 속(Lactobacillus), 클로스트리듐 속(Clostridium), 엔테로코쿠스 속(Enterococcus), 에리시펠로트릭스 속(Erysipelothrix) 및 바실러스 속(Bacillus)을 포함하는 그람 양성균으로 당업계에 공지된 모든 그람 양성균인 것이 바람직하며, 바실러스 서브틸리스(Bacillus subtilis), 스타필로코커스 아우레우스(Staphylococcus aureus) 또는 스타필로코커스 에피더미디스(Staphylococcus epidermidis)인 것이 보다 바람직하나 이에 한정되지 않는다. 상기 그람 음성균은 대장균 속(Escherichia), 슈도모나스 속(Pseudomonas), 살모넬라 속(Salmonella), 렙토스피라 속(Leptospira), 리케치아 속(Rickettsia)을 포함하는 그람 음성균으로 당업계에 공지된 모든 그람 음성균인 것이 바람직하며, 대장균(Escherichia coli), 슈도모나스 에루지노사(Psedomonas aeruginosa), 아세네토박터 바우마니(Acinetobacter baumannii) 또는 살모넬라 타이피뮤리움(Salmonella typhimurium)인 것이 보다 바람직하며, 구체적으로 대장균(Escherichia coli) 또는 아세네토박터 바우마니(Acinetobacter baumannii) 중 어느 하나 인 것이 가장 바람직하나 이에 한정되지 않는다.The "novel antibiotic peptide" of the present invention is preferably, but not limited to, those having antimicrobial activity against Gram-positive bacteria, Gram-negative bacteria and their antibiotic-resistant bacteria. Specifically, the Gram-positive bacteria are Staphylococcus genus (Staphylococcus), Listeria genus (Listeria), Streptococcus genus (Streptococcus), the genus Corynebacterium (Corynebacterium), Lactobacillus genus (Lactobacillus), genus Clostridium ( Clostridium), Enterobacter nose kusu genus (Enterococcus), Erie when fellow matrix in (Erysipelothrix) and Bacillus (Bacillus) gram and positive bacteria preferably a positive bacteria of all known Gram in the art, including, Bacillus subtilis (Bacillus subtilis , Staphylococcus aureus or Staphylococcus epidermidis , but is not limited thereto. The gram-negative bacteria is E. coli in (Escherichia), Pseudomonas species (Pseudomonas), Salmonella genus (Salmonella), Leptospira in (Leptospira), rikechiah in (Rickettsia) industry preferably all gram-negative bacteria is known in the art as gram-negative bacteria, including And more preferably Escherichia coli , Pseudomonas aeruginosa , Acinetobacter baumannii or Salmonella typhimurium , and more preferably Escherichia coli or Acetobacter spp. It is most preferable to use one of Acinetobacter baumannii , but the present invention is not limited thereto.

[0067] 본 발명의 구체적인 실시예에 있어서, 본 발명자들은 우수한 항균활성을 나타내는 신규 항생 펩타이드를 합성하기 위해, 호랑나비 유충으로부터 분리된 항균펩타이드 파필리오신(Papiliocin, Pap)의 N-terminal 영역과 마가이닌(Magainin 2, MA)의 N-말단 영역잔기들을 연결하여 만든 파필리오신 혼성 펩타이드인 PapMA-1의 15 번재 아미노산인 알라닌 및/또는 18번째 아미노산인 페닐알라닌을 트립토판으로 치환하여 PapMA-2 내지 PapMA-4의 펩타이드를 설계하였다. 또한, 상기 PapMA-1 내지 PapMA-4의 펩타이드로부터 11 번째 아미노산인 페닐알라닌(F)이 류신(L)으로 치환; 및/또는 15 번째 아미노산인 알라닌(A) 또는 트립토판(W)이 페닐알라닌(F) 또는 류신(L)으로 치환;하여 PapMA-5 내지 PapMA-10의 항생 펩타이드를 설계하였다(표 1).In a specific example of the present invention, the inventors of the present invention have found that in order to synthesize a novel antibiotic peptide exhibiting excellent antimicrobial activity, the N-terminal region of the antibacterial peptide papillocin (Pap) Papalan-2, MA), which is a papyridinosynthesized peptide made by linking residues of Papain-2, MA, is substituted with tryptophan, The peptides of PapMA-4 were designed. Also, phenylalanine (F) which is the 11th amino acid from the peptides of PapMA-1 to PapMA-4 is substituted with leucine (L); Antigenic peptides of PapMA-5 to PapMA-10 were designed by replacing alanine (A) or tryptophan (W), which is the 15th amino acid, with phenylalanine (F) or leucine (L).

또한, 본 발명자들은 PapMA-5 내지 PapMA-10가 나타내는 항균 활성을 확인한 결과, PapMA-5 내지 PapMA-10는 모든 그람 음성균에 대해 높은 항균활성을 나타내어, 비교군 펩타이드인 파필리오신과 같이 그람음성균에 선택적으로 매우 높은 항균활성을 나타내는 것을 확인하였다(표 2 및 표 3). 또한, 종래 항생제로 사용되는 에리트로마이신, 반코마이신 및 리네졸리드는 그람 양성균에 항균활성을 갖고, 그람 음성균에 대한 항균활성은 매우 낮은 것을 확인하였다(표 4).Further, as a result of confirming the antimicrobial activity of PapMA-5 to PapMA-10, the present inventors have found that PapMA-5 to PapMA-10 exhibit high antimicrobial activity against all Gram-negative bacteria, and as a comparative group peptide, (Table 2 and Table 3). ≪ tb > < TABLE > In addition, it has been confirmed that erythromycin, vancomycin, and linzolide, which are conventionally used as antibiotics, have antimicrobial activity against gram-positive bacteria and very low antimicrobial activity against gram-negative bacteria (Table 4).

또한, 본 발명자들은 PapMA-5 내지 PapMA-10이 기존 항생제와 시너지 항균 활성을 나타낼 수 있는지 확인하기 위하여 에리트로마이신, 반코마이신 또는 리네졸리드와 함께 그람음성균 및 항생제 내성 균주에 투여한 결과, 항생제를 단독으로 처리하였을 때 나타나는 항균 활성에 비해 유의적으로 상승한 수준의 항균 활성을 나타내는 것을 확인하였고(표 5 내지 표13), 이는 본 발명의 합성 펩타이드와 항생제가 유의적인 상승적 효과의 항균 활성을 나타내는 결과임을 확인하였다(도 1, 도 2 및 표 15 내지 표 18).The present inventors also found that when Papami-5 to PapMA-10 were administered to Gram-negative bacteria and antibiotic-resistant strains together with erythromycin, vancomycin or linezolid to confirm that they could exhibit synergistic antimicrobial activity with existing antibiotics, (Table 5 to Table 13), indicating that the synthetic peptide and the antibiotic of the present invention show a significant synergistic antimicrobial activity (Fig. 1, Fig. 2 and Tables 15 to 18).

따라서, 본 발명의 항생 펩타이드인 PapMA-5 내지 PapMA-10은 그람음성균에 대하여 보다 유의적인 항균 활성을 나타낼 뿐 아니라, 그람양성균에만 유의적인 항균 활성을 갖고 그람 음성균에는 낮은 항균활성을 가지는 항생제와 본 발명의 항생 펩타이드를 함께 투여하였을 때, 그람음성균 및 이의 항생제 내성균에 대하여 우수한 상승적 항균 활성을 나타내므로, 본 발명의 항생 펩타이드 또는 이를 항생제와 함께 포함하는 복합제는 항균용 조성물의 유효성분으로 유용하게 사용할 수 있다.Therefore, the antibiotic peptides PapMA-5 to PapMA-10 of the present invention exhibit not only significant antimicrobial activity against Gram-negative bacteria but also antimicrobial activity which has a significant antimicrobial activity only for Gram-positive bacteria and low antibacterial activity for Gram- When the antibiotic peptide of the present invention is administered together, it exhibits an excellent synergistic antimicrobial activity against Gram-negative bacteria and its antibiotic-resistant bacteria. Therefore, the antibiotic peptide of the present invention or the combination comprising the antibiotic together with the antibiotic may be usefully used as an effective ingredient .

본 발명은 또한, 서열번호 1 내지 서열번호 4로 이루어진 군으로부터 선택되는 어느 하나의 아미노산 서열로부터, 11 번째 아미노산인 페닐알라닌(F)이 류신(L)으로의 치환; 및 15 번째 아미노산인 알라닌(A) 또는 트립토판(W)이 페닐알라닌(F) 또는 류신(L)으로의 치환;으로 이루어진 군으로부터 선택된 적어도 하나 이상의 치환이 이루어진 아미노산 서열로 구성되는, 항생 펩타이드를 유효 성분으로 포함하는, 항균용 약학적 조성물을 제공한다. The present invention also provides a method for producing a protein comprising the steps of: substituting phenylalanine (F) as an 11th amino acid with leucine (L) from any one of amino acid sequences selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 4; And wherein the 15th amino acid alanine (A) or tryptophan (W) is substituted with phenylalanine (F) or leucine (L) Or a pharmaceutically acceptable salt thereof.

또한, 본 발명은 (a) 상기 항생 펩타이드; 및 (b) 항생제를 유효 성분으로 포함하는, 항균용 약학적 조성물을 제공한다.
또한, 본 발명은 (a) 상기 항생 펩타이드; 및 (b) 항생제를 유효 성분으로 포함하는, 항균 보조제를 제공한다.
The present invention also relates to a pharmaceutical composition comprising (a) the antibiotic peptide; And (b) an antibiotic as an active ingredient.
The present invention also relates to a pharmaceutical composition comprising (a) the antibiotic peptide; And (b) an antibiotic as an active ingredient.

본 발명의 "항생 펩타이드"는 서열번호 5 내지 10으로 기재되는 아미노산 서열 중 어느 하나로 구성되는 것이 바람직하나, 이에 한정되지 않고, 이의 유도체 및 기능적 동등물일 수 있다. 상기 "기능적 동등물"은 펩타이드의 아미노산 부가, 치환 또는 결실로 인해, 상기 신규한 항생 펩타이드의 아미노산 서열과 적어도 70% 이상, 바람직하게는 80% 이상, 보다 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상의 서열 상동성을 갖는 것으로,신규한 항생 펩타이드와 실질적으로 동질의 생리활성을 나타내는 펩타이드를 말한다.The "antibiotic peptide" of the present invention is preferably composed of any one of the amino acid sequences set forth in SEQ ID NOS: 5 to 10, but is not limited thereto, and derivatives and functional equivalents thereof. Is at least 70%, preferably 80% or more, more preferably 90% or more, more preferably 90% or more, more preferably 90% or more, more preferably 90% or more, Refers to a peptide having a homology of at least 95% and exhibiting substantially the same physiological activity as a novel antibiotic peptide.

본 발명의 "항생제"는 그람양성균에 대하여 항균활성을 가지고, 그람음성균에 대하여 낮은 항균활성을 가지거나 항균활성이 없는 것으로 당업계에 알려진 것이라면 어떤 것을 사용하여도 무방하다. 구체적으로, 본 발명의 항생제는 에리트로마이신(Erythromycin), 암피실린(Ampicillin), 반코마이신(Vancomycin), 리네졸리드(Linezolid), 메티실린(Methicillin), 옥사실린(Oxacillin), 세포탁심(Cefotaxime), 리팜피신(Rifampicin), 아미카신(Amikacin), 겐타마이신(Gentamicin), 아미카신(Amikacin), 카나마이신(Kanamycin), 토브라마이신(Tobramycin), 네오마이신(Neomycin), 에르타페넴(Ertapenem), 도리페넴(Doripenem), 이미페넴/실라스타틴(Imipenem/Cilastatin), 메로페넴(Meropenem), 세프타지딤(Ceftazidime), 세파핌(Cefepime), 세프타로린(Ceftaroline), 세프토비프롤(Ceftobiprole), 아즈트레오남(Aztreonam), 피페라실린(Piperacillin), 폴리믹신 B(Polymyxin B), 콜리스틴(Colistin), 시프로플록사신(Ciprofloxacin), 레보플록사신(Levofloxacin), 목시플록사신(Moxifloxacin), 가티플록사신(Gatifloxacin), 티게사이클린(Tigecycline), 이의 배합체 및 이들의 유도체로 구성된 군으로부터 선택되는 어느 하나 이상인 것이 바람직하고, 보다 구체적으로 에리트로마이신, 반코마이신 및 리네졸리드로 구성된 군으로부터 선택되는 어느 하나 이상인 것이 더욱 바람직하나, 이에 한정되지 않는다.The "antibiotic" of the present invention may be any of those known in the art as having antimicrobial activity against Gram-positive bacteria and having low antimicrobial activity against gram-negative bacteria or having no antimicrobial activity. Specifically, the antibiotics of the present invention may be selected from the group consisting of Erythromycin, Ampicillin, Vancomycin, Linezolid, Methicillin, Oxacillin, Cefotaxime, But are not limited to, Rifampicin, Amikacin, Gentamicin, Amikacin, Kanamycin, Tobramycin, Neomycin, Ertapenem, The compounds of the present invention may be used in combination with other drugs such as Doripenem, Imipenem / Cilastatin, Meropenem, Ceftazidime, Cefepime, Ceftaroline, Ceftobiprole, Piperacillin, Polymyxin B, Colistin, Ciprofloxacin, Levofloxacin, Moxifloxacin, Gatifloxacin, and the like. , Tigecycline, a combination thereof, and a combination thereof Body preferably at least one selected from the group consisting of and, more specifically, erythromycin, one or more preferably more than one selected from the group consisting of vancomycin, and Rhine Jolly draw, and the like.

본 발명의 "항균용 약학적 조성물"은 하기와 같은 병원균에 대하여 항균활성을 나타내는 것이 바람직하나, 이에 한정되지 않는다: 아세네토박터 바우마니(Acinetobacter baumannii), 방사선균류속(Actinomyces sp.)(예를 들어, 악티노미세스 이스라에라이(Actinomyces israelii) 및 악티노미세스 네스런다이(Actinomyces naeslundii)), 에로모나스 속(Aeromonas sp.)(예를 들어, 에로모난스 하이드로필라(Aeromonas hydrophila), 에로모나스 베로나이 비오바 소브리아(에로모나스 소프리아)(Aeromonas veronii biovar sobria(Aeromonas sobria)) 및 에로모나스 카비에(Aeromonas caviae)), 아나플라스마 페토사이도필럼(Anaplasma phagocytophilum), 알칼리제니스 자일로스옥시단(Alcaligenes xylosoxidans), 악티노바실러스 악티노미세템코미탄(Actinobacillus actinomycetemcomitans), 바실루스 속(Bacillus sp.)(예를 들어 탄저균(Bacillus anthracis), 세레우스균(Bacillus cereus), 고초균(Bacillus subtilis), 투린지엔시스균(Bacillus thuringiensis), 및 바실루스 스티로서머필러스(Bacillus stearothermophilus), 가세균 속(Bacteroides sp.)(예를 들어, 박테로이드 프레질리스(Bacteroides fragilis)), 바르토넬라 속(Bartonella sp)(예를 들어, 바르토넬라 바실리포르미스(Bartonella bacilliformis) 및 바르토넬라 핸셀레(Bartonella henselae)), 비피더스균 속(Bifidobacterium sp.), 보데텔라 속(Bordetella sp.)(예를 들어 백일해균(Bordetella pertussis), 파라백일해균(Bordetella parapertussis) 및 보데텔라 브론카이셉티카(Bordetella bronchiseptica)), 보렐리아 속(Borrelia sp.)(예를 들어, 회귀열보렐리아(Borrelia recurrentis) 및 보렐리아 버그도르페리(Borrelia burgdorferi)), 브루셀라균 속(Brucella sp.)(예를 들어, 소유산균(Brucella abortus), 개유산균(Brucella canis), 말타열균(Brucella melintensis) 및 돼지유산균(Brucella suis)), 버르크홀데리아 속(Burkholderia sp.)(예를 들어, 버르크홀데리아 수도말레이(Burkholderia pseudomallei) 및 버르크홀데이라 세파시아(Burkholderia cepacia)), 캄필로박터 속(Campylobacter sp.)(예를 들어, 공장캄필로박터(Campylobacter jejuni), 캄필로박터 콜리(Campylobacter coli), 캄필로박터 라리(Campylobacter lari) 및 캄필로박터 태아고균(Campylobacter fetus)), 캅노사이토파가 속(Capnocytophaga sp.), 카르디오박테리움 호미니스(Cardiobacterium hominis), 클라미디아 트라코마티스(Chlamydia trachomatis), 클라미도필라 수모니에(Chlamydophila pneumonia), 앵무병 클라미도필라 (Chlamydophila psittaci), 시트로박터속 콕시엘라 부르네티(Citrobacter sp. Coxiella burnetii), 코리네박테리아 속(Corynebacterium sp.)(예를 들어, 디프테리아균(Corynebacterium diphtheria), 코리네박테리움 제이키움(Corynebacterium jeikeum) 및 코리네박테리움(Corynebacterium)), 클로스트리듐 속(Clostridium sp.)(예를 들어, 웰치균(Clostridium perfringens), 클로스트리듐 디피실리균(Clostridium difficile), 클로스트리듐 보툴리늄(Clostridium botulinum) 및 파상풍균(Clostridium tetani)), 에이케넬라 코로덴스(Eikenella corrodens), 엔테로박터 속(Enterobacter sp.)(예를 들어, 엔테로박터 에어로게네스균(Enterobacter aerogenes), 엔테로박터 아글로메란스(Enterobacter agglomerans), 엔테로박터 클로아케(Enterobacter cloacae) 및 장독성원소 대장균(enterotoxigenic E. Coli), 장침입성 대장균(enteroinvasive E. Coli), 장병원성 대장균(enteropathogenic E. Coli), 장출혈성 대장균(enterohemorrhagic E. Coli), 장관집합성 대장균(enteroaggregative E. Coli) 및 요로질환유발성 대장균(Uropathogenic E. coli)과 같은 기회 감염성 대장균을 포함하는 대장균(Escherichia coli)), 장구균 속(Enterococcus sp.)(예를 들어 엔데로코쿠스 페칼리스(Enterococcus faecalis) 및 엔테로코쿠스 페슘(Enterococcus faecium)), 에르리치아 속(Ehrlichia sp.)(예를 들어, 에르리치아 카핀시아(Ehrlichia chafeensia) 및 에프리치아 카니스(Ehrlichia canis)), 돼지단독균(Erysipelothrix rhusiopathiae), 유박테리움 속(Eubacterium sp.), 야토병균(Francisella tularensis), 누클레아튬균(Fusobacterium nucleatum), 가드네렐라 베지날리스(Gardnerella vaginalis), 게멜라 모르빌로럼(Gemella morbillorum), 헤모필루스 속(Haemophilus sp.)(예를 들어, 인플루엔자균(Haemophilus influenzae), 헤모필루스 듀크레이(Haemophilus ducreyi), 헤모필루스 에이집티우스(Haemophilus aegyptius), 헤모피루스 헤모인플루엔자(Haemophilus parainfluenzae), 헤모필루스 헤모리티쿠스(Haemophilus haemolyticus) 및 헤모필루스 파라헤모리티쿠스(Haemophilus parahaemolyticus)), 헬리코박터 속(Helicobacter sp.)(예를 들어, 헬리코박터 피포리(Helicobacter pylori), 헬리코박터 시네디(Helicobacter cinaedi) 및헬리코박터 페넬리에(Helicobacter fennelliae)), 킹겔라 킹게(Kingella kingii), 클레프시엘라 속(Klebsiella sp.)(예를 들어, 폐렴간균(Klebsiella pneumoniae), 클레브시엘라 그라눌로마티스(Klebsiella granulomatis) 및클레브시엘라 옥시토카(Klebsiella oxytoca)), 젖산균 속(Lactobacillus sp.), 리스테리아 모노사이토제니스(Listeria monocytogenes), 렙토스피라 인테로간스(Leptospira interrogans), 레지오필라 뉴모필라(Legionella pneumophila), 렙토스피라 인테로간스(Leptospira interrogans), 펩토사슬알균 속(Peptostreptococcus sp.), 모락셀라 카타르할리스(Moraxella catarrhalis), 모르가넬라 속(Morganella sp.), 모비룬쿠스 속(Mobiluncus sp.), 미구균 속(Micrococcus sp.), 마이코박테리움 속(Mycobacterium sp.)(예를 들어, 나병균(Mycobacterium leprae), 마이코박테리움 인트라셀룰레어(Mycobacterium intracellulare), 조형결핵균(Mycobacterium avium), 소결핵균(Mycobacterium bovis) 및 마이코박테리움 마리넘(Mycobacterium marinum)), 마이코플리즘 속(Mycoplasm sp.)(예를 들어, 폐렴 마이코플라즈마(Mycoplasma pneumoniae), 마이코플라즈마 호미니(Mycoplasma hominis) 및 마이코플라즈마 제니탈리움(Mycoplasma genitalium)), 노카르디아균(Nocardia sp.)(예를 들어, 노카르니아 에스테로이드(Nocardia asteroides), 노카르디아 시리아시지오지카(Nocardia cyriacigeorgica) 및 노카르디아 브라질리엔시스(Nocardia brasiliensis)), 나이세리균(Neisseria sp.)(예를 들어, 임균(Neisseria gonorrhoeae) 및 수막염균(Neisseria meningitidis)), 파스튜렐라 멀토시다(Pasteurella multocida), 플레시오모나스 시겔로이드(Plesiomonas shigelloides), 프리보텔라 속(Prevotella sp.), 포르피로모나스 속(Porphyromonas sp.), 프리보텔라 멜로니노게니카(Prevotella melaninogenica), 프로테우스 속(Proteus sp.)(예를 들어, 프로테우스 불가리스(Proteus vulgaris) 및 프로테우스 미라빌리스(Proteus mirabilis)), 프로비덴시아 속(Providencia sp.)(예를 들어, 프로비덴시아 알칼리파시엔(Providencia alcalifaciens), 프로비덴시아 레트게리(Providencia rettgeri) 및 프로비덴시아 스투아르테(Providencia stuartii)), 녹농균,(Pseudomonas aeruginosa), 프로피온산균 에크니(Propionibacterium acnes), 로도코쿠스 에쿠이(Rhodococcus equi), 살모넬라균 속(Salmonella sp.)(예를 들어, 살모넬라 엔테리카(Salmonella enterica), 장티푸스균(Salmonella typhi), 파라티푸스균(Salmonella paratyphi), 장염균(Salmonella enteritidis), 살모넬라 식중독(Salmonella cholerasuis) 및 쥐티푸스균(Salmonella typhimurium), 세라티아 속(Serratia sp.)(예를 들어, 영균(Serratia marcesans) 및 세라티아 리뮈파시엔(Serratia liquifaciens)), 시겔라 속(Shigella sp.)(예를 들어, 지하적리균(Shigella dysenteriae), 시겔라 플렉스네리(Shigella flexneri), 보이드 설사균(Shigella boydii) 및 시겔라 소네이균(Shigella sonnei)), 포도상국균 속(Staphylococcus sp.)(예를 들어, 황색포도상구균(Staphylococcus aureus), 표피포도상구균(Staphylococcus epidermidis), 스타필로코쿠스 헤모리티쿠스(Staphylococcus hemolyticus), 스타필로코쿠스 사프로피티쿠스(Staphylococcus saprophyticus)), 연쇄상구균 속(Streptococcus sp.)(예를 들어, 폐렴 연쇄상구균(Streptococcus pneumoniae), 스펙티노마이신-내성 혈청형 6B 폐렴 연쇄상구균(Spectinomycin-resistant serotype 6B Streptococcus pneumoniae), 스트렙토마이신-내성 혈청형 9V 폐렴 연쇄상구균(Streptomycin-resistant serotype 9V Streptococcus pneumoniae), 에리트로마이신-내성 혈청형 14 폐렴 연쇄상구균(Erythromycin-resistant serotype 14 Streptococcus pneumoniae), 옵토힌-내성 혈청형 14 폐렴 연쇄상구균(Optochin-resistant serotype 14 Streptococcus pneumoniae), 리팜피신-내성 혈청형 18C 폐렴 연쇄상구균(Rifampicin-resistant serotype 18C Streptococcus pneumoniae), 테트라사이클린-내성 혈청형 19F 폐렴 연괘상구균(Tetracycline-resistant serotype 19F Streptococcus pneumoniae), 페니실린-내성 혈청형 19F 폐렴 연쇄상구균(Penicillin-resistant serotype 19F Streptococcus pneumoniae) 및 트리메소프림-내성 혈청형 23F 폐련 연쇄상구균(Trimethoprim-resistant serotype 23F Streptococcus pneumoniae), 클로람페니콜-내성 혈청형 4 폐렴 연쇄상구균(Chloramphenicol-resistant serotype 4 Streptococcus pneumoniae), 스트렙토마이신-내성 혈청형 9V 폐렴 연쇄상구균(Streptomycin-resistant serotype 9V Streptococcus pneumoniae), 옵토힌-내성 혈청형 14 폐렴 연쇄상구균(Optochin-resistant serotype 14 Streptococcus pneumoniae), 리팜피신-내성 혈청형 18C 폐렴 연쇄상구균(Rifampicin-resistant serotype 18C Streptococcus pneumoniae), 페니실린-내성 혈청형 19F 폐렴 연쇄상구균(Penicillin-resistant serotype 19F Streptococcus pneumoniae) 또는 트리메소프림-내성 혈청형 23F 폐련 연쇄상구균(Trimethoprim-resistant serotype 23F Streptococcus pneumoniae), 스트렙토코쿠스 아갈락티에(Streptococcus agalactiae), 스트렙토코쿠스 뮤탄(Streptococcus mutans), 화농성 연쇄상구균(Streptococcus pyogenes), A군 용혈연쇄구균(Group A streptococci), 화농성연쇄상구균(Streptococcus pyogenes), B군 용혈연쇄구균(Group B streptococci), 스트렙토코쿠스 아갈락티에(Streptococcus agalactiae), C군 용혈연쇄구균(Group C streptococci), 스트렙토코쿠스 안지노수스(Streptococcus anginosus), 스트렙토코쿠스 이퀴스밀리스(Streptococcus equismilis), D군 용혈연쇄구균(Group D streptococci), 스트렙토코쿠스 보비스(Streptococcus bovis), F군 용혈연쇄구균(Group F streptococci) 및 스트렙토코쿠스 안지노수스(Streptococcus anginosus), G군 용혈연쇄구균(Group G streptococci), 스피릴룸 마이너스(Spirillum minus), 모닐리포르미스연쇄간균(Streptobacillus moniliformi), 트레포네마균 속(Treponema sp.)(예를 들어, 트레포네마 카라튬(Treponema carateum), 트레포네마 페테뉴(Treponema petenue), 매독트레포네마(Treponema pallidum) 및 트레포네마 엔데미쿰(Treponema endemicum), 트로페리마 위펠리(Tropheryma whippelii), 유레아플라스마 유레알티쿰(Ureaplasma urealyticum), 메요넬라 속(Veillonella sp.), 비브리오균 속(Vibrio sp.)(예를 들어, 아시아콜레라균(Vibrio cholerae), 장염비브리오균(Vibrio parahemolyticus), 비브리오 불니피쿠스균(Vibrio vulnificus), 장염비브리오균(Vibrio parahaemolyticus), 비브리오 불니피쿠스(Vibrio vulnificus), 비브리오 알지노리티쿠스(Vibrio alginolyticus), 비브리오 미미쿠스(Vibrio mimicus), 비브리오 홀리세(Vibrio hollisae), 비브리오 플루비알리스(Vibrio fluvialis), 비브리오 메치니코비(Vibrio metchnikovii), 비브리오 뎀셀라(Vibrio damsela) 및 비브리오 푸르니시(Vibrio furnisii)), 예르시니아 속(Yersinia sp.)(예를 들어, 여시니아 엔테로콜리티카(Yersinia enterocolitica) 및 페스트균 (Yersinia pestis)) 및 말토필리아(Xanthomonas maltophilia).The "antimicrobial pharmaceutical composition" of the present invention is preferably but not limited to: Acinetobacter baumannii , Actinomyces sp. (Example Actinomyces israelii and Actinomyces naeslundii ), Aeromonas sp. (For example, Aeromonas hydrophila , eromonas verona, Aeromonas sobria ( Aeromonas sobria ) and Aeromonas caviae ), Anaplasma phagocytophilum , Alcaligenes < RTI ID = 0.0 > xylosoxidans), Bacillus bad bad Martino Martino micro system comitán (Actinobacillus actinomycetemcomitans), in Bacillus (Bacillus sp.) (e.g. anthrax (Bacillus anthracis), cereus bacteria (Bacillus cereus), Bacillus subtilis (Bacillus subtilis), pitcher Lindsey N-Sys bacteria (Bacillus thuringiensis), and Bacillus styryl Summer pillar's (Bacillus stearothermophilus), in addition bacteria genus (Bacteroides sp.) (For example, (For example, Bacteroides fragilis ), Bartonella sp (for example, Bartonella bacilliformis and Bartonella henselae ), bifidobacteria in (Bifidobacterium sp.), Bode in telra (Bordetella sp.) (for example, whooping cough bacteria (Bordetella pertussis), para pertussis bacteria (Bordetella parapertussis) and Bode telra Braun Kai counts Mathematica (Bordetella bronchiseptica)) in Oh, borelri ( Such as Borrelia sp. (For example, Borrelia recurrentis and Borrelia burgdorferi ), Brucella sp. (For example, Brucella abortus , ( Brucella canis , Brucella melintensis and Brucella suis ), Burkholderia sp. (for example, Burkholderia pseudomallei and Burkholderia spp . ( E.g. , Burkholderia cepacia ), Campylobacter sp. ( E.g. , plant Campylobacter jejuni , Campylobacter coli , Campylobacter lari and Campylobacter sp . fetal gogyun (Campylobacter fetus)), Cobb nosayi topa belongs (Capnocytophaga sp.), carboxylic video tumefaciens hoe varnish (Cardiobacterium hominis), Chlamydia trachomatis (Chlamydia trachomatis), the Cloud shown pillar can monitor (Chlamydophila pneumonia), parrots Chlamydophila psittaci , Citrobacter sp. ≪ / RTI > Coxiella burnetii), Corey four bacterial genus (Corynebacterium sp.) (For example, diphtheria bacteria (Corynebacterium diphtheria), Corynebacterium Jay Kiwoom (Corynebacterium jeikeum) and Corynebacterium (Corynebacterium)), genus Clostridium ( Clostridium sp.) (e.g., Welch bacteria (Clostridium perfringens), Clostridium difficile silica bacteria (Clostridium difficile), Clostridium botulinum (Clostridium botulinum) and tetanus (Clostridium tetani)), the pond Nella nose Rhodes's Eikenella corrodens , Enterobacter sp. (For example, Enterobacter aerogenes , Enterobacter agglomerans , Enterobacter cloacae and enterotoxin, element E. coli (enterotoxigenic E. coli), jangchim grain growth of E. coli (enteroinvasive E. coli), Chapter E. coli (enteropathogenic E. coli), Chapter hemorrhagic Escherichia coli (enterohemorrhagic E. coli), Related aggregation coli (enteroaggregative E. Coli) and E. coli urinary tract disease-induced (Uropathogenic E. coli) and E. coli containing the opportunity infectious E. coli (Escherichia coli)), Enterococcus genus (Enterococcus sp.) (E.g. Ende Lokomotiv kusu Enterococcus faecalis and Enterococcus faecium ), Ehrlichia sp. (For example, Ehrlichia chafeensia and Ehrlichia canis ) , Erysipelothrix rhusiopathiae , Eubacterium sp., Francisella tularensis , Fusobacterium nucleatum , Gardnerella vaginalis , Gemelamorubilis, Gemella morbillorum , Haemophilus sp. ) (E. G., Haemophilus influenzae (Haemophilus influenzae), Haemophilus Duke ray (Haemophilus ducreyi), Haemophilus this jipti mouse (Haemophilus aegyptius), H. fur loose hemo influenza (Haemophilus parainfluenzae), Haemophilus H. Mori T kusu (Haemophilus haemolyticus) and ( E.g. , Haemophilus parahaemolyticus ), Helicobacter sp. (For example, Helicobacter pylori , Helicobacter cinaedi and Helicobacter fennelliae ) King Gela kingge (Kingella kingii), keulrepeu when Ella in (Klebsiella sp.) (for example, Klebsiella pneumoniae (Klebsiella pneumoniae), as Klebsiella Gras pressed clematis (Klebsiella granulomatis) and Klebsiella oxy cytokines (Klebsiella oxytoca ), Lactobacillus sp., Listeria monocytogenes , Leptospira interrogans ( Lep tobacco interrogans , Legionella pneumophila , Leptospira interrogans , Peptostreptococcus sp. , Moraxella catarrhalis , Morganella sp. , tombstones Rune kusu in (Mobiluncus sp.), US aureus in (Micrococcus sp.), Mycobacterium genus (Mycobacterium sp.) (e.g., nabyeonggyun (Mycobacterium leprae), Mycobacterium intra cellulose rare (Mycobacterium intracellulare), plastic tuberculosis (Mycobacterium avium), bovine tuberculosis (Mycobacterium bovis) and Mycobacterium horses over (Mycobacterium marinum)), my algorithm in Copley (Mycoplasm sp. ( E.g. , Mycoplasma pneumoniae , Mycoplasma hominis and Mycoplasma genitalium ), Nocardia sp. ( E.g., Nocardia spp.), Nocardia asteroides , Nocardia cyriacigeorgica and Nocardia brasiliensis ), Neisseria sp. (For example Neisseria gonorrhoeae ) And Neisseria meningitidis ), Pasteurella multocida , Plesiomonas shigelloides , Prevotella sp., Porphyromonas sp., Prevore telra Carmelo Nino's Danica (Prevotella melaninogenica), in Proteus (Proteus sp.) (for example, Proteus vulgaris (Proteus vulgaris) and Proteus Billy's mum (Proteus mirabilis)), au Lobby den cyano in (Providencia sp.) (E.g., Providencia alkali Pacific yen (Providencia alcalifaciens), Providencia inlet Gary (Providencia rettgeri) and Providencia Stu Artemisia (Providencia stuartii)), Pseudomonas aeruginosa, (Pseudomonas for example, aeruginosa , Propionibacterium acnes , Rhodococcus equi , Salmonella sp. (for example, Salmonella enterica , Salmonella typhi , Salmonella paratyphi , Salmonella enteritidis , Salmonella cholerasuis and Salmonella typhimurium , Serratia sp. (For example, Serratia marcesans and Serratia limypsia ) Serratia liquifaciens ), Shigella sp. (For example, Shigella dysenteriae , Shigella flexneri , Shigella b oydii) and Shigella Sone yigyun (Shigella sonnei)), Staphylococcus Aspergillus genus (Staphylococcus sp.) (e.g., Staphylococcus aureus (Staphylococcus aureus), epidermal Staphylococcus (Staphylococcus epidermidis), Staphylococcus H. Mori T kusu Staphylococcus hemolyticus , Staphylococcus saprophyticus ), Streptococcus sp. (For example, Streptococcus pneumoniae , Spectinomycin-resistant serotype 6B pneumococcal strain Streptomycin-resistant serotype 6B Streptococcus pneumoniae , Streptomycin-resistant serotype 9V Streptococcus pneumoniae , Erythromycin-resistant serotype 14 Streptococcus pneumoniae , , Optochin-resistant serotype 14 pneumococcal streptococci (Optochin-resistant serotype 14 Streptococcus pneumoniae ), rifampicin-resistant serotype 18C Resistant serotype 18C Streptococcus pneumoniae , a tetracycline-resistant serotype 19F Tetracycline-resistant serotype 19F Streptococcus pneumoniae , a penicillin-resistant serotype 19F Streptococcus 19F Streptococcus pneumoniae) and trimesoyl Supreme-resistant serotype 23F pyeryeon Streptococcus (Trimethoprim-resistant serotype 23F Streptococcus pneumoniae ), chloramphenicol-resistant serotype 4 Streptococcus pneumoniae (chloramphenicol-resistant serotype 4 Streptococcus pneumoniae ), streptomycin-resistant serotype 9V Streptomycin-resistant serotype 9V Streptococcus pneumoniae , Optochin-resistant serotype 14 Streptococcus pneumoniae , rifampicin-resistant serotype 18C Rifampicin-resistant serotype 18C Streptococcus pneumoniae ), Penicillin-resistant serotype 19F pneumococcal strain Aureus (Penicillin-resistant serotype 19F Streptococcus pneumoniae ) or trimesoyl Supreme-resistant serotype 23F pyeryeon Streptococcus (Trimethoprim-resistant serotype 23F Streptococcus pneumoniae ), Streptococcus Agar lock thienyl (Streptococcus agalactiae), Streptococcus myutan (Streptococcus mutans ), Streptococcus pyogenes , Group A streptococci , Streptococcus pyogenes , Group B streptococci , Streptococcus agalactiae , Group C streptococci , Streptococcus anginosus , Streptococcus equismilis , Group D streptococci , Streptococcus bovis, Streptococcus equisilis , Streptococcus bovis , Group F streptococci and Streptococcus anginosus , Group G streptococcus , Hemolytic Streptococcus (Group G streptococci), RY rilrum negative (Spirillum minus), Mo nilri formate miss chain bacilli (Streptobacillus moniliformi), Trail Four nematic bacteria in (Treponema sp.) (E.g., TRE Four nematic color lithium (Treponema Caratoum , Treponema petenue , Treponema pallidum and Treponema endemicum , Tropheryma whippelii , Ureaplasma urealyticum, Ureaplasma urealyticum, ), meyo Nella in (Veillonella sp.), parahaemolyticus in (Vibrio sp.) (e.g., Asian cholera (Vibrio cholerae), Vibrio parahaemolyticus (Vibrio parahemolyticus), Vibrio vulnificus bacteria (Vibrio vulnificus), Vibrio parahaemolyticus (Vibrio parahaemolyticus), Vibrio vulnificus (Vibrio vulnificus), Vibrio know nori Tea Syracuse (Vibrio alginolyticus), Vibrio Mimi Syracuse (Vibrio mimicus), the three Vibrio holly (Vibrio hollisae) , Vibrio flat ruby Alice (Vibrio fluvialis), Vibrio methoxy struck Kobe (Vibrio metchnikovii), Vibrio demsel La (Vibrio damsela) and Vibrio pureuni time (e. G. (Vibrio furnisii)), for example reusi in California (Yersinia sp.), Yersinia enterocolitica and Yersinia pestis ) and Xanthomonas maltophilia .

상기 그람 양성균은 스타필로코커스 속(Staphylococcus), 리스테리아 속(Listeria), 스트렙토코쿠스 속(Streptococcus), 코리네박테리움 속(Corynebacterium), 락토바실러스 속(Lactobacillus), 클로스트리듐 속(Clostridium), 엔테로코쿠스 속(Enterococcus), 에리시펠로트릭스 속(Erysipelothrix) 및 바실러스 속(Bacillus)을 포함하는 그람 양성균으로 당업계에 공지된 모든 그람 양성균인 것이 바람직하며, 바실러스 서브틸리스(Bacillus subtilis), 스타필로코커스 아우레우스(Staphylococcus aureus) 또는 스타필로코커스 에피더미디스(S. epidermidis)인 것이 보다 바람직하나 이에 한정되지 않으며, 바람직하게는 이들의 항생제 내성 균주를 포함할 수 있다.The Gram-positive bacteria are Staphylococcus genus (Staphylococcus), Listeria genus (Listeria), Streptococcus genus (Streptococcus), the genus Corynebacterium (Corynebacterium), Lactobacillus genus (Lactobacillus), Clostridium genus (Clostridium), Enterobacter nose kusu genus (Enterococcus), Erie when fellow matrix in (Erysipelothrix) and Bacillus (Bacillus) gram and positive bacteria preferably a positive bacteria of all known Gram in the art, including, Bacillus subtilis (Bacillus subtilis), Staphylococcus aureus or Staphylococcus epidermidis is more preferable, but is not limited thereto, and preferably it can include antibiotic-resistant strains thereof.

상기 그람 음성균은 대장균 속(Escherichia), 슈도모나스 속(Pseudomonas), 살모넬라 속(Salmonella), 렙토스피라 속(Leptospira), 리케치아 속(Rickettsia)을 포함하는 그람 음성균으로 당업계에 공지된 모든 그람 음성균인 것이 바람직하며, 대장균(Escherichia coli), 슈도모나스 에루지노사(Psedomonas aeruginosa), 아세네토박터 바우마니(Acinetobacter baumannii) 또는 살모넬라 타이피뮤리움(Salmonella typhimurium)인 것이 보다 바람직하며, 구체적으로 대장균(Escherichia coli) 또는 아세네토박터 바우마니(Acinetobacter baumannii) 중 어느 하나 인 것이 가장 바람직하나 이에 한정되지 않으며, 바람직하게는 이들의 항생제 내성 균주를 포함할 수 있다.The gram-negative bacteria is E. coli in (Escherichia), Pseudomonas species (Pseudomonas), Salmonella genus (Salmonella), Leptospira in (Leptospira), rikechiah in (Rickettsia) industry preferably all gram-negative bacteria is known in the art as gram-negative bacteria, including And more preferably Escherichia coli , Pseudomonas aeruginosa , Acinetobacter baumannii or Salmonella typhimurium , and more preferably Escherichia coli or Acetobacter spp. Most preferably, Acinetobacter baumannii , but is not limited thereto. Preferably, the strain may include an antibiotic-resistant strain thereof.

본 발명의 PapMA-5 내지 PapMA-10 펩타이드는 기존의 항생제와 함께 혼합 처리하였을 때 그람음성균 및 이의 항생제 내성 균주에 대하여 유의적인 상승적 항균 효과를 나타내므로, 본 발명의 항생 펩타이드 및 항생제의 복합제는 항균용 약학적 조성물의 유효성분으로 유용하게 사용될 수 있다.Since the PapMA-5 to PapMA-10 peptides of the present invention exhibit significant synergistic antimicrobial effects against Gram-negative bacteria and their antibiotic-resistant strains when mixed with conventional antibiotics, the antibiotic peptide and antibiotic combination of the present invention can be used for antibacterial And can be usefully used as an active ingredient of a pharmaceutical composition.

본 발명의 항균용 약학적 조성물은 임상투여시 비경구로 투여가 가능하며 일반적인 의약품 제제의 형태로 사용될 수 있다. 비경구 투여는 직장, 정맥, 복막, 근육, 동맥, 경피, 비강(Nasal), 흡입, 안구 및 피하와 같은 경구 이외의 투여경로를 통한 투여를 의미할 수 있다. 본 발명의 펩타이드 및 항균제 복합제를 의약품으로 사용하는 경우, 추가로 동일 또는 유사한 기능을 나타내는 유효성분을 1종 이상 함유할 수 있다.The antimicrobial pharmaceutical composition of the present invention can be administered parenterally at the time of clinical administration and can be used in the form of a general pharmaceutical preparation. Parenteral administration may refer to administration via routes other than oral, such as rectal, intravenous, peritoneal, muscular, arterial, percutaneous, nasal, inhalation, ocular and subcutaneous. When the peptide and the antibacterial agent complex of the present invention are used as medicines, they may further contain one or more active ingredients showing the same or similar functions.

즉, 본 발명의 항균용 약학적 조성물은 실제로 비경구의 여러 가지 제형으로 투여될 수 있는데, 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다. 비경구투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제, 좌제가 포함된다. 비수성용제, 현탁용제로는 프로필렌글리콜(Propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(Witepsol), 마크로골, 트윈(Tween) 61, 카카오지, 리우린지, 글리세로제라틴 등이 사용될 수 있다. That is, the antimicrobial pharmaceutical composition of the present invention may be administered in various forms of parenteral administration. In the case of formulation, a diluent or excipient such as a filler, an extender, a binder, a wetting agent, a disintegrant, . Formulations for parenteral administration include sterilized aqueous solutions, non-aqueous solutions, suspensions, emulsions, freeze-dried preparations, and suppositories. Propylene glycol, polyethylene glycol, vegetable oil such as olive oil, injectable ester such as ethyl oleate, and the like can be used as the non-aqueous solvent and suspension agent. Witepsol, macrogol, Tween 61, cacao bean, Liu lingzhi, glycerogelatin and the like can be used as the base of the suppository.

또한, 본 발명의 항균용 약학적 조성물은 생리식염수 또는 유기용매와 같이 약제로 허용된 여러 전달체(Carrier)와 혼합하여 사용될 수 있고, 안정성이나 흡수성을 증가시키기 위하여 글루코스, 수크로스 또는 덱스트란과 같은 탄수화물, 아스코르브산(Ascorbic acid) 또는 글루타치온(Glutathione)과 같은 항산화제(Antioxidants), 킬레이트화제(Chelating agents), 저분자 단백질 또는 다른 안정화제(Stabilizers)들이 약제로 사용될 수 있다.In addition, the pharmaceutical composition for antimicrobial use of the present invention can be used by mixing with various carriers that are accepted as medicines such as physiological saline or organic solvents, and can be used as glucose, sucrose or dextran such as sucrose, Antioxidants such as carbohydrates, ascorbic acid or glutathione, chelating agents, low molecular weight proteins or other stabilizers can be used as pharmaceuticals.

본 발명의 항균용 약학적 조성물의 유효용량은 0.01 내지 100 ㎎/㎏이고, 바람직하게는 0.1 내지 10 ㎎/㎏ 이며, 하루 1회 내지 3회 투여될 수 있다.The effective dose of the antibacterial pharmaceutical composition of the present invention is 0.01 to 100 mg / kg, preferably 0.1 to 10 mg / kg, and can be administered once to three times a day.

본 발명의 약학적 조성물에서 본 발명의 항생 펩타이드, 또는 항생 펩타이드 및 항균제 복합제의 총 유효량은 볼루스(Bolus) 형태 혹은 상대적으로 짧은 기간 동안 주입(Infusion) 등에 의해 단일 투여량(Single does)으로 환자에게 투여될 수 있으며, 다중 투여량(Multiple does)이 장기간 투여되는 분할 치료 방법(Fractionated treatment protocol)에 의해 투여될 수 있다. 상기 농도는 약의 투여 경로 및 치료 횟수뿐만 아니라 환자의 나이 및 건강상태 등 다양한 요인들을 고려하여 환자의 유효 투여량이 결정되는 것이므로 이러한 점을 고려할 때, 이 분야의 통상적인 지식을 가진 자라면 본 발명의 약학펩타이드 및 항균제 복합제의 약학적 조성물로서의 특정한 용도에 따른 적절한 유효 투여량을 결정할 수 있을 것이다.In the pharmaceutical composition of the present invention, the total effective amount of the antibiotic peptide or antibiotic peptide and antibacterial agent of the present invention may be in a Bolus form or in a single dose by infusion for a relatively short period of time And may be administered by a fractionated treatment protocol in which multiple doses are administered over a prolonged period of time. Since the concentration of the effective dose of the patient is determined in consideration of various factors such as the route of administration and the number of treatments as well as the age and health condition of the patient, in view of this point, As well as the pharmaceutical composition of the pharmaceutical peptide and antimicrobial agent of the present invention.

본 발명의 항균 보조제는 항생제 투여시, 항생제와 함께, 항생제 처리전, 항생제 처리 후 투여할 수 있으며, 항생제의 항균활성을 증진시키기 위한 보조제로서 사용될 수 있다. 상기 보조제는 항생제와 항균활성에 대하여 상승적 효과를 가지는 것이 바람직하며, 그람 음성균 및 항생제 내성 균주에 대하여 항생제의 항균활성을 증가시키는 것이 바람직하다.The antimicrobial adjuvant of the present invention can be administered at the time of administering the antibiotic, together with the antibiotic, before the antibiotic treatment, after the antibiotic treatment, and as an adjuvant for enhancing the antibiotic activity of the antibiotic. Preferably, the adjuvant has a synergistic effect on the antimicrobial activity with antibiotics, and it is preferable to increase the antimicrobial activity of the antibiotic against Gram-negative bacteria and antibiotic-resistant strains.

본 발명은 또한, 서열번호 1 내지 서열번호 4로 이루어진 군으로부터 선택되는 어느 하나의 아미노산 서열로부터, 11 번째 아미노산인 페닐알라닌(F)이 류신(L)으로의 치환; 및 15 번째 아미노산인 알라닌(A) 또는 트립토판(W)이 페닐알라닌(F) 또는 류신(L)으로의 치환;으로 이루어진 군으로부터 선택된 적어도 하나 이상의 치환이 이루어진 아미노산 서열로 구성되는, 항생 펩타이드를 유효 성분으로 포함하는, 항균용 식품 첨가제를 제공한다. // 또한, 본 발명은 (a) 상기 항생 펩타이드; 및 (b) 항생제를 유효 성분으로 포함하는, 항균용 식품 첨가제를 제공한다.The present invention also provides a method for producing a protein comprising the steps of: substituting phenylalanine (F) as an 11th amino acid with leucine (L) from any one of amino acid sequences selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 4; And wherein the 15th amino acid alanine (A) or tryptophan (W) is substituted with phenylalanine (F) or leucine (L) As a food additive. // Also, the present invention relates to a pharmaceutical composition comprising (a) the antibiotic peptide; And (b) an antibiotic as an active ingredient.

본 발명의 "항생 펩타이드"는 서열번호 5 내지 10으로 기재되는 아미노산 서열 중 어느 하나로 구성되는 것이 바람직하나, 이에 한정되지 않고, 이의 유도체 및 기능적 동등물일 수 있다.The "antibiotic peptide" of the present invention is preferably composed of any one of the amino acid sequences set forth in SEQ ID NOS: 5 to 10, but is not limited thereto, and derivatives and functional equivalents thereof.

본 발명의 PapMA-5 내지 PapMA-10 펩타이드는 기존의 항생제와 함께 혼합 처리하였을 때 그람음성균 및 이의 항생제 내성 균주에 대하여 유의적인 상승적 항균 효과를 나타내므로, 본 발명의 항생 펩타이드, 또는 항생 펩타이드 및 항생제의 복합제는 식품 첨가제의 유효성분으로 유용하게 사용될 수 있다.Since the PapMA-5 to PapMA-10 peptides of the present invention exhibit significant synergistic antimicrobial effects against Gram-negative bacteria and their antibiotic-resistant strains when mixed with conventional antibiotics, the antibiotic peptides, antibiotic peptides and antibiotics of the present invention Can be usefully used as an active ingredient of food additives.

본 발명의 항생 펩타이드, 또는 항생 펩타이드 및 항균제 복합제를 식품 첨가물로 사용하는 경우, 상기 항생 펩타이드, 또는 항생 펩타이드 및 항균제 복합제를 그대로 첨가하거나 다른 식품 성분과 함께 사용될 수 있고, 통상적인 방법에 따라 적절하게 사용될 수 있다. 유효성분의 혼합양은 그의 사용 목적에 따라 적절하게 결정될 수 있다. 일반적으로, 본 발명의 항생 펩타이드, 또는 항생 펩타이드 및 항균제 복합제는 원료에 대하여 15 중량부이하, 바람직하게는 10 중량부 이하의 양으로 첨가된다. 그러나, 장기간의 섭취의 경우에는 상기 양은 상기 범위 이하일 수 있으며, 안정성 면에서 아무런 문제가 없기 때문에 유효성분은 상기 범위 이상의 양으로도 사용될 수 있다. When the antibiotic peptide or antibiotic peptide and antimicrobial agent of the present invention is used as a food additive, the antibiotic peptide, antibiotic peptide and antimicrobial agent may be added intact or used together with other food ingredients, Can be used. The mixing amount of the active ingredient can be appropriately determined depending on the purpose of use thereof. Generally, the antibiotic peptide or antibiotic peptide and antibacterial agent complex of the present invention is added in an amount of not more than 15 parts by weight, preferably not more than 10 parts by weight, based on the raw material. However, in the case of long-term ingestion, the amount may be less than the above range, and since there is no problem in terms of stability, the active ingredient may be used in an amount in the above range.

상기 식품의 종류에는 특별한 제한은 없다. 상기 물질을 첨가할 수 있는 식품의 예로는 육류, 소시지, 빵, 쵸코렛, 캔디류, 스넥류, 과자류, 피자, 라면, 기타 면류, 껌류, 아이스크림류를 포함한 낙농제품, 각종스프, 음료수, 차, 드링크제, 알코올 음료 및 비타민 복합제 등이 있으며, 통상적인 의미에서의 식품을 모두 포함한다.There is no particular limitation on the kind of the food. Examples of foods to which the above substances can be added include dairy products such as meat, sausage, bread, chocolate, candy, snack, confectionery, pizza, ramen, other noodles, gums, ice cream, various soups, drinks, tea, Alcoholic beverages, and vitamin complexes, and includes foods in a conventional sense.

본 발명은 또한, 서열번호 1 내지 서열번호 4로 이루어진 군으로부터 선택되는 어느 하나의 아미노산 서열로부터, 11 번째 아미노산인 페닐알라닌(F)이 류신(L)으로의 치환; 및 15 번째 아미노산인 알라닌(A) 또는 트립토판(W)이 페닐알라닌(F) 또는 류신(L)으로의 치환;으로 이루어진 군으로부터 선택된 적어도 하나 이상의 치환이 이루어진 아미노산 서열로 구성되는, 항생 펩타이드를 유효 성분으로 포함하는, 항균용 사료 첨가제를 제공한다.
또한, 본 발명은 (a) 상기 항생 펩타이드; 및 (b) 항생제를 유효 성분으로 포함하는, 항균용 사료 첨가제를 제공한다.
The present invention also provides a method for producing a protein comprising the steps of: substituting phenylalanine (F) as an 11th amino acid with leucine (L) from any one of amino acid sequences selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 4; And wherein the 15th amino acid alanine (A) or tryptophan (W) is substituted with phenylalanine (F) or leucine (L) And a feed additive for antibacterial activity.
The present invention also relates to a pharmaceutical composition comprising (a) the antibiotic peptide; And (b) an antibiotic as an active ingredient.

본 발명의 PapMA-5 내지 PapMA-10 펩타이드는 기존의 항생제와 함께 혼합 처리하였을 때 그람음성균 및 이의 항생제 내성 균주에 대하여 유의적인 상승적 항균 효과를 나타내므로, 본 발명의 항생 펩타이드, 또는 항생 펩타이드 및 항생제의 복합제는 사료 첨가제의 유효성분으로 유용하게 사용될 수 있다.Since the PapMA-5 to PapMA-10 peptides of the present invention exhibit significant synergistic antimicrobial effects against Gram-negative bacteria and their antibiotic-resistant strains when mixed with conventional antibiotics, the antibiotic peptides, antibiotic peptides and antibiotics of the present invention Can be usefully used as an active ingredient of a feed additive.

본 발명의 항생 펩타이드, 또는 항생 펩타이드 및 항균제 복합제를 포함하는 사료 조성물은 기존의 항생제를 대체하고 유해한 식품 병원성균의 생장을 억제하여 동물체의 건강상태를 양호하게 하고, 가축의 증체량과 육질을 개선시키며, 산유량 및 면역력을 증가시키는 효과가 있다. 본 발명의 사료 조성물은 발효사료, 배합사료, 펠렛 형태 및 사일레지 등의 형태로 제조될 수 있다. The feed composition comprising the antibiotic peptide or antibiotic peptide and antibacterial agent combination of the present invention replaces the existing antibiotics and inhibits the growth of harmful food pathogenic bacteria to improve the health condition of the animal and improve the body weight and meat quality of the livestock , Milk production and immunity. The feed composition of the present invention can be produced in the form of a fermented feed, a compound feed, a pellet form, a silage reed, or the like.

상기 발효사료는 본 발명의 항생 펩타이드, 또는 항생 펩타이드 및 항균제 복합제 이외의 여러 가지 미생물군 또는 효소들을 첨가함으로써 유기물을 발효시켜 제조할 수 있으며, 배합사료는 여러 종류의 일반사료와 본 발명의 항생 펩타이드, 또는 항생 펩타이드 및 항균제 복합제를 혼합하여 제조할 수 있다. 펠렛 형태의 사료는 상기 배합사료 등을 펠렛기에서 열과 압력을 가하여 제조할 수 있으며, 사일레지는 청예사료를 미생물로 발효시킴으로써 제조할 수 있다. 습식발효사료는 음식물 쓰레기 등과 같은 유기물을 수집 및 운반하여 살균과정과 수분조절을 위한 부형제를 일정비율로 혼합한 후, 발효에 적당한 온도에서 24시간 이상 발효하여, 수분함량이 약 70%으로 포함되도록 조절하여 제조할 수 있다. 발효건조사료는 습식발효사료를 건조과정을 추가로 거쳐 수분함량이 30% 내지 40% 정도 함유되도록 조절하여 제조할 수 있다.The fermented feed can be prepared by fermenting an organic material by adding various microbial groups or enzymes other than the antibiotic peptide of the present invention or the antibiotic peptide and antimicrobial agent combination. The compounded feed can be prepared by mixing various kinds of general feeds and antibiotic peptides of the present invention , Or antibiotic peptide and antibacterial agent combination. The pellet-shaped feed can be produced by applying heat and pressure to the compound feed or the like in a pelletizer, and the silage can be produced by fermenting a chrysanthemum feed as a microorganism. The wet fermented feed is prepared by collecting and transporting organic matter such as food waste, mixing the excipient and the excipient for moisture control at a certain ratio, fermenting at a suitable temperature for fermentation for more than 24 hours, And the like. The fermented dried feed can be prepared by adjusting the wet fermented feed so that the moisture content is 30% to 40%.

본 발명은 또한, 서열번호 1 내지 서열번호 4로 이루어진 군으로부터 선택되는 어느 하나의 아미노산 서열로부터, 11 번째 아미노산인 페닐알라닌(F)이 류신(L)으로의 치환; 및 15 번째 아미노산인 알라닌(A) 또는 트립토판(W)이 페닐알라닌(F) 또는 류신(L)으로의 치환;으로 이루어진 군으로부터 선택된 적어도 하나 이상의 치환이 이루어진 아미노산 서열로 구성되는, 항생 펩타이드를 유효 성분으로 포함하는, 방부용 조성물을 제공한다.
또한, 본 발명은 (a) 상기 항생 펩타이드; 및 (b) 항생제를 유효 성분으로 포함하는, 방부용 조성물을 제공한다.
The present invention also provides a method for producing a protein comprising the steps of: substituting phenylalanine (F) as an 11th amino acid with leucine (L) from any one of amino acid sequences selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 4; And wherein the 15th amino acid alanine (A) or tryptophan (W) is substituted with phenylalanine (F) or leucine (L) By weight based on the total weight of the composition.
The present invention also relates to a pharmaceutical composition comprising (a) the antibiotic peptide; And (b) an antibiotic as an active ingredient.

본 발명의 PapMA-5 내지 PapMA-10 펩타이드는 기존의 항생제와 함께 혼합 처리하였을 때 그람음성균 및 이의 항생제 내성 균주에 대하여 유의적인 상승적 항균 효과를 나타내므로, 본 발명의 항생 펩타이드, 또는 항생 펩타이드 및 항생제의 복합제는 방부용 조성물의 유효성분으로 유용하게 사용될 수 있다.Since the PapMA-5 to PapMA-10 peptides of the present invention exhibit significant synergistic antimicrobial effects against Gram-negative bacteria and their antibiotic-resistant strains when mixed with conventional antibiotics, the antibiotic peptides, antibiotic peptides and antibiotics of the present invention Can be usefully used as an effective ingredient of the composition for an antidandruff agent.

상기 방부 조성물에는 식품의 방부제, 화장품 보존제 또는 의약품 보존제 등이 있다. 상기 식품의 방부제, 화장품 보존제 및 의약품 보존제는 의약품의 변질, 부패, 변색 및 화학변화를 방지하기 위해 사용되는 첨가물로서 살균제, 산화방지제가 이에 포함되며 세균, 곰팡이, 효모 등 미생물의 증식을 억제하여 식품 및 의약품에서 부패미생물의 발육저지 또는 살균작용을 하는 등의 기능성 항생제도 포함된다. 이러한 방부 조성물의 이상적인 조건으로는 독성이 없어야 하며, 미량으로도 효과가 있어야 한다.The preservative composition includes a food preservative, a cosmetic preservative, or a pharmaceutical preservative. Preservatives, cosmetic preservatives, and pharmaceutical preservatives of foods mentioned above are additives used to prevent deterioration, decay, discoloration and chemical change of medicines, including antiseptics and antioxidants, which inhibit the growth of microorganisms such as bacteria, fungi and yeast, And functional antibiotics such as inhibiting the growth of microorganisms or sterilizing microorganisms in pharmaceuticals. Ideal conditions for such preservative compositions should be non-toxic and effective in trace amounts.

본 발명은 또한, 서열번호 1 내지 서열번호 4로 이루어진 군으로부터 선택되는 어느 하나의 아미노산 서열로부터, 11 번째 아미노산인 페닐알라닌(F)이 류신(L)으로의 치환; 및 15 번째 아미노산인 알라닌(A) 또는 트립토판(W)이 페닐알라닌(F) 또는 류신(L)으로의 치환;으로 이루어진 군으로부터 선택된 적어도 하나 이상의 치환이 이루어진 아미노산 서열로 구성되는, 항생 펩타이드를 유효 성분으로 포함하는, 항균용 의약외품 조성물을 제공한다.
또한, 본 발명은 (a) 상기 항생 펩타이드; 및 (b) 항생제를 유효 성분으로 포함하는, 항균용 의약외품 조성물을 제공한다.
The present invention also provides a method for producing a protein comprising the steps of: substituting phenylalanine (F) as an 11th amino acid with leucine (L) from any one of amino acid sequences selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 4; And wherein the 15th amino acid alanine (A) or tryptophan (W) is substituted with phenylalanine (F) or leucine (L) A quasi-drug composition for antimicrobial use.
The present invention also relates to a pharmaceutical composition comprising (a) the antibiotic peptide; And (b) an antibiotic as an active ingredient.

본 발명의 PapMA-5 내지 PapMA-10 펩타이드는 기존의 항생제와 함께 혼합 처리하였을 때 대장균, 아세네토박터균 및 그 항생제 내성 균주에 대하여 유의적인 상승적 항균 효과를 나타내므로, 본 발명의 항생 펩타이드, 또는 항생 펩타이드 및 항생제의 복합제는 항균용 의약외품의 유효성분으로 유용하게 사용될 수 있다.Since the PapMA-5 to PapMA-10 peptides of the present invention exhibit significant synergistic antimicrobial effects against Escherichia coli, Acinetobacter spp. And antibiotic resistant strains thereof when mixed with an existing antibiotic, the antibiotic peptides of the present invention or Antibiotic peptide and antibiotic combination may be useful as an effective ingredient of quasi-antibiotic quasi-drugs.

본 발명의 조성물을 의약외품 첨가물로 사용할 경우, 본 발명의 항생 펩타이드, 또는 항생 펩타이드 및 항생제 복합제를 그대로 첨가하거나 다른 의약외품 또는 의약외품 성분과 함께 사용할 수 있고, 통상적인 방법에 따라 적절하게 사용할 수 있다. 유효성분의 혼합량은 사용 목적에 따라 적합하게 결정될 수 있다.When the composition of the present invention is used as a quasi-drug additive, the antibiotic peptide, antibiotic peptide and antibiotic combination of the present invention may be added as it is or may be used together with other quasi-drugs or quasi-drugs, and may be suitably used according to a conventional method. The amount of the active ingredient to be mixed can be appropriately determined depending on the purpose of use.

본 발명의 의약외품 조성물은 이에 제한되지는 않으나, 바람직하게는 소독청결제, 샤워폼, 가그린, 물티슈, 세제비누, 핸드워시, 가습기 충진제, 마스크, 연고제, 패치, 또는 필터 충진제일 수 있다.The quasi-drug composition of the present invention may be a disinfectant cleaner, a shower foam, a gagrin, a wet tissue, a detergent soap, a hand wash, a humidifier filler, a mask, an ointment agent, a patch or a filter filler.

이하, 실시예 및 제조예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예 및 제조예는 오로지 본 발명을 예시하기 위한 것으로서, 본 발명의 범위가 이들 실시예 및 제조예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다Hereinafter, the present invention will be described in more detail with reference to examples and preparation examples. It should be apparent to those skilled in the art that these examples and preparations are only for illustrating the present invention and that the scope of the present invention is not construed as being limited by these examples and preparations

항생 펩타이드의 합성Synthesis of antibiotic peptides

그람음성 다제내성균에 대한 항균 활성을 나타내는 펩타이드를 대상으로 하기 위해서, 항생 펩타이드인 파필리오신(Papiliocin, 서열번호 11)의 N 말단 잔기 및 마가이닌(Magainin, 서열번호 12)의 N 말단 잔기를 연결한 서열을 설계하여, 항생 펩타이드(PapMA-1)를 설계하였다.
서열번호 1로 기재되는 아미노산 서열의 항생 펩타이드(PapMA-1)로부터, 15번째 아미노산인 알라닌(A)을 트립토판(W)으로 치환; 및/또는 18번째 아미노산인 페닐알라닌(F)을 트립토판(W)으로 치환;하여 서열번호 2 내지 서열번호 4로 기재되는 아미노산 서열의 항생 펩타이드(PapMA-2 내지 PapMA-4)를 설계하였다.
그런 다음, 상기 서열번호 1 내지 서열번호 5로 기재되는 아미노산 서열의 항생 펩타이드로부터, 11번째 아미노산인 페닐알라닌(F)을 류신(L)으로 치환; 및/또는 15번째 아미노산인 알라닌(A) 또는 트립토판(W)을 페닐알라닌(F) 또는 류신(L)으로 치환;하여 서열번호 5 내지 서열번호 10으로 기재되는 아미노산 서열의 항생 펩타이드(PapMA-5 내지 PapMA-10)를 설계하였다.
(N-terminal residue of Magiliin (SEQ ID NO: 12)) of the antibiotic peptide Papiliocin (SEQ ID NO: 11) and the N-terminal residue of Magainin (SEQ ID NO: 12) were ligated to the peptide exhibiting antimicrobial activity against Gram- One sequence was designed to design antibiotic peptide (PapMA-1).
Alanine (A) as the 15th amino acid was substituted with tryptophan (W) from the antibiotic peptide (PapMA-1) of the amino acid sequence shown in SEQ ID NO: 1; (PapMA-2 to PapMA-4) of the amino acid sequence shown in SEQ ID NO: 2 to SEQ ID NO: 4 were designed by replacing the 18th amino acid phenylalanine (F) with tryptophan (W)
Subsequently, the 11th amino acid phenylalanine (F) is substituted with leucine (L) from the antibiotic peptide of the amino acid sequence shown in SEQ ID NO: 1 to SEQ ID NO: 5, (PapMA-5 to 5) of the amino acid sequence shown in SEQ ID NO: 5 to SEQ ID NO: 10 by replacing the 15th amino acid alanine (A) or tryptophan (W) with phenylalanine PapMA-10) was designed.

설계한 펩타이드 서열은 N-(9-플루오레닐)메톡시카보닐(N-(9-fluorenyl)methoxycarbonyl; Fmoc) 합성법을 사용하여, 고체상 합성법으로 펩타이드를 합성하고 이를 정제하였다(Biochimica et Biophysica Acta (BBA)-Biomembranes 1798.10 (2010): 1913-1925). 그러 다음, 합성한 펩타이드의 농도는 UV 분광광도계를 사용하여 정량하였고, 최종적인 펩타이드의 순도(>98%)는 역상 고성능 액체크로마토그래피(Reverse-phase HPLC)로 분석하였다.The designed peptide sequence was synthesized and purified by solid state synthesis using the synthesis of N- (9-fluorenyl) methoxycarbonyl (Fmoc) ( Biochimica et Biophysica Acta (BBA) -Biomembranes 1798.10 (2010): 1913-1925). The concentration of synthesized peptides was then quantitated using a UV spectrophotometer and the final peptide purity (> 98%) was analyzed by reverse-phase high performance liquid chromatography.

그 결과, 하기 [표 1]에서 나타난 바와 같이 서열번호 5 내지 10의 아미노산 서열로 구성된 항생 펩타이드를 합성하였다As a result, antibiotic peptides composed of the amino acid sequences of SEQ ID NOS: 5 to 10 were synthesized as shown in Table 1 below

본 발명에서 합성한 펩타이드의 서열 및 비교 펩타이드 서열The sequence of the peptides synthesized in the present invention and the comparative peptide sequence 펩타이드
명칭
Peptides
designation
아미노산 서열Amino acid sequence 서열번호SEQ ID NO: net
charge
net
charge
비고Remarks
PapMA-1Papa-1 RWK IFK KIP KFL HSA KKF-NH2RWK IFK KIP KFL HSA KKF-NH2 서열번호 1SEQ ID NO: 1 +8+8
합성
펩타이드

synthesis
Peptides
PapMA-2PapMA-2 RWK IFK KIP KFL HSA KKW-NH2RWK IFK KIP KFL HSA KK W -NH2 서열번호 2SEQ ID NO: 2 +8+8 PapMA-3PapMA-3 RWK IFK KIP KFL HSW KKF-NH2RWK IFK KIP KFL HS W KKF-NH2 서열번호 3SEQ ID NO: 3 +8+8 PapMA-4PapMA-4 RWK IFK KIP KFL HSW KKW-NH2RWK IFK KIP KFL HS W KK W -NH2 서열번호 4SEQ ID NO: 4 +8+8 PapMA-5Papa-5 RWK IFK KIP KFL HSF KKF-NH2RWK IFK KIP KFL HS F KKF-NH2 서열번호 5SEQ ID NO: 5 +8+8 PapMA-6PapMA-6 RWK IFK KIP KFL HSL KKF-NH2RWK IFK KIP KFL HS L KKF-NH2 서열번호 6SEQ ID NO: 6 +8+8 PapMA-7PapMA-7 RWK IFK KIP KLL HSF KKF-NH2RWK IFK KIP L K L F KKF HS-NH2 서열번호 7SEQ ID NO: 7 +8+8 PapMA-8Papa-8 RWK IFK KIP KLL HSL KKF-NH2RWK IFK KIP K L L L KKF HS-NH2 서열번호 8SEQ ID NO: 8 +8+8 PapMA-9PapMA-9 RWK IFK KIP KLL HSA KKW-NH2RWK IFK KIP K L L HSA KK W -NH2 서열번호 9SEQ ID NO: 9 +8+8 PapMA-10PapMA-10 RWK IFK KIP KLL HSL KKW-NH2RWK IFK KIP K L L HS L KK W -NH2 서열번호 10SEQ ID NO: 10 +8+8 파필리오신Papillie RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK-NH2RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK-NH2 서열번호 11SEQ ID NO: 11 +8+8 비교
펩타이드
compare
Peptides
마가이닌Maganin GIGKFLHSAKKFGKAFVGEIMNSGIGKFLHSAKKFGKAFVGEIMNS 서열번호 12SEQ ID NO: 12 +3+3 멜리틴Melitin GIGAVLKVLTTGLPALISWIKRKRQQGIGAVLKVLTTGLPALISWIKRKRQQQ 서열번호 13SEQ ID NO: 13 +5+5

항생 펩타이드의 항균 활성 확인Antibacterial activity of antibiotic peptides

<2-1> 그람 양성균 및 그람 음성균에 대한 항생 펩타이드의 항균 활성 확인<2-1> Confirmation of antimicrobial activity of antimicrobial peptides against Gram-positive and Gram-negative bacteria

본 발명의 항생 펩타이드가 나타내는 항균 활성을 비교하기 위하여, 그람 음성균 및 그람 양성균에 대해 항생 펩타이드 또는 기존의 항생제가 나타내는 항균 활성을 측정하였다. 상기 항균활성은 영양분이 충분한 MH배지에서 균체가 분열되지 않는 펩타이드의 최소성장 억제농도(Minimal inhibitory concentration: MIC)를 측정하였다.In order to compare the antimicrobial activities exhibited by the antibiotic peptides of the present invention, antimicrobial activities of antimicrobial peptides or conventional antibiotics against Gram-negative bacteria and Gram-positive bacteria were measured. The antimicrobial activity was measured by measuring the minimum inhibitory concentration (MIC) of the peptides in which the cells were not cleaved in a nutrient-rich MH medium.

구체적으로, 하기 [표 2]에 기재된 균주를 구입하여, 세균수가 ㎖ 당 2×106 colony-forming units(CFUs)가 되도록 MH 배지로 희석하고 100 ㎕씩 96-웰 마이크로 적정 플레이트(Microtiter plate)에 분주한 후, MH 배지로 희석한 펩타이드 용액(2:1 단계적으로 희석된 용액)을 각 웰에 100 ㎕씩 첨가하였다. 플레이트를 37에서 16 시간 동안 배양한 후 ELISA판독기(Bio-Tek Instruments)로 620 ㎚에서 각 웰의 흡광도를 측정하여 펩타이드의 MIC를 결정하였다. MIC값이 해당농도 이상으로 나올 경우에는 해당 농도로 MIC를 가정하여 이후 실험을 진행하였다.Specifically, the strains described in [Table 2] below were purchased, diluted with MH medium such that the number of bacteria was 2 × 10 6 colony-forming units (CFUs) per ml, and 100 μl was added to a 96-well microtiter plate , And a peptide solution (2: 1 step diluted solution) diluted with MH medium was added to each well in an amount of 100 占 퐇. Plates were incubated at 37 for 16 hours and the absorbance of each well was measured at 620 nm with an ELISA reader (Bio-Tek Instruments) to determine the MIC of the peptide. When the MIC value is higher than the corresponding concentration, the MIC is assumed to be the corresponding concentration, and the experiment is performed thereafter.

Figure 112017065730205-pat00001
Figure 112017065730205-pat00001

그 결과, 하기 [표 3]에 나타낸 바와 같이, 서열번호 5 내지 10의 펩타이드는 모든 그람 음성균에 대해 높은 항균활성을 가짐을 확인하였다. 특히 서열번호 7-10의 PapMA-7, PapMA-8, PapMA-9 및 PapMA-10 펩타이드는 PapMA-1에 비해 그람음성균 중 E. coli 에 대하여 나타나는 항균 활성의 수준이 2 배 이상 증가하여, PapMA-1보다 우수한 항균 활성을 나타내는 것을 확인하였다.
또한, 서열번호 9, 10의 PapMA-9 및 PapMA-10 펩타이드는 그람음성균 중 P. aeruginosa 에 대하여 PapMA-1, PapMA-2보다 2배 우수한 항균활성을 가지는 것을 확인하였다.
As a result, as shown in the following Table 3, it was confirmed that the peptides of SEQ ID NOS: 5 to 10 had a high antimicrobial activity against all Gram-negative bacteria. In particular, the level of antimicrobial activity of E. coli against Gram-negative bacteria was more than two times higher than that of PapMA-1 in Papa-7, PapMA-8, PapMA-9 and PapMA-10 peptides of SEQ ID NOS: -1. &Lt; / RTI &gt;
In addition, it was confirmed that the PapMA-9 and PapMA-10 peptides of SEQ ID NOS: 9 and 10 have an antimicrobial activity against P. aeruginosa that is 2 times better than PapMA-1 and PapMA-2 among Gram-negative bacteria.

특히, 그람음성균 중 A. baumannii 와 S. typhimurium 에 대하여, PapMA-6, PapMA-7, PapMA-8, PapMA-9 및 PapMA-10 펩타이드는 PapMA-1에 비해 2배-4배 우수한 항균활성을 가지는 것을 확인하였다. In particular, against A. baumannii and S. typhimurium , the antimicrobial activity of PapMA-6, PapMA-7, PapMA-8, PapMA-9 and PapMA-10 peptides was 2 to 4 times better than PapMA-1 .

이를 종합하여 보았을 때, PapMA-7 및 PapMA-8 펩타이드의 경우, 대부분의 그람음성균에 대한 항균 활성이 이전에 개발된 PapMA-1, PapMA-2, PapMA-3 및 PapMA-4보다 같거나 더 높은 항균활성을 가지는 것을 확인하였다. 또한, PapMA-6, PapMA-7 및 PapMA-8 펩타이드는 그람음성균 중에서도 P. aeruginosa, S. typhimurium에 대해서 유의적으로 증가된 수준의 항균 활성을 나타내어, 이는 그람음성균 에 대한 항균활성이 높다고 알려진 비교 펩타이드인 파필리오신이나 멜리틴과 유사한 수준의 항균활성을 보였다. 이들 펩타이드 및 비교 대조군으로 사용한 항생 펩타이드 파필리오신은 그람음성균에 대하여 항균활성을 나타내는 것으로 공지된 펩타이드인 바, 모든 그람음성균에 선택적으로 매우 높은 항균활성을 가짐을 확인하였고, 그람양성균에는 매우 낮은 항균 활성을 가짐을 확인하였다(표 3).In summary, the antimicrobial activity against most Gram-negative bacteria in the case of PapMA-7 and PapMA-8 peptides is equal to or higher than that of the previously developed PapMA-1, PapMA-2, PapMA-3 and PapMA-4 It was confirmed that it had antibacterial activity. In addition, PapMA-6, PapMA-7, and PapMA-8 peptides showed significantly increased antimicrobial activity against P. aeruginosa and S. typhimurium among Gram-negative bacteria. This indicates that the antimicrobial activity against Gram- Showed similar antimicrobial activity to that of the peptides papilio sinus and melittin. These peptides and the antibiotic peptide papyriosin used as a comparative control group are known peptides that exhibit antimicrobial activity against Gram-negative bacteria. As a known peptide, it has been confirmed that they have a very high antimicrobial activity selectively for all Gram-negative bacteria, and Gram- (Table 3).

그람 음성균, 그람 양성균 및 항생제 내성균에 대한 항생 펩타이드의 항균 활성Antimicrobial activity of antimicrobial peptides against Gram-negative bacteria, Gram-positive bacteria and antibiotic resistant bacteria 대상 균주Target strain 최소생장억제농도 MIC (㎍/㎖)Minimum growth inhibitory concentration MIC (占 퐂 / ml) 서열번호1:
PapMA-1
SEQ ID NO: 1:
Papa-1
서열번호2:
PapMA-2
SEQ ID NO: 2:
PapMA-2
서열번호3:
PapMA-3
SEQ ID NO: 3:
PapMA-3
서열번호4:
PapMA-4
SEQ ID NO: 4:
PapMA-4
서열번호5:
PapMA-5
SEQ ID NO: 5:
Papa-5
서열번호6:
PapMA-6
SEQ ID NO: 6:
PapMA-6
서열번호7:
PapMA-7
SEQ ID NO: 7:
PapMA-7
서열번호8:
PapMA-8
SEQ ID NO: 8:
Papa-8
서열번호9:
PapMA-9
SEQ ID NO: 9:
PapMA-9
서열번호10:
PapMA-10
SEQ ID NO: 10:
PapMA-10
비교펩타이드
서열번호11:
Papiliocin
Comparative peptide
SEQ ID NO: 11:
Papiliocin
비교펩타이드
서열번호13:
Melittin
Comparative peptide
SEQ ID NO: 13:
Melittin
E. coliE. coli 6464 6464 3232 1616 6464 6464 3232 3232 3232 3232 88 1616 MDREC 1229MDREC 1229 6464 6464 3232 3232 6464 6464 6464 6464 6464 6464 88 1616 MDREC 1238MDREC 1238 6464 6464 6464 3232 6464 6464 6464 6464 6464 6464 1616 3232 P. aeruginosaP. aeruginosa 1616 1616 1616 1616 1616 1616 1616 1616 88 88 1616 88 MDRPA 2002MDRPA 2002 1616 1616 1616 1616 1616 3232 1616 1616 1616 88 1616 1616 MDRPA 2003MDRPA 2003 3232 1616 1616 1616 1616 3232 1616 1616 1616 1616 1616 1616 A. baumanniiA. baumannii 6464 1616 1616 1616 6464 3232 1616 3232 3232 1616 88 88 MDRAB 12035MDRAB 12035 6464 1616 1616 1616 6464 6464 3232 6464 6464 3232 88 88 MDRAB 12036MDRAB 12036 6464 1616 1616 1616 6464 6464 3232 6464 6464 3232 1616 1616 S. typhimuriumS. typhimurium 6464 3232 3232 3232 6464 1616 1616 3232 3232 1616 1616 3232 MDRST 8007MDRST 8007 6464 3232 3232 3232 6464 3232 3232 6464 6464 3232 1616 3232 MDRST 8009MDRST 8009 6464 6464 6464 3232 6464 6464 3232 6464 6464 3232 1616 3232 B. subtilisB. subtilis >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 3232 S. epidermidisS. epidermidis >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 1616 S. aureusS. aureus >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 88 MRSA 3114MRSA 3114 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 88 MRSA 3126MRSA 3126 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 >128> 128 1616

<2-2> 그람 양성균 및 그람 음성균에 대한 기존 항생제의 항균 활성 확인<2-2> Identification of antimicrobial activity of existing antibiotics against Gram-positive and Gram-negative bacteria

본 발명의 항생 펩타이드의 항균 활성을 기존 항생제와 비교하기 위해서, 동일한 그람 양성균 및 그람 음성균 균주에 대하여 항생제이 나타내는 MIC 농도를 확인하였다.In order to compare the antimicrobial activity of the antibiotic peptides of the present invention with those of the existing antibiotics, the MIC concentrations exhibited by the antibiotics against the same Gram-positive bacteria and Gram-negative bacteria were confirmed.

구체적으로, 상기 실시예 <2-1>과 동일한 방법으로 대상 균주를 준비하고, 항생제인 에리트로마이신(Erythromycin), 반코마이신(Vancomycin) 또는 리네졸리드(Linezolid)를 각각 처리하여 항생제의 MIC를 확인하였다.Specifically, the target strain was prepared in the same manner as in Example <2-1>, and the MIC of the antibiotic was confirmed by treating the antibiotic Erythromycin, Vancomycin, or Linezolid, respectively .

그 결과, 하기 [표 4]에서 나타난 바와 같이 항생제는 알려진 바와 같이 그람 음성균에 대해 32 ㎍/㎖ 이상의 MIC를 보여 낮은 항균활성을 가지는 반면, 그람 양성균에 대해서는 모든 항생제가 매우 높은 항균활성을 나타냄을 확인하였다(표 4).As a result, as shown in Table 4 below, antibiotics have a low antimicrobial activity with a MIC of 32 μg / ml or more for Gram-negative bacteria, while all antibiotics have a very high antimicrobial activity against Gram-positive bacteria (Table 4).

기존 항생제의 그람음성균, 그람양성균 및 항생제내성균에서의 항균 활성Antimicrobial activity of existing antibiotics in Gram-negative bacteria, Gram-positive bacteria and antibiotic-resistant bacteria 구분division 대상 균주Target strain 최소생장억제농도 MIC (㎍/㎖)Minimum growth inhibitory concentration MIC (占 퐂 / ml) ErythromycinErythromycin VancomycinVancomycin LinezolidLinezolid
그람음성균


Gram-negative bacteria

E. coliE. coli 128128 10241024 256256
P. aeruginosaP. aeruginosa 256256 >1024> 1024 >1024> 1024 A. baumanniiA. baumannii 3232 10241024 256256 S. typhimuriumS. typhimurium 6464 512512 256256
그람양성균

Gram-positive bacteria
B. subtilisB. subtilis 0.250.25 1One 1One
S. epidermidisS. epidermidis 1One 1One 1One S. aureusS. aureus 0.250.25 1One 1One 항생제내성균
Antibiotic resistant bacteria
MDREC 1229MDREC 1229 256256 >1024> 1024 512512
MDRAB 12035MDRAB 12035 3232 >1024> 1024 512512

항생 펩타이드 및 항생제 병용처리시 시너지 효과의 확인Identification of synergistic effects in combination with antibiotic peptide and antibiotics

<3-1> 항생 펩타이드 및 항생제 병용 처리시 항생제 또는 항생 펩타이드에 따른 MIC 변화 확인<3-1> Antimicrobial or antimicrobial peptide-dependent MIC changes in combination with antibiotic peptide and antibiotics

본 발명의 항생 펩타이드는 그람 음성균에 대하여 높은 항균 활성을 나타내는 것을 확인하여, 그람양성균에만 강한 항균활성을 내고 그람음성균에는 유의적인 항균활성을 가지지 않는 항생제를 본 발명의 합성 펩타이드와 병용 처리하였을 때 유의적인 시너지 활성을 나타내는지 확인하였다.The antibiotic peptide of the present invention has high antimicrobial activity against Gram-negative bacteria. Therefore, when antibiotics having a strong antibacterial activity only against Gram-positive bacteria and having no significant antibacterial activity against Gram-negative bacteria are treated with the synthetic peptide of the present invention Gt; synergistic activity &lt; / RTI &gt;

구체적으로, 상기 [표 2]에 기재된 각각의 균주를 준비하여 세균수가 ml 당 2×106 colony-forming units (CFUs)가 되도록 MH배지로 희석하고 100 ㎕씩 96-웰 마이크로적정 플레이트(Microtiter plate)에 분주한 후, MH 배지로 MIC 값부터 희석한 펩타이드 용액 (2:1 단계적으로 희석된 용액)을 각 웰에 50 ㎕씩 첨가하였다. 그 후 항생제 용액을 MH 배지에 희석하여 각 웰에 50 ㎕씩 첨가하고 상반된 조건으로도 동일하게 실시하여 각 혼합액의 MIC 값을 결정하였다.Specifically, each of the strains described in Table 2 was prepared, diluted with MH medium such that the number of bacteria was 2 × 10 6 colony-forming units (CFUs) per ml, and 100 μl was added to a 96-well microtiter plate ), And then 50 [mu] l of a peptide solution (2: 1 step diluted solution) diluted from the MIC value with MH medium was added to each well. Then, the antibiotic solution was diluted in the MH medium, and 50 μl was added to each well. The MIC value of each mixed solution was determined in the same manner under the opposite conditions.

그 결과, 하기 [표 5] 내지 [표 9]에서 나타낸 바와 같이, 기존의 항생제인 에리트로마이신, 반코마이신 또는 리네졸리드를 본 발명의 항생 펩타이드인 PapMA-5, PapMA-6, PapMA-7, PapMA-8, PapMA-9 또는 PapMA-10과 함께 투여한 항균 활성의 시너지 효과를 확인한 결과, 본 발명의 펩타이드를 1/2 MIC가로 처리하였을 때 대장균과 이의 내성균 및 A.baumannii와 이의 내성균에 대해 에리트로마이신의 MIC가 1024 배까지 낮아지는 것을 확인하였다(표 5 내지 표 8).As a result, as shown in the following Tables 5 to 9, existing antibiotics erythromycin, vancomycin or linazolidine were used as the antibiotic peptides PapMA-5, PapMA-6, PapMA-7, PapMA -8, PapMA-9, or PapMA-10. As a result, it was found that when the peptide of the present invention was treated with 1/2 MIC, the E. coli and its resistant bacteria, and A. baumannii and its resistant bacteria, It was confirmed that the MIC of the mycin decreased to 1024 times (Tables 5 to 8).

구체적으로, 본 발명의 유도체 펩타이드의 모체 펩타이드인 PapMA-1 및 PapMA-2의 경우, 대장균에 대한 MIC 농도는 64 ㎍/㎖이었다. 항생 펩타이드와 기존 항생제와의 병용 처리시 시너지 효과를 확인하기 위하여, PapMA-1 또는 PapMA-2의 MIC의 1/4 농도인 16 ㎍/㎖로 PapMA-1 또는 PapMA-2 펩타이드를 각각 항생제와 혼합하여 대장균에 처리하였을 때, PapMA-1 또는 PapMA-2를 에리트로마이신와 혼합한 경우에서 에리트로마이신의 MIC 값이 각각 0.5 및 0.25㎍/㎖(항생제 MIC의 1/256, 1/512)로 감소하였고, 리네졸리드와 혼합한 경우에서 MIC 값이 각각 16 및 8 ㎍/㎖(각각 항생제 MIC의 1/16, 1/32)로 감소하여, PapMA-1 및 PapMA-2 펩타이드는 항생제와 유의적인 시너지 효과를 나타내는 것을 확인하였다.Specifically, in the case of PapMA-1 and PapMA-2 which are the parent peptide of the derivative peptide of the present invention, the MIC concentration for E. coli was 64 占 퐂 / ml. In order to confirm the synergistic effect of antibiotic peptide and conventional antibiotics, PapMA-1 or PapMA-2 peptide was mixed with antibiotics at a concentration of 16 μg / ml, which is 1/4 concentration of MIC of PapMA-1 or PapMA- , The MIC values of erythromycin were reduced to 0.5 and 0.25 μg / ml (1/256 and 1/512 of the antibiotic MIC, respectively) when PapMA-1 or PapMA-2 was mixed with erythromycin, MIC values were reduced to 16 and 8 ㎍ / ㎖ (1/16 and 1/32 of antibiotic MIC, respectively) when mixed with linazolidine, and the PapMA-1 and PapMA-2 peptides showed significant synergy with antibiotics .

이와 동일한 방법으로 본 발명의 유도체 펩타이드를 기존 항생제와 병용 처리하여 시너지효과를 나타내는지 확인하였다. PapMA-7은 대장균에 대하여 32 ㎍/㎖의 MIC를 나타내었고, 이의 1/2 농도인 16 ㎍/㎖으로 PapMA-7을 에리트로마이신 또는 리네졸리드와 혼합하여 처리한 경우에서, 에리트로마이신 및 리네졸리드의 MIC 값은 각각 0.125 및 1 ㎍/㎖을 가져, 각각 항생제를 단독으로 처리하는 경우의 MIC 값보다 1/512 및 1/256 수준으로 감소하는 것을 확인하였다(표 5). 이를 통하여, PapMA-7 펩타이드와 혼합 처리하는 경우에서 에리트로마이신 및 리네졸리드의 MIC 값이 PapMA-1 펩타이드와 혼합 처리하는 경우보다 더욱 감소된 수준을 나타내는 것을 알 수 있으므로, 본 PapMA-7 펩타이드가 PapMA-1 펩타이드보다 기존 항생제와의 시너지 효과를 높은 수준으로 나타내는 것을 확인하였다.In the same manner, the derivative peptide of the present invention was used in combination with a conventional antibiotic to confirm synergistic effects. When PapMA-7 was treated with erythromycin or linzolide in combination with PapM-7 at a concentration of 16 쨉 g / ml, which was a half concentration of MIC of 32 / / ml against E. coli, The MIC values of Jolide were 0.125 and 1 ㎍ / ㎖, respectively, and were found to be reduced to 1/512 and 1/256, respectively, compared with the MIC values of antibiotics alone (Table 5). As a result, it can be seen that the MIC value of erythromycin and linazolidide in the case of mixing with PapMA-7 peptide shows a further reduced level than that in case of mixing with PapMA-1 peptide. Therefore, this PapMA-7 peptide It was confirmed that the synergy effect with the existing antibiotic was higher than that of the PapMA-1 peptide.

또한, 하기 [표 7]에서 나타난 바와 같이, A. baumannii에 대해서도 PapMA-7이 증가된 수준의 시너지 효과를 나타내는 것을 확인하였다. A. baumannii에 대하여 PapMA-1은 64 ㎍/㎖의 MIC를 나타내므로, 이의 1/8 농도인 8 ㎍/㎖의 PapMA-1를 에리트로마이신과 병용투여하였을 때, 에리트로마이신은 0.5 ㎍/㎖의 MIC를 가져 에리트로마이신을 단독 처리한 경우보다 MIC가 1/64의 수준을 나타내는 것을 확인하였고 리네졸리드와 병용투여하였을때는 리네졸리드를 단독투여하였을때보다 MIC가 1/32의 수준을 나타내는 것을 확인하였다 . 또한 A. baumannii에 대하여 PapMA-2는 16 ㎍/㎖의 MIC를 나타내므로, 이의 1/2농도인 8 ㎍/㎖의 PapMA-2를 에리트로마이신과 병용투여하였을 때, 에리트로마이신은 0.125 ㎍/㎖의 MIC를 가져 에리트로마이신을 단독 처리한 경우보다 MIC가 1/256의 수준을 나타내는 것을 확인하였고 리네졸리드와 병용투여하였을때는 리네졸리드를 단독투여하였을때보다 MIC가 8로 1/32의 수준을 나타내는 것을 확인하였다. 이와 비교하였을 때, PapMA-7을 PapMA-1, 2와 동일한 농도인 8 ㎍/㎖로 처리하여 에리트로마이신과 혼합 처리하였을 때, 에리트로마이신의 MIC 값이 0.125 ㎍/㎖로 감소하여, 단독 투여시의 MIC 보다 1/256 수준으로 감소하는 것을 확인하였다. 또한 리네졸리드를 투여하였을때는 리네졸리드의 MIC값이 1로 1/256의 수준을 나타냈다. 에리트로마이신과 동일한 양상으로, 반코마이신에 대해서도 8㎍/㎖의 PapMA-7 펩타이드를 가했을 때, 이와 혼합 처리한 반코마이신의 MIC가 2㎍/㎖(1/512), 로 감소하였다. 즉, 이를 통하여 PapMA-7 펩타이드의 경우 주형 펩타이드인 PapMA-1 또는 PapMA-2와 동일한 농도를 처리하였을 때, 기존 항생제와의 혼합 처리에 의한 시너지 효과가 유의적으로 증가하는 것을 확인하였다. PapMA-7 펩타이드는 PapMA-1~10까지의 펩타이드 중 가장 우수한 항균활성을 나타내는 것으로 확인하였다.In addition, as shown in the following Table 7, it was confirmed that PapMA-7 also exhibited an increased level of synergy against A. baumannii . Papam-1 exhibited an MIC of 64 μg / ml against A. baumannii . Therefore, when 8 μg / ml of PapMA-1, which is a 1/8 concentration thereof, was administered in combination with erythromycin, erythromycin was administered at a dose of 0.5 μg / MIC was found to be 1/64 of that of erythromycin alone, and when combined with linzolide, MIC was found to be 1/32 of that of single administration of linozolide Respectively. Papama-2 exhibited a MIC of 16 μg / ml against A. baumannii . Therefore, when combined with erythromycin at a concentration of 8 μg / ml of PapMA-2 at a half concentration thereof, erythromycin produced 0.125 μg / ml Of MIC was found to be 1/256 of that of erythromycin alone. When combined with linzolide, the MIC was 8/1, which was lower than that of single administration of linzolide . Compared with this, the MIC value of erythromycin decreased to 0.125 ㎍ / ㎖ when mixed with erythromycin at a concentration of 8 ㎍ / ㎖, which was the same as that of PapMA-1, 2, Of the MIC was reduced to 1/256 level. In addition, when linzolide was administered, the MIC value of the linezolid was 1, indicating a level of 1/256. In the same manner as for erythromycin, when 8 mg / ml of PapMA-7 peptide was added to vancomycin, the MIC of vancomycin mixed with the vancomycin was reduced to 2 μg / ml (1/512). In other words, it was confirmed that when the same concentration of PapMA-7 peptide as the template peptide, PapMA-1 or PapMA-2, was treated, the synergy effect by the mixing treatment with the existing antibiotic was significantly increased. It was confirmed that PapMA-7 peptide exhibited the best antimicrobial activity among the peptides of PapMA-1 to 10.

또한 다제내성 대장균 MDREC1229에 대해서도 에리트로마이신, 반코마이신과 리네졸리드에 대해서도 8 ㎍/㎖의 PapMA-7 펩타이드를 가했을 때, 이와 혼합 처리한 에리트로마이신, 반코마이신 및 리네졸리드의 MIC가 각각 1 ㎍/㎖(1/256), 8 ㎍/㎖(<1/128), 4 ㎍/㎖ (1/128)로 감소하므로, PapMA-7 펩타이드는 PapMA-1~10까지의 펩타이드 중 가장 우수한 항균활성을 나타내는 것으로 확인하였다(표 6). 또한 다제내성 아세네토박터균 MDRAB 12035에 대해서도 에리트로마이신, 반코마이신과 리네졸리드에 대해서도 8 ㎍/㎖의 PapMA-7 펩타이드를 가했을 때, 이와 혼합 처리한 에리트로마이신, 반코마이신 및 리네졸리드의 MIC가 각각 0.125 ㎍/㎖(1/256), 2 ㎍/㎖ (>1/512), 2 ㎍/㎖ (1/256)로 감소하므로, PapMA-7 펩타이드는 PapMA-1~10까지의 펩타이드 중 가장 우수한 항균활성을 나타내는 것으로 확인하였다(표 8).In addition, when 8 μg / ml of PapMA-7 peptide was added to erythromycin, vancomycin, and linzolide for multidrug-resistant Escherichia coli MDREC1229, the MIC of erythromycin, vancomycin, and linzolide treated with the combination of 1 μg / (1/256), 8 μg / ml (<1/128) and 4 μg / ml (1/128), the PapMA-7 peptide exhibits the best antimicrobial activity among the peptides (Table 6). In addition, when 8 μg / ml of PapMA-7 peptide was added to erythromycin, vancomycin, and linzolide for the multidrug-resistant acnesetobacter MDRAB 12035, the MICs of the erythromycin, vancomycin and linazolides mixed therewith were , The PapMA-7 peptide was found to be the most superior among the peptides of PapMA-1 to 10, since it was reduced to 0.125 μg / ml (1/256), 2 μg / ml (> 1/512), and 2 μg / Indicating antibacterial activity (Table 8).

이와 동일한 방법으로 비교하였을 때, 본 발명의 PapMA-5, PapMA-6, PapMA-7, PapMA-8, PapMA-9 및 PapMA-10 펩타이드는 기존 항생제와의 혼합 처리에서 시너지 효과를 나타낼 수 있음을 확인하였고, 이 중 PapMA-6, PapMA-7 및 PapMA-9 펩타이드는 PapMA-1 또는 PapMA-2와 동일한 펩타이드 농도 기존 항생제와 혼합하여 대상 균주에 각각 가했을 때, PapMA-1 또는 PapMA-2에 비해 혼합한 항생제의 MIC 값이 같거나, 2 내지 4 배 낮아짐을 확인하여, PapMA-1 및 PapMA-2보다 상승된 시너지 항균활성을 나타내는 것으로 확인하였다.Compared with the same method, the present Papama-5, PapMA-6, PapMA-7, PapMA-8, PapMA-9 and PapMA-10 peptides can exhibit a synergistic effect in mixing with existing antibiotics PapMA-6, PapMA-7 and PapMA-9 peptides showed the same peptide concentrations as PapMA-1 or PapMA-2. Compared to PapMA-1 or PapMA-2, The MIC values of the mixed antibiotics were confirmed to be the same or 2 to 4 times lower than those of the Papama-1 and PapMA-2.

본 발명의 항생 펩타이드 처리 시, 대장균에 대한 항생제의 항균 활성In the antibiotic peptide treatment of the present invention, the antimicrobial activity of the antibiotic against Escherichia coli E. coliE. coli 펩타이드 처리 농도
(㎍/㎖)
Peptide treatment concentration
(占 퐂 / ml)
항생제 MIC(㎍/㎖)Antibiotic MIC (占 퐂 / ml)
ErythromycinErythromycin VancomycinVancomycin LinezolidLinezolid Compound
Alone
Compound
Alone
128128 10241024 256256
PapMA-1
concentration
(Concentration/MIC)




Papa-1
concentration
(Concentration / MIC)




64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.1250.125 44 88 16(1/4)16 (1/4) 0.50.5 1616 1616 8 (1/8)8 (1/8) 22 3232 1616 6 (1/11)6 (1/11) 44 3232 1616 4 (1/16)4 (1/16) 1616 >128> 128 6464 2 (1/32)2 (1/32) 3232 >128> 128 128128 1 (1/64)1 (1/64) 6464 >128> 128 128128 PapMA-2
concentration
(Concentration/MIC)




PapMA-2
concentration
(Concentration / MIC)




64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.1250.125 44 44 16 (1/4)16 (1/4) 0.250.25 88 88 8 (1/8)8 (1/8) 0.50.5 3232 88 6 (1/11)6 (1/11) 22 6464 1616 4 (1/16)4 (1/16) 1616 >128> 128 1616 2 (1/32)2 (1/32) 3232 >128> 128 6464 1 (1/64)1 (1/64) 6464 >128> 128 128128 PapMA-3
concentration
(Concentration/MIC)




PapMA-3
concentration
(Concentration / MIC)




64 (2)64 (2) 00 00 00
32 (1)32 (1) 00 00 00 16 (1/2)16 (1/2) 0.1250.125 88 22 8 (1/4)8 (1/4) 1One 3232 1616 6 (1/5)6 (1/5) 44 128128 3232 4 (1/8)4 (1/8) 1616 >128> 128 3232 2 (1/16)2 (1/16) 3232 >128> 128 6464 1 (1/32)1 (1/32) 6464 >128> 128 128128 PapMA-4
concentration
(Concentration/MIC)




PapMA-4
concentration
(Concentration / MIC)




64 (4)64 (4) 00 00 00
32 (2)32 (2) 00 00 00 16 (1)16 (1) 00 00 00 8 (1/2)8 (1/2) 88 3232 1616 6 (1/3)6 (1/3) 88 128128 3232 4 (1/4)4 (1/4) 1616 >128> 128 3232 2 (1/8)2 (1/8) 3232 >128> 128 6464 1 (1/16)1 (1/16) 6464 >128> 128 128128 PapMA-5
concentration
(Concentration/MIC)




Papa-5
concentration
(Concentration / MIC)




64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.50.5 22 22 16(1/4)16 (1/4) 0.50.5 88 88 8 (1/8)8 (1/8) 22 3232 1616 6 (1/11)6 (1/11) 88 6464 3232 4 (1/16)4 (1/16) 3232 128128 6464 2 (1/32)2 (1/32) 6464 >128> 128 128128 1 (1/64)1 (1/64) 128128 >128> 128 >128> 128 PapMA-6
concentration
(Concentration/MIC)




PapMA-6
concentration
(Concentration / MIC)




64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.1250.125 1One 22 16(1/4)16 (1/4) 0.250.25 22 22 8 (1/8)8 (1/8) 0.50.5 88 88 6 (1/11)6 (1/11) 44 1616 88 4 (1/16)4 (1/16) 88 3232 3232 2 (1/32)2 (1/32) 6464 >128> 128 >128> 128 1 (1/64)1 (1/64) 6464 >128> 128 >128> 128 PapMA-7
concentration
(Concentration/MIC)
PapMA-7
concentration
(Concentration / MIC)
64 (2)64 (2) 00 00 00
32 (1)32 (1) 00 00 00 16 (1/2)16 (1/2) 0.1250.125 1One 1One 8 (1/4)8 (1/4) 0.250.25 44 44 6 (1/5)6 (1/5) 22 88 44 4 (1/8)4 (1/8) 44 3232 88 2 (1/16)2 (1/16) 3232 128128 128128 1 (1/32)1 (1/32) 6464 >128> 128 >128> 128 PapMA-8
concentration
(Concentration/MIC)
Papa-8
concentration
(Concentration / MIC)
64 (2)64 (2) 00 00 00
32 (1)32 (1) 00 00 00 16 (1/2)16 (1/2) 0.250.25 22 22 8 (1/4)8 (1/4) 0.50.5 1616 88 6 (1/5)6 (1/5) 44 3232 3232 4 (1/8)4 (1/8) 88 6464 128128 2 (1/16)2 (1/16) 6464 >128> 128 >128> 128 1 (1/32)1 (1/32) 128128 >128> 128 >128> 128 PapMA-9
concentration
(Concentration/MIC)
PapMA-9
concentration
(Concentration / MIC)
64 (2)64 (2) 00 00 00
32 (1)32 (1) 00 00 00 16 (1/2)16 (1/2) 0.1250.125 22 22 8 (1/4)8 (1/4) 0.50.5 88 44 6 (1/5)6 (1/5) 22 1616 88 4 (1/8)4 (1/8) 88 6464 1616 2 (1/16)2 (1/16) 6464 >128> 128 >128> 128 1 (1/32)1 (1/32) 128128 >128> 128 >128> 128 PapMA-10
concentration
(Concentration/MIC)
PapMA-10
concentration
(Concentration / MIC)
64 (2)64 (2) 00 00 00
32 (1)32 (1) 00 00 00 16 (1/2)16 (1/2) 0.250.25 22 44 8 (1/4)8 (1/4) 0.50.5 1616 88 6 (1/5)6 (1/5) 88 3232 6464 4 (1/8)4 (1/8) 3232 6464 128128 2 (1/16)2 (1/16) 6464 >128> 128 >128> 128 1 (1/32)1 (1/32) 128128 >128> 128 >128> 128

본 발명의 항생 펩타이드 처리 시, MDREC 1229에 대한 항생제의 항균 활성The antimicrobial activity of antibiotics against MDREC 1229 in the antibiotic peptide treatment of the present invention MDREC 1229MDREC 1229 펩타이드 처리 농도
(㎍/㎖)
Peptide treatment concentration
(占 퐂 / ml)
항생제 MIC(㎍/㎖)Antibiotic MIC (占 퐂 / ml)
ErythromycinErythromycin VancomycinVancomycin LinezolidLinezolid Compound AloneCompound Alone 256256 >1024> 1024 512512


PapMA-1
concentration
(Concentration/MIC)




Papa-1
concentration
(Concentration / MIC)

64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.250.25 88 88 16(1/4)16 (1/4) 1One 1616 1616 8 (1/8)8 (1/8) 44 128128 3232 6 (1/11)6 (1/11) 88 >128> 128 6464 4 (1/16)4 (1/16) 1616 >128> 128 6464 2 (1/32)2 (1/32) 3232 >128> 128 128128 1 (1/64)1 (1/64) 128128 >128> 128 >128> 128


PapMA-2
concentration
(Concentration/MIC)




PapMA-2
concentration
(Concentration / MIC)

64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.1250.125 88 44 16 (1/4)16 (1/4) 0.50.5 1616 88 8 (1/8)8 (1/8) 22 6464 1616 6 (1/11)6 (1/11) 88 128128 3232 4 (1/16)4 (1/16) 1616 128128 3232 2 (1/32)2 (1/32) 3232 >128> 128 6464 1 (1/64)1 (1/64) 6464 >128> 128 >128> 128


PapMA-3
concentration
(Concentration/MIC)




PapMA-3
concentration
(Concentration / MIC)

64 (2)64 (2) 00 00 00
32 (1)32 (1) 00 00 00 16 (1/2)16 (1/2) 0.250.25 1616 44 8 (1/4)8 (1/4) 44 128128 1616 6 (1/5)6 (1/5) 1616 >128> 128 3232 4 (1/8)4 (1/8) 3232 >128> 128 6464 2 (1/16)2 (1/16) 3232 >128> 128 6464 1 (1/32)1 (1/32) 128128 >128> 128 >128> 128


PapMA-4
concentration
(Concentration/MIC)




PapMA-4
concentration
(Concentration / MIC)

64 (2)64 (2) 00 00 00
31 (1)31 (1) 00 00 00 16 (1/2)16 (1/2) 0.250.25 3232 44 8 (1/24)8 (1/24) 44 128128 1616 6 (1/5)6 (1/5) 1616 >128> 128 6464 4 (1/8)4 (1/8) 1616 >128> 128 6464 2 (1/16)2 (1/16) 3232 >128> 128 6464 1 (1/32)1 (1/32) 6464 >128> 128 >128> 128


PapMA-5
concentration
(Concentration/MIC)




Papa-5
concentration
(Concentration / MIC)

64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.250.25 88 44 16 (1/4)16 (1/4) 1One 1616 1616 8 (1/8)8 (1/8) 44 6464 3232 6 (1/11)6 (1/11) 88 >128> 128 3232 4 (1/16)4 (1/16) 1616 >128> 128 6464 2 (1/32)2 (1/32) 6464 >128> 128 128128 1 (1/64)1 (1/64) 128128 >128> 128 128128


PapMA-6
concentration
(Concentration/MIC)\




PapMA-6
concentration
(Concentration / MIC) \

64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.1250.125 22 1One 16 (1/4)16 (1/4) 0.250.25 44 44 8 (1/8)8 (1/8) 1One 1616 88 6 (1/11)6 (1/11) 22 6464 88 4 (1/16)4 (1/16) 88 >128> 128 3232 2 (1/32)2 (1/32) 3232 >128> 128 6464 1 (1/64)1 (1/64) 6464 >128> 128 128128 PapMA-7
concentration
(Concentration/MIC)
PapMA-7
concentration
(Concentration / MIC)
64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.06250.0625 1One 1One 16 (1/4)16 (1/4) 0.1250.125 22 22 8 (1/8)8 (1/8) 1One 88 44 6 (1/11)6 (1/11) 22 1616 88 4 (1/16)4 (1/16) 44 128128 1616 2 (1/32)2 (1/32) 1616 >128> 128 3232 1 (1/64)1 (1/64) 6464 >128> 128 128128 PapMA-8
concentration
(Concentration/MIC)
Papa-8
concentration
(Concentration / MIC)
64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.1250.125 88 88 16 (1/4)16 (1/4) 0.50.5 1616 1616 8 (1/8)8 (1/8) 1One 3232 3232 6 (1/11)6 (1/11) 44 >128> 128 3232 4 (1/16)4 (1/16) 88 >128> 128 128128 2 (1/32)2 (1/32) 6464 >128> 128 >128> 128 1 (1/64)1 (1/64) >128> 128 >128> 128 >128> 128 PapMA-9
concentration
(Concentration/MIC)
PapMA-9
concentration
(Concentration / MIC)
64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.1250.125 22 22 16 (1/4)16 (1/4) 0.50.5 44 44 8 (1/8)8 (1/8) 1One 88 88 6 (1/11)6 (1/11) 22 3232 1616 4 (1/16)4 (1/16) 88 128128 3232 2 (1/32)2 (1/32) 6464 >128> 128 6464 1 (1/64)1 (1/64) 6464 >128> 128 128128 PapMA-10
concentration
(Concentration/MIC)
PapMA-10
concentration
(Concentration / MIC)
64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.250.25 1616 88 16 (1/4)16 (1/4) 1One 3232 1616 8 (1/8)8 (1/8) 22 128128 6464 6 (1/11)6 (1/11) 88 >128> 128 6464 4 (1/16)4 (1/16) 1616 >128> 128 128128 2 (1/32)2 (1/32) 6464 >128> 128 >128> 128 1 (1/64)1 (1/64) >128> 128 >128> 128 >128> 128

본 발명의 항생 펩타이드 처리 시, A. baumannii에 대한 항생제의 항균 활성Antimicrobial activity of antibiotics against A. baumannii in the treatment of antibiotic peptides of the present invention A. baumanniiA. baumannii 펩타이드 처리 농도
(㎍/㎖)
Peptide treatment concentration
(占 퐂 / ml)
항생제 MIC(㎍/㎖)Antibiotic MIC (占 퐂 / ml)
ErythromycinErythromycin VancomycinVancomycin LinezolidLinezolid Compound
Alone
Compound
Alone
3232 10241024 256256
PapMA-1
concentration
(Concentration/MIC)




Papa-1
concentration
(Concentration / MIC)




64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.06250.0625 22 44 16(1/4)16 (1/4) 0.1250.125 88 44 8 (1/8)8 (1/8) 0.50.5 88 88 6 (1/11)6 (1/11) 22 1616 3232 4 (1/16)4 (1/16) 88 3232 3232 2 (1/32)2 (1/32) 1616 128128 128128 1 (1/64)1 (1/64) 3232 >128> 128 >128> 128 PapMA-2
concentration
(Concentration/MIC)




PapMA-2
concentration
(Concentration / MIC)




64 (4)64 (4) 00 00 00
32 (2)32 (2) 00 00 00 16 (1)16 (1) 00 00 00 8 (1/2)8 (1/2) 0.1250.125 88 88 6 (1/3)6 (1/3) 1One 1616 1616 4 (1/4)4 (1/4) 88 3232 3232 2 (1/8)2 (1/8) 1616 128128 6464 1 (1/16)1 (1/16) 1616 >128> 128 >128> 128 PapMA-3
concentration
(Concentration/MIC)




PapMA-3
concentration
(Concentration / MIC)




64 (4)64 (4) 00 00 00
32 (2)32 (2) 00 00 00 16 (1)16 (1) 00 00 00 8 (1/2)8 (1/2) 0.1250.125 3232 88 6 (1/3)6 (1/3) 1One 3232 1616 4 (1/4)4 (1/4) 88 6464 3232 2 (1/8)2 (1/8) 1616 128128 6464 1 (1/16)1 (1/16) 3232 >128> 128 >128> 128 PapMA-4
concentration
(Concentration/MIC)




PapMA-4
concentration
(Concentration / MIC)




64 (4)64 (4) 00 00 00
32 (2)32 (2) 00 00 00 16 (1)16 (1) 00 00 00 8 (1/2)8 (1/2) 44 3232 1616 6 (1/3)6 (1/3) 44 6464 3232 4 (1/4)4 (1/4) 88 6464 6464 2 (1/8)2 (1/8) 1616 128128 6464 1 (1/16)1 (1/16) 3232 >128> 128 >128> 128 PapMA-5
concentration
(Concentration/MIC)




Papa-5
concentration
(Concentration / MIC)




64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.1250.125 22 22 16 (1/4)16 (1/4) 0.250.25 44 44 8 (1/8)8 (1/8) 0.50.5 88 44 6 (1/11)6 (1/11) 44 1616 88 4 (1/16)4 (1/16) 88 3232 1616 2 (1/32)2 (1/32) 1616 >128> 128 6464 1 (1/64)1 (1/64) 3232 >128> 128 128128 PapMA-6
concentration
(Concentration/MIC)




PapMA-6
concentration
(Concentration / MIC)




64 (2)64 (2) 00 00 00
32 (1)32 (1) 00 00 00 16 (1/2)16 (1/2) 0.06250.0625 22 0.50.5 8 (1/4)8 (1/4) 0.1250.125 44 22 6 (1/5)6 (1/5) 22 88 44 4 (1/8)4 (1/8) 44 1616 88 2 (1/16)2 (1/16) 88 128128 6464 1 (1/32)1 (1/32) 1616 >128> 128 128128 PapMA-7
concentration
(Concentration/MIC)
PapMA-7
concentration
(Concentration / MIC)
64 (4)64 (4) 00 00 00
32 (2)32 (2) 00 00 00 16 (1)16 (1) 00 00 00 8 (1/2)8 (1/2) 0.1250.125 22 1One 6 (1/3)6 (1/3) 1One 44 22 4 (1/4)4 (1/4) 22 1616 88 2 (1/8)2 (1/8) 88 6464 3232 1 (1/16)1 (1/16) 1616 >128> 128 128128 PapMA-8
concentration
(Concentration/MIC)
Papa-8
concentration
(Concentration / MIC)
64 (2)64 (2) 00 00 00
32 (1)32 (1) 00 00 00 16 (1/2)16 (1/2) 0.1250.125 44 1One 8 (1/4)8 (1/4) 0.250.25 88 44 6 (1/5)6 (1/5) 44 1616 1616 4 (1/8)4 (1/8) 44 3232 3232 2 (1/16)2 (1/16) 88 >128> 128 6464 1 (1/32)1 (1/32) 3232 >128> 128 >128> 128 PapMA-9
concentration
(Concentration/MIC)
PapMA-9
concentration
(Concentration / MIC)
64 (2)64 (2) 00 00 00
32 (1)32 (1) 00 00 00 16 (1/2)16 (1/2) 0.1250.125 22 0.50.5 8 (1/4)8 (1/4) 0.250.25 88 22 6 (1/5)6 (1/5) 22 1616 88 4 (1/8)4 (1/8) 44 3232 88 2 (1/16)2 (1/16) 88 128128 128128 1 (1/32)1 (1/32) 3232 >128> 128 >128> 128 PapMA-10
concentration
(Concentration/MIC)
PapMA-10
concentration
(Concentration / MIC)
64 (4)64 (4) 00 00 00
32 (2)32 (2) 00 00 00 16 (1)16 (1) 00 00 00 8 (1/2)8 (1/2) 0.50.5 44 88 6 (1/3)6 (1/3) 22 1616 3232 4 (1/4)4 (1/4) 88 1616 6464 2 (1/8)2 (1/8) 1616 6464 128128 1 (1/16)1 (1/16) 3232 >128> 128 >128> 128

본 발명의 항생 펩타이드 처리 시, MDRAB 12035에 대한 항생제의 항균 활성The antimicrobial activity of antibiotics against MDRAB 12035 in the antibiotic peptide treatment of the present invention MDRAB 12035MDRAB 12035 펩타이드 처리 농도
(㎍/㎖)
Peptide treatment concentration
(占 퐂 / ml)
항생제 MIC(㎍/㎖)Antibiotic MIC (占 퐂 / ml)
ErythromycinErythromycin VancomycinVancomycin LinezolidLinezolid Compound
Alone
Compound
Alone
3232 >1024> 1024 512512
PapMA-1
concentration
(Concentration/MIC)
Papa-1
concentration
(Concentration / MIC)
64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.1250.125 88 44 16(1/4)16 (1/4) 0.250.25 1616 88 8 (1/8)8 (1/8) 0.50.5 1616 1616 6 (1/11)6 (1/11) 44 3232 3232 4 (1/16)4 (1/16) 1616 128128 6464 2 (1/32)2 (1/32) 3232 >128> 128 128128 1 (1/64)1 (1/64) 3232 >128> 128 >128> 128 PapMA-2
concentration
(Concentration/MIC)
PapMA-2
concentration
(Concentration / MIC)
64 (4)64 (4) 00 00 00
32 (2)32 (2) 00 00 00 16 (1)16 (1) 00 00 00 8 (1/2)8 (1/2) 0.250.25 1616 88 6 (1/3)6 (1/3) 22 3232 3232 4 (1/4)4 (1/4) 44 128128 3232 2 (1/8)2 (1/8) 1616 >128> 128 6464 1 (1/16)1 (1/16) 3232 >128> 128 >128> 128 PapMA-3
concentration
(Concentration/MIC)




PapMA-3
concentration
(Concentration / MIC)




64 (4)64 (4) 00 00 00
32 (2)32 (2) 00 00 00 16 (1)16 (1) 00 00 00 8 (1/2)8 (1/2) 0.250.25 1616 1616 6 (1/3)6 (1/3) 44 3232 3232 4 (1/4)4 (1/4) 88 128128 3232 2 (1/8)2 (1/8) 1616 >128> 128 128128 1 (1/16)1 (1/16) 3232 >128> 128 >128> 128 PapMA-4
concentration
(Concentration/MIC)




PapMA-4
concentration
(Concentration / MIC)




64 (4)64 (4) 00 00 00
32 (2)32 (2) 00 00 00 16 (1)16 (1) 00 00 00 8 (1/2)8 (1/2) 22 6464 3232 6 (1/3)6 (1/3) 44 6464 6464 4 (1/4)4 (1/4) 88 128128 6464 2 (1/8)2 (1/8) 1616 >128> 128 128128 1 (1/16)1 (1/16) 3232 >128> 128 >128> 128 PapMA-5
concentration
(Concentration/MIC)




Papa-5
concentration
(Concentration / MIC)




64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.1250.125 44 44 16 (1/4)16 (1/4) 0.250.25 88 88 8 (1/8)8 (1/8) 1One 1616 88 6 (1/11)6 (1/11) 22 3232 1616 4 (1/16)4 (1/16) 1616 128128 6464 2 (1/32)2 (1/32) 3232 >128> 128 128128 1 (1/64)1 (1/64) 3232 >128> 128 >128> 128 PapMA-6
concentration
(Concentration/MIC)




PapMA-6
concentration
(Concentration / MIC)




64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.06250.0625 22 1One 16 (1/4)16 (1/4) 0.1250.125 44 22 8 (1/8)8 (1/8) 0.250.25 88 44 6 (1/11)6 (1/11) 0.50.5 88 88 4 (1/16)4 (1/16) 44 6464 1616 2 (1/32)2 (1/32) 88 128128 3232 1 (1/64)1 (1/64) 1616 >128> 128 128128 PapMA-7
concentration
(Concentration/MIC)
PapMA-7
concentration
(Concentration / MIC)
64 (2)64 (2) 00 00 00
32 (1)32 (1) 00 00 00 16 (1/2)16 (1/2) 0.06250.0625 1One 1One 8 (1/4)8 (1/4) 0.1250.125 22 22 6 (1/5)6 (1/5) 0.50.5 44 44 4 (1/8)4 (1/8) 22 88 88 2 (1/16)2 (1/16) 44 3232 3232 1 (1/32)1 (1/32) 88 128128 6464 PapMA-8
concentration
(Concentration/MIC)
Papa-8
concentration
(Concentration / MIC)
64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 1One 22 22 16 (1/4)16 (1/4) 22 44 44 8 (1/8)8 (1/8) 44 88 1616 6 (1/11)6 (1/11) 88 3232 3232 4 (1/16)4 (1/16) 1616 6464 6464 2 (1/32)2 (1/32) 3232 >128> 128 >128> 128 1 (1/64)1 (1/64) 3232 >128> 128 >128> 128 PapMA-9
concentration
(Concentration/MIC)
PapMA-9
concentration
(Concentration / MIC)
64 (1)64 (1) 00 00 00
32 (1/2)32 (1/2) 0.1250.125 22 22 16 (1/4)16 (1/4) 0.250.25 88 44 8 (1/8)8 (1/8) 0.250.25 88 44 6 (1/11)6 (1/11) 0.50.5 1616 1616 4 (1/16)4 (1/16) 44 6464 3232 2 (1/32)2 (1/32) 1616 128128 6464 1 (1/64)1 (1/64) 1616 >128> 128 >128> 128 PapMA-10
concentration
(Concentration/MIC)
PapMA-10
concentration
(Concentration / MIC)
64 (2)64 (2) 00 00 00
32 (1)32 (1) 00 44 22 16 (1/2)16 (1/2) 44 44 88 8 (1/4)8 (1/4) 88 1616 1616 6 (1/5)6 (1/5) 88 3232 3232 4 (1/8)4 (1/8) 1616 6464 6464 2 (1/16)2 (1/16) 3232 >128> 128 >128> 128 1 (1/32)1 (1/32) 3232 >128> 128 >128> 128

또한, 하기 [표 9]에서 확인한 바와 같이, 비교대조군으로서 파필리오신과 항생제를 혼합하여 대장균 및 A. baumannii에 대한 항생제의 항균 활성을 확인한 결과, 파필리오신은 자체의 항균활성은 매우 우수하지만 항생제와 혼합했을 때 본 발명의 펩타이드들에 비해서 항균활성이 크게 상승효과를 가지지 않음을 알 수 있다(표 9).As shown in the following Table 9, the antibacterial activity of antibiotics against Escherichia coli and A. baumannii was confirmed by mixing papyriosin and antibiotics as a comparative control. As a result, papyriosin itself has excellent antimicrobial activity It can be seen that the antimicrobial activity does not have a synergistic effect when compared with the peptides of the present invention when mixed with antibiotics (Table 9).

비교대조군인 파필리오신 처리 시, 대장균 및 A. baumannii에 대한 항생제의 항균 활성The antimicrobial activity of antibiotics against E. coli and A. baumannii during the treatment of the comparative control papyriosin MIC Concentration (㎍/ml)MIC Concentration (/ / ml) 펩타이드 처리농도
(㎍/㎖)
Peptide treatment concentration
(占 퐂 / ml)
E. coliE. coli A. baumanniiA. baumannii
ErythromycinErythromycin VancomycinVancomycin LinezolidLinezolid ErythromycinErythromycin VancomycinVancomycin LinezolidLinezolid Compound aloneCompound alone 128128 10241024 256256 3232 10241024 256256 Papiliocin
농도
(농도/MIC)
Papiliocin
density
(Concentration / MIC)
8 (1)8 (1) 00 00 00 00 00 00
4 (1/2)4 (1/2) 6464 256256 128128 1616 256256 6464 2 (1/4)2 (1/4) 6464 256256 128128 1616 256256 6464 1 (1/8)1 (1/8) 6464 512512 128128 3232 512512 128128

또한, 하기 [표 10] 내지 [표 14]에 나타낸 바와 같이, 항생제를 가했을 때 항균펩타이드의 항균활성을 측정한 결과, E. coli 와 그 내성균, A.baumannii와 그 내성균에 대해 항생제를 가하면 항균펩타이드의 MIC가 256배까지 낮아지는 것을 확인하였다(표 10 내지 표 14).As shown in the following Tables 10 to 14, when the antibiotic was added, the antimicrobial activity of the antimicrobial peptide was measured. As a result, when antibiotics were added to E. coli and its resistant bacteria, A.baumannii and its resistant bacteria, It was confirmed that the MIC of the peptide was lowered to 256 times (Tables 10 to 14).

예를 들어 본 발명에서 확인한 바와 같이, A.baumannii의 다재내성균 MDRAB 12035에 대한 에리트로마이신의 MIC 값은 256 ㎍/㎖이었다. 에리트로마이신을 기준으로 하였을 때 항생 펩타이드와 기존 항생제와의 병용 처리에 의한 시너지 효과를 확인할 수 있다. 에리트로마이신의 MIC의 1/4 농도인 8 ㎍/㎖로 PapMA-1 또는 PapMA-2 펩타이드와 혼합하여 MDRAB 12035에 처리하였을 때, 에리트로마이신을 PapMA-1 또는 PapMA-2와 혼합한 경우에서 MIC 값이 4 ㎍/㎖으로 감소하여, 각각의 항생 펩타이드를 단독으로 처리할 때의 MIC 값 보다 1/16 또는 1/32 수준으로 감소하는 것을 확인하였다. 이에 비해, 본 발명의 유도체 펩타이드를 적용하였을 때, 에리트로마이신을 8 ㎍/㎖ 농도로 처리하는 경우 PapMA-7의 MIC는 1 ㎍/㎖로 감소하여, 단독으로 처리할 때의 MIC 값 보다 1/32 수준으로 감소하는 것을 확인하여, PapMA-7 및 에리트로마이신의 병용 처리는 MDRAB 12035에 대하여 PapMA-1 및 PapMA-2와 유사하거나 더욱 높은 수준의 시너지 효과를 나타내는 것을 확인하였다(표 13).For example, as identified in the present invention, MIC values of erythromycin resistant strains of the versatility of MDRAB 12035 A.baumannii was 256 ㎍ / ㎖. Based on erythromycin, synergistic effects of antibiotic peptide and conventional antibiotic treatment can be confirmed. When MIC of erythromycin was mixed with PapMA-1 or PapMA-2 when mixed with PapMA-1 or PapMA-2 peptide at a concentration of 1/4 of the MIC of erythromycin and treated with MDRAB 12035, Was reduced to 4 / / ml, and it was confirmed that the MIC value of each antibiotic peptide was reduced to 1/16 or 1/32 level when treated with each antibiotic peptide alone. In contrast, when the derivative peptide of the present invention was applied, the MIC of PapMA-7 decreased to 1 μg / ml when erythromycin was treated at a concentration of 8 μg / ml, 32, the combined treatment of PapMA-7 and erythromycin showed similar or even higher synergistic effects to MDRAB 12035 than PapMA-1 and PapMA-2 (Table 13).

이와 동일한 방법으로 비교하였을 때, 본 발명의 기존 항생제와 PapMA-5, PapMA-6, PapMA-7, PapMA-8, PapMA-9 및 PapMA-10 펩타이드를 병용 처리하였을 때 항생제 및 펩타이드를 1/4 내지 1/256 수준의 농도로 처리하여도 유의적인 항균 활성을 나타낼 수 있음을 확인하여, PapMA-1 또는 PapMA-2와 유사하거나 상승된 수준의 시너지 항균활성을 나타내는 것으로 확인하였다.When antibiotics and peptides were treated in combination with the conventional antibiotics of the present invention and PapMA-5, PapMA-6, PapMA-7, PapMA-8, PapMA-9 and PapMA-10 peptides, To 1/256 level, it was confirmed that they exhibited synergistic antimicrobial activity similar or higher than that of PapMA-1 or PapMA-2.

항생제 처리 시, 대장균에 대한 본 발명의 항균 펩타이드의 항균 활성The antimicrobial activity of the antimicrobial peptide of the present invention against Escherichia coli at the time of antibiotic treatment E. coliE. coli 항생제 처리농도(㎍/㎖)Antibiotic treatment concentration (占 퐂 / ml) 펩타이드 MIC(㎍/㎖)Peptide MIC ([mu] g / ml) PapMA
-1
Papa
-One
PapMA
-2
Papa
-2
PapMA
-3
Papa
-3
PapMA
-4
Papa
-4
PapMA-5Papa-5 PapMA-6PapMA-6 PapMA-7PapMA-7 PapMA-8Papa-8 PapMA-9PapMA-9 PapMA-10PapMA-10
peptide alonepeptide 6464 6464 3232 1616 6464 6464 3232 3232 3232 3232 Erythromycin
conc
(Conc/MIC)
Erythromycin
conc
(Conc / MIC)
128 (1)128 (1) 00 00 00 00 00 00 00 00 00 00
64 (1/2)64 (1/2) 1One 1One 1One 1One 22 1One 22 22 22 22 32 (1/4)32 (1/4) 22 22 22 22 44 22 22 44 44 44 16 (1/8)16 (1/8) 44 44 22 44 88 22 44 44 44 88 Vancomycin
conc
(Conc/MIC)
Vancomycin
conc
(Conc / MIC)
1024 (1)1024 (1) 00 00 00 00 00 00 00 00 00 00
512 (1/2)512 (1/2) 22 22 22 22 22 22 22 22 22 22 256 (1/4)256 (1/4) 44 44 44 44 44 22 22 22 44 44 128 (1/8)128 (1/8) 88 88 88 88 44 22 22 44 44 44 Linezolid
conc
(Conc/MIC)
Linezolid
conc
(Conc / MIC)
256 (1)256 (1) 00 00 00 00 00 00 00 00 00 00
128 (1/2)128 (1/2) 1One 1One 1One 1One 22 44 22 44 44 44 64 (1/4)64 (1/4) 44 22 22 22 44 44 44 44 44 44 32 (1/8)32 (1/8) 44 44 44 44 88 44 44 44 44 88

항생제 처리 시, MDREC 1229에 대한 본 발명의 항균 펩타이드의 항균 활성Antimicrobial activity of the antimicrobial peptide of the present invention against MDREC 1229 upon antibiotic treatment MDREC 1229MDREC 1229 항생제 처리농도(㎍/㎖)Antibiotic treatment concentration (占 퐂 / ml) 펩타이드 MIC(㎍/㎖)Peptide MIC ([mu] g / ml) PapMA
-1
Papa
-One
PapMA
-2
Papa
-2
PapMA
-3
Papa
-3
PapMA
-4
Papa
-4
PapMA-5Papa-5 PapMA-6PapMA-6 PapMA-7PapMA-7 PapMA-8Papa-8 PapMA-9PapMA-9 PapMA-10PapMA-10
peptide alonepeptide 6464 6464 3232 3232 6464 6464 6464 6464 6464 6464 Erythromycin
conc
(Conc/MIC)
Erythromycin
conc
(Conc / MIC)
256 (1)256 (1) 00 00 00 00 00 00 00 00 00 00
128 (1/2)128 (1/2) 1One 1One 0.50.5 0.50.5 1One 0.50.5 0.50.5 22 1One 22 64 (1/4)64 (1/4) 1One 1One 1One 1One 22 1One 1One 22 1One 22 32 (1/8)32 (1/8) 22 22 22 22 44 22 22 44 22 44 Vancomycin
conc
(Conc/MIC)
Vancomycin
conc
(Conc / MIC)
1024 (1)1024 (1) 1One 1One 1One 1One 22 1One 1One 22 22 44
512 (1/2)512 (1/2) 22 22 22 22 22 22 22 22 44 44 256 (1/4)256 (1/4) 44 44 44 44 44 44 44 88 44 44 128 (1/8)128 (1/8) 88 88 88 88 88 88 44 88 44 88 Linezolid
conc
(Conc/MIC)
Linezolid
conc
(Conc / MIC)
512 (1)512 (1) 00 00 00 00 00 00 00 00 00 00
256 (1/2)256 (1/2) 1One 1One 1One 1One 1One 0.50.5 0.50.5 22 1One 22 128 (1/4)128 (1/4) 22 1One 22 22 1One 1One 1One 44 1One 44 64 (1/8)64 (1/8) 22 22 1One 22 44 22 22 88 22 88

항생제 처리 시, A. baumannii에 대한 본 발명의 항균 펩타이드의 항균 활성Antimicrobial activity of the antimicrobial peptide of the present invention against A. baumannii during antibiotic treatment A. baumanniiA. baumannii 항생제 처리농도(㎍/㎖)Antibiotic treatment concentration (占 퐂 / ml) 펩타이드 MIC(㎍/㎖)Peptide MIC ([mu] g / ml) PapMA
-1
Papa
-One
PapMA
-2
Papa
-2
PapMA
-3
Papa
-3
PapMA
-4
Papa
-4
PapMA-5Papa-5 PapMA-6PapMA-6 PapMA-7PapMA-7 PapMA-8Papa-8 PapMA-9PapMA-9 PapMA-10PapMA-10
peptide alonepeptide 6464 1616 1616 1616 6464 3232 1616 3232 3232 1616 Erythromycin
conc
(Conc/MIC)
Erythromycin
conc
(Conc / MIC)
32 (1)32 (1) 00 00 00 00 00 00 00 00 00 00
16 (1/2)16 (1/2) 22 1One 22 22 22 1One 1One 22 22 22 8 (1/4)8 (1/4) 44 44 44 44 44 22 22 44 22 44 4 (1/8)4 (1/8) 44 44 44 88 88 44 22 44 44 88 Vancomycin
conc
(Conc/MIC)
Vancomycin
conc
(Conc / MIC)
1024 (1)1024 (1) 00 00 00 00 00 00 00 00 00 00
512 (1/2)512 (1/2) 0.250.25 0.250.25 0.250.25 0.250.25 0.50.5 0.250.25 0.250.25 1One 0.250.25 1One 256 (1/4)256 (1/4) 0.50.5 0.50.5 0.250.25 0.250.25 1One 0.50.5 0.250.25 1One 0.50.5 1One 128 (1/8)128 (1/8) 44 22 22 22 44 22 22 44 22 44 Linezolid
conc
(Conc/MIC)
Linezolid
conc
(Conc / MIC)
256 (1)256 (1) 00 00 00 00 00 00 00 00 00 00
128 (1/2)128 (1/2) 0.50.5 0.50.5 1One 1One 1One 1One 1One 22 22 44 64 (1/4)64 (1/4) 44 44 22 44 22 22 22 22 44 44 32 (1/8)32 (1/8) 44 44 44 44 44 44 22 44 44 88

항생제 처리 시, MDRAB 12035에 대한 본 발명의 항균 펩타이드의 항균 활성The antimicrobial activity of the antimicrobial peptide of the present invention against MDRAB 12035 upon antibiotic treatment MDRAB 12035MDRAB 12035 항생제 처리농도(㎍/㎖)Antibiotic treatment concentration (占 퐂 / ml) 펩타이드 MIC(㎍/㎖)Peptide MIC ([mu] g / ml) PapMA
-1
Papa
-One
PapMA
-2
Papa
-2
PapMA
-3
Papa
-3
PapMA
-4
Papa
-4
PapMA-5Papa-5 PapMA-6PapMA-6 PapMA-7PapMA-7 PapMA-8Papa-8 PapMA-9PapMA-9 PapMA-10PapMA-10
peptide alonepeptide 6464 1616 1616 1616 6464 6464 3232 6464 6464 3232 Erythromycin
conc
(Conc/MIC)
Erythromycin
conc
(Conc / MIC)
32 (1)32 (1) 00 00 00 00 00 00 00 00 00 00
16 (1/2)16 (1/2) 44 22 22 22 44 1One 1One 44 1One 44 8 (1/4)8 (1/4) 44 44 44 44 44 22 1One 88 44 88 4 (1/8)4 (1/8) 44 44 44 44 44 44 22 88 44 1616 Vancomycin
conc
(Conc/MIC)
Vancomycin
conc
(Conc / MIC)
1024 (1)1024 (1) 1One 0.250.25 0.250.25 0.250.25 1One 0.250.25 0.250.25 1One 0.250.25 1One
512 (1/2)512 (1/2) 22 1One 22 22 22 1One 0.50.5 22 1One 22 256 (1/4)256 (1/4) 44 22 22 22 44 22 1One 22 1One 44 128 (1/8)128 (1/8) 44 44 44 44 44 22 1One 44 22 44 Linezolid
conc
(Conc/MIC)
Linezolid
conc
(Conc / MIC)
512 (1)512 (1) 00 00 00 00 00 00 00 00 00 00
256 (1/2)256 (1/2) 1One 1One 1One 1One 1One 1One 1One 1One 1One 22 128 (1/4)128 (1/4) 44 22 22 22 44 1One 1One 22 22 22 64 (1/8)64 (1/8) 44 44 44 44 44 22 1One 44 22 44

또한, 하기 [표 14]에서 확인한 바와 같이, 항생제를 처리할 때 비교대조군인 파필리오신과 혼합하여 파필리오신의 항균 활성을 확인한 결과, 본 발명의 펩타이드들에 비해서 항균활성이 크게 상승효과를 가지지 않음을 알 수 있다(표 14).As shown in the following Table 14, when antibiotics were treated, antibiotic activity of papyriosin was confirmed by mixing with comparative control papyriosin. As a result, antimicrobial activity was significantly enhanced compared to the peptides of the present invention (Table 14).

항생제 처리 시, 대장균 및 A. baumannii에 대한 비교 대조군 파필리오신의 항균 활성Antimicrobial activity of comparative control papyriosin against E. coli and A. baumannii during antibiotic treatment 펩타이드 MIC(㎍/㎖)Peptide MIC ([mu] g / ml) BacteriaBacteria 항생제 처리 농도Antibiotic treatment concentration PapiliocinPapiliocin 항생제 단독 처리Antibiotic alone treatment 88 E. coliE. coli Erythromycin
concentration
(Concentration/MIC)
Erythromycin
concentration
(Concentration / MIC)
128 (1)128 (1) 00
64 (1/2)64 (1/2) 44 32 (1/4)32 (1/4) 44 16 (1/8)16 (1/8) 44 Vancomycin
concentration
(Concentration/MIC)
Vancomycin
concentration
(Concentration / MIC)
1024 (1)1024 (1) 00
512 (1/2)512 (1/2) 22 256 (1/4)256 (1/4) 22 128 (1/8)128 (1/8) 44 Linezolid
concentration
(Concentration/MIC)
Linezolid
concentration
(Concentration / MIC)
256 (1)256 (1) 00
128 (1/2)128 (1/2) 44 64 (1/4)64 (1/4) 44 32 (1/8)32 (1/8) 88 A. baumanniiA. baumannii Erythromycin
concentration
(Concentration/MIC)
Erythromycin
concentration
(Concentration / MIC)
32 (1)32 (1) 00
16 (1/2)16 (1/2) 44 8 (1/4)8 (1/4) 44 4 (1/8)4 (1/8) 88 Vancomycin
concentration
(Concentration/MIC)
Vancomycin
concentration
(Concentration / MIC)
1024 (1)1024 (1) 00
512 (1/2)512 (1/2) 22 256 (1/4)256 (1/4) 22 128 (1/8)128 (1/8) 44 Linezolid
concentration
(Concentration/MIC)
Linezolid
concentration
(Concentration / MIC)
256 (1)256 (1) 00
128 (1/2)128 (1/2) 44 64 (1/4)64 (1/4) 44 32 (1/8)32 (1/8) 88

<3-2> 항생 펩타이드 및 항생제 병용 처리시 MIC 값을 이용한 항균 활성의 시너지 효과 확인<3-2> Synergy effect of antimicrobial activity using antimicrobial peptide and antibiotics using MIC value

각 혼합액에 대하여 결정한 MIC 값을 이용하여, 균주에 대한 항균 활성에서 펩타이드와 항생제의 시너지효과를 평가하였다. 평가를 위하여, 분할 저해 농도(Fractional inhibitory concentration; FIC) 값을 사용하였다(Elion, Gertrude B., Samuel Singer, and George H. Hitchings. Journal of Biological Chemistry 208.2 (1954): 477-488.). Using the determined MIC values for each mixture, the synergistic effect of the peptide and the antibiotic on the antimicrobial activity against the strain was evaluated. Fractional inhibitory concentration (FIC) values were used for the evaluation (Elion, Gertrude B., Samuel Singer, and George H. Hitchings. Journal of Biological Chemistry 208.2 (1954): 477-488.).

구체적으로, 상기 실시예 <3-1>에서 계산한 MIC 값을 이용하여, 하기 [수학식 1]에 의해 FIC 값을 계산하였으며, 계산한 FIC 값에 따라 다음과 같이 평가하였다: <0.5, 시너지 효과(Synergy effect); 0.5~1, 부분 시너지 효과(Partial synergy effect); 1.0, 상가 효과(Additive effect); 2.0~4.0, 무차별(Indifference); >4.0, 길항작용 (Antagonism).Specifically, the FIC value was calculated according to the following Equation 1 using the MIC value calculated in the above Example <3-1>, and was evaluated according to the calculated FIC value as follows: <0.5, Synergy effect; 0.5 to 1, partial synergy effect; 1.0, additive effect; 2.0 to 4.0, Indifference; > 4.0, Antagonism.

Figure 112017065730205-pat00002
Figure 112017065730205-pat00002

FIC 값을 사용하여 시너지 효과를 판단하기 위해 일반적으로 사용하는 방법은 체커보드 분석법(Checkerboard assay)으로서, 균의 생장이 억제되는 웰 중 가장 낮은 FIC index 값을 선택하는 방법이다. 그러나, 이러한 방법에서 하나의 FIC index를 선택하는 것은, 항생제의 항균 활성이 더 낮은 경우 큰 시너지 효과를 가지도록 계산되어 정확하지 않고 실험적 오차가 많다는 문제점을 가진다. 이에, 상기 [수학식 1]로 계산한 FIC index는 다시 하기 [수학식 2]를 사용하여 평균 FIC index를 계산하였다(He, Jing, Charles G. Starr, and William C. Wimley. Biochimica et Biophysica Acta (BBA)-Biomembranes 1848.1 (2015): 8-15.).A commonly used method for determining synergy using FIC values is the Checkerboard assay, which selects the lowest FIC index value of the wells in which growth of the bacteria is inhibited. However, the selection of one FIC index in this method has a problem that the antibiotic activity of the antibiotic is calculated to have a large synergy effect when the antibacterial activity is lower, and it is not accurate and there are many experimental errors. Therefore, the FIC index calculated by the above-mentioned equation (1) was calculated again using the following formula (2): He, Jing, Charles G. Starr, and William C. Wimley. Biochimica et Biophysica Acta (BBA) -Biomembranes 1848.1 (2015): 8-15.).

Figure 112017065730205-pat00003
Figure 112017065730205-pat00003

그 결과, 하기 [표 15] 내지 [표 19]에서 나타난 바와 같이 기존의 항생제인 에리트로마이신, 반코마이신 또는 리네졸리드를 본 발명의 항생 펩타이드인 PapMA-5 ~ PapMA-10와 함께 투여한 항균 활성의 시너지 효과를 FIC값을 이용하여 확인한 결과, 그람 양성균에만 높은 항균활성을 가지고 그람음성균에 활성이 없는 항생제들과 본 발명의 서열번호 5 내지 10 펩타이드를 함께 투여했을 때 모든 항생제에 대하여 그람 음성균인 E. coli에 대해서 0.5보다 매우 낮은 0.09-0.47 이하의 FIC index를 가져 시너지효과가 매우 우수함을 확인하였다. 또한 다제내성 대장균 (MDREC 1229)에 대해서 0.5보다 매우 낮은 0.06-0.25 이하의 FIC index를 가져 시너지효과가 매우 우수함을 확인하였다. A. baumannii에 대해서는 0.5보다 매우 낮은 0.07-0.49 이하의 FIC index를 가져 시너지효과가 매우 우수함을 확인하였고 그 내성균(MDRAB 12035)에 대해서는 PapMA-10이 에리트로마이신에대해서 0.61의 FIC 를 가지는 것을 제외하면 0.5보다 매우 낮은 0.04-0.45 이하의 FIC index를 가져 시너지효과가 매우 우수함을 확인하여, 최근 심각한 내성문제로 사회적 이슈가 되고 있는 그람음성균들에 대해 기존 항생제와의 복합제로 사용하여 높은 시너지효과를 가질 수 있는 항균제임을 확인하였다(표 15 내지 표 18, 도 1 및 도 2). 특히 PapMA-7은 4개 모든 그람음성균에 대해 0.27 이하의 FIC index를 가지며, 이는 기존 합성했던 PaPMA-1, PapMA-2, PapMA-3 및 PapMA-4 펩타이드보다 유의적으로 낮은 수준의 FIC index를 가지는 것이므로, PapMA-7이 항생제와 혼합 처리하여 나타낼 수 있는 시너지 효과가 매우 우수함을 확인하였다.As a result, as shown in the following Tables 15 to 19, when the existing antibiotic erythromycin, vancomycin or linezolid was administered together with the antibiotic peptides PapMA-5 to PapMA-10 of the present invention, As a result of confirming the synergy effect using the FIC value, it was found that when antibiotics having high antimicrobial activity only for Gram-positive bacteria and having no activity for gram-negative bacteria were administered together with the peptide of SEQ ID NO: 5 to 10 of the present invention, Gram- and the FIC index of 0.09-0.47 or less, which is much lower than 0.5 for E. coli. In addition, the FIC index of 0.06-0.25 or less, which is much lower than 0.5 for MDREC 1229, was confirmed to have excellent synergistic effect. For A. baumannii, the FIC index was 0.07-0.49 or less, which was much lower than 0.5, and the synergy effect was excellent. For the resistant strain (MDRAB 12035), except that PapMA-10 had an FIC of 0.61 for erythromycin The FIC index of 0.04-0.45 or less, which is much lower than 0.5, confirms that the synergy effect is very good. Therefore, Gram-negative bacteria, which is a social issue due to serious resistance problem, is used as a compound with existing antibiotics and has a high synergy effect (Table 15 to Table 18, Figures 1 and 2). In particular, PapMA-7 has a FIC index of less than 0.27 for all four gram-negative bacteria, which is significantly lower than the previously synthesized PaPMA-1, PapMA-2, PapMA-3 and PapMA-4 peptides Therefore, it was confirmed that the synergy effect that PapMA-7 can be exhibited by mixing with antibiotics is excellent.

항생 펩타이드 및 항생제 혼합 처리시 대장균에 대한 항균 활성의 시너지 효과를 나타내는 FIC index의 비교Comparison of FIC index showing synergy of antimicrobial activity against Escherichia coli in antibiotic peptide and antibiotic mixture treatment E. coliE. coli 펩타이드 명Peptide name Average FIC indexAverage FIC index ErythromycinErythromycin VancomycinVancomycin LinezolidLinezolid PapMA-1Papa-1 0.140.14 0.160.16 0.220.22 PapMA-2PapMA-2 0.140.14 0.160.16 0.140.14 PapMA-3PapMA-3 0.150.15 0.220.22 0.200.20 PapMA-4PapMA-4 0.230.23 0.330.33 0.240.24 PapMA-5Papa-5 0.280.28 0.130.13 0.300.30 PapMA-6PapMA-6 0.160.16 0.090.09 0.320.32 PapMA-7PapMA-7 0.160.16 0.090.09 0.270.27 PapMA-8Papa-8 0.280.28 0.140.14 0.430.43 PapMA-9PapMA-9 0.280.28 0.150.15 0.340.34 PapMA-10PapMA-10 0.340.34 0.150.15 0.470.47

항생 펩타이드 및 항생제 혼합 처리시 다제내성균인 MDREC 1229에 대한 항균 활성의 시너지 효과를 나타내는 FIC index의 비교Comparison of FIC index showing the synergistic effect of antimicrobial activity against MDREC 1229, a multi-drug resistant bacterium mixed with antibiotic peptide and antibiotics MDREC 1229MDREC 1229 펩타이드 명Peptide name Average FIC indexAverage FIC index ErythromycinErythromycin VancomycinVancomycin LinezolidLinezolid PapMA-1Papa-1 0.110.11 0.200.20 0.160.16 PapMA-2PapMA-2 0.080.08 0.160.16 0.120.12 PapMA-3PapMA-3 0.130.13 0.260.26 0.140.14 PapMA-4PapMA-4 0.090.09 0.260.26 0.150.15 PapMA-5Papa-5 0.140.14 0.200.20 0.120.12 PapMA-6PapMA-6 0.070.07 0.160.16 0.070.07 PapMA-7PapMA-7 0.060.06 0.120.12 0.060.06 PapMA-8Papa-8 0.190.19 0.210.21 0.230.23 PapMA-9PapMA-9 0.080.08 0.140.14 0.080.08 PapMA-10PapMA-10 0.200.20 0.220.22 0.250.25

항생 펩타이드 및 항생제 혼합 처리시 A.baumannii에 대한 항균 활성의 시너지 효과를 나타내는 FIC index의 비교Comparison of FIC index showing synergy of antimicrobial activity against A.baumannii when mixed with antibiotic peptide and antibiotics A.baumanniiA.baumannii 펩타이드 명Peptide name Average FIC indexAverage FIC index ErythromycinErythromycin VancomycinVancomycin LinezolidLinezolid PapMA-1Papa-1 0.270.27 0.070.07 0.260.26 PapMA-2PapMA-2 0.300.30 0.100.10 0.320.32 PapMA-3PapMA-3 0.380.38 0.100.10 0.290.29 PapMA-4PapMA-4 0.470.47 0.110.11 0.350.35 PapMA-5Papa-5 0.290.29 0.090.09 0.140.14 PapMA-6PapMA-6 0.170.17 0.070.07 0.160.16 PapMA-7PapMA-7 0.180.18 0.070.07 0.160.16 PapMA-8Papa-8 0.270.27 0.120.12 0.240.24 PapMA-9PapMA-9 0.240.24 0.080.08 0.270.27 PapMA-10PapMA-10 0.450.45 0.140.14 0.490.49

항생 펩타이드 및 항생제 혼합 처리시 다제내성균인 MDRAB 12035에 대한 항균 활성의 시너지 효과를 나타내는 FIC index의 비교Comparison of FIC index showing synergistic effect of antimicrobial activity against MDRAB 12035, a multi-drug resistant strain, when antibiotic peptide and antibiotics were mixed MDRAB 12035MDRAB 12035 펩타이드 명Peptide name Average FIC indexAverage FIC index ErythromycinErythromycin VancomycinVancomycin LinezolidLinezolid PapMA-1Papa-1 0.380.38 0.130.13 0.160.16 PapMA-2PapMA-2 0.370.37 0.200.20 0.210.21 PapMA-3PapMA-3 0.390.39 0.210.21 0.220.22 PapMA-4PapMA-4 0.400.40 0.220.22 0.240.24 PapMA-5Papa-5 0.370.37 0.130.13 0.150.15 PapMA-6PapMA-6 0.140.14 0.080.08 0.060.06 PapMA-7PapMA-7 0.090.09 0.040.04 0.050.05 PapMA-8Papa-8 0.450.45 0.110.11 0.180.18 PapMA-9PapMA-9 0.180.18 0.080.08 0.110.11 PapMA-10PapMA-10 0.610.61 0.160.16 0.220.22

이러한 결과를 통하여, 본 발명의 펩타이드인 서열번호 5 내지 10의 펩타이드는 기존항생제들과 복합적으로 사용되었을 때 대장균과 아시네토박터균 및 그 다제내성균의 대해 우수한 시너지효과를 보이는 것을 알 수 있고, 동일한 농도의 펩타이드를 처리했을 때 특히 서열번호 7의 PapMA-7 펩타이드가 자체 항균활성도 가장 높고 또한 기존 항생제들의 MIC를 가장 잘 낮추는 것을 확인할 수 있었다. These results show that the peptides of SEQ ID NOS: 5 to 10, which are peptides of the present invention, exhibit excellent synergistic effects against Escherichia coli, Acinetobacter bacteria and multidrug-resistant bacteria when used in combination with existing antibiotics, 7 peptide of SEQ ID NO: 7 showed the highest antimicrobial activity and the lowest MIC of conventional antibiotics.

이하, 본 발명에 따른 상기 항생 펩타이드를 유효성분으로 함유하는 의약품의 제조예를 설명하나, 본 발명은 이를 한정하고자 함이 아닌 단지 구체적으로 설명하고자 함이다. 본 발명의 그람 음성균 및 그람 양성균에 대한 항균 활성을 나타내는 항생 펩타이드를 가지고 하기와 같은 조성성분 및 조성비에 따라 제조예 1의 의약품을 통상적인 방법에 따라서 제조하였다.Hereinafter, a preparation example of a medicament containing the antibiotic peptide according to the present invention as an active ingredient will be described, but the present invention is not intended to be limited thereto but is specifically explained. Antibiotic peptides showing antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria according to the present invention were produced according to the conventional methods according to the following composition components and composition ratios.

<제조예 1> 약학적 제제의 제조&Lt; Preparation Example 1 > Preparation of pharmaceutical preparations

<1-1> 산제의 제조<1-1> Preparation of powder

본 발명의 펩타이드 및 항균제 복합제 2g2 g of the peptide and antibacterial agent combination of the present invention

유당 1gLactose 1g

상기의 성분을 혼합하고 기밀포에 충진하여 산제를 제조하였다.The above components were mixed and packed in airtight bags to prepare powders.

<1-2> 정제의 제조<1-2> Preparation of tablets

본 발명의 펩타이드 및 항균제 복합 100㎎100 mg of the peptide and the antibacterial agent complex of the present invention

옥수수전분 100㎎100 mg of corn starch

유 당 100㎎100 mg of milk

스테아린산 마그네슘 2㎎2 mg of magnesium stearate

상기의 성분을 혼합한 후, 통상의 정제의 제조방법에 따라서 타정하여 정제를 제조하였다.After mixing the above components, tablets were prepared by tableting according to a conventional method for producing tablets.

<1-3> 캡슐제의 제조&Lt; 1-3 > Preparation of capsules

본 발명의 펩타이드 및 항균제 복합제 100㎎100 mg of the peptide and antibacterial agent combination of the present invention

옥수수전분 100㎎100 mg of corn starch

유 당 100㎎100 mg of milk

스테아린선 마그네슘 2㎎Stearin Magnesium 2 mg

상기의 성분을 혼합한 후, 통상의 캡슐제의 제조방법에 따라서 젤라틴 캡슐에 충전하여 캡슐 제를 제조하였다.After mixing the above components, the capsules were filled in gelatin capsules according to the conventional preparation method of capsules.

<1-4> 환의 제조&Lt; 1-4 >

본 발명의 펩타이드 및 항균제 복합제 1 g1 g of the peptide and antibacterial agent complex of the present invention

유당 1.5 gLactose 1.5 g

글리세린 1 gGlycerin 1 g

자일리톨 0.5 g0.5 g of xylitol

상기의 성분을 혼합한 후, 통상의 방법에 따라 1 환 당 4 g이 되도록 제조하였다.After mixing the above components, they were prepared so as to be 4 g per one ring according to a conventional method.

<1-5> 과립의 제조<1-5> Preparation of granules

본 발명의 펩타이드 및 항균제 복합제 150 ㎎150 mg of the peptide and antibacterial agent combination of the present invention

대두 추출물 50 ㎎Soybean extract 50 mg

포도당 200 ㎎200 mg of glucose

전분 600 ㎎600 mg of starch

상기의 성분을 혼합한 후, 30% 에탄올 100 ㎎을 첨가하여 섭씨 60에서 건조하여 과립을 형성한 후 포에 충진하였다.After mixing the above components, 100 mg of 30% ethanol was added and the mixture was dried at 60 ° C to form granules, which were then filled in a capsule.

<1-6> 주사제의 제조<1-6> Preparation of injections

본 발명의 펩타이드 및 항균제 복합제 500 ng500 ng of the peptide and antibacterial agent complex of the present invention

만니톨 180 mg180 mg mannitol

Na2HPO42H2O 26 mgNa2HPO42H2O 26 mg

증류수 2974 mgDistilled water 2974 mg

통상적인 주사제의 제조방법에 따라, 상기 성분들을 제시된 함량으로 함유시켜 주사제를 제조하였다.According to the conventional method for preparing an injectable preparation, an injectable preparation was prepared by incorporating the aforementioned components in the amounts indicated.

<110> KONKUK UNIVERSITY INDUSTRIAL COOPERATION CORP <120> Antimicrobial peptides with high synergistic effect with antibiotics against Escherichia coli, Acinetobater Baumannii, and their multidrug resistant bacteria and their uses <130> 1061424 <160> 13 <170> KopatentIn 2.0 <210> 1 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-1 <400> 1 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Phe Leu His Ser Ala Lys 1 5 10 15 Lys Phe <210> 2 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-2 <400> 2 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Phe Leu His Ser Ala Lys 1 5 10 15 Lys Trp <210> 3 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-3 <400> 3 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Phe Leu His Ser Trp Lys 1 5 10 15 Lys Phe <210> 4 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-4 <400> 4 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Phe Leu His Ser Trp Lys 1 5 10 15 Lys Trp <210> 5 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-5 <400> 5 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Phe Leu His Ser Phe Lys 1 5 10 15 Lys Phe <210> 6 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-6 <400> 6 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Phe Leu His Ser Leu Lys 1 5 10 15 Lys Phe <210> 7 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-7 <400> 7 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Leu Leu His Ser Phe Lys 1 5 10 15 Lys Phe <210> 8 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-8 <400> 8 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Leu Leu His Ser Leu Lys 1 5 10 15 Lys Phe <210> 9 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-9 <400> 9 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Leu Leu His Ser Ala Lys 1 5 10 15 Lys Trp <210> 10 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-10 <400> 10 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Leu Leu His Ser Leu Lys 1 5 10 15 Lys Trp <210> 11 <211> 37 <212> PRT <213> Artificial Sequence <220> <223> Papiliocin <400> 11 Arg Trp Lys Ile Phe Lys Lys Ile Glu Lys Val Gly Arg Asn Val Arg 1 5 10 15 Asp Gly Ile Ile Lys Ala Gly Pro Ala Val Ala Val Val Gly Gln Ala 20 25 30 Ala Thr Val Val Lys 35 <210> 12 <211> 23 <212> PRT <213> Artificial Sequence <220> <223> Magainin <400> 12 Gly Ile Gly Lys Phe Leu His Ser Ala Lys Lys Phe Gly Lys Ala Phe 1 5 10 15 Val Gly Glu Ile Met Asn Ser 20 <210> 13 <211> 26 <212> PRT <213> Artificial Sequence <220> <223> Melittin <400> 13 Gly Ile Gly Ala Val Leu Lys Val Leu Thr Thr Gly Leu Pro Ala Leu 1 5 10 15 Ile Ser Trp Ile Lys Arg Lys Arg Gln Gln 20 25 <110> KONKUK UNIVERSITY INDUSTRIAL COOPERATION CORP <120> Antimicrobial peptides with high synergistic effect with          Antibiotics against Escherichia coli, Acinetobacter baumannii, and          their multidrug resistant bacteria and their uses <130> 1061424 <160> 13 <170> Kopatentin 2.0 <210> 1 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> Papa-1 <400> 1 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Phe Leu His Ser Ala Lys   1 5 10 15 Lys Phe         <210> 2 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-2 <400> 2 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Phe Leu His Ser Ala Lys   1 5 10 15 Lys Trp         <210> 3 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-3 <400> 3 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Phe Leu His Ser Trp Lys   1 5 10 15 Lys Phe         <210> 4 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-4 <400> 4 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Phe Leu His Ser Trp Lys   1 5 10 15 Lys Trp         <210> 5 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-5 <400> 5 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Phe Leu His Ser Phe Lys   1 5 10 15 Lys Phe         <210> 6 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-6 <400> 6 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Phe Leu His Ser Leu Lys   1 5 10 15 Lys Phe         <210> 7 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-7 <400> 7 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Leu Leu His Ser Phe Lys   1 5 10 15 Lys Phe         <210> 8 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> Papa-8 <400> 8 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Leu Leu His Ser Leu Lys   1 5 10 15 Lys Phe         <210> 9 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-9 <400> 9 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Leu Leu His Ser Ala Lys   1 5 10 15 Lys Trp         <210> 10 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> PapMA-10 <400> 10 Arg Trp Lys Ile Phe Lys Lys Ile Pro Lys Leu Leu His Ser Leu Lys   1 5 10 15 Lys Trp         <210> 11 <211> 37 <212> PRT <213> Artificial Sequence <220> <223> Papiliocin <400> 11 Arg Trp Lys Ile Phe Lys Lys Ile Glu Lys Val Gly Arg Asn Val Arg   1 5 10 15 Asp Gly Ile Ile Lys Ala Gly Ala Val Ala Val Val Gly Gln Ala              20 25 30 Ala Thr Val Val Lys          35 <210> 12 <211> 23 <212> PRT <213> Artificial Sequence <220> <223> Magainin <400> 12 Gly Ile Gly Lys Phe Leu His Ser Ala Lys Lys Phe Gly Lys Ala Phe   1 5 10 15 Val Gly Glu Ile Met Asn Ser              20 <210> 13 <211> 26 <212> PRT <213> Artificial Sequence <220> <223> Melittin <400> 13 Gly Ile Gly Ala Val Leu Lys Val Leu Thr Thr Gly Leu Pro Ala Leu   1 5 10 15 Ile Ser Trp Ile Lys Arg Lys Arg Gln Gln              20 25

Claims (15)

서열번호 5 내지 10으로 기재되는 아미노산 서열 중 어느 하나로 구성되는 항생 펩타이드.
An antibiotic peptide comprising any one of the amino acid sequences set forth in SEQ ID NOS: 5 to 10.
삭제delete 서열번호 5 내지 10으로 기재되는 아미노산 서열 중 어느 하나로 구성되는 항생 펩타이드를 유효성분으로 포함하는, 항균용 조성물.
An antimicrobial peptide consisting of any one of the amino acid sequences of SEQ ID NOS: 5 to 10 as an active ingredient.
(a) 서열번호 5 내지 10으로 기재되는 아미노산 서열 중 어느 하나로 구성되는 항생 펩타이드; 및
(b) 항생제 를 유효성분으로 포함하는, 항균용 조성물.
(a) an antibiotic peptide consisting of any one of the amino acid sequences of SEQ ID NOS: 5 to 10; And
(b) an antibiotic as an active ingredient.
삭제delete 제4항에 있어서, 상기 항생제는 에리트로마이신(Erythromycin), 암피실린(Ampicillin), 반코마이신(Vancomycin), 리네졸리드(Linezolid), 메티실린(Methicillin), 옥사실린(Oxacillin), 세포탁심(Cefotaxime), 리팜피신(Rifampicin), 아미카신(Amikacin), 겐타마이신(Gentamicin), 아미카신(Amikacin), 카나마이신(Kanamycin), 토브라마이신(Tobramycin), 네오마이신(Neomycin), 에르타페넴(Ertapenem), 도리페넴(Doripenem), 이미페넴/실라스타틴(Imipenem/Cilastatin), 메로페넴(Meropenem), 세프타지딤(Ceftazidime), 세파핌(Cefepime), 세프타로린(Ceftaroline), 세프토비프롤(Ceftobiprole), 아즈트레오남(Aztreonam), 피페라실린(Piperacillin), 폴리믹신 B(Polymyxin B), 콜리스틴(Colistin), 시프로플록사신(Ciprofloxacin), 레보플록사신(Levofloxacin), 목시플록사신(Moxifloxacin), 가티플록사신(Gatifloxacin), 티게사이클린(Tigecycline), 이의 배합체 및 이들의 유도체로 구성된 군으로부터 선택되는 어느 하나 이상인 것을 특징으로 하는, 항균용 약학적 조성물.
5. The method of claim 4, wherein the antibiotic is selected from the group consisting of Erythromycin, Ampicillin, Vancomycin, Linezolid, Methicillin, Oxacillin, Cefotaxime, Rifampicin, Amikacin, Gentamicin, Amikacin, Kanamycin, Tobramycin, Neomycin, Ertapenem, (Eg, Doripenem, Imipenem / Cilastatin, Meropenem, Ceftazidime, Cefepime, Ceftaroline, Ceftobiprole, The present invention relates to a pharmaceutical composition comprising Aztreonam, Piperacillin, Polymyxin B, Colistin, Ciprofloxacin, Levofloxacin, Moxifloxacin, Gatifloxacin, ), Tigecycline, a combination thereof, and derivatives thereof Any, antimicrobial pharmaceutical composition, characterized in that at least selected from the group consisting of.
제 3항 또는 제 4항에 있어서, 상기 항균용 조성물은 그람 양성균, 그람 음성균 및 이의 항생제 내성균주에 대해 항균 활성을 갖는 것을 특징으로 하는, 항균용 조성물.
The antimicrobial composition according to claim 3 or 4, wherein the antimicrobial composition has antimicrobial activity against Gram-positive bacteria, Gram-negative bacteria and antibiotic-resistant bacteria thereof.
제 7항에 있어서, 상기 그람 양성균은 바실러스 서브틸리스(Bacillus subtilis), 스타필로코커스 아우레우스(Staphylococcus aureus) 및 스타필로코커스 에피더미디스(Staphylococcus epidermidis)로 구성된 군으로부터 선택되는 어느 하나 이상인 것을 특징으로 하는, 항균용 조성물.
[Claim 8] The method according to claim 7, wherein the Gram positive bacteria are any one or more selected from the group consisting of Bacillus subtilis , Staphylococcus aureus , and Staphylococcus epidermidis Wherein said antimicrobial composition is an antimicrobial composition.
제 7항에 있어서, 상기 그람 음성균은 대장균(Escherichia coli), 슈도모나스 에루지노사(Psedomonas aeruginosa), 아세네토박터 바우마니(Acinetobacter baumannii) 및 살모넬라 타이피뮤리움(Salmonella typhimurium)로 구성된 군으로부터 선택되는 어느 하나 이상인 것을 특징으로 하는, 항균용 조성물.
The method according to claim 7, wherein the Gram-negative bacterium is selected from the group consisting of Escherichia coli , Pseudomonas aeruginosa , Acinetobacter baumannii , and Salmonella typhimurium . Wherein the antimicrobial composition is at least one antimicrobial composition.
제 3항 또는 제 4항에 있어서, 상기 항균용 조성물은 약학적 조성물인 것을 특징으로 하는, 항균용 조성물.
The antimicrobial composition according to claim 3 or 4, wherein the antimicrobial composition is a pharmaceutical composition.
제 3항 또는 제 4항에 있어서, 상기 항균용 조성물은 식품 첨가제 조성물인 것을 특징으로 하는, 항균용 조성물.
The antimicrobial composition according to claim 3 or 4, wherein the antimicrobial composition is a food additive composition.
제 3항 또는 제 4항에 있어서, 상기 항균용 조성물은 사료 첨가제 조성물인 것을 특징으로 하는, 항균용 조성물.
The antimicrobial composition according to claim 3 or 4, wherein the antimicrobial composition is a feed additive composition.
제 3항 또는 제 4항에 있어서, 상기 항균용 조성물은 방부용 조성물인 것을 특징으로 하는, 항균용 조성물.
The antimicrobial composition according to claim 3 or 4, wherein the antimicrobial composition is a composition for antimicrobial use.
제 3항 또는 제 4항에 있어서, 상기 항균용 조성물은 의약외품 조성물인 것을 특징으로 하는, 항균용 조성물.
The antimicrobial composition according to claim 3 or 4, wherein the antimicrobial composition is a quasi-drug composition.
서열번호 5 내지 서열번호 10으로 이루어진 군으로부터 선택되는 어느 하나의 아미노산 서열로 구성되는 것을 특징으로 하는, 신규 펩타이드.Wherein the peptide is composed of any one of the amino acid sequences selected from the group consisting of SEQ ID NO: 5 to SEQ ID NO: 10.
KR1020160120307A 2016-06-23 2016-09-20 Antimicrobial peptides with high synergistic effect with antibiotics against Escherichia coli, Acinetobater Baumannii, and their multidrug resistant bacteria and their uses KR101876920B1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
KR1020160120307A KR101876920B1 (en) 2016-09-20 2016-09-20 Antimicrobial peptides with high synergistic effect with antibiotics against Escherichia coli, Acinetobater Baumannii, and their multidrug resistant bacteria and their uses
PCT/KR2017/006650 WO2017222335A1 (en) 2016-06-23 2017-06-23 Antimicrobial peptide having synergistic antibacterial effect with antibiotics on multidrug resistant bacteria, and use thereof
CN201780039278.1A CN109415412B (en) 2016-06-23 2017-06-23 Antibacterial peptide with synergistic antibacterial effect on gram-negative multidrug-resistant bacteria with antibiotics and application thereof
US16/311,028 US11214594B2 (en) 2016-06-23 2017-06-23 Antimicrobial peptide having synergistic antibacterial effect with antibiotics on multidrug resistant bacteria, and use thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020160120307A KR101876920B1 (en) 2016-09-20 2016-09-20 Antimicrobial peptides with high synergistic effect with antibiotics against Escherichia coli, Acinetobater Baumannii, and their multidrug resistant bacteria and their uses

Publications (2)

Publication Number Publication Date
KR20180031527A KR20180031527A (en) 2018-03-28
KR101876920B1 true KR101876920B1 (en) 2018-08-07

Family

ID=61901459

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020160120307A KR101876920B1 (en) 2016-06-23 2016-09-20 Antimicrobial peptides with high synergistic effect with antibiotics against Escherichia coli, Acinetobater Baumannii, and their multidrug resistant bacteria and their uses

Country Status (1)

Country Link
KR (1) KR101876920B1 (en)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102267302B1 (en) * 2019-06-19 2021-06-21 대한민국 Novel peptide from Apis mellifera having antimicrobial activity and uses thereof

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
Shin, A. Biochemistry 2015, 54, 3921-3931

Also Published As

Publication number Publication date
KR20180031527A (en) 2018-03-28

Similar Documents

Publication Publication Date Title
US11214594B2 (en) Antimicrobial peptide having synergistic antibacterial effect with antibiotics on multidrug resistant bacteria, and use thereof
KR101875057B1 (en) Antimicrobial peptides with high synergistic effect with antibiotics against multidrug resistant gram-negative bacteria and their uses
KR101734064B1 (en) Novel antimicrobial peptide derived from myxinidin peptide and uses thereof
KR101341210B1 (en) Novel antimicrobial peptide and use thereof
KR101595440B1 (en) The effect of antimicrobial activity of CMA3 analogue peptide derived from CA-MA
KR102158036B1 (en) Novel antimicrobial peptide derived from Pseudin-2 peptide and uses thereof
KR101876920B1 (en) Antimicrobial peptides with high synergistic effect with antibiotics against Escherichia coli, Acinetobater Baumannii, and their multidrug resistant bacteria and their uses
KR101976923B1 (en) Antimicrobial peptides substituted D-leucine for improving antibiotics effect and their uses
KR101970876B1 (en) Antimicrobial peptides substituted D-lysine for improving antibiotics effect and their uses
JP2011510977A (en) Novel antibiotic peptide derived from ribosomal protein L1 of Helicobacter pylori and use thereof
KR101980897B1 (en) Novel antimicrobial peptide derived from LL37 peptide and uses thereof
KR101970875B1 (en) Antimicrobial peptides substituted glumatic acid for improving antibiotics effect and their uses
KR101379318B1 (en) Novel analogues of antibacterial peptide derived from Styela clava and the use thereof
KR102509412B1 (en) Novel antimicrobial peptide and uses thereof
US11117931B2 (en) Antimicrobial peptide derived from Hp1404 peptide and uses thereof
KR102603281B1 (en) Novel peptide derived from Hylin a1 peptide and uses thereof
KR101838208B1 (en) Antimicrobial peptide with improved specificity to gram-negative pathogen and antimicrobial composition comprising the same
KR102358469B1 (en) Antimicrobial peptide derived from Impatiens balsamina and antimicrobial composition comprising the same
KR102608336B1 (en) Novel peptide derived from pep27 peptide and uses thereof
KR102430003B1 (en) Peptide, zophobacin-1 derived from zophobas atratus orientalis and uses thereof
KR102492395B1 (en) Peptide, papiliocin-3 derived from papilio xuthus orientalis and uses thereof
KR20140035744A (en) Novel antibacterial peptide using peptide derived from styela clava and the use thereof
KR101735341B1 (en) An antibacterial composition comprising an extract of corylopsis coreana
KR101667272B1 (en) An antibacterial composition comprising an extract of allilum hookeri
KR20240115407A (en) Novel antimicrobial peptide designed from duck-derived antimicrobial peptide and its use

Legal Events

Date Code Title Description
A201 Request for examination
E902 Notification of reason for refusal
E701 Decision to grant or registration of patent right
GRNT Written decision to grant