KR101502267B1 - 항-vegf 항체 조성물 및 방법 - Google Patents

항-vegf 항체 조성물 및 방법 Download PDF

Info

Publication number
KR101502267B1
KR101502267B1 KR1020137031727A KR20137031727A KR101502267B1 KR 101502267 B1 KR101502267 B1 KR 101502267B1 KR 1020137031727 A KR1020137031727 A KR 1020137031727A KR 20137031727 A KR20137031727 A KR 20137031727A KR 101502267 B1 KR101502267 B1 KR 101502267B1
Authority
KR
South Korea
Prior art keywords
antibody
vegf
amp
tumor
antibodies
Prior art date
Application number
KR1020137031727A
Other languages
English (en)
Other versions
KR20130136014A (ko
Inventor
아니타 카브리에
카일 슐루네거
Original Assignee
페레그린 파마수티컬즈, 인크
아피테크 리서치 에이에스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US98701507P priority Critical
Priority to US60/987,015 priority
Priority to US10604708P priority
Priority to US61/106,047 priority
Priority to US10802308P priority
Priority to US61/108,023 priority
Application filed by 페레그린 파마수티컬즈, 인크, 아피테크 리서치 에이에스 filed Critical 페레그린 파마수티컬즈, 인크
Priority to PCT/GB2008/003745 priority patent/WO2009060198A1/en
Publication of KR20130136014A publication Critical patent/KR20130136014A/ko
Application granted granted Critical
Publication of KR101502267B1 publication Critical patent/KR101502267B1/ko

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6845Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a cytokine, e.g. growth factors, VEGF, TNF, a lymphokine or an interferon
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Abstract

본 발명은 두개의 주요 VEGF 수용체 중 하나(VEGFR2)에만 결합하는 VEGF를 특이적으로 억제하는 인간 항체에 관한 것이다. 상기 항체는 신생혈관형성을 효과적으로 억제하고 종양의 퇴화를 유도하며, 그것들의 특이성 때문에 향상된 안정성을 가진다. 본 발명은 따라서 암 및 다른 신생혈관성 질병을 치료하기 위한 새로운 인간 항체에 기초한 조성물, 방법 및 조합된 프로토콜을 제공한다. 새로운 VEGF-특이적 인간 항체를 사용하는 유리한 면역접합체 조성물 및 방법 또한 제공된다.

Description

항-VEGF 항체 조성물 및 방법{ANTI-VEGF ANTIBODY COMPOSITIONS AND METHODS}

관련 출원에 대한 상호 참조

본 발명은 2007년 11월 9일에 출원된 1차 미국 임시 특허출원 제60/987,015호, 2008년 10월 16일에 출원된 2차 미국 임시 특허출원 제61/106,047호, 2008년 10월 24일에 출원된 3차 미국 임시 특허출원 제61/108,023호에 대한 우선권, 권리의 포기 없이 참조에 의해 본원에 통합된 전체 명세서, 청구항, 서열 및 도면을 청구한다.

본 발명은 일반적으로 항체(antibodies), 신생혈관형성(angiogenesis) 및 종양(tumor)의 치료 분야에 관한 것이다. 더욱 상세하게는, 본 발명은 두개의 VEGF 수용체 중 단지 하나(VEGFR2)에 대한 VEGF 결합을 특별히 억제하는 인간 항-VEGF 항체(human anti-VEGF antibodies)를 제공한다. 이와 같은 항체들은 신생혈관형성을 억제하고 종양 퇴행(regression)을 유발하도록 설계되며, 게다가 그것들의 특정한 차단 특성(blocking properties) 때문에 향상된 안정성을 가진다. 본 발명의 항체 기재(antibody-based) 조성물 및 방법은 또한 면역접합체(immunoconjugates)의 용도 및 다른 치료학적 조합, 키트 및 방법을 제공한다.

화학 치료제(chemotherapeutic agent)에 내성을 가지는 종양 세포는 임상 종양학(clinical oncology)에서 상당한 문제들을 나타낸다. 사실, 이 분야에서의 확실한 진보에도 불구하고 왜 가장 일반적인 형태의 인간의 암 중 대부분이 여전히 효과적인 화학치료의 개입에 영향을 받지 않는가 하는 것이 주요 원인 중 하나이다.

또 다른 종양 치료 방법은 종양 세포로 독소(toxin)를 운반하는 데 사용되는 항종양 세포 항체(anti-tumor cell antibody)인 "면역독소(immunotoxin)"의 사용이다. 그러나, 화학치료의 접근법과 마찬가지로 면역독소 치료 또한 고형 종양(solid tumor)에 적용할 경우 상당한 장애를 발생시킨다. 예를 들면, 항원음성(antigen-negative) 또는 항원결손(antigen-deficient) 세포들은 살아남아 종양을 재증식(repopulate)시키거나 또 다른 전이를 일으킬 수 있다.

고형 종양이 항체 기재 치료에 대하여 저항성을 가지는 것에 대한 또 다른 이유는 종양 덩어리가 일반적으로 항체 및 면역독소와 같은 거대분자 약제(macromolecular agents)에 불투과성이라는 것이다(Burrows et al ., 1992; Dvorak et al ., 1991; Baxter and Jain, 1991). 종양 내에서의 물리적 확산(physical diffusion) 및 간질압(interstitial pressure) 모두 이러한 형태의 치료에 대하여 상당히 제한적이다. 따라서, 모든 인간 암의 90% 이상을 이루고 있는 고형 종양은 지금까지 항체 및 면역독소 치료에 내성을 가지는 것으로 판명되었다.

더욱 최근의 방법은 고형 종양의 맥관구조(vasculature)를 표적으로 하는 것이다. 종양 세포 그 자체보다는 종양의 혈관을 표적으로 하는 것은 내성을 가진 종양 세포의 성장을 야기하지 않고 표적 세포는 쉽게 영향을 받는다는 확실한 이점을 가진다. 더욱이, 많은 종양 세포들이 산소 및 영양분을 위한 단일 혈관에 의존하고 있기 때문에, 혈관의 파괴는 항종양 효과를 증폭시킨다(Burrows and Thorpe, 1993; 1994). 대표적인 혈관 표적 방법은 특히 종양 맥관구조의 마커에 대한 항종양제(anti-cellular agents) 및 독소의 표적 운반을 기재하고 있는 미국 특허출원 제5,855,866호 및 제5,965,132호에 기재되어 있다.

혈관 표적 접근법의 다른 효과적인 버전(version)은 종양 맥관구조 내에서 발현되거나 흡착된 마커에 대한 응고 인자(coagulation factor)를 표적으로 하는 것이다(Huang et al ., 1997; U.S. Patent No. 5,877,289, 6,004,555 및 6,093,399). 종양 맥관구조에 대하여 독소보다는 응고제(coagulants)의 운반이 감소된 면역원성(immunogenecity) 및 더욱 낮은 독소 부작용의 위험에 대하여 더 이점을 가진다. 미국 특허출원 제5,877,289에 기재된 것과 같이, 이와 같은 종양 특이적 "응고 리간드(coaguligands)"에 사용하기 위한 바람직한 응고 인자는 인간 응고유도 단백질(human coagulation-inducing protein)의 절단된 형태(truncated version), 조직 인자(Tissue Fator(TF)), 혈액 응고의 주요 개시자(initiator)이다.

종양 혈관에 대한 독소 및 응고 인자의 특정 운반이 종양 치료에 현저한 이점을 나타내기는 하지만, 어떤 말초 종양 세포(peripheral tumor cell)는 이러한 치료에 의해 야기되는 종양내 파괴(intratumoral destruction)로부터 살아남을 수 있다. 따라서, 항신생혈관형성 방법은 미국 특허출원 제5,855,866호 및 제6,004,555의 종양 파괴 방법과 함께 조합하여 사용할 수 있다.

항신생혈관형성 종양 치료 방법은 일반적으로 고형 종양의 주변에 새로 생성된 혈관의 증식을 억제하는 데 기초한다. 이 치료들은 미세전이(micrometastasis)의 위험을 감소시키고, (수술 또는 화학치료와 같은) 더욱 기존의 처치방법과 함께 후에 고형 종양의 성장을 억제하는 데 특히 효과적이다.

신생혈관형성은 기존의 혈관 및/또는 순환성 내피 줄기세포(circulating endothelial stem cells)로부터의 새로운 맥관구조의 발생을 말한다(Asahara et al., 1997; Springer et al ., 1998; Folkman and Shing, 1992). 신생혈관형성은 배발생(embryogenesis), 상처 치유(wound healing) 및 월경(menstruation)과 같은 많은 생리학적 과정에 있어서 대단히 중요한 역할을 한다. 신생혈관형성은 또한 어떤 병리학적 발병(pathological events)에 중요하다. 고형 종양의 성장 및 전이에 더하여 신생혈관형성 성분과 함께 다른 중요한 조건은 관절염(arthritis), 건선(psoriasis) 및 당뇨성 망막증(diabetic retinopathy)이다(Hanahan and Folkman, 1996; Fidler and Ellis, 1994).

신생혈관형성은 표적 조직 및 멀리 떨어진 부위에서 생성된 신생혈관형성 자극(angiogenic stimuli)과 신생혈관형성 억제제(angiogenic inhibitor)의 균형에 의해 정상(normal) 및 악성(malignant) 조직으로 규정된다(Fidler et al ., 1998; McNamara et al ., 1998). 혈관내피 성장인자-A(vascular endothelial growth factor-A)(VEGF, 혈관 투과성 인자(vascular permeability factor; VPF)로도 알려져 있음)는 신생혈관형성의 주요 자극원(primary stimulant)이다. VEGF는 저산소증(hypoxia) 및 암유발 돌연변이(oncogenic mutations)에 의해 유도되는 다기능성 사이토카인(multifuntional cytokine)이며, 다양한 조직들에 의해 생성될 수 있다(Kerbel et al ., 1998; Mazure et al ., 1996).

병리학적 환경에서 신생혈관형성의 주요 자극원으로서의 VEGF의 인식은 VEGF 활성을 차단하기 위한 다양한 시도들을 이끌어내었다. 억제성 항-VEGF 수용체 항체(inhibitory anti-VEGF receptor antibodies), 수용성 수용체 구조물(soluble receptor constructs), 역배열 방법(antisense strategies), VEGF에 대한 RNA 압타머(RNA aptamers) 및 저분자량의 VEGF 수용체 티로신 카이네이즈(receptor tyrosine kinase; TRK) 억제제는 모두 VEGF 신호전달을 방해하는 데 사용하기 위하여 제안되었다(Siemeister et al ., 1998). 하기의 마우스 유래의 항체(murine antibody)(Kim et al ., 1993; Asano et al ., 1998; Mesiano et al ., 1998; Luo et al., 1998a; 1998b; Borgstrom et al ., 1996; 1998) 및 아바스틴(Avastin; bevacizumab)이라 칭하는 인간화 항-VEGF 항체(humanized anti-VEGF antibody)(Presta et al ., 1997)를 사용한 마우스에서의 종양 성장의 억제는 임상적 용도로 승인되었다(Hurwitz et al ., 2004).

VEGF를 인식하고 VEGF 유도 기능을 억제하는 다른 마우스 유래의 항체들이 보고되어 있다. 이것들은 두개의 주요한 VEGF 수용체 중 단 하나에만 결합하는 VEGF를 억제하는 이점을 가지는, 2C3라 칭하는 마우스 유래의 항체를 포함한다(Brekken et al ., 2000). VEGFR1이 아니라 VEGFR2에 결합하는 VEGF를 차단함으로써, 마우스 유래의 2C3 항체는 VEGFR1을 통해 매개되는 유익한 효과를 유지하는 향상된 안정성 프로필을 가진다(Brekken et al ., 2000; U.S. Patent No. 6,342,219, 6,524,583, 6,342,221).

그러나, 본 발명자들은 VEGF를 인식하고 VEGF 유도성 신생혈관형성을 억제하는 추가 약제의 확인이 다수의 치료적인 선택을 넓히는 데 유익할 것이라는 것을 깨달았다. 예를 들면, 장래성이 있기는 하지만 생쥐 유래의 2C3 항체는 확실한 한계를 가진다. 특히, 상기 2C3 항체는 마우스의 VEGF와 결합하지 않으며, 이는 마우스의 동종의 종양(syngeneic tumor)을 사용하는 전임상 연구에 사용될 수 없다는 것을 의미한다. 따라서, 임상 이용을 위한 전임상 연구에서의 가장 효과적인 임상적용은 마우스와 인간 VEGF 모두에 결합하는 새로운 항체의 개발에 유익할 것이다.

또한, 본 발명자들은 면역학적 관점에서 더욱 허용가능한 인간의 치료를 위한 치료제의 개발이 유익할 것이라는 것을 깨달았다. 이와 관련하여, 인간의 항체들은 일반적으로 인간의 치료에 사용하기 위한 적어도 3개의 강력한 이점을 가진다. 첫째로, 인간의 면역 시스템은 항체를 외부의 것으로서 인식해서는 안된다. 두번째로, 인간의 순환계에서의 반감기(half-life)는 더욱 적고 덜 빈번한 투약이 가능하도록 자연적으로 생성된 인간 항체와 유사할 것이다. 세번째로, 반응하는 부분(effector portion)이 인간이기 때문에, 그것은 예를 들어, 보체 의존적 독성(complement-dependent cytotoxicity; CDC) 또는 항체 의존적 세포독성(antibody-dependent cellular cytotoxicity; ADCC)에 의해 더욱 효과적으로 표적 세포를 파괴하는 인간 면역 시스템의 다른 부분과 더욱 잘 접촉할 것이다.

그러나, 비록 인간의 항체들이 일반적으로 이러한 이점들을 나타낸다는 것을 알았다고 하여도, 성공적인 인간 치료를 위한 후보 물질들을 만들기 위하여 충분히 높은 친화성 및 적절한 기능적 특성을 가지는 인간 항체를 개발하는 것은 결코 수월한 일이 아니라는 것은 잘 알려져 있다. 따라서, 종래에는 여전히 인간의 안전하고 효과적인 치료를 위한 VEGF 유도성 신생혈관형성을 억제하는 약제가 부족하였고, 이러한 약제의 개발에 도전하였다.

본 발명은 항신생혈관형성(anti-angiogenic) 및 항종양 치료에 사용하기 위한 새로운 치료학적 조성물 및 방법을 제공함으로써 종래 기술에서의 어떤 한계점을 극복하였다. 본 발명은 두개의 주요 VEGF 수용체 중 단지 하나(VEGFR2)에만 결합하는 VEGF를 특이적으로 억제하는 기능적 특성을 가지고, 효과적인 치료 방법에 대하여 충분히 높은 VEGF에 대한 친화력을 가지는 인간 항체에 기초한다. 이와 같은 항체들은 신생혈관형성을 억제하며, 임상 이용을 위해 이미 승인된 것들 및 그것들의 특이적 차단 특성 때문에 이미 향상된 안정성을 가지는 것들을 포함하는 다른 항-VEGF 항체만큼 효과적으로 종양을 치료한다. 본 발명의 조성물 및 방법은 또한 제공된 항체의 특정 카테고리를 사용하는 프로드러그(prodrugs)를 포함하는 면역접합체 및 조합의 용도를 제공한다.

본 발명의 두개의 주요 VEGF 수용체 중 단지 하나(VEGFR2)에만 결합하는 VEGF를 특이적으로 억제하는 기능적 특성을 가지는 인간 항체는 VEGF 유도성 신생혈관형성을 억제하는 데 효과적이므로, 항신생혈관형성(anti-angiogenic) 및 항종양 치료에 효과적으로 사용될 수 있다.

본 발명의 명세서의 일부분을 형성하는 하기의 도면들은 본 발명의 어떤 양상을 더 설명하기 위하여 포함된다. 본 발명은 본원에 존재하는 특정 구현의 상세한 명세서와 조합하여 하나 또는 그 이상의 이 도면들을 참조로 하여 더욱 잘 이해될 수 있다.
도 1은 클론 EJ173/112-Cl1(r84/PGN311)의 scFv 형태의 중쇄(VH) 및 경쇄(VL) 가변 영역의 뉴클레오티드 및 아미노산 서열을 나타낸다. ScFv는 pHOG21 내로 Nco/NotI 부위를 통하여 클로닝된다(3.7kb). 초기 클로닝에 사용된 제한 부위(NcoI, HindIII, M1uI 및 NotI)는 이탤릭체로 나타내고 밑줄을 그었다. VH와 VL 사이의 링커 서열은 이탤릭체로 나타내었다.
도 2는 클론 EJ173/112-Cl1(r84/PGN311) scFv가 VEGF에 결합한다는 것을 나타낸다. 도 2는 평판배양된 VEGF-A에 대한 클론 EJ173/112-Cl1(r84), 그것의 모 클론(mother clone) 및 양성 대조군 항체(마우스 유래의 B9)의 결합을 평가하기 위한 ELISA 검정의 결과를 나타낸다. 클론 EJ173/112-Cl1(r84)는 가장 높은 결합 시그널을 나타내었으므로, 가장 높은 친화력을 보여주었다.
도 3은 클론 EJ173/112-Cl1(r84/PGN311) scFv가 VEGF에 결합하기 위하여 2C3 항체와 효과적으로 경쟁함을 나타내며, 이는 경쟁적 ELISA 검정의 결과에 의해 나타난다. 클론 EJ173/112-Cl1(r84)가 VEGF와 결합하기 위하여 2C3 항체와 효과적으로 경쟁하기 때문에, 이것은 클론 EJ173/112-Cl1(r84)가 마우스 유래의 2C3 항-VEGF 항체와 같은 동일한 에피토프에 실질적으로 결합한다는 것을 나타낸다.
도 4는 클론 EJ173/112-Cl1(r84/PGN311) scFv가 마우스 유래의 VEGF 및 인간의 VEGF 모두에 결합함을 나타낸다.
도 5는 고정화된 VEGF-A에 대한 다양한 scFv 항체의 결합 친화력을 검정하기 위해 사용된 비아코어 검정(Biacore assay) 결과를 나타내는 것이다. 결합 곡선은 도 5에 나타내었으며, 그것은 scFv 형태의 EJ173/112-Cl1(r84/PGN311)가 단일 사슬 형태의 모 클론(m)보다 눈에 띄게 더욱 큰 결합 친화력을 가짐을 확인할 수 있다. 나타낸 다른 곡선들은 v41, r68, r3 및 r26으로 표지되었다.
도 6은 EJ173/112-Cl1(r84/PGN311) IgG가 VEGFR2를 통한 VEGF-매개성 세포내 세포 신호전달을 억제함을 나타내는 것이며, 시험관 내 세포 검정의 결과로써 나타내었고, 여기에서 EJ173/112-Cl1(r84) IgG는 Erk1/2의 인산화를 억제함을 보여주었다.
도 7은 클론 EJ173/112-Cl1(r84/PGN311)가 VEGF의 절단된 아형(VEGF121)을 인식함을 보여주며, 이를 ELISA 검정으로부터의 결과로 나타내었다.
도 8A 및 도 8B는 모두 r84/PGN3l1이 VEGFR2와 함께 VEGR의 상호작용을 실질적으로 차단하지만, VEGFR1과 함께 VEGF의 상호작용을 실질적으로 차단하지는 않는다는 것을 보여준다. 지시된 항체의 존재 또는 부재하에서 VEGF-비오틴은 수용성 VEGFR1(도 8A) 또는 VEGFR2(도 8B)로 코팅된 ELISA 플레이트의 웰에서 배양되었다. 지시된 항체의 존재하에서 VEGF 단독(VEGF) 또는 VEGF의 시그널은 VEGF 단독(100%)으로 표준화되었다. 평균 +/- SEM을 표시하였다. N=12(각각 처리를 한 4개의 동일한 플레이트에서 3번 수행하였다). 50% 보다 낮은 시그널은 현저하고 실질적인 결합의 억제로 간주된다. 시나지스(Synagis)는 음성 대조군으로서 사용되는 인간 항-RSV 항체이다. 비교를 위하여, VEGFR2 및 VEGFR1 모두와의 VEGF 상호작용을 실질적으로 차단하는 아바스틴(Avastin; bevacizumab)(Presta et al., 1997) 항체 또한 존재한다.
도 9A 및 9B는 scFv 발현 벡터를 나타내는 것이다. 도 9A는 scFv 발현 벡터 pHOG21. ApR, 암피실린 저항성 유전자(Ampicillin resistance gene); ColE1, DNA 복제 기원; fIIG, 파지 f1(phage f1)의 유전자 내부 영역(intergenic region); c-myc, 단일클론 항체 9E10에 의하여 인식되는 에피토프; His6, 6개의 히스티딘 잔기; pelB, 세균성 펙테이트 리아제(pactate lyase)의 시그널 펩티드; P/O, 야생형 락 프로모터 작동자(wild type lac promoter operator)를 나타낸다. 도 9B는 C-말단 코딩 영역의 뉴클레오티드 서열(SEQ ID NO:28) 및 아미노산 서열(SEQ ID NO:29)를 나타낸다.
도 10A, 도 10B 및 도 10C는 종양 관련 대식세포가 VEGFR2를 발현함을 나타내는 것이다. 도 10A는 대조군 처리 또는 2C3 처리된 동물들로부터 얻은 종양 절편 상의 T014(VEGFR2 항체) 및 F4/80(대식세포 마커) 염색이 동일 위치에 존재(co-localization)함을 나타낸다. 도 10A는 2C3가 대식세포의 침윤을 감소시킴을 보여준다. 그러나, 대조군 및 2C3군 모두 VEGRR2 및 대식세포 마커가 동일 위치에 존재한다는 것을 증명한다. 도 10B는 다수의 세포들이 3가지의 서로 다른 대식세포 마커 및 VEGFR2 중 하나에 대하여 이중 양성(double positive)임을 나타낸다. 도 10C는 종양을 가지는 동물로부터의 복막 대식세포(peritoneal macrophage)가 VEGFR2를 발현함을 보여주기 위하여 VEGFR2에 대하여 두개의 서로 다른 항체를 사용한다.
도 11은 r84/PGN311이 MDA-MB-231 종양의 성장을 억제함을 보여준다. 도 11은 생체 내(마우스) MDA-MB-231 유방암 종양 모델을 사용한 연구로부터의 결과 및 종양 크기에 대한 r84, 아바스틴 또는 식염수(대조군)의 효과를 나타낸다. 평균 종양 크기 +/- SEM을 나타내었다. 아바스틴 및 r84로 처리된 마우스는 대조군 처리된 동물들에 비하여 현저하게 더욱 작아진 종양의 크기를 가진다.
도 12는 각 군에서 각각의 동물에 대한 종양 무게/체중의 비를 나타낸다는 것을 제외하고는, 도 11에 나타낸 것과 같은 동일한 연구로부터의 결과를 보여준다. 아바스틴 및 r84/PGN311 처리된 마우스는 대조군 처리된 동물들에 비하여 현저하게 더욱 작은 종양 크기/체중의 비를 가진다.
도 13은 r84/PGN311이 A673 종양의 성장을 억제함을 보여준다. 도 13은 생체 내(마우스) A673 종양 모델을 사용하는 연구로부터의 결과 및 종양 크기에 대한 r84, 2C3 또는 대조군 항체(시나지스 - 인간 항-RSV)의 효과를 나타낸다. 평균 종양 크기 +/- SEM을 나타내었다. 2C3 및 r84 처리된 마우스는 대조군 처리된 동물들에 비하여 현저하게 더욱 작은 종양 크기를 가지므로, A673 종양의 성장을 조절하는 데 효과적이다.
도 14는 r84/PGN311이 종양 관련 대식세포의 침윤을 현저하게 감소시킴을 보여준다. MDA-MB-231 종양 세포를 가지는 마우스로부터 종양을 얻고 절편한 후, 대식세포 마커(Mac-3)에 대한 항체를 사용하여 염색하였다. 대조군 동물로부터의 3개의 종양 및 각각 r84 및 2C3로 처리된 동물로부터의 3개의 종양을 분석하고, 각 종양으로부터 얻은 5개의 이미지를 분석하였다. 도 14는 r84 및 2C3로 처리된 동물로부터 얻은 종양이 대식세포 마커 Mac-3의 발현을 현저하게 감소시키고, r84는 2C3보다 더욱 명백한 효과(r84에 대하여 p<0.01)를 가짐을 나타낸다.
도 15는 r84/PGN311이 MDA-MB-231 동물 모델의 종양에서 미세혈관의 밀도를 현저하게 감소시킴을 보여준다. MDA-MB-231 종양 세포를 가지는 마우스로부터 종양을 취하고 절편한 후, 마우스 내피 세포에 대한 항체(MECA-32)로 염색하였다. 대조군 동물로부터 얻은 3개의 종양 및 각각 r84와 2C3로 처리된 동물로부터 얻은 3개의 종양을 분석하고, 각 종양으로부터 얻은 5개의 이미지를 분석하였다. 도 15는 r84와 2C3로 처리된 동물로부터의 종양이 현저하게 감소된 다수의 혈관/현미경 시야(high power field)(MECA-32, p<0.0001)을 나타냄을 보여준다.
도 16A 및 도 16B는 r84/PGN311이 VEGFR2 경로를 선택적으로 차단함을 보여준다. 도 16A는 r84/PGN311이 VEGFR2 발현 세포(HDMEC) 상에서 Erk 1/2(pERK1/2) 및 PLC-γ(pPLC-γ)의 VEGF-자극성(+VEGF) 인산화를 억제함을 보여준다. 양성 대조군인 아바스틴 또한 Erk 1/2 및 pLC-γ의 VEGF-자극성 인산화를 억제한다. 도 16B는 r84/PGN311이 VEGFR1 발현 세포(PAE Flt) 상에서 VEGFR1의 VEGF-자극성 인산화를 억제하지 않음을 보여주며, 여기에서 양성 대조군인 아바스틴은 VEGR1의 인산화를 억제한다.
도 17A, 도 17B, 도 17C 및 도 17D는 r84/PGN311이 비소세포 폐암 세포주(non-small lung cancer cell lines)에 의해 만들어진 종양의 성장을 현저하게 감소킴을 보여준다. 도 17A, 도 17B, 도 17C 및 도 17D는 생체 내 마우스 모델 및 4개의 서로 다른 비소세포 폐암 세포주, H460(도 17A), H1299(도 17B), H358(도 17C) 및 A549(도 17D)를 사용한 연구로부터 얻은 결과를 나타낸다. 종양의 ㅋ크큭크기에 대한 r84/PGN311, 아바스틴 또는 대조군 항체(시나지스 또는 XTL)의 효과를 나타내었다(종량의 평균 중량 +/- SEM으로 나타내었다). r84/PGN311 및 아바스틴으로 처리된 마우스는 대조군 처리된 동물들보다 더욱 현저하게 작은 평균 종양 크기를 가진다. r84/PGN311 및 아바스틴은 따라서 비소세포 폐암 세포주의 성장을 조절하는 데 효과적이다. r84/PGN311은 H460(도 17A), H1299(도 17B) 및 A549(도 17D) 모델에서 아바스틴 보다 적어도 더욱 잘 작동한다. r84는 A549 모델(도 17D)에서 아바스틴보다 현저하게 더 우수하다.
도 18A, 도 18B 및 도 18C는 r84 처리된 종양에서의 림프관의 밀도는 대조군 종양에서보다 현저하게 낮음을 보여준다. 도 18A(6개의 패널)은 대조군(위 패널) 및 r84 처리된 종양(아래 패널)에서, 림프관 마커인 포도플라닌(podoplanin; 녹색), 프록스 1(Prox1; 빨강)을 나타내는 동결 MDA-MB-231 종양 절편의 면역형광 염색과 합쳐진 이미지를 나타낸다. 도 18B는(두개의 패널) 대조군(위 패널) 및 r-84 처리된 종양(아래 패널)에서 LYVE-1으로 염색된 MDA-MB-231 종양 절편을 나타낸다. LYVE-1 염색의 패턴(도 18B)은 포도플라닌 및 프록스에 대한 것(도 18A)과 유사하다. 각 LYVE-1으로 염색된 종양 절편의 전체 영역을 저배율로 검사하였으며, 각각의 LYVE-1 양성 부위의 백분율을 NIS-요소 이미징 소프트웨어(NIS-Elements imaging software)를 사용하여 각 필드를 측정하였다(도 18C). 가장 높은 LYVE-1 양성 백분율 부위를 가지는 10개의 필드를 함께 평균내고, 통계분석(unpaired student's t-test)에 의하여 유의성을 검사하여 각 종양과 군에 대한 최종 수치 평균을 얻었다. 대조군 종양의 LYVE-1 양성 부위의 백분율(7.03±1.013; n=6)은 P=0.0042를 가지는 r84 처리된 종양(2.23±0.986; n=5)보다 현저하게 크다.
도 19는 전 인간(fully human) 및 마우스 유래의 키메라 IgG 형태의 r84는 마우스 유래의 VEGF 및 인간 VEGF 모두에 결합한다. 인간 VEGF(0.5μg/mL, R&D) 또는 마우스 VEGF(0.5μg/mL, Sigma)를 96-웰 플레이트의 바닥에 코팅하였다. 웰들을 차단한 후, 지시된 농도의 인간 r84(파란 선) 또는 마우스 키메라 r84(녹색 선)을 사용하여 배양하였다. 웰에 결합한 항체들은 항-인간 Fc 또는 항-마우스 HRP-접합 합체와 함께 배양함으로써 검출된다.
도 20A 및 도 20B는 r84/PGN311이 VEGFR2를 발현하는 내피 세포의 VEGF-유도성 이동을 강력하게 억제함을 보여준다. HDMEC(도 20A) 및 PAE KDR을 발현하는 세포(도 20B)가 트랜스웰 검정(transwell assay)에 사용되었다. 상기 세포들은 자극되지 않거나(not stimulated; NS) VEGF의 이동을 자극하기 위하여 100ng/ml로 VEGF에 노출되고, VEGF-유도성 이동을 억제하기 위한 500배의 몰 과잉 r84, 아바스틴(Avas) 또는 대조군(Cntl) 항체(IgG 형태)의 능력을 시험하였다. VEGF는 자극되지 않은 세포와 비교하여 이동을 유도한다(p<0.01). r84 및 아바스틴은 VEGF-유도성 이동을 억제한다(***, p<0.0001 vs. VEGF 단독).
도 21은 r84/PGN311이 VEGFR1을 발현하는 내피 세포의 VEGF-유도성 이동을 억제하지 않음을 보여준다. PAE Flt1을 발현하는 세포를 자극하지 않거나(NS), 이동을 자극하기 위하여(VEGF) VEGF에 노출시키고, VEGF-유도성 이동을 억제하기 위한 r84, 아바스틴(Avas) 또는 대조군(Cntl) 항체들의 능력을 시험하였다. VEGF는 자극되지 않은 세포에 비하여 이동을 유도한다. 아바스틴은 VEGF-유도성 이동을 현저하게 억제하는데 반하여, r84는 억제하지 않는다. 따라서, 도 21은 r84/PGN311이 VEGFR1을 발현하는 내피 세포의 VEGF-유도성 이동을 억제하지 않음을 보여준다. 오로지 VEGFR1만을 발현하는 내피 세포인 PAE Flt1을 24시간 동안 혈청을 결핍시킨 후, 트랜스웰 인서트(transwell inserts)에 세럼을 포함하지 않는 배지를 넣었다(8μM pores, 5,000 cells/insert). 바람직하지 않은 막으로의 이동은 인서트 아래의 웰에 하기의 것들을 첨가함으로써 자극된다: 혈청을 포함하지 않은 배지(NS); VEGF(100ng/ml); VEGF + 대조군 IgG(Cntl); VEGF + 아바스틴(Avastin); VEGF + r84(r84). 세포들은 막이 제거될 때까지 24시간 동안 이동하게 되고, 막의 표면 위에서 수집된 세포들을 고정하고 DAPI로 염색하였다. 그 후, 바람직하지 않은 막 상에서 DAPI 염색된 핵을 형광 현미경으로 계산하고 소프트웨어(Elements, Nikon)을 사용하여 정량화하였다. *, p<0.05 r84 vs 아비스틴; **, p<0.01 아비스틴 vs 대조군. 도 22는 r84/PGN311이 마우스의 Panc1 췌장 종양 세포의 성장을 현저하게 감소시킴을 보여준다. Panc1 췌장 선암 세포(adenocarcinoma cells)을 가지는 마우스에게 r84/PGN311 IgG 또는 시나지스(음성 대조군) 중 하나를 주었다. 종양의 크기를 치료 시간대별로 나타내었다. 따라서, 도 22는 r84/PGN311이 피하의 인간 췌장 종양 이종이식(zenografts)의 성장을 감소시킨다. Panc1 종양 세포를 0일째에 SCID 마우스의 피하에 주입하였다(2 x 106 cells/animal). 1일째에 마우스를 주당 2번(2x/week) 500μg의 대조군 IgG(시나지스) 또는 r84로 치료하기 시작하였다. 캘리퍼스(calipers)를 사용하여 시간에 따른 종양의 크기를 관찰하였다. 종양 세포 주입(tumor cell injection; TCI) 후 일자별 평균(SEM) 종양 크기(n=5/군)를 나타내었다.
도 23은 마우스 키메라 형태의 r84/PGN311은 동계의 4T1 유방 종양(syngeneic 4T1 mammary tumors)를 가지는 마우스의 생존을 연장시킴을 보여준다. 마우스 유래의 4T1 종양을 Balb/C 마우스에 정위적으로(orthotopically) 주입하였다(그룹 당 n=8 마우스). 마우스 키메라 형태의 r84/PGN311(mcr84, 빨간선) 또는 대조군(대조군, 검은선) 항체 중 어느 하나를 12일 째부터 시작하여 3주 동안 주당 2번 정맥 주사를 통하여 투여하였다. r84/PGN311은 대조군에 비하여 생존을 연장시켰다.
도 24는 (나타낸 것과 같이) 대조군 IgG, 아바스틴, 2C3 또는 r84로 처리된 종양을 가지는 마우스의 혈청으로부터의 마우스 VEGF 농도를 보여준다. 혈청을 수집하고 R&D 시스템사의 키트를 사용하여 마우스 VEGF의 농도를 ELISA로 측정하였다. 게다가, r84 처리된 마우스로부터의 혈청 엘리컷(aliquot)을 단백질 G 비드(Protein G beads)로 미리 제거하였다. 단백질 G가 제거된 혈청으로부터의 상등액(r84 supe) 또한 테스트하였다.
도 25는 r84, r84보다 정도는 덜하지만 아바스틴(bev)이 생체 내에서 MDA-MB-231 종양 내로의 CD1lb+/Gr1+ 세포의 침윤을 감소시키는 반면, 2C3는 감소시키지 않는다. r84에 대한 감소는 39%이다. 일원배치 분산분석(one-way ANOVA)는 감소된 침윤이 r84 처리된 동물에서는 관찰되지만, 2C3 또는 아바스틴(bev) 처리된 동물에서는 관찰되지 않으며, 대조군 처리된 동물들과는 실질적으로 다름을 보여준다(지정된 **, p<0.01).

발명의 요약

본 발명의 특정 이점은 제공된 인간 항체가 VEGFR1이 아니라 VEGFR2에만 결합하는 VEGF를 억제한다는 것이다. 이것은 VEGFR2 및 VEGFR1 모두에 결합하는 VEGF를 억제하는 A4.6.1 및 인간화된 버전인 아바스틴을 포함하는 종래 기술에서의 주요 항체들과는 상반된다. VEGFR1은 예를 들어, 용골 세포(osteoclast) 및 연골파괴 세포(chondroclast) 기능에서 신생혈관형성과는 관련이 없는 중요한 생물학적 역할을 하기 때문에, VEGFR2-매개성(VEGFR2-mediated) 신생혈관형성만을 억제하기 위한 실제 능력만이 명확한 이점이다. 골 대사(bone metabolism), 예를 들어 소아암(pediatric cancers)의 치료에서 주목할만한 임상학적 이점 내에서 이러한 결과들은 불리한 영향이 아니다. 종양의 진행 및 전이 상에서 대식세포(macrophage)의 해로운 영향은 또한 이 대식세포 집단이 본 발명의 항체에 의해 억제되는 VEGFR2를 발현하기 때문에 억제된다.

또 다른 이점은, VEGFR1에 대한 VEGF의 결합은 본 발명의 항체의 존재하에서 유지되기 때문에, 그것들은 종양의 내피 상에서 발현증가(upregulated)된 VEGFR1에 결합하는 VEGF에 결합하므로 종양의 맥관 구조에 부착된 치료제를 명확하게 운반하는 데 사용될 수 있다. 따라서, 면역접합체의 맥락에서, 본 발명은 동일한 분자 내에서 항신생혈관형성 및 종양 파괴 특성 모두를 가지는 약제를 제공한다.

여전히 또 다른 이점이 VEGFR2를 통해 매개되는 VEGF의 생존 신호(survival signal)를 무력화시키기 위하여 제공되는 조성물의 능력에 존재한다. 본 발명의 나상(naked) 결합 항체(conjugated antibodies)는 따라서 다른 치료 및/또는 부착된 약제, 특히 그것들의 파괴적인 특성을 중화시키는 VEGF의 능력 때문에 생체 내에서(in vivo) 최대의 유효성을 달성하는데 실패한 방법 및 약제들과 함께 상승적인 조합을 형성한다.

VEGF, 상보성 결정 부위(complementarity determining regions; CDRs)를 포함하는 그것들의 VH 및 VL 도메인에 결합하는 본 발명의 항체 분자의 아미노산 및/또는 DNA 서열은 본원에 나열된 다양한 서열번호에서 설명한다.

일 구현에서, 본 발명은 VEGF에 결합하고, SEQ ID NO:5의 아미노산 서열 또는 그것과 실질적으로 동일한(homologous) 서열을 포함하는 중쇄(havey chain) CDR1 도메인을 포함하는 항체를 제공한다.

대안적으로 또는 덧붙여서, 본 발명의 구현에서, VEGF에 결합하는 상기 항체는 SEQ ID NO:6의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR2 도메인을 포함한다.

대안적으로 또는 덧붙여서, 본 발명의 구현에서, VEGF에 결합하는 상기 항체는 SEQ ID NO:7의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR3 도메인을 포함한다.

대안적으로 또는 덧붙여서, 본 발명의 구현에서, VEGF에 결합하는 상기 항체는 SEQ ID NO:8의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄(light chain) CDR1 도메인을 포함한다.

대안적으로 또는 덧붙여서, 본 발명의 구현에서, VEGF에 결합하는 상기 항체는 SEQ ID NO:9의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR2 도메인을 포함한다.

대안적으로 또는 덧붙여서, 본 발명의 구현에서, VEGF에 결합하는 상기 항체는 SEQ ID NO:10의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR3 도메인을 포함한다.

따라서, 어떤 구현에서, 본 발명은 하나 또는 그 이상의 중쇄 CDR 도메인을 포함하는 VEGF에 결합하는 항체를 제공하며, 여기에서, 상기 중쇄 CDR 도메인은

(a) SEQ ID NO:5의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR1 도메인;

(b) SEQ ID NO:6의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR2 도메인; 및

(c) SEQ ID NO:7의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR3 도메인

으로 이루어진 군으로부터 선택된다.

본 발명은 또한 어떤 구현에서 하나 또는 그 이상의 경쇄 CDR 도메인을 포함하는 VEGF에 결합하는 항체를 제공하며, 여기에서 상기 경쇄 CDR 도메인은

(a) SEQ ID NO:8의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR1 도메인;

(b) SEQ ID NO:9의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR2 도메인; 및

(c) SEQ ID NO:10의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR3 도메인

으로 이루어지는 군으로부터 선택된다.

어떤 바람직한 구현에서, VEGF에 결합하는 항체는 (a) SEQ ID NO:7의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR3; 및 (b) SEQ ID NO:10의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR 모두를 포함한다.

더욱 바람직하게는, SEQ ID NO:5의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR1 도메인 및/또는 SEQ ID NO:8의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR1 도메인, 및/또는 SEQ ID NO:6의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR2 도메인 및/또는 SEQ ID NO:9의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR2 도메인도 또한 존재한다.

하나의 바람직한 구현에서, SEQ ID NO:5의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR1, SEQ ID NO:6의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR2 및 SEQ ID NO:7의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR3는 각각 또는 조합하여 존재한다.

또 다른 바람직한 구현에서, SEQ ID NO:8의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR1, SEQ ID NO:9의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR2, 및 SEQ ID NO:10의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR3는 각각 또는 조합하여 존재한다.

대안적인 관점에서 보면, 어떤 구현에서, 본 발명은 SEQ ID NO:7의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR3 도메인 및/또는 SEQ ID NO:10의 아미노산 서열 또는 그것과 실질적으로 동일한 경쇄 CDR3 도메인을 포함하는 VEGF에 결합하는 항체를 제공한다. 상기 항체는 선택적으로 SEQ ID NO:6의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR2 도메인 및/또는 SEQ ID NO:9의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR2 도메인을 더 포함하고/하거나 SEQ ID NO:5의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR1 도메인 및/또는 SEQ ID NO:8의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR1 도메인을 더 포함한다.

대안적인 관점에서 보면, 어떤 구현에서, 본 발명은 SEQ ID NO:6의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR2 도메인 및/또는 SEQ ID NO:9의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR2 도메인을 포함하는 VEGF에 결합하는 항체를 제공한다. 상기 항체는 선택적으로 SEQ ID NO;7의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR3 및/또는 SEQ ID NO:10의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR3를 더 포함하고/포함하거나 SEQ ID NO:5의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR1 도메인 및/또는 SEQ ID NO;8의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR1을 더 포함한다.

대안적인 관점에서 보면, 어떤 구현에서, 본 발명은 SEQ ID NO:5의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR1 도메인 및/또는 SEQ ID NO:8의 아미노산 서열 또는 그것과 실질적으로 동일한 경쇄 CDR1 도메인을 포함하는 VEGF에 결합하는 항체를 제공한다. 상기 항체는 선택적으로 SEQ ID NO:7의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR3 도메인 및 또는 SEQ ID NO:10의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR3 도메인을 포함하고/포함하거나 SEQ ID NO:6의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 중쇄 CDR2 도메인 및/또는 SEQ ID NO:9의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 포함하는 경쇄 CDR2 도메인을 더 포함한다.

본 발명의 어떤 바람직한 항체들은 SEQ ID NOs: 5, 6, 7, 8, 9 및 10 또는 앞의 SEQ ID NOs 중 임의의 하나와 실질적으로 동일한 서열로 이루어진 군으로부터 선택된 하나 또는 그 이상의 CDRs를 포함한다.

어떤 바람직한 항체들은 두개 또는 그 이상의 SEQ ID NOs: 8, 9 또는 10의 경쇄 CDRs, 또는 앞의 SEQ ID NOs 중 임의의 하나와 실질적으로 동일한 서열을 포함한다. 특히 바람직한 결합 분자들은 SEQ ID NOs: 8, 9 또는 10의 경쇄 CDRs 중 3개, 또는 앞의 SEQ ID NOs 중 임의의 하나와 실질적으로 동일한 서열(즉, 각각 앞서 언급한 경쇄 CDR1 및 CDR2 및 CDR3 중 하나 또는 그것과 실질적으로 동일한 서열)을 포함한다.

다른 어떤 바람직한 항체들은 두개 또는 그 이상의 SEQ ID NOs. 5, 6 또는 7의 중쇄 CDRs, 또는 앞의 SEQ ID NOs 중 임의의 하나와 실질적으로 동일한 서열을 포함한다. 특히 바람직한 결합 분자들은 SEQ ID NOs: 5, 6 및 7의 중쇄 CDRs 중 3개, 또는 앞의 SEQ ID NOs 중 임의의 하나와 실질적으로 동일한 서열(즉, 각각 앞서 언급한 중쇄 CDR1 및 CDR2 및 CDR3 중 하나 또는 그것과 실질적으로 동일한 서열)을 포함한다.

어떤 더욱 특히 바람직한 항체들은 SEQ ID NOs: 8, 9 또는 10의 경쇄 CDRs 중 3개, 또는 이 서열들 중 임의의 하나와 실질적으로 동일한 서열(즉, 각각 앞서 언급한 경쇄 CDR1 및 CDR2 및 CDR3 중 하나 또는 그것과 실질적으로 동일한 서열 ), 및 SEQ ID NOs: 5, 6 또는 7의 중쇄 CDRs 중 3개, 또는 이 서열들 중 임의의 하나와 실질적으로 동일한 서열을 포함한다(즉, 각각 앞서 언급한 중쇄 CDR1 및 CDR2 및 CDR3 중 하나 또는 그것과 실질적으로 동일한 서열).

어떤 특히 바람직한 항체들은

SEQ ID NO:5의 중쇄 CDR1 도메인,

SEQ ID NO:6의 중쇄 CDR2 도메인, 및

SEQ ID NO:7의 중쇄 CDR3 도메인,

또는 앞의 서열들 중 임의의 하나와 실질적으로 동일한 서열을 포함하고/포함하거나,

SEQ ID NO:8의 경쇄 CDR1 도메인,

SEQ ID NO:9의 경쇄 CDR2 도메인, 및

SEQ ID NO:10의 경쇄 CDR3 도메인,

또는 앞의 서열들 중 임의의 하나와 실질적으로 동일한 서열을 포함한다.

다른 구현에서, 본 발명은 3개의 CDRs 및 3개의 CDRs를 포함하는 적어도 하나의 경쇄 가변 영역(variable region)을 포함하는 적어도 하나의 중쇄 가변 영역을 포함하는 VEGF에 결합하는 항체를 제공하며, 여기에서 상기 경쇄 가변 영역은

(i) SEQ ID NO:8의 아미노산 서열을 가지는 가변(variable light; VL) CDR1,

(ii) SEQ ID NO:9의 아미노산 서열을 가지는 VL CDR2, 및

(iii) SEQ ID NO:10의 아미노산 서열을 가지는 VL CDR3

를 포함한다.

이 구현의 바람직한 양상에서, 하나 또는 그 이상의 상기 중쇄 가변 영역 CDRs는

(i) SEQ ID NO:5의 아미노산 서열을 가지는 불변(variable heavy; VH) CDR1,

(ii) SEQ ID NO:6의 아미노산 서열을 가지는 VH CDR2, 및

(iii) SEQ ID NO:7의 아미노산 서열을 가지는 VH CDR3

로 이루어지는 군으로부터 선택된다.

이 구현의 다른 바람직한 양상에서, 2개의 상기 중쇄 가변 영역 CDRs는

(i) SEQ ID NO:5의 아미노산 서열을 가지는 VH CDR1

(ii) SEQ ID NO:6의 아미노산 서열을 가지는 VH CDR2, 및

(iii) SEQ ID NO:7의 아미노산 서열을 가지는 VH CDR3

로 이루어지는 군으로부터 선택된다.

이 구현의 여전히 다른 바람직한 양상에서, 3개의 상기 중쇄 가변 영역 CDRs는

(i) SEQ ID NO:5의 아미노산 서열을 가지는 VH CDR1,

(ii) SEQ ID NO:6의 아미노산 서열을 가지는 VH CDR2, 및

(iii) SEQ ID NO:7의 아미노산 서열을 가지는 VH CDR3

로 이루어지는 군으로부터 선택된다.

본 발명의 어떤 다른 바람직한 구현은 SEQ ID NOs: 5, 6 또는 7의 하나, 둘 또는 세개의 중쇄 CDRs, 또는 하나 또는 그 이상의 SEQ ID NOs: 5, 6 또는 7과 실질적으로 동일한 서열을 포함하는 VH 도메인, 및/또는 SEQ ID NOs: 8, 9 또는 10의 하나, 둘 또는 세개의 경쇄 CDRs, 또는 하나 또는 그 이상의 SEQ ID NOs: 8, 9 또는 10과 실질적으로 동일한 서열을 포함하는 VL 도메인을 포함하는, VEGF에 결합하는 항체를 제공한다.

특히 바람직한 VL 도메인은 SEQ ID NOs: 8, 9 또는 10의 경쇄 CDRs 중 3개, 또는 하나 또는 그 이상의 SEQ ID NOs: 8, 9 또는 10과 실질적으로 동일한 서열(즉, 각각 CDR1, CDR2 및 CDR3 중 하나 또는 그것과 실질적으로 동일한 서열)을 포함한다.

특히 바람직한 VH 도메인은 SEQ ID NOs: 5, 6 및 7의 중쇄 CDRs 중 3개, 또는 하나 또는 그 이상의 SEQ ID NOs: 5, 6 또는 7과 실질적으로 동일한 서역(즉, 각각 CDR1, CDR2 및 CDR3 중 하나 또는 그것과 실질적으로 동일한 서열)을 포함한다.

본 발명의 더욱 특히 바람직한 구현은 VEGF에 결합하고, SEQ ID NOs: 8, 9 및 10의 3개의 경쇄 CDRs를 포함하는 VL 도메인 및 3개의 중쇄 CDRs를 포함하는 VH 도메인을 포함하는 항체를 제공한다. 바람직한 구현에서, 하나, 둘 또는 세개의 중쇄 CDRs는 SEQ ID NOs: 5, 6 및 7에 정의되어 있는 것과 같다.

본 발명의 어떤 바람직한 구현은 SEQ ID NO:3의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 가지는 VH 도메인 및/또는 SEQ ID NO:4의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 가지는 VL 도메인을 포함하는 VEGF에 결합하는 항체를 제공한다.

더욱 바람직한 구현은 SEQ ID NO:4의 아미노산 서열을 가지는 VL 도메인 및 3개의 중쇄 CDRs를 포함하는 VH 도메인을 포함하는 VEGF와 결합하는 항체를 제공한다. 바람직하게는, 상기 VH 도메인은 SEQ ID NO:3의 아미노산 서열을 가진다.

여전히 다른 구현에서, 본 발명은 SEQ ID NO:21의 아미노산 서열을 포함하거나, VEGF와 결합하는 그것들의 단편 또는 그것들과 실질적으로 동일한 서열을 포함하는, VEGF와 결합하는 항체(상기 항체는 또한 본원에서 r84 또는 PGN311 또는 EJ173/112-Cl1으로 칭함)를 제공한다.

다른 구현에서, 본 발명은 SEQ ID NO:21의 아미노산 서열을 포함하거나, VEGF와 결합하는 그것들의 단편을 포함하는, VEGF와 결합하는 항체(상기 항체는 또한 본원에서 r84 또는 PGN311 또는 EJ173/112-Cl1으로 칭함)를 제공한다.

본 발명은 단일 클론 항체(monoclonal antibody) r84(또한 본원에서 PGN311 및 EJ-173/112-Cl1으로 칭함), 도 1에 나타낸 것의 단일 사슬 형태(SEQ ID NO:21 및 SEQ ID NO:20) 및 실시예 6에 나타낸 것의 전장(full length) IgG 형태를 예로 들었다. r84 항체의 CDR 도메인, VH 및 VL 도메인을 표 1 및 도 1에 나타내었다. 이 CDR 도메인들 또는 VH 및 VL 도메인(또는 그것들과 실질적으로 동일한 서열)을 포함하는 항체들은 본 발명의 바람직한 양상이다.

본 발명의 바람직한 구현은 바람직하게는 SEQ ID NO:20(핵산)에 의해 암호화된 SEQ ID NO:21(아미노산)으로 나타내는 r84 항체의 scFv 형태이다.

본 발명의 다른 바람직한 구현은 r84 항체의 전장 IgG 형태, 바람직하게는 SEQ ID NO:22(핵산)에 의해 암호화된 SEQ ID NO:24(아미노산)으로 나타낸 것의 중쇄; 및 바람직하게는 SEQ ID NO:23(핵산)에 의해 암호화된 SEQ ID NO:25(아미노산)으로 나타낸 것의 경쇄이다.

실질적으로 동일한 서열의 어떤 예는 기재된 아미노산 서열과 적어도 70%의 동일성을 가지는 서열이다.

어떤 구현에서, VEGF에 결합하는 본 발명의 항체는 SEQ ID NO:4의 아미노산 서열에 대하여 적어도 약 75%, 더욱 바람직하게는 적어도 약 80%, 더욱 바람직하게는 적어도 약 85%, 더욱 바람직하게는 적어도 약 90% 또는 95% 및 가장 바람직하게는 적어도 약 97%, 98% 또는 99%의 아미노산 서열 동일성을 가지는 아미노산 서열 영역을 포함하는 적어도 하나의 경쇄 가변 영역, 및/또는 SEQ ID NO:3의 아미노산 서열에 대하여 적어도 약 75%, 더욱 바람직하게는 적어도 약 80%, 더욱 바람직하게는 적어도 약 85%, 더욱 바람직하게는 적어도 약 90% 또는 95% 및 가장 바람직하게는 적어도 약 97%, 98% 또는 99%의 아미노산 서열 동일성을 가지는 아미노산 서열 영역을 포함하는 적어도 하나의 중쇄 가변 영역을 포함한다.

실질적으로 동일한 서열의 다른 바람직한 예는 기재된 아미노산 서열의 보존적 아미노산 치환(conservative amino acid substitutions)을 함유하는 서열이다.

실질적으로 동일한 서열의 다른 바람직한 예는 기재된 하나 또는 그 이상의 CDR 영역에서 1, 2 또는 3, 바람직하게는 1 또는 2의 변경된(altered) 아미노산을 함유하는 서열이다. 이와 같은 변경은 보존된 또는 비-보존된 아미노산 치환 또는 그것들의 혼합일 수 있다.

이와 같은 모든 구현에서, 바람직한 변경은 보존적 아미노산 치환이다.

모든 구현에서, 실질적으로 동일한 서열을 포함하는 항체들은 VEGF와 결합하는 능력을 계속 유지한다.

본 발명의 구현에서, 경쇄 CDR3 도메인에서의 변경을 고려할 경우, 상기 CDR에서 위치 8에서의 L 잔기는 변이(variation) 없이 유지시키는 것이 바람직하다.

본 발명의 다른 구현은 VEGF에 결합하고 본 발명의 항체, 본 발명의 VH 또는 VL 도메인, 또는 본 발명의 하나 또는 그 이상의 CDRs를 포함하는 결합 단백질을 제공한다.

본 발명의 바람직한 항체는 세개의 CDRs를 포함하는 적어도 하나의 중쇄 가변 영역 및 세개의 CDRs를 포함하는 적어도 하나의 경쇄 가변 영역을 포함한다. 대표적이면서 바람직한 이 CDRs의 서열은 본원에 기재되어 있다.

본원에 사용된 것으로서, 상기 간결한 용어 "VEGF"는 특별히 언급하거나 과학 용어로 명확하게 하지 않는 한 혈관 내피 성장 인자-A(Vascular Endothelial Growth Factor-A; VEGF-A)를 의미하며, 또한 혈관 투과성 인자(vascular permeability factor; VPF)로서 알려져 있다.

"VEGF"는 또한 VEGF의 임의의 형태를 의미하며, 특히 VEGF는 표유류에 걸쳐 보존된다. 따라서, 본 발명의 항체 또는 항체 단편들은 예를 들어, 인간, 원숭이, 소(솟과의 동물), 마우스, 쥐, 햄스터, 흰족제비(ferret), 기니아 피그(guinea pig) 및/또는 토끼의 VEGF에 결합할 수 있다. 바람직하게는 본 발명의 항체 또는 항체 단편들은 적어도 인간 VEGF에 결합할 것이다. 어떤 바람직한 구현에서, 본 발명의 항체 또는 항체 단편들은 적어도 인간 및 마우스의 VEGF에 결합할 것이다.

본원에 사용된 것으로서, 본 발명의 항체 또는 항체 단편의 맥락에서 상기 용어 "VEGF와 결합하는 것(that binds VEGF)"은 하나 또는 그 이상의 하기의 것; 바람직하게는 많은 수의 하기의 것; 및 가장 바람직하게는 하기의 것이 모두 가능한:

(a) 웨스턴 블롯(Western blot)에서 VEGF에 결합함으로써 측정되는 것과 같이, 비-구조적인 의존성 VEGF 에피토프(non-conformationally dependent VEGF epitope)에 결합하고;

(b) 자유 VEGF 또는 고체 지지체 상의 VEGF에 결합하고;

(c) 적어도 인간 VEGF 및 마우스 VEGF에 결합하고;

(d) VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 현저하게 억제하거나 현저하게 감소시키고;

(e) VEGF를 현저하게 억제하지 않거나 VEGF 수용체 VEGFR1(Flt-1)에 결합하는 것을 감소키고;

(f) VEGFR2의 VEGF-유도성 인산화(phosphorylation)를 억제, 바람직하게는 현저하게 억제하고,

(g) VEGF-유도성 혈관 투과를 억제, 바람직하게는 현저하게 억제하고,

(h) VEGF-매개성 내피세포 증식을 억제, 바람직하게는 현저하게 억제하고,

(i) 신생혈관형성을 억제, 바람직하게는 현저하게 억제하고,

(j) 림프관 형성(lymphangiogenesis)을 억제, 바람직하게는 현저하게 억제하고,

(k) VEGFR1-매개성 자극 또는 VEGFR1-발현성(VEGFR1-expressing) 용골세포 또는 연골파괴 세포와 같은 세포의 활성을 현저하게 억제하지 않고/않거나,

(l) 동물에 투여하여 혈관이 생성된 종양과 함께 종양의 맥관구조 및/또는 종양의 기질(stroma)에 대한 위치를 특정하는

인간 항체 또는 항체 단편들을 의미한다.

더욱 바람직하게는, 본 발명의 인간 항체 또는 항체 단편들은 VEGF 수용체 VEGFR1(Flt-1)에 결합하는 VEGF를 현저하게 억제하는 일 없이 VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 현저하게 억제하는 것이다.

따라서, 본 발명은 VEGFR2 수용체에 결합하는 VEGF를 특이적으로 차단하거나 특히 VEGFR2 수용체에만 결합하는 VEGF를 차단하는 인간 항체를 제공한다. 이와 같은 인간 항체들은 VEGFR1 수용체(Flt-1)에 결합하는 VEGF를 현저하게 억제하는 일 없이 VEGFR2 수용체(KDR/Flk-1)에 결합하는 VEGF를 현저하게 억제한다. 이와 같은 인간 항체들은 따라서 VEGFR2 수용체(KDR/Flk-1)에 결합하는 VEGF는 억제하며, 실질적으로 VEGFR1 수용체(Flt-1)에 결합하는 VEGF는 억제하지 않고, 생체 내에서 항신생혈관형성 및 항종양 효과를 나타내며, 용골 세포 또는 연골파괴 세포의 기능과 같은 VEGFR1-매개성 사건을 현저하게 억제하지 않는다.

따라서, 본 발명의 인간 항체들은 간결하게 "VEGFR2-차단, 비-VEGFR1-차단, 인간 항-VEGF 항체(VEGFR2-blocking, non-VEGFR1-blocking, human anti-VEGF antibodies)"로 칭한다. 심지어 더욱 간결하게는, 그것들은 본 발명의 모든 조성물, 용도 및 방법에 관련하여 간략하게 사용되는 "VEGFR2-차단, 인간 항-VEGF 항체(VEGFR2-blocking, human anti-VEGF antibodies)"로 칭한다.

따라서, 이 발명을 고려하여 VEGFR2-차단 인간 항-VEGF 항체의 범위는 VEGFR1을 통한 VEGF 신호전달(signaling)을 억제하지 않고 그것에 관련된 주목할 만한 단점 및 부작용들 없이, 신생혈관형성의 억제 및 신생혈관형성성 질병 및 종양의 치료를 포함하는 다양한 구현으로 만들어지고 사용될 수 있다.

어떤 구현에서, 본 출원은 VEGFR2-차단 인간 항-VEGF 항체 후보물질을 만들기 위한 방법 및 후보물질들의 집단으로부터 실제적인 VEGFR2-차단에 특이적인 항체를 확인하는 데 필요한 검정법의 통상적인 기술 양상을 더 기술한다.

전 출원에 걸쳐 사용된 것으로서, 상기 용어 "하나(a or an)"는 여기에서 상한치(upper limit)가 그에 따라 특정하게 언급되는 경우를 제외하고는 그것들이 참조된 조성물 또는 단계의 "적어도 하나(at least one)", "적어도 제1의(at least a first)", "하나 또는 그 이상(one or more)" 또는 "많은 수(a plurality)"를 의미하는 것으로 사용된다. 따라서, 본원에서 사용된 것으로서 "항체(antibody)"는 "적어도 제1의 항체(at least a first antibody)"를 의미한다. 임의의 단일 약제의 양으로서, 조합의 실시가능한 한계와 파라미터는 본 명세서를 고려하여 당업자가 알 수 있을 것이다.

"VEGF 수용체 VEGFR2(KDR/Flt-1)에 결합하는 VEGF를 특이적으로 억제하는" 본 발명의 인간 항체들은 경쟁(competition)적 및/또는 기능적(functional) 검정에 의해 확인될 수 있다. 단순화를 위한 바람직한 검정은 ELISA를 기초로 한 경쟁적 검정이다. 경쟁적 검정에서, 다양한 양의 시료 항체와 VEGF를 프리믹스(pre-mixes)하거나 혼합하고(예를 들어, 100배 내지 1000배의 몰 과잉, 예를 들어, 500배 또는 750배 몰 과잉), VEGFR2에 결합하는 VEGF를 감시키기 위한 시료 항체의 능력을 측정한다. VEGF는 미리 표지(pre-labeled)되어 직접 검출될 수 있거나, (2차) 항-VEGF 항체 또는 2차 및 3차 항체 검출 시스템을 사용하여 검출될 수 있다. 이러한 경쟁적 검정의 ELISA 형식은 바람직한 형식이지만, 임의의 형태의 면역경쟁적 검정도 수행될 수 있다.

이러한 경쟁적 검정에서 (비-차단 항-VEGF 단일클론 항체들을 포함하는) 완전히 관련이 없는 항체의 존재하에서 VEGFR2에 결합하는 VEGF는 대조군의 높은 값(100%)이다. 테스트 검정에서, 테스트 항체의 존재하에서 VEGFR2에 결합하는 VEGF의 현저한 감소는 VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 현저하게 억제하는 테스트 항체를 나타내는 것이다.

현저한 감소는 "재현가능한(reproducible)", 즉 결합에의 감소가 지속적으로 관찰되는 것이다. 본 출원에 의한 "현저한 감소(significant reduction)"는 VEGF에 대한 항체의 약 100배 내지 약 1000배(예를 들어, 약 500배 또는 약 750배)의 몰 과잉(molar excess) 사이의 임의의 양에서 적어도 약 50%, 약 55%, 약 60% 또는 약 65%의 (VEGFR2에 결합하는 VEGF에서의) 재현가능한 감소로서 정의된다. 대안적인 관점에서 보면, (대조군의 값 100%와 비교할 경우) 50%보다 적은 시그널은 결합의 현저한 억제로 간주된다.

본 발명의 바람직한 특징은 제공된 인간 항체들이 실질적으로 또는 현저하게 VEGFR1에 결합하는 VEGF를 감소시키거나 차단하지 않는다는 것이다. VEGFR2에 결합하는 VEGF의 적당하게 현저한 감소를 보이는 인간 항체들은 그것들이 VEGFR1에 결합하는 VEGF를 실질적으로 억제하지 않는 한 여전히 유용할 것이다. 그럼에도 불구하고, 더욱 바람직한 항체들은 VEGFR2에 결합하는 VEGF를 억제하는 데 더욱 현저한 능력을 가지는 것들일 것이다. 이 항체들은 VEGF에 대한 항체의 약 100배 및 약 1000배(예를 들어, 약 500배 또는 약 750배)의 몰 과잉 사이의 임의의 양에서 적어도 약 70%, 약 75% 또는 약 80%로 VEGFR2에 결합하는 VEGF를 감소시키기 위한 재현가능한 능력을 나타내는 것들이다. 비록 본 발명을 실시하는 데 있어 필수적이지는 않지만, 적어도 약 85%, 약 90%, 약 95% 또는 심지어 더욱 높은 %로 VEGFR2에 결합하는 VEGF를 감소시키는 항체들을 결코 제외시키는 것은 아니다.

VEGF 수용체 VEGFR1(Flt-1)에 결합하는 VEGF를 현저하게 억제하는 일 없이 VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 억제하는 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편(antigen-binding fragments)들은 VEGFR1을 사용하는 것이 아니라 상기에 기재된 것들과 같은 간단한 경쟁적 검정에 의해 쉽게 확인된다.

현저한 억제 또는 감소의 부재(absence)는 "재현가능"하고, 즉 "결합의 실질적인 유지(substantial maintenance of binding)"가 지속적으로 관찰된다. 본 출원에 의한 "결합의 실질적인 유지"는 VEGF에 대한 항체의 약 100배 및 약 1000배 몰 과잉 사이의 임의의 양에서 적어도 약 60%, 약 75%, 약 80% 또는 약 85%의 (VEGFR1에 대한 VEGF 결합에서의) 재현가능한 유지로서 정의된다.

VEGFR1에 결합하는 VEGF를 실질적으로 억제하지 않는 인간 항체를 이용하는 본 발명은 VEGFR1에 의해 매개된 생물학적 기능을 유지하는 것이다. 따라서, 항체는 생물학적 반응이 VEGF에 의해 유도되기 위하여 단지 VEGFR1에 결합하는 VEGF를 충분히 유지할 필요가 있다. 그럼에도 불구하고, 더욱 바람직한 항체들은 VEGFR1에 결합하는 VEGF를 유지하기 위한 더욱 현저한 능력을 가지는 것들일 수 있다. 이 항체들은 VEGF에 대한 항체의 약 100배 및 약 1000배의 몰 과잉 사이의 임의의 양에서 적어도 약 88%, 약 90%, 약 92%, 약 95% 또는 약 98-99%의 레벨로 VEGFR1에 결합하는 VEGF를 유지하기 위한 재현가능한 능력을 나타내는 것들이다.

VEGFR2에 결합하는 VEGF를 더욱 실질적으로 억제하는 인간 항체들은 VEGFR1과의 결합에서는 그 이상의 감소를 보이지는 않을 것이라는 것을 알 수 있다. 동등하게는, 항체가 VEGFR2에 결합하는 VEGF에 적당한 감소(moderate reduction)를 보이는 경우, VEGFR1에 대한 결합의 유지는 더욱 엄격해져야만 할 것이다.

항체가 VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 억제한다는 것을 확인 및/또는 승인하기 위한 또 다른 바람직한 결합 검정은 공침 검정(co-precipitation assay)이다. 공침 검정은 용액에서 하나 또는 그 이상의 수용체에 대한 VEGF의 결합을 차단하기 위한 항체의 능력을 테스트한다. 이와 같은 검정에서, VEGF 또는 검정가능하도록 표지된 VEGF는 적절한 형태의 수용체와 함께 배양된다.

면역침전(immunoprecipitation) 또는 공침전 검정을 수행하기 위한 많은 형식들이 있다. 현재의 경우에 있어서, "수용체의 적절한 형태(suitable form of the receptor)"는 쟁점중인 VEGFR2 수용체 또는 수용체의 세포외 도메인(extracellular domain)일 수 있다. 표준 시약, VEGFR2 수용체에 대한 항체의 존재 또는 VEGF가 결합하는 부위와 구별되는 수용체의 세포외 도메인 상의 에피토프 뿐만 아니라, 면역침전도 그 후 필요할 것이다. 본 발명은 다른 "적절한" 형태의 VEGF 수용체들, 즉 Fc 항체 부분에 연결되어 있는 수용체의 세포외 도메인을 제공한다. 이와 같은 수용체/Fc 구조물들은 단백질 A-기재 조성물과 같은 효과적인 면역침전 조성물과 함께 배양함으로써 침전될 수 있다.

적절한 수용체에 상관 없이, 면역침전 또는 공침전 검정은 대조군과 함께 수행하는 데 바람직하다. 선택된 수용체에 결합하는 VEGF의 단독 능력은 항-VEGF 항체의 부재하에서 침전에 의해 확인되어야만 한다. 바람직하게는, 대조군으로서 작용하기 위한 공지의 결합 특성을 가지는 항체의 존재 또는 부재하에서 병행 배양(parallel incubation)을 수행한다. 가장 바람직하게는, 차단 대조군 항체 및 비-차단 대조군 항체 모두를 사용한 검정을 병행하여 실시한다.

임의의 결합된 면역학적 종들이 그 후 예를 들어, 단백질 A 조성물 또는 단백질 A 세파로오스 비즈(sepharose beads)와 같은 효과적인 면역침전 조성물과 함께 배양함으로써 면역침전된다. 상기 침전물은 그 후 VEGF의 존재에 대하여 테스트된다. 초기 배양에서 VEGF가 방사성 표지된(radio-labeled) VEGF와 같은 검출가능하도록 표지된 VEGF인 경우, 면역 침전물에서 임의의 VEGF는 직접 검출될 수 있다. 면역 침전물에서 임의의 비표지된 VEGF는 다른 적절한 방법, 예를 들어, 겔 분리(gel separation) 및 항-VEGF 항체를 사용한 면역검출에 의해 검출될 수 있다.

이와 같은 공침전 검정에서, VEGFR2와 같은 VEGF 수용체에 결합하는 VEGF를 차단하기 위한 인간 항체의 능력은 쉽게 정량될 수 있으나, 정성적 결과 또한 중요하다. 정량은 표지된 VEGF의 직접적인 측정 또는 예를 들어, 면역검출된 VEGF의 물리적 밀도 분석(densitometric analyses)에 의해 달성될 수 있다. 따라서, 재현성을 나타내는, 즉 VEGFR2에 결합하는 VEGF를 저해하기 위한 능력이 지속적으로 관찰되는 항체들이 검출될 수 있고, 유용한 항체들이 상기에 약술된 정량적 기준에 따라서 선택될 수 있다.

VEGF 수용체 VEGFR1(Flt-1)에 결합하는 VEGF를 현저하게 억제하지 않는 인간 항-VEGF 항체들 또한 상기에 기재된 것과 같은 공침전을 수행함으로써 쉽게 확인될 수 있으나, VEGFR2 보다는 VEGFR1을 사용한다. 따라서, VEGF 수용체 VEGFR1(Flt-1)에 결합하는 VEGF를 현저하게 억제하는 일 없이 VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 억제하는 항-VEGF 항체들 또한 이와 같은 방법을 사용하여 쉽게 확인될 수 있다.

본 출원은 또한 인간 항체가 VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 현저하게 억제하는가를 확인하기 위한 다양한 기능적 검정법을 제공한다. 이것들은 일반적으로 어떤 정의된 생물학적 반응을 담당하는 수용체와 같은 VEGFR2의 확인에 관련된 것이다. 비록 앞서 말한 무세포계(cell-free system)에서 수행되는 경쟁형 검정이 가장 재현가능하고(reproducible), 신뢰성이 높고(reliable), 노동 절약형이며(labor-saving) 비용 효과적이나, 하기의 검정법들 또한 본 발명의 맥락에 있어서 유용하다.

예를 들면, VEGFR2-차단성 인간 항-VEGF 항체는 (VEGF의 분열촉진(mitogenic) 활성을 억제하는) VEGF-매개성 내피세포 성장을 저해하기 위한 능력에 대한 테스트에 의해 확인될 수 있다. 임의의 적절한 검정들이 테스트 항체들의 존재 여부에 관계없이 VEGF의 존재하에서 임의의 다양한 내피 세포를 사용하여 사용될 수 있다. 바람직하게는, VEGF를 사용하지 않은 것과 정의된 특성(차단성과 비차단성 모두)의 대조군 항체를 사용한 것과 같이, 이중 검정(duplicate assays)을 병행하여 수행한다. 내피세포 성장이 측정될 수 있으며, 바람직하게는 비색 검정(colorimetric assays)을 포함하는 세포수를 측정하는 임의의 허용가능한 방법에 의해 정확하게 정량화될 수 있다.

VEGF-매개성 내피세포 성장을 억제하는 능력을 가지는 인간 항체는 일반적으로 약 25%, 30%, 35%, 40%, 45% 또는 50% 정도의 VEGF-매개성 내피세포 성장의 지속적으로 관찰되는 억제를 나타낼 것이다. 이와 같은 범위의 억제는 생체 내(in vivo)에서 신생혈관형성을 억제하는 데 충분한 특성을 가지는 항체를 나타낼 것이다. 더욱 현저한 억제 활성을 가지는 항체들은 본 발명으로부터 제외되지 않는다.

본 발명에 따른 인간 항체를 확인하기 위한 또 다른 기능적 검정법은 VEGF-유도성 인산화의 차단을 테스트하기 위한 검정이다. 임의의 형태의 천연(native) 또는 재조합의 인산화가능한(phosphorylatable) VEGFR2를 나타내는 임의의 다양한 내피세포를 사용하는 임의의 적절한 검정이 사용될 수 있다. 세포들은 적절한 기간 동안 테스트될 항체의 존재 또는 부재하에서 VEGF와 함께 배양된다. 바람직하게는, VEGF를 사용하지 않은 것과 정의된 특성(차단성 및 비차단성 모두)의 대조군 항체를 사용한 것과 같은 이중 검정을 병행하여 수행한다.

VEGFR2의 VEGF-유도성 인산화는 측정될 수 있고, 바람직하게는 임의의 허용가능한 방법에 의해 정확하게 정량화될 수 있다. 일반적으로, VEGFR2는 추가 분석을 위하여 면역침전시킨다. VEGFR2의 인산화 정도는 직접 측정될 수 있으며, 예를 들어, 세포들은 면역침전된 VEGFR2 내에서 32P의 직접적인 정량을 가능하게 하는 32P-표지된 ATP와 함께 배양된다. 바람직하게는, 면역침전된 VEGFR2는 다른 방법, 예를 들어, 겔 분리 및 포스포티로신 잔기(phosphotyrosine residues)에 결합하는 항체를 사용한 면역검출에 의하여 분석된다. VEGFR2의 VEGF-유도성 인산화를 억제하는 능력을 가지는 인간 항체는 일반적으로 인산화된 VEGFR2의 레벨로 지속적으로 관찰되는 감소를 나타낼 것이다.

본 발명에 따른 VEGFR2-차단성 인간 항-VEGF 항체를 확인하기 위한 여전히 또 다른 기능적 검정법은 VEGF-유도성 혈관 투과성의 억제를 테스트하기 위한 검정법이다. 비록 임의의 이와 같은 검정법이 사용될 수 있다 하여도, 특히 적합한 검정법은 마일즈 투과성 검정(Miles permeability assay)이며, 여기에서 기니아 피그와 같은 동물들에 에반스 블루 염료(Evan's blue dye)와 같은 염료를 주사하고, 테스트 항체들의 존재 또는 부재하에서 VEGF를 공급한 후 동물의 피부에서 염료의 출현을 측정하였다. 바람직하게는, VEGF를 사용하지 않은 것과 정의된 특성(차단성 및 비차단성 모두)의 대조군 항체를 사용한 것과 같은 이중 검정을 병행하여 수행한다. 동물 피부에서 염료의 출현은 동물의 등에서 사진으로 찍을 수 있고 측정할 수 있는 파란 점과 같은 국소적인 점으로 나타난다.

VEGFR2-차단성 인간 항-VEGF 항체들은 VEGF에 대하여 100배 또는 1000배의 몰 과잉으로 제공될 때와 같은 저농도에서 지속적으로 관찰되는 억제와 같이 VEGF-유도성 혈관 투과를 억제할 것이다. VEGFR2에 결합하는 VEGF를 차단하지 않는 항체들은 VEGF-유도성 혈관 투과에 임의의 현저한 억제를 보이지 않을 것이다. 일반적으로, VEGF에 대하여 10배의 몰 과잉에서와 같은 높은 농도에서 VEGF-유도성 투과만을 차단하는 항체들은 본 발명에 따른 특성을 가지는 항체들이 아닐 것이다.

널리 사용되는 신생혈관형성에 대한 기능적 검정법과 그리고 항신생혈관형성 약제는 신생혈관형성(neovascularization)의 각막 미세주머니 검정(corneal micropocket assay) 및 닭의 융모막 요막(chick chorio-allantoic membrane; CAM) 검정이다. 미국 특허등록 제5,712,291호는 특히 각막 미세주머니와 닭의 융모막 요막 검정이 극도로 넓은 범위의 신생혈관형성성 질병의 치료에 사용하기 위한 약제를 확인하는 데 충분히 효과적이라는 것을 나타내는 참조로서 본원에 통합되어 있다.

미국 특허등록 제5,001,116호 또한 특히 CAM 검정을 설명하기 위한 목적으로 참조로서 본원에 통합되어 있다. 본질적으로, 수정된 닭의 배아(fertilized chick enbryos)는 3일 또는 4일 째에 그것의 껍질로부터 제거되고, 테스트 화합물을 함유하는 메틸셀룰로오스 디스크(methylcellulose disc)가 융모막 요막 상에 이식된다. 상기 배아들을 대략 48시간 후에 검사하여, 만일 깨끗한 무혈관성 존(avascular zone)이 메틸셀룰로오스 디스크 주변에 나타난다면, 그 존의 지름을 측정한다. 본 발명의 맥락에 있어서, 이러한 목적을 위하여 참조로 본원에 특별히 통합되어 있는 미국 특허등록 제5,712,291호에 기재된 바와 같이, 임의의 무혈관성 존의 출현은 항신생혈관형성 항체를 증명하기에 충분하다. 더욱 큰 존을 나타낼수록 더욱 효과적인 항체이다.

신생혈관 형성의 각막 미새주머니 검정은 쥐 또는 토끼의 각막을 사용하여 수행될 수 있다. 이 생체 내(in vivo) 모델은 각각 증명을 목적으로 참조에 의해 본원에 특별히 통합되어 있는 미국 특허등록 제5,712,291호 및 제5,871,723호에서 증명된 것과 같이, 임상학적 유용성의 예측을 위한 것으로서 널리 사용된다. 비록 본 발명과 특별히 관련된다고는 할 수 없으나, 그것들은 일반적으로 그 자체로는 불활성이지만 활성 화합물을 산출하기 위하여 대사되는 화합물을 인식할 것이기 때문에, 상기 각막 검정은 CAM 검정에 비하여 바람직하다.

본 발명에서, 상기 각막 미세주머니 검정은 항신생혈관형성 약제를 확인하는 데 사용된다. 이것은 각막 내의 다수의 혈관에서 지속적으로 관찰되고 바람직하게는 두드러진 감소를 나타내는 것과 같은 신생혈관형성에서의 현저한 감소에 의해 증명된다. 이와 같은 반응들은 바람직하게는 테스트 물질과 접촉하였을 때 지속된 성장의 증거를 나타내지 않는, 가끔 발아(sprout) 및/또는 헤어핀 루프(hairpin loop)만을 보여주는 각막들로 정의된다.

청구된 것과 같은 본 발명은 본 발명의 명세서, 쉽게 입수가능한 기술 참고문헌들, 노하우 및 시료 물질에 따를 수 있다.

따라서, 본 발명의 어떤 바람직한 구현은 본 발명의 적어도 제1의 인간 항-VEGF 항체 또는 그것들의 항원 결합 단편들을 포함하는 조성물이다.

VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 특이적으로 억제하는 인간 항-VEGF 항체 또는 그것들의 항원 결합 단편들; 및 VEGF 수용체 VEGFR1(Flt-1)에 결합하는 VEGF를 현저하게 억제하는 일 없이 VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 억제하는 항-VEGF 항체 또는 그것들의 항원 결합 단편들은 본 발명의 다른 양상들을 형성한다.

바람직한 조합의 특성을 가지는 인간 항체들은 수용체 경쟁자, ELISA, 공침전 및/또는 상기에 기재된 기능적 검정들의 하나 또는 그 이상 또는 조합에 의해 쉽게 확인될 수 있다. VEGFR2에 결합하는 VEGF를 지속적으로 현저하게 감소시키고 VEGFR1에 결합하는 VEGF를 지속적으로 현저하게 억제하지 않는 항체의 정량적 평가를 고려하는 지시는 상기에 기재된 것과 같다.

r84는 본원에서 VEGF에 대한 100배 및 500배의 몰 과잉에서 각각 약 11% 및 2%로 VEGFR2로 코팅된 ELISA 웰에 결합하는 VEGF의 양을 감소시키는 것으로 나타났다. 이 수치들은 각각 약 89% 및 약 98%의 VEGFR2에 결합하는 VEGF의 감소에 해당한다. r84는 본원에서 VEGF에 대한 100배 및 500배의 몰 과잉에서 각각 약 94% 및 84%로 VEGFR1으로 코팅된 ELISA 웰에 결합하는 VEGF의 양을 유지하는 것으로 나타났다. 심지어 VEGF에 대한 1000배의 몰 과잉에서도, r84는 여전히 약 65%로 VEGFR1에 결합하는 VEGF를 유지한다. VEGFR2에 결합하는 VEGF를 더욱 실질적으로 억제하는 항체들은 VEGFR1과의 결합에서는 그 이상의 감소를 보이지는 않을 것이라는 것을 알 수 있다. 동등하게는, 항체가 VEGFR2에 결합하는 VEGF에 적당한 감소(moderate reduction)를 보이는 경우, VEGFR1에 대한 결합의 유지는 더욱 엄격해져야만 할 것이다. 따라서, 두개의 값 사이에서의 "상대적인(comparative)" 차이가 중요하다는 것을 확인할 수 있을 것이다.

본원에 정의된 것과 같은 본 발명의 인간 항체를 암호화하는 핵산 서열을 포함하는 핵산 분자, 또는 그것들의 일부분 또는 단편, 또는 그것들과 실질적으로 동일한 핵산 분자는 본 발명의 여전히 다른 양상을 형성한다. 바람직한 핵산 분자는 (바람직하게는 SEQ ID NO:20에 의해 암호화되는) SEQ ID NO:21로 시작하는 아미노산 서열을 암호화하는 서열을 포함한다. 다른 바람직한 핵산 분자는 (바람직하게는 SEQ ID NO:22에 의해 암호화되는) SEQ ID NO:24의 아미노산 서열을 가지는 중쇄를 암호화하고, (바람직하게는 SEQ ID NO:23에 의해 암호화되는) SEQ ID NO:25의 아미노산 서열을 가지는 경쇄를 암호화하는 서열을 포함한다.

다른 바람직한 핵산 분자는 본 발명의 항체의 IgG 형태 또는 예를 들어, 실시예 6에 기재된 것과 같은 마우스 유래의 키메라(chimeric) 형태를 암호화하는 서열을 포함한다.

상기에 나타낸 바와 같이, 본 발명에 포함되는 다른 핵산 분자들은 예를 들어, 항체의 중쇄를 암호화하는 핵산 분자(예를 들어, SEQ ID NO:22와 같은 SEQ ID NO:24를 암호화하는 핵산 분자) 또는 항체의 경쇄를 암호화하는 핵산 분자(예를 들어, SEQ ID NO:23과 같은 SEQ ID NO:25를 암호화하는 핵산 분자)와 같은 본 발명의 인간 항체의 일부분 또는 단편을 암호화하는 핵산 분자이다. 다른 바람직한 핵산 분자들은 본 발명의 항체의 VH 영역을 암호화하는 핵산 분자(예를 들어, SEQ ID NO:1 또는 SEQ ID NO:26과 같은 SEQ ID NO:3을 암호화하는 핵산 분자)이다. 다른 바람직한 핵산 분자들은 본 발명의 항체의 VL 영역을 암호화하는 핵산 분자(예를 들어, SEQ ID NO:2 또는 SEQ ID NO:27과 같은 SEQ ID NO:4를 암호화하는 핵산 분자)이다.

따라서, 본원에 정의된 것과 같은 본 발명의 항체의 단편들 또는 그것들과 실질적으로 동일한 서열들 또는 이와 같은 단편들을 암호화하는 서열들을 포함하는 핵산 부자들은 본 발명의 여전히 다른 양상을 형성한다.

유리하게는, IgG 형식일 경우, 본 발명의 항체는 VEGF에 대한 높은 결합 친화력(binding affinity), 즉 1 x 10-8M 또는 그보다 적은 범위의 Kd를 가진다. 중요하게는, 이와 같은 친화력을 가지는 항체들은 치료에 유용함을 나타내는 확립된 범위에 있다. 바람직하게는, IgG 형식일 경우, 본 발명의 항체는 20nM, 15nM 또는 10nM보다 적은, 더욱 바람직하게는 10, 9.5, 9, 8.5, 8, 7.5, 7, 6.5, 6, 5.5, 5, 4.5, 4, 3.5, 3, 2.5, 2, 1.5 또는 1nM보다 적은 Kd에 일치하는 VEGF(바람직하게는, 인간의 VEGF)에 대한 결합 친화력을 가진다. 예를 들면, IgG 형식일 경우, 본 발명의 항체의 결합 친화력은 약 7 x 10-9M 또는 약 6 x 10-9M과 같거나 6.7 x 10-9M 처럼 6.7 x 10-9M 또는 그보다 적을 수 있다. Kd를 측정하기 위한 임의의 적절한 방법이 사용될 수 있다. 그러나, 바람직하게는 상기 Kd는 예를 들어, 라인위버-버크 방법(Lineweaver-Burk method)을 사용하거나 바람직하게는 비아코어 3000 평가 소프트웨어(Biacore 3000 Evaluation software)에서의 1:1 결합 모델과 같은 상용의 결합 모델 소프트웨어를 사용함으로써, 표준 곡선을 확립하기 위하여 시험관 내(in vitro)에서 다양한 농도의 항원(VEGF)에 대하여 다양한 농도의 테스트 항체를 테스트함으로써 측정된다. 적절한 검정법은 실례를 목적으로 한 실시예 5에 기재되어 있다. 바람직하게는, 상기 Kd는 고체 지지체, 예를 들어 비아코어 칩(Biacore chip) 상에 항원(VEGF)을 고정화시키고, 상기 항원에 대한 항체의 결합을 평가함으로써 측정된다. 바람직하게는, 상기 결합 친화력은 상온, 예를 들어 25℃의 온도에서 평가되지만, 다른 온도, 예를 들어 37℃(예를 들어, 체온)에서도 평가될 수 있다.

본원의 어느 곳에서 논의되는 것과 같이, 본 발명의 바람직한 항체는 인간의 VEGF 및 마우스의 VEGF 모두에 결합한다. 이것은 임상 이용에 대한 전임상적 연구에 가장 효과적으로 적용할 수 있게 하는 데 중요한 이점이다. 예를 들면, 인간 VEGF 및 마우스 VEGF 모두와 결합하는 본 발명의 항체의 능력은 이와 같은 항체들이 동종(syngeneic) 및 이종(syngeneic)의 종양 모델 모두를 사용하는 전임상 연구에서 테스트될 수 있다는 것을 의미한다. 마우스 VEGF에 결합하지 않는 항체들은 동종의 마우스 모델에서 사용될 수 없다.

게다가, 마우스와 인간 VEGF 모두와 결합하는 능력은 이종 마우스 모델에서 본 발명의 이와 같은 항체에 의해 나타난 결과들이 인간 피험자에서 보다 대표적인 항체의 활성이 된다는 것을 의미한다. 이는 마우스의 VEGF가 아닌 인간의 VEGF에 결합할 수 있는 항체(예를 들어, 아바스틴 및 2C3)는 마우스 모델에서 인간의 종양 세포에 의해 생성된 VEGF에는 결합할 것이지만 내생적인(endogenous) 마우스 유래의 VEGF에 결합할 수는 없을 것이라는 것 때문이다. 이것은 물론 종양과 내생적인 VEGF에 의해 생성된 VEGF가 존재할 인간 환자에서의 상황과는 다르다.

이와 같은 상황이 가지는 잠재적인 단점은 마우스의 VEGF가 아닌 인간의 VEGF에 결합하는 항체가 마우스의 이종 모델에서는 잘 작용할 수 있지만, 이것은 더구나 VEGF가 존재하는 경우 인간계에서 유사한 작용으로 반영될 수 없다는 것이다. 즉, 마우스의 VEGF가 아닌 인간의 VEGF에 결합할 수 있는 항체를 사용하여 마우스의 이종계에서 보이는 항종양 효과는 임상학적 현실에서 보다 더 나아보일 수 있다. 반대로, 만일 인간과 마우스 VEGF 모두에 결합할 수 있는 항체를 가지고 작업한다면, 이것은 그 후 마우스 모델계에 존재하는 모든 형태의 VEGF에 결합할 것이며, 항체를 인간에게 넣었을 경우의 대표적 상황에 더욱 가까울 것이다.

본 발명에 따른 조성물, 면역접합체, 제약, 화합물(combinations), 혼합물(cocktails), 키트, 제1 및 제2의 의학 용도 및 모든 방법의 하기의 서술에서, 특별히 언급하거나 과학 용어로 명확하게 하지 않는 한 용어 "항체(antibody)" 및 "면역접합체(immunoconjugates)" 또는 그것들의 항원 결합 부위 또는 단편은 일련의 VEGFR2-차단성 인간 항-VEGF 항체 뿐만 아니라 특이적 r84 항체를 칭한다.

본원에 사용된 것으로서, 상기 용어 "항체" 및 "면역글로불린(immunoglobulin)"은 폭넓게 다클론성(polyclonal) 및 단일클론성(monoclonal) 항체를 포함하는 인간 항원 결합 도메인을 포함하는 임의의 면역학적 결합제(immunological binding agent) 또는 분자를 말한다. 중쇄에서의 불변 영역(constant domain)에 의존하는 전체 항원들은 다섯개의 주요 분류 중 하나에 해당한다: IgA, IgD, IgE, IgG 및 IgM. 이들 중 몇개는 IgG1, IgG2, IgG3, IgG4 등과 같은 하위분류(subclasses) 또는 이성체(isotype)로 더 나뉘어진다. 서로 다른 분류의 면역글로불린에 대응하는 중쇄 불변 영역은 각각 α, δ, ε, γ 및 μ로 칭한다. 서로 다른 분류의 면역글루불린의 서브유닛 및 3차원 구조는 잘 알려져 있다.

일반적으로, 항원 결합 부위보다는 전체 항체가 본원 발명에 사용되며, IgG 및 IgM은 생리학적 상황에 있어서 가장 흔한 항체이며 실험실의 셋팅시에 가장 쉽게 만들 수 있기 때문에 바람직하다.

포유동물 항체의 "경쇄(light chains)"는 두개의 명확하게 구별되는 형태 중 하나에 해당한다: 그것들의 가변 영역의 골격부(framework region)에서 그것들의 불변 영역 및 어떤 아미노산의 아미노산 서열에 기초한 카파(kappa; κ) 및 람다(lambda; λ). 본 발명의 항체에서 κ 또는 λ 경쇄 불변 영역의 사용에 대한 선호는 본질적으로 없다.

당업자들에 의해 이해되어질 것으로서, 상기 용어 "항체"에 포함되는 면역학적 결합제들은 전(whole) 항체, 이량체, 삼량체(trimeric) 및 다량체성 (multimeric) 항체를 포함하는 모든 인간 항체 및 그것들의 항원 결합 단편들; 이중특이성(bispecific) 항체; 키메라성(chimeric) 항체; 재조합(recombinant) 및 조작된(engineered) 항체 및 그것들의 단편들을 나타낸다.

따라서, 상기 용어 "항체"는 항원 결합 영역을 가지는 임의의 인간 항체-유사 분자를 칭하는 데 사용되며, 이 용어는 Fab', Fab, F(ab')2와 같은 항원 결합 도메인, 단일 도메인 항체(single domain antibodies; DABs), TandAbs 다이머(dimer), Fv, scFv(단일쇄(single chain) Fv), dsFv, ds-scFv, Fd, 선형 항체, 미니항체(minibodies), 2가 항체(diabodies), 이중 특이성 항체 단편 등을 포함하는 항체 단편들을 포함한다.

다양한 항체-기재 구조물 및 단편들을 제조하고 사용하기 위한 기술들은 당업계에 잘 알려져 있다(Kabat et al ., 1991를 참조, 참조에 의해 본원에 특별히 통합되어 있음). 2가 항체는 특히 유럽 특허출원번호 제404,097호 및 국제공개번호 제93/11161호에 기재되어 있으며, 그에 반하여 선형 항체들은 자파타 등에 추가로 기재되어 있다(Zapata et al ., (1995)).

항체들은 기존의 기술들을 사용하여 단편화될 수 있다. 예를 들면, F(ab')2 단편들은 펩신으로 항체를 처리함으로써 생성될 수 있다. 그 결과 생성된 F(ab')2 단편은 Fab' 단편들을 만들기 위하여 디설파이드 결합(disulfide bridges)을 감소시키기 위해 처리될 수 있다. 펩신에 의한 분해는 Fab 단편의 형성을 야기할 수 있다. Fab, Fab' 및 F(ab')2, scFv, Fv, dsFv, Fd, dAbs, TandAbs, ds-scFv, 이량체, 미니항체, 2가 항체, 이중 특이성 항체 단편들 및 다른 단편들 또한 재조합 기술에 의해 합성될 수 있거나, 화학적으로 합성될 수 있다. 항체 단편들을 생산하기 위한 기술들은 잘 알려져 있고 종래 기술에 기재되어 있다. 예를 들면, 각각의 벡맨 등(Beckman et al ., 2006), 올리거 및 허드슨 등(Holliger & Hudson, 2005), 르 갈 등(Le Gall et al ., 2004), 레프 및 허드 등(Reff & Heard, 2001), 라이터 등(Reiter et al ., 1996) 및 영 등(Young et al ., 1005)이 효과적인 항체 단편들의 생산이 가능함을 추가로 기재하고 있다.

인간 항체들 또는 항체 단편들은 자연적으로 생성될 수 있거나 전적(wholly) 또는 부분(partially) 합성적으로 생성될 수 있다. 따라서, 상기 항체들은 임의의 적절한 소스(source), 예를 들어 재조합원(recombinant sources) 및/또는 형질전환 동물(transgenic animals) 또는 형질전환 식물에서 또는 IgY 기술을 이용한 달걀에서 생산될 수 있다. 따라서, 상기 항체 분자들은 시험관 내(in vitro) 또는 생체 내(in vivo)에서 생산될 수 있다.

바람직하게는, 상기 인간 항체 또는 항체 단편은 3개의 CDR 도메인을 포함하는 항체 경쇄 가변 영역(VL) 및 3개의 CDR 도메인을 포함하는 항체 중쇄 가변 영역(VH)를 포함한다. 상기 VL 및 VH는 일반적으로 항원 결합 부위(antigen binding site)를 형성한다.

"Fv" 단편은 완전한 항원 인식 및 결합 부위를 포함하는 최소 항체 단편이다. 이 영역은 빽빽하고(tight) 비공유적인 결합에서 이량체의 하나의 중쇄 및 하나의 경쇄 가변 도메인을 가진다. 이러한 구성에서, 각 가변 도메인의 3개의 고변이 영역(hypervariable region; CDRs)은 VH-VL 이량체의 표면 상에서 항원 결합 부위를 정의하기 위하여 상호작용한다. 총괄하여, 6개의 고변이 영역(CDRs)들이 항체에 대한 항원 결합 특이성을 부여한다.

그러나, 경쇄 가변 도메인으로부터의 3개의 CDRs 및 항체의 중쇄 가변 도메인으로부터의 3개의 CDRs의 존재는 항원 결합에 필요하지 않다는 것은 종래 기술에 잘 명시되어 있다. 따라서, 상기 종래의 항체 단편보다 더욱 작은 구조물들이 효과적이라는 것을 알 수 있다.

예를 들면, 낙타과 항체(camelid antibodies)(Hamers-Casterman et al ., 1993; Arbabi Ghahroudi et al ., 1997)는 확장된 항원 결합 레퍼토리를 가지지만 경쇄는 없다. 또한, VH 도메인만을 포함하거나(Ward et al ., 1989; Davies and Riechmann, 1955) VL 도메인만을 포함하는(van den Beucken et al ., 2001) 단일 도메인 항체들을 가지는 결과물들은 이 도메인들이 허용가능한 높은 친화력을 가지고 항원에 결합할 수 있음을 보여준다. 따라서, 세개의 CDRs는 효과적으로 항원과 결합할 수 있다.

단일 CDR 또는 두개의 CDRs도 항원과 효과적으로 결합할 수 있다는 것 또한 공지되어 있다. 첫번째 예로서, 단일 CDR은 이종성 단백질(heterologous protein) 내로 삽입될 수 있으며, GFP와 같은 이종성 단백질 내로 삽입된 VH CDR3 영역이 이종성 단백질에 대한 항원 결합 능력을 부여한다는 것을 보여주는 예시와 같은(Kiss et al ., 2006; Nicaise et al ., 2004) 이종성 단백질에 대한 항원 결합 능력을 부여한다.

두개의 CDRs는 효과적으로 항원과 결합할 수 있으며, 심지어는 모 항체(parent antibody)에 의해 가지게 된 것보다 뛰어난 특성을 부여한다는 것 또한 알 수 있다. 예를 들면, 모 항체로부터의 두개의 CDRs(VH CDR1 및 VL CDR3 영역)는 모 분자(parent molecules)의 항원 인식 특성을 유지하지만, 침습성 종양(penetrate tumor)에 대하여 더욱 뛰어난 능력을 가진다는 것을 보여준다(Qiu et al., 2007). 천연의 모 항체를 어느 정도 닮은 CDRs가 되도록 하기 위하여 적절한 링커 서열(linker sequence)(예를 들어, VH FR2)을 가지는 이 CDR 도메인들을 결합하는 것은 항원 인식을 더욱 좋게 만든다. 따라서, 모 항체에서 발견되는 구조를 유지하기 위하여 적절한 골격부(framework region)를 사용하여 지향된 두개의 CDR 도메인들(바람직하게는, 하나의 VH 도메인 형태 및 하나의 VL 도메인 형태, 더욱 바람직하게는 CDR3 도메인이 되는 두개의 CDR 도메인들 중 하나를 가지는 형태)을 포함하는 항원 결합 항체 모방체들을 제조할 수 있다는 것이 당업계에 알려져 있다.

따라서, 비록 본 발명의 바람직한 항체들이 6개의 CDR 영역(경쇄로부터 3개, 중쇄로부터 3개)을 포함할 수 있다고 하여도, 6개의 CDR 영역들보다 더 적거나 겨우 하나 또는 두개의 CDR 영역을 가지느느 항체들은 본 발명에 포함된다. 게다가, 단지 중쇄 또는 경쇄로부터의 CDRs를 가지는 항체들 또한 고려된다.

VEGF에 결합하는 본 발명의 바람직한 항체들은 세개의 CDRs를 포함하는 적어도 하나의 중쇄 가변 영역 및 세개의 CDRs를 포함하는 적어도 하나의 경쇄 가변 영역을 포함하며, 여기에서 상기 경쇄 가변 영역은

(a) SEQ ID NO:8의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 가지는 가변(variable light; VL) CDR1,

(b) SEQ ID NO:9의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 가지는 VL CDR2, 및

(c) SEQ ID NO:10의 아미노산 서열 또는 그것과 실질적으로 동일한 서열을 가지는 VL CDR3

를 포함한다.

특정의 경쇄 CDR 영역과 함께 사용하기 위한 바람직한 중쇄 CDR 영역은 본원의 어느 곳에 기재되어 있다. 그러나, 본 발명의 경쇄 가변 영역과 함께 사용하기 위한, 세개의 CDRs를 포함하는 다른 중쇄 가변 영역 또한 고려된다. 본 발명의 경쇄 가변 영역과 함께 사용될 수 있고 항체가 VEGF와 결합할 수 있게 하는 적절한 중쇄 가변 영역은 당업자에 의해 쉽게 확인될 수 있다.

예를 들면, 본 발명의 경쇄 가변 영역은 단일 중쇄 가변 영역 또는 중쇄 가변 영역의 레퍼토리와 결합할 수 있고, 그 결과 생성된 항체들은 VEGF에 결합하는 지에 대한 테스트를 한다. 서로 다른 중쇄 가변 영역을 가지는 매우 많은 수의 본 발명의 이와 같은 경쇄 가변 영역의 조합은 VEGF에 결합하는 능력을 유지할 것이라고 기대된다. 실제로, 이는 본 발명의 바람직한 항체(r84/PGN311)을 사용하여 증명되었으며, 이 항체의 VL 도메인은 몇개의 서로 다른 VH 도메인과 결합할 수 있으며 여전히 VEGF와 결합하는 능력을 유지한다는 것을 보여주었다. 이 실험에서, r84 항체의 VL 도메인과 조합하여 테스트된 VH 도메인 중 3/7은 매우 적당한 비율의 VEGF에 대한 현저한 결합을 보여주며, 이는 본 발명의 경쇄 가변 영역이 VEGF 결합 특이성을 결정하는데 특히 중요하며, 또한 본 발명의 경쇄 가변 영역과 조합될 수 있고, 항체가 VEGF에 결합할 수 있게 하는 다른 중쇄 가변 영역이 쉽게 확인될 수 있다는 것을 보여준다. 본 발명의 항체의 경쇄 가변 영역과 조합하여 사용하기 위한 바람직한 중쇄 가변 영역은 VEGF에 결합하는 것으로 알려진 항체들 또는 항체 단편들로부터 얻어지거나 유래되는 것들이다.

본 발명의 바람직한 중쇄 가변 영역과 조합하여 사용하기 위한 대안적인 경쇄 가변 영역들을 확인하기 위하여 유사한 방법들이 사용될 수 있다.

어떤 구현에서, 항체 또는 항체 단편은 IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, IgE, IgM 또는 IgD 불변 영역과 같은 중쇄 불변 영역의 전부 또는 일부를 포함한다. 바람직하게는, 상기 중쇄 불변 영역은 IgG1 중쇄 불변 영역 또는 그것들의 일부이다. 게다가, 항체 또는 항체 단편은 카파 경쇄 불변 영역 또는 람다 경쇄 불변 영역의 전부 또는 일부, 또는 그것들의 일부를 포함할 수 있다. 이와 같은 불변 영역의 전부 또는 일부는 자연적으로 생성될 수 있거나, 전적으로 또는 부분적으로 합성될 수 있다. 이와 같은 불변 영역의 적절한 서열은 잘 알려져 있으며, 당업계에 기술되어 있다. 중쇄 및 경쇄로부터의 불변 영역의 전 보체(full complement)가 본 발명의 항체에 포함된다면, 이와 같은 항체들은 일반적으로 본원에서 "전장(full length)" 항체 또는 "전(whole)" 항체로 칭한다.

Fc 영역을 포함하는 항체는 Fc 영역이 ADCC 및 CDC와 같은 효과 기능(effector function)을 매개하는 경우에, 어떤 용도, 특히 생체 내에서의 치료학적 용도에 바람직하다.

아미노산 또는 핵산 서열과 함께 본원에서 사용된 것으로서 상기 용어 "실질적으로 동일한(substantially homologous)"은 적어도 70% 또는 75%, 바람직하게는 적어도 80% 및 심지어 더욱 바람직하게는 적어도 85%, 90%, 95%, 96%, 97%, 98% 또는 99%를 가지는 서열, 기재된 아미노산 또는 핵산 서열과 동일한 서열을 포함한다. 따라서, 본 발명의 실질적으로 동일한 서열은 본 발명의 서열에 대하여 단일 또는 다중 염기(base) 또는 아미노산의 변경(추가, 치환, 삽입 또는 결실)을 포함한다. 아미노산의 레벨에서, 바람직한 실질적으로 동일한 서열은 본 발명의 서열을 이루는 하나 또는 그 이상의 골격부 및/또는 하나 또는 그 이상의 CDRs에서, 단지 1, 2, 3, 4 또는 5, 바람직하게는 1, 2 또는 3, 더욱 바람직하게는 1 또는 2개의 변경된 아미노산 만을 포함한다. 상기 변경은 보존적 또는 비보존적 아미노산과 함께일 수 있다. 바람직하게는, 상기 변경은 보존적 아미노산 치환체이다.

상기 실질적으로 동일한 핵산 서열은 또한 적어도 적당하게 엄격한 혼성화 조건 하에서 기재된 핵산 서열(또는 그것들의 상보적 서열)과 혼성화하는, 예를 들어 하나 또는 그 이상의 본 발명의 경쇄 또는 중쇄 CDRs, 본 발명의 경쇄 또는 중쇄 가변 영역 또는 본 발명의 항체(또는 그것들의 상보적 서열에 혼성화하는)를 암호화하는 뉴클레오티드 서열과 혼성화하는 뉴클레오티드 서열을 포함한다.

상기 용어 "실질적으로 동일한"은 또한 실질적으로 동일한 방법으로 본 발명의 단백질 또는 핵산 분자로서 실질적으로 동일한 기능을 수행하는, 본 발명의 아미노산 및 뉴클레오티드 서열의 변형체(modification) 또는 화학적 동등체(chemical equivalents)를 포함한다. 예를 들면, 임의의 실질적으로 동일한 항체(또는 그것을 암호화하는 실질적으로 동일한 핵산)는 상기에 기재된 것과 같이 VEGF에 결합하는 능력을 유지해야만 한다. 바람직하게는, 임의의 실질적으로 동일한 결합 단백질은 논의가 되고 있는 결합 단백질에 의해 인식된 VEGF의 동일한 에피토프, 예를 들면, 본 발명의 CDR 도메인에 의해 인식된 동일한 에피토프 또는 본원에 기재된 것과 같은 본 발명의 VH 및 VL 도메인에 특이적으로 결합하는 능력을 유지해야만 한다. 동일한 에피토프/항원에 결합하는 것은 당업계에서 잘 알려져 있고 기술되어 있는 방법, 예를 들어 경쟁적 검정과 같은 결합 검정을 사용함으로써 쉽게 테스트될 수 있다.

따라서, 당업자들은 결합 검정이 "실질적으로 동일한" 항체들이 본 발명의 항체 및 항체 단편들과 같이 동일한 결합 특이성을 가지는가의 여부를 테스트하는 데 사용될 수 있다는 것, 예를 들면, ELISA 검정 또는 비아코어 검정과 같은 결합 검정이 이와 같은 "실질적으로 동일한" 항체들이 VEGF에 결합할 수 있는가의 여부를 입증하는 데 쉽게 사용될 수 있다는 것을 확인할 수 있을 것이다. 하기에 나타낸 바와 같이, 경쟁적 결합 검정은 "실질적으로 동일한" 항체들이 본 발명의 항체들에 의해 인식되는 것과 같은 VEGF의 실질적으로 동일한 에피토프에 특이적으로 결합하는 능력을 유지하는가의 여부를 테스트하는 데 사용될 수 있다. 하기에 기재된 방법은 단지 적절한 경쟁적 검정 중 하나일 뿐이다. 당업자들은 다른 적절한 방법 및 변형들을 알 것이다.

대표적인 경쟁적 검정법은 다양한 농도의 테스트 항체(예를 들어, 실질적으로 동일한 항체)의 존재하에서 VEGF에 대한 다양한 효과적인 농도의 본 발명의 항체의 결합을 평가하는 것을 포함한다. 그 후, 테스트 항체에 의해 유도된 결합의 억제량이 평가될 수 있다. 증가하는 농도에서 본 발명의 항체와 증가된 경쟁을 나타내는 테스트 항체(즉, 높은 농도의 테스트 항체는 VEGF에 결합하는 본 발명의 항체의 양에 대응하는 감소를 나타냄)는 실질적으로 동일한 에피토프에의 결합에 대한 증거이다. 바람직하게는, 상기 테스트 항체는 VEGF에 결합하는 본 발명의 항체의 양을 현저하게 감소시킨다. 바람직하게는, 상기 테스트 항체는 VEGF에 결합하는 본 발명의 항체의 양을 적어도 약 80%로 감소시킨다. ELISA 검정은 이와 같은 경쟁적 검정에서 결합의 억제를 평가하는 데 적절하지만, 다른 적절한 기술들도 당업자들에게 잘 알려져 있을 것이다.

본 발명의 단백질의 실질적으로 동일한 서열은 제한 없이 보존적 아미노산 치환체, 또는 예를 들어, 항체의 VH, VL 또는 CDR 도메인에 영향을 주지 않는, 예를 들어, 서로 다른 링커 서열이 사용될 때의 scFv 항체 또는 태그 서열 또는 다른 성분들이 항원의 결합에 영향을 주지 않고 추가될 때의 항체를 포함하는 변경, 또는 하나의 타입 또는 형식의 항체 분자 또는 단편을 다른 타입 또는 형식의 항체 분자 또는 단편으로 전환하기 위한 변경(예를 들어, Fab를 scFv로 또는 그 반대로 전환), 또는 항체 분자를 특정 클래스 또는 서브 클래스의 항체 분자로의 전환(예를 들어, 항체 분자를 IgG 또는 그것의 서브 클래스, 예를 들어 IgG1 또는 IgG3로 전환)을 포함한다.

본원에 사용된 것으로서 "보존적 아미노산 치환체(conservative amino acid substitution)"는 아미노산 잔기가 유사한 측쇄(side chain)를 가지는 다른 아미노산 잔기로 바뀐 것이다. 유사한 측쇄를 가지는 아미노산 잔기들의 패밀리는 당업계에 정의되어 있으며, 염기성 측쇄(basic side chain)(예를 들어, 라이신, 아르기닌, 히스티딘), 산성 측쇄(acidic side chain)(예를 들어, 아스파르트산, 글루타민, 세린, 쓰레오닌, 티로신, 시스테인), 무극성 측쇄(nonpolar side chain)(예를 들어, 글리신, 시스테인, 알라닌, 발린, 루이신, 이소루이신, 프롤린, 페닐알라닌, 메티오닌, 트립토판), 베타-분지성 측쇄(beta-branched side chain)(예를 들어, 쓰레오닌, 발린, 이소루이신) 및 방향족성 측쇄(aromatic side chain)(예를 들어, 티로신, 페닐알라닌, 트립토판, 히스티딘)를 포함한다.

상동성(homology)은 임의의 기존의 방법에 의해 평가될 수 있다. 그러나, 서열간의 상동성의 정도를 측정하기 위해서는 서열의 다중 정렬(multiple alignments)을 만드는 컴퓨터 프로그램, 예를 들어 클러스탈 W(Clustal W; Thompson et al ., 1994)가 유용하다. 만일 원한다면, 서열의 총 길이 중 적어도 50%가 정렬(alignments)에 포함되고 가장 높은 오더 매치(order 매치)를 두개의 서열 사이에서 얻기 위하여, 상기 클러스탈 W 알고리듬은 BLOSUM 62 측정 행렬(scoring matrix)(Henikoff and Henikoff, 1992) 및 10보다 많은 공백 개시(gap opening) 및 0.1보다 많은 공백 연장(gap extension)과 함께 사용될 수 있다. 서열을 정렬하는 데 사용할 수 있는 다른 방법은 가장 높은 오더 매치를 두개의 서열 사이에서 얻고, 다수의 동일한 아미노산 서열을 두개의 서열 사이에서 측정하기 위한, 스미스 및 워터맨(Smith and Waterman(1981))에 의해 개정된 니들맨 및 분쉬(Needleman-Wunsch(1970))의 정렬 방법이다. 두개의 아미노산 서열 간의 동일성의 백분율을 계산하기 위한 다른 방법은 일반적으로 당업계에 승인되어 있으며, 예를 들어, 카릴로 및 립톤에 의해 기재된 것(Carillo and Lipton(1988)) 및 계산분자생물학에 기재된 것과 같은 것(Computational Molecular Biology, Lesk, e.d. Oxford University Press, New York, 1988, Biocomputing: Informatics and Genomics Projects)을 포함한다.

일반적으로, 컴퓨터 프로그램은 이와 같은 계산에 사용될 수 있다. ALIGN(Myers and Miller, 1988), FASTA(Pearson and Lipman, 1988; Pearson, 1990) 및 gapped BLAST(Altschul et al ., 1997), BLASTP, BLASTN 또는 GCG(Devereux et al., 1984)와 같이 한쌍의 서열을 비교하고 정렬하는 프로그램 또한 이러한 목적에 유용하다. 게다가, 유럽 생물정보 연구소(European Bioinformatics institute)에서 Dali 서버는 단백질 서열의 구조에 기초한 정렬을 제공한다(Holm, 1993; 1995; 1998).

기준(reference point)의 제공에 의하여, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% 또는 99%의 상동성, 서열 동일성 등을 가지는 본 발명에 따른 서열은 기본 매개변수(default parameters)를 사용하는 ALIGN 프로그램(예를 들면, GENESTREAM 네트워크 서버에서 인터넷이 가능, IGH, Montpellier, France)을 사용하여 측정될 수 있다.

"적어도 적당하게 엄격한 혼성화 조건(at least moderately stringent hybridization conditions)"은 용액에서 두개의 상보적 핵산 분자 사이에 선택적 혼성화가 진행되도록 선택된 조건을 의미한다. 혼성화는 핵산 서열 분자의 전부 또는 일부분에서 일어날 수 있다. 혼성화하는 부위는 일반적으로 적어도 15(예를 들어, 20, 25, 30, 40 또는 50)개의 뉴클레오티드 길이이다. 당업자들은 핵산 듀플렉스(duplex) 또는 혼성물(hybrid)의 안정성이 소디움을 함유하는 버퍼에서의 소디움 이온 농도 및 온도(Tm = 81.5℃-16.6(Log10[Na+] + 0.41(%(G+C) - 600/l) 또는 유사 방정식)의 함수에서 Tm에 의해 측정될 수 있다는 것을 알 수 있을 것이다. 따라서, 혼성물의 안정성을 결정하는 세척 조건에서의 매개변수는 소디움 이온 농도와 온도이다. 공지의 핵산 분자에 대하여 유사하지만 동일하지 않은 분자들을 확인하기 위하여, 1%의 미스매치(mismatch)가 Tm에서 약 1℃의 감소를 야기한다고 추정될 수 있다. 예를 들면, 만일 핵산 분자들이 95% 이상의 동일성을 가진다고 생각된다면, 최종 세척 온도는 약 5℃로 감소될 것이다. 이러한 고려 사항에 기초하여, 당업자들은 적절한 혼성화 조건을 쉽게 선택할 수 있을 것이다. 바람직한 구현에서, 엄격한 혼성화 조건이 선택된다. 예시에 의하여, 하기의 조건들이 엄격한 혼성화를 달성하기 위해 사용될 수 있다: 상기 방정식에 기초하여 Tm -5℃에서5x 소디움 클로라이드/ 소디움 시트레이트(SSC)/ 5x 덴하르트 용액(Denhardt's solution)/ 1.0% SDS에서 혼성화한 후 60℃에서 0.2x SSC/ 0.1% SDS로 세척하였다. 적당하게 엄격한 혼성화 조건은 42℃에서 3x SSC로 세척하는 단계를 포함한다. 또 다른 예에 의하여, "혼성화되는" 서열들은 엄격하지 않은 조건(예를 들어, 상온에서 6x SSC, 50% 포름아미드)하에서 결합하고, 낮은 엄격성을 가지는 조건(예를 들어, 2x SSC, 상온, 더욱 바람직하게는 2x SSC, 42℃) 또는 더욱 높은 엄격성을 가지는 조건(예를 들어, 2x SSC, 65℃)(여기에서, SSC = 0.15M NaCl, 0.015M 소디움 시트레이트, pH 7.2) 하에서 세척된다.

그러나, 동등한 엄격성은 대안적인 버퍼, 염 및 온도를 사용하여 달성될 수 있다. 혼성화 조건에 관련된 추가적인 안내는 하기에서 찾을 수 있을 것이다: Current Protocols in Molecular Biology(John Wiley & Sons, N.Y., 1989, 6.3.1-6.3.6 and in: Sambrook et al., Molecular Cloning, a Laboratory Manual, Cold Spring Harbor Laboratory Press. 1989, Vol. 3.)

일반적으로 말하자면, 높은 엄격성을 가지는 조건 하에서 혼성화되는 서열들은 코드의 퇴화(degeneracy of the code)를 제외하고는 높은 엄격한 조건하에서 혼성화되는 것이 바람직하다.

다른 바람직한 구현에서, r84와 같은 원래의 VEGFR2-차단성 인간 항-VEGF 항체와 비교하여 강화되거나 더욱 우수한 특성을 가지는 제2세대 항체들이 제공된다. 예를 들면, 제2세대 항체들은 더욱 강력한 결합 친화력, VEGFR2에 결합하는 VEGF의 더욱 효과적인 차단성, VEGFR2에 결합하는 VEGF의 특이적 차단성, 심지어는 VEGFR1에 결합하는 VEGF의 보다 낮은 차단성, 내피 세포의 VEGF-유도성 증식 및/또는 이동을 억제하기 위한 강화된 능력, VEGF-유도성 혈관 침투성을 억제하기 위한 보다 우수한 능력 및 바람직하게는 생체 내에서 VEGF-유도성 신생혈관형성을 억제하기 위한 증가된 능력을 가질 수 있고, 혈관이 형성된 종양(vascularized tumor)을 포함하는 신생혈관형성성 질병을 치료하기 위한 것이다.

효과적인 제2세대 항체들을 확인하기 위한 비교는 예를 들어, 본원에 상세하게 기재된 하나 또는 그 이상의 다양한 검정을 사용하여 쉽게 수행되고 정량화된다. r84 항체로 대표되는 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체들과 비교하여 강화된 생물학적 특성 또는 적어도 약 2배, 5배, 10배, 20배 및 바람직하게는 적어도 약 50배의 활성을 가지는 제2세대 항체들은 본 발명에 포함된다.

본 발명의 항체, 결합 단백질 및 핵산 분자들은 일반적으로 인간 또는 동물의 신체 내의 원 위치에(in situ) 존재할 수 있는 임의의 이와 같은 성분 또는 인간 또는 동물의 신체로부터 유래된 조직 샘플과 구별되는 한 "분리된(isolated)" 또는 "정제된(purified)" 분자들이다. 그러나, 상기 서열들은 인간 또는 동물의 신체에서 발견되는 것과 같은 서열들과 일치하거나 실질적으로 동일할 수 있다. 따라서, 핵산 분자 또는 서열 및 단백질 또는 폴리펩티드, 예를 들어 항체와 관련하여 본원에서 사용된 것으로서 상기 용어 "분리된" 또는 "정제된"은 그것들의 천연 환경으로부터 분리되고, 정제되거나 그것들의 천연 환경을 실질적으로 포함하지 않는, 예를 들면, (만일 실제로 그것들이 자연적으로 발생한다면) 인간 또는 동물의 신체로부터 분리되거나 정제되었을 때의 이와 같은 분자들을 칭하거나, 기술 공정에 의해 생산된 경우, 즉 재조합 및 합성적으로 생산된 분자들을 포함하는 이와 같은 분자들을 칭한다.

따라서, 핵산 분자와 관련되어 사용될 경우 이와 같은 용어는 예를 들어 다른 핵산/유전자 또는 폴리펩티드와 자연적으로 관련된 물질을 실질적으로 포함하지 않는 핵산을 칭할 수 있다. 이 용어들은 또한 재조합 DNA 기술에 의해 생산되었을 때의 세포 물질 또는 배지 또는 화학 전구체 또는 화학적으로 합성되었을 때의 다른 화학물질을 실질적으로 포함하지 않는 핵산을 칭할 수 있다. 분리되거나 정제된 핵산은 또한 유래된 핵산의 측면에 자연적으로 위치하는 서열(즉, 핵산의 5' 및 3' 말단에 위치한 서열) 또는 예를 들어, 유전공학에 의해 핵산의 측면에 위치하도록 만들어진 서열(예를 들어, 치료 가치를 가지고 있지 않은 태그 서열 또는 다른 서열)을 실질적으로 포함하지 않을 수 있다.

따라서, 단백질 또는 경쇄 CDRs1, CDRs2 및 CDRs3, 중쇄 CDRs1, CDRs2 및 CDRs3, 경쇄 가변 영역, 중쇄 가변 영역과 같은 폴리펩티드 분자 및 결합 단백질 또는 전장 항체들을 포함하는 본 발명의 항체와 관련되어 사용될 경우, 상기 용어 "분리된" 또는 "정제된"은 일반적으로 그것이 유래된 소스(source)로부터의 세포 물질 또는 다른 단백질을 실질적으로 포함하지 않는 단백질을 칭한다. 어떤 구현에서, 특히 인간 또는 동물에게 단백질이 투여될 경우, 이와 같은 분리되거나 정제된 단백질들은 재조합 기술에 의해 생산되었을 때의 배지 또는 화학 전구체 또는 화학적으로 합성되었을 때의 다른 화학물질을 실질적으로 포함하지 않는다. 이와 같은 분리되거나 정제된 단백질들은 또한 분리된 핵산 분자들에 대하여 상기에 기재된 것들과 같은 측면에 위치하는 서열들을 포함하지 않을 것이다.

본원에 사용된 것으로서 상기 용어 "핵산 서열(nucleic acid sequence)" 또는 "핵산 분자(nucleic acid molecule)"는 천연의 염기(bases), 당(sugars) 및 당간(intersugar)(골격(backbone)) 결합으로 구성되어 있는 뉴클레오시드 또는 뉴클레오티드 모노머의 서열을 칭한다. 상기 용어는 또한 비천연(non-naturally occurring) 모노머 또는 그것들의 일부분을 포함하는 변경되거나 치환된 서열들을 포함한다. 본 발명의 핵산 서열은 DNA(deoxyribonucleic acid sequences) 또는 RNA(ribonucleic acid sequences)일 수 있고, 아데닌, 구아닌, 시토신, 티미딘 및 우라실을 포함하는 천연 염기를 포함할 수 있다. 이와 같은 변경된 염기들의 예는 아자(aza) 및 데아자(deaza) 아데닌, 구아닌, 시토신, 티미딘 및 우라실; 및 크산틴 및 하이포크산틴을 포함한다. 상기 핵산 분자들은 이중나선(double stranded) 또는 단일 나선(single stranded)일 수 있다. 상기 핵산 분자들은 또한 전적 또는 부분적 합성물 또는 재조합형일 수 있다.

항체 분자 및 결합 단백질에 관련하여 본원에 사용된 것으로서 상기 용어 "인간(human)" 항체는 첫째로 가변 영역(예를 들어, VH, VL, CDR 또는 FR 영역)을 가지는 항체 및 결합 단백질을 칭하고, 선택적으로 인간의 레퍼토리로부터 분리 또는 유래되거나 인간, 예를 들어 인간의 생식 계열(germline) 또는 체세포(somatic cells)에서 발견된 서열로부터 유래되거나 일치하는 불변 항체 영역(constant antibody region)을 칭한다. r84 항체는 이와 같은 인간 항체 분자의 예이며, 여기에서 상기 가변 영역은 인간의 레퍼토리로부터 분리된다.

본 발명의 "인간" 항체 및 결합 단백질은 인간의 서열에 의해 암호화되지 않은 아미노산 잔기, 예를 들어, 시험관 내 클로닝 또는 PCR에 의해 유도된 변이체(mutations)와 같은 시험관 내에서 랜덤 또는 부위 지정(site directed) 변이에 의해 유도된 변이체를 더 포함한다. 이와 같은 변이체의 실례는 항체 또는 결합 단백질의 적은 수의 잔기, 예를 들어 항체 또는 결합 단백질의 5, 4, 3, 2 또는 1의 잔기에, 바람직하게는 예를 들어, 항체 또는 결합 단백질의 하나 또는 그 이상의 CDRs를 이루는 5, 4, 3, 2 또는 1의 잔기에 보존적 치환 또는 다른 변이를 포함하는 변이체이다. 이와 같은 "인간" 항체의 어떤 예는 잠재적인 면역성 부위(potentially immunogenic sites)의 양을 감소시키기 위한 표준 변경 기술을 적용하는 항체 및 가변 영역을 포함한다.

따라서, 본 발명의 "인간" 항체들은 인간에서 발견되는 서열로부터 유래되고 관련되지만, 생체 내 인간 항체 생식 계열 레퍼토리 내에 자연적으로 존재하지 않을 수 있는 서열을 포함한다. 게다가, 본 발명의 인간 항체 및 결합 단백질은 인간의 서열 또는 인간의 서열과 실질적으로 동일한 서열로부터 확인된 인간 공통 서열(consensus sequence)을 포함하는 단백질을 포함한다.

게다가, 본 발명의 인간 항체 및 결합 단백질은 인간 항체 분자와 함께 발견된 그것들 자신인 VH, VL CDR 또는 FR 영역의 조합에 한정되지 않는다. 따라서, 본 발명의 인간 항체 및 결합 단백질은 인간에서 반드시 자연적으로 존재하지는 않는 이와 같은 영역의 조합을 포함할 수 있거나 조합과 일치할 수 있다.

바람직한 구현에서, 상기 인간 항체들은 완전한 인간 항체(fully human antibodies)일 것이다. 본원에 사용된 것으로서, "완전한 인간(fully human)" 항체는 실질적인 비-인간 항체 서열을 가지지 않거나 임의의 비-인간 항체 서열을 가지지 않는, 상기에 정의된 것과 같은 "인간" 가변 영역 도메인 및/또는 CDRs를 포함하는 항체이다. 예를 들면, "실질적인 비-인간 항체 서열을 가지지 않는(without substantial non-human antibody sequences)" 인간 가변 영역 도메인 및/또는 CDRs를 포함하는 항체는 단지 약 인간 항체 서열에 의해 암호화되지 않는 아미노산인 5, 4, 3, 2 또는 1 아미노산에서의 항체, 도메인 및/또는 CDRs이다. 따라서, "완전한 인간" 항체는 인간의 항체에 일반적으로 존재하는 아미노산과 더욱 일치하도록 변화시킨 어떤 아미노산에서의 실질적인 비-인간 가변 영역 도메인, 예를 들어, 마우스의 가변 영역 도메인을 기초로 하여 "인간화된(humanized)" 항체와는 구별된다.

본 발명의 "완전한 인간" 항체는 단일쇄 항체와 같은 임의의 다른 실질적인 항체 서열을 가지지 않는 인간 가변 영역 도메인 및/또는 CDRs일 수 있다. 대안적으로, 본 발명의 "완전한 인간" 항체는 하나 또는 그 이상의 인간 항체 불변 영역과 일체화되거나 작동가능하도록 부착된 인간 가변 영역 도메인 및/또는 CDRs일 수 있다. 어떤 바람직한 완전한 인간 항체는 IgG 불변 영역의 전 보체를 가지는 IgG 항체이다.

다른 구현에서, 본 발명의 "인간" 항체는 부분적-인간 키메라(part-human chimeric) 항체일 것이다. 본원에 사용된 것으로서, "부분적-인간 키메라" 항체는 쥐 또는 마우스와 같은 비-인간 종의 불변 영역 상에 작동가능하도록 부착되거나 이식된 "인간" 가변 영역 도메인 및/또는 CDRs를 포함하는 항체이다. 이와 같은 부분적-인간 키메라 항체는 예를 들어, 전임상 연구에서 사용될 수 있으며, 여기에서 상기 불변 영역은 전임상 실험에서 사용된 동물과 동일한 종의 것이 바람직할 것이다. 이 부분적-인간 키메라 항체는 또한 예를 들어, 생체 외(ex vivo) 진단에 사용될 수 있고, 여기에서 비-인간 종의 불변 영역은 항원 검출을 위한 추가적 옵션을 제공할 수 있을 것이다.

본원에 사용된 것으로서, 상기 용어 "단편(fragment)"은 생물학적 관련성이 있는 단편, 예를 들어 항원 결합 부위의 일부분을 형성하는 것과 같이 항원 결합에 기여하고/하거나 VEGF 항원의 기능을 억제 또는 감소시키는 데 기여하고/하거나 천연 리간드 VEGFR2와 결합하는 VEGF 항원의 예방에 기여하는 단편을 칭한다. 어떤 바람직한 단편은 본 발명의 항체의 중쇄 가변 영역(VH 도메인) 및/또는 경쇄 가변 영역(VL 도메인)을 포함한다. 다른 바람직한 단편은 본 발명의 항체(또는 본 발명의 VH 도메인)의 하나 또는 그 이상의 중쇄 CDRs, 또는 본 발명의 항체의(또는 본 발명의 VL 도메인)의 하나 또는 그 이상의 경쇄 CDRs를 포함한다. 어떤 바람직한 단편은 적어도 5개의 아미노산 길이이며, 적어도 하나의 CDR 영역, 바람직하게는 CDR3 영역, 더욱 바람직하게는 중쇄 CDR3 영역을 포함한다.

일 구현에서, 임의의 정의된 서열의 단편을 포함하는(예를 들어, SEQ ID NO:21의 단편을 포함하는) 본 발명의 항체가 예를 들어, 본 발명의 VH 및/또는 VL 도메인을 포함하는 항체, 또는 본 발명의 하나 또는 그 이상의 CDRs를 포함하는 항체 또는 결합 단백질인 경우, 그 후 이 영역/도메인들은 일반적으로 각각의 영역/도메인들이 그것의 생물학적 기능을 수행할 수 있고 항원 결합이 계속 유지될 수 있게 기여하도록 항체 또는 결합 단백질 내에서 분리된다. 따라서, VH 및 VL 도메인들은 바람직하게는 적절한 스캐폴드 서열(scaffold sequence)/링커 서열에 의해 분리되고, CDRs는 바람직하게는 천연 항체 및/또는 효과적으로 조작된 항체에서 발견되는 것과 같은 적절한 골격 부위에 의해 분리된다. 따라서, 본 발명의 VH, VL 및 개개의 CDR 서열들은 바람직하게는 항원 결합이 가능하도록 하는 적절한 골격 또는 스캐폴드 내에 제공되거나 통합된다. 이와 같은 골격 서열 또는 부위는 적절한 스캐폴드를 만드는 데 알맞도록 천연 골격 부위, FR1, FR2, FR3 및 FR4와 일치할 수 있거나, 예를 들어 다양한 천연 골격 부위를 비교함으로서 확인된 공통(consensus) 골격 부위와 일치할 수 있다. 대안적으로, 비-항체 스캐폴드 또는 골격, 예를 들어 T 세포 수용체 골격이 사용될 수 있다.

골격 부위에 사용될 수 있는 적절한 서열은 당업계에 잘 알려져 있고 기록되어 있으며, 임의의 이것들을 사용할 수 있다. 골격 부위를 위한 바람직한 서열들은 본 발명의 VH 및/또는 VL 도메인을 만드는 하나 또는 그 이상의 골격 부위, 즉 SEQ ID NO:21 또는 표 1에 기재된 하나 또는 그 이상의 골격 부위, 또는 그것과 실질적으로 동일한 골격 부위 및 특히 항원 특이성을 유지할 수 있도록 하는 골격 부위, 예를 들어 항체의 3D 구조와 실질적으로 동일하거나 동일하게 하는 골격 부위이다. 어떤 바람직한 구현에서, 적절하게는 4개의 가변성 경쇄(SEQ ID NOs: 15, 16, 17 및 18) 및 4개의 가변성 중쇄(SEQ ID NOs: 11, 12, 13 및 14) 모두, EQ ID NO: 21의 FR 영역(표 1에 표시) 또는 그것과 실질적으로 동일한 FR 영역은 본 발명의 항체에서 발견된다.

게다가, 비록 본 발명의 바람직한 항체들이 본 발명의 VH, VL 또는 CDRs로 구성되지만, 만일 상기에 약술된 것과 같은 본 발명의 항체 또는 결합 단백질의 VEGF 결합 특성이 여전히 존재하는 한, 본 발명의 항체들은 또한 본 발명이 아닌 다른 VH, VL 또는 CDRs와 함께 본 발명의 하나 또는 그 이상의 VH, VL 또는 CDRs를 포함한다는 것에 주의하여야만 한다.

본원에 사용된 것으로서, 상기 용어 "중쇄 상보성 결정 영역(heavy chain complementairy determining region)"("중쇄 CDR(heavy chain CDR)")은 항체 분자의 중쇄 가변 영역(VH 도메인) 내의 고변이 영역을 칭한다. 상기 중쇄 가변 영역은 아미노 말단에서 카르복시 말단으로 중쇄 CDR1, 중쇄 CDR2 및 중쇄 CDR3으로 칭하는 세개의 CDRs를 가진다. 상기 중쇄 가변 영역은 또한 4개의 골격 부위(아미노 말단에서 카르복시 말단으로 FR1, FR2, FR3 및 FR4)를 가진다. 이 골격 부위들은 CDRs를 분리한다.

본원에 사용된 것으로서, 상기 용어 "중쇄 가변 영역(heavy chain variable region"(VH 도메인)은 항체 분자의 중쇄의 가변 영역을 칭한다.

본원에 사용된 것으로서, 상기 용어 "경쇄 상보성 결정 영역(light chain complementairy determining region)"("경쇄 CDR(light chain CDR)")은 항체 분자의 경쇄 가변 영역(VL 도메인) 내의 고변이 영역을 칭한다. 상기 경쇄 가변 영역은 아미노 말단에서 카르복시 말단으로 경쇄 CDR1, 경쇄 CDR2 및 경쇄 CDR3으로 칭하는 세개의 CDRs를 가진다. 상기 경쇄 가변 영역은 또한 4개의 골격 부위(아미노 말단에서 카르복시 말단으로 FR1, FR2, FR3 및 FR4)를 가진다. 이 골격 부위들은 CDRs를 분리한다.

본원에 사용된 것으로서, 상기 용어 "경쇄 가변 영역(light chain variable region"(VL 도메인)은 항체 분자의 경쇄의 가변 영역을 칭한다.

본원에서는 필요한 경우에 CDRs의 위치를 정의하기 위하여 Kabat 명명법을 따르고 있다는 것에 주의하여야 한다(Kabat et al ., 1991, 참조로서 본원에 특별히 통합되어 있음).

당업자들은 경쇄 및 중쇄 CDRs, 경쇄 및 중쇄 가변 영역, 항체, 항체 단편 및 면역접합체와 같은 본 발명의 단백질 및 폴리펩티드가 당업계에서 잘 알려져 있으며 기술되어 있는 임의의 몇가지 방법들로 제조될 수 있지만, 재조합 방법을 사용하여 제조되는 것이 가장 바람직하다는 것을 확인할 수 있을 것이다.

본 발명의 항체의 경쇄 및 중쇄 가변 영역을 암호화하는 핵산 단편은 임의의 적절한 방법, 예를 들어, 클로닝 또는 합성에 의해 유래되거나 생산될 수 있다. 이와 같은 서열들은 예를 들어, 인간 생식계 유전자로부터 적절한 서열을 클로닝함으로써 제조된 후, 당업계에 잘 알려져 있고 기술되어 있는 방법을 사용하여 본 발명의 서열을 얻기 위한 생식계 서열에 임의의 필요한 변경을 함으로써 제조될 수 있다. 대안적이며 더욱 효과적인 방법은 중첩 프라이머(overlapping primer)로서 적절한 경쇄 또는 중쇄 가변 영역 서열을 합성하고 전장 서열을 얻기 위하여 프라이머 확장을 이용할 수 있을 것이다. 상기 전장 서열은 그 후 더 클로닝하고 조작하기 위하여, 예를 들어 적절한 발현 벡터 내로 클로닝하기 위하여 적절한 제한 부위를 포함하는 프라이머를 사용하여 PCR을 통하여 증폭될 수 있다. 하나의 가변 영역 당 5 내지 7개의 중첩 프라이머가 일반적으로 충분하며, 그것에 의하여 이 기술이 매우 효과적이고 정확해진다.

일단 본 발명의 항체의 경쇄 및 중쇄 가변 영역을 암호화하는 핵산 단편이 얻어지면, 이 단편들은 예를 들어, 적절한 불변 영역 도메인을 사용하여 가변 영역 단편을 전장 항체 분자로 전환시키거나 본원의 어느 곳에 논의된 항체 단편의 특정 형태, 예를 들어 Fab 단편, sdFv 단편 등으로 전환시키기 위하여, 표준 재조합 DNA 기술에 의해 더 조작될 수 있다. 전형적으로 또는 이러한 추가 조작 순서의 일부로서, 본 발명의 항체 분자를 암호화하는 핵산 단편들은 일반적으로 본 발명의 항체의 용이한 생산을 위하여 적절한 발현 벡터 내로 통합된다.

가능한 발현 벡터는 벡터가 사용된 숙주 세포와 적합하는 한 코스미드(cosmids), 플라스미드 또는 변경된 바이러스(예를 들어, 복제 결함 레트로바이러스(replication defective retroviruses), 아데노바이러스 및 아데노-관련 바이러스)를 포함하지만 이로 제한되는 것은 아니다. 상기 발현 벡터는 본 발명의 핵산 분자 및 핵산 분자에 작동가능하도록 연결되어 있는 발현을 위해 사용될 숙주 세포를 기반으로 선택된 조절 서열(regulatory sequences)을 포함하는 "숙주 세포의 형질전환에 적합한(suitable for transformation of a host cell)" 발현 벡터를 의미한다. 작동가능하도록 연결된다는 것은 핵산이 핵산의 발현이 가능하도록 하는 방식으로 조절 서열에 연결된다는 것을 의미한다.

따라서, 본 발명은 본 발명의 핵산 분자 또는 그것의 단편 및 본 발명의 핵산 분자에 의해 암호화되는 단백질 서열의 전사 및 번역에 필수적인 조절 서열을 포함하는 재조합 발현 벡터를 고려한다.

적절한 조절 서열은 박테리아, 진균, 바이러스, 포유동물 또는 곤충의 유전자(예를 들면, 괴델 등(Goeddel, 1990)에 기재된 조절 서열을 참조)를 포함하는 다양한 소스(sources)로부터 유래될 수 있다. 적절한 조절 서열의 선택은 하기에 논의되는 것과 같은 숙주 세포의 선택에 의존하며, 당업자에 의해 쉽게 완성될 수 있다. 이와 같은 조절 서열의 예는 번역 개시 시그널(translation initiation signal)을 포함하는 전사 프로모터(transcriptional promoter) 및 인핸서(enhancer) 또는 RNA 폴리머라아제 결합 서열(RNA polymerase binding sequence), 리보솜 결합 서열(ribosomal binding sequence)을 포함한다. 추가적으로, 선택된 숙주 세포 및 사용된 벡터에 의존하는 복제의 원점, 추가적인 DNA 제한 부위, 인핸서와 같은 다른 서열 및 전사 유도성을 부여하는 서열들이 발현 벡터 내로 통합될 수 있다.

본 발명의 재조합 발현 벡터는 또한 본 발명의 재조합 분자를 사용하여 형질전환되거나 감염된 숙주 세포의 선별을 용이하게 하는 선별가능한 마커 유전자를 포함할 수 있다. 선별가능한 마커 유전자의 예는 어떤 약물에, β-갈락토시다아제(β-galactosidase), 클로람페니콜 아세틸트랜스퍼라아제(chloramphenicol acetyltransferase), 파이어플라이 루시퍼라아제(firefly luciferase), 또는 면역글로불린, 바람직하게는 IgG의 Fc 부분과 같은 면역글로불린 또는 그것들의 일부분에 내성을 부여하는 네오마이신(neomycin) 및 하이그로마이신(hygromycin)과 같은 단백질을 암호화하는 유전자이다. 선별가능한 마커 유전자의 전사는 β-갈락토시다아제, 클로람페니콜 아세틸트랜스퍼라아제 또는 파이어플라이 루시퍼라아제와 같은 선별가능한 마커 단백질의 농도를 변화시킴으로써 관찰된다. 만일 네오마이신 저항성 형질전환 세포와 같은 항생제 저항성을 부여하는 단백질을 암호화하는 선별가능한 마커 유전자는 G418과 함께 선택될 수 있다. 선별가능한 마커 유전자에 통합되어 있는 세포들은 다른 세포들이 죽는다 할지라도 살아남을 것이다. 이는 본 발명의 재조합 발현 벡터의 발현을 가시화하고 검정할 수 있게 하고, 특히 발현과 표현형(phenotype) 상에서 변이의 효과를 검출할 수 있게 만든다. 선별가능한 마커는 목적 핵산으로부터 분리된 벡터 상에 도입될 수 있다.

상기 재조합 발현 벡터는 또한 재조합 단백질의 발현을 증가시키고; 재조합 단백질의 용해성을 증가시키고; 친화 정제법(affinity purification)에서 리간드로서 작용함으로써 표적 재조합 단백질의 정제에 도움을 주는 융합 부분(fusion moiety)(예를 들어, 정제 및/또는 확인을 가능하게 하기위한 적절한 "태그(tag)", 예를 들어 His 태그 또는 myc 태그가 존재할 수 있다)를 암호화하는 유전자를 포함할 수 있다. 예를 들면, 융합 단백질의 정제 후 융합 부분으로부터 재조합 단백질의 분리를 가능하게 하기 위하여 표적 재조합 단백질에 단백질 절단 부위(proteolytic clevage site)가 첨가될 수 있다. 대표적인 융합 발현 벡터는 재조합 단백질에 대하여 각각 글루타티온 S-트랜스퍼라아제(glutathioine S-transferase; GST), 말토오스 E 결합 단백질(maltose E binding protein) 또는 단백질 A(protein A)와 융합하는 pGEX(Amrad Corp., Melbourne, Australia), pMal(New England Biolabs, Beverly, MA) 및 pRIT5(Pharmacia, Piscataway, NJ)를 포함한다.

재조합 발현 벡터는 형질전환된 숙주 세포를 생산하기 위하여 숙주 세포 내로 도입될 수 있다. 상기 용어 "형질전환된(transformed with)", "감염시킨(transfected with)", "형질전환(transformation)" 및 "감염(transfection)"은 당업계에 공지된 많은 가능한 기술들 중 하나에 의한 세포 내로의 핵산(예를 들어, 벡터)의 도입을 완수하는 것을 의미한다. 본원에 사용된 것으로서, 상기 용어 "형질전환된 숙주 세포(transformed host cell)"는 또한 본 발명의 재조합 발현 벡터로 형질전환된 글리코실화(glycosylation)가 가능한 세포를 포함하는 것을 의미한다. 원핵세포(prokaryotic cells)는 예를 들어, 전기천공법(electroporation) 또는 칼슘-클로라이드 매개성 형질전환(calcium-chloride mediated transformation)에 의해 핵산을 사용하여 형질전환될 수 있다. 예를 들면, 핵산은 칼슘 포스페이트 또는 칼슘 클로라이드 공침전, DEAE-덱스트란 매개성 감염, 리포펙틴(lipofectin), 전기천공법 또는 미세주입(microinjection)과 같은 기존의 기술을 통하여 포유동물의 세포 내로 도입될 수 있다. 숙주 세포를 형질전환하고 감염시키기에 적절한 방법은 샘브룩 등(Sambrook et al ., 1989) 및 다른 실험 교과서에서 찾을 수 있다.

적절한 숙주 세포는 매우 다양한 진핵 숙주 세포 및 원핵 세포들을 포함한다. 예를 들면, 본 발명의 단백질은 효모 세포 또는 포유동물의 세포에서 발현될 수 있다. 다른 적절한 숙주 세포는 괴델 등에서 찾을 수 있다(Goeddel, 1990). 게다가, 본 발명의 단백질은 대장균과 같은 원핵 세포에서 발현될 수 있다(Zhang et al ., 2004).

본 발명을 수행하기에 적합한 효모 및 진균 숙주 세포는 사카로마이세스 세레비시애(Saccharomyces cerevisiae), 피치아(Pichia) 또는 클루이베로마이세스(Kluyveromyces) 속 및 아스퍼질러스(Aspergillus) 속의 다양한 종을 포함하지만 이에 제한되지는 않는다. 효모 사카로마이세스 세레비시애에서의 발현을 위한 벡터의 예는 pYepSec1(Baldari et al., 1987), pMFa(Kurjan and Herskowitz, 1982), pJRY88(Schultz et al., 1987) 및 pYES2(Invitrogen Corporation, San Diego, CA)를 포함한다. 효모 및 진균의 형질전환을 위한 프로토콜은 당업계의 당업자들에게 잘 알려져 있다(Hinnen et al ., 1978; Ito et al ., 1983; and Cullen et al ., 1987을 참조).

본 발명을 수행하기에 적합한 포유동물 세포는 특히 COS(예를 들어, ATCC No. CRL 1650 또는 1651), BHK(예를 들어, ATCC No. CRL 6281), CHO(ATCC No. CCL 61), HeLa(예를 들어, ATCC No. CCL 2), 293(ATCC No. 1573) 및 NS-1 세포를 포함한다. 포유동물의 세포에서 발현을 유도하기에 적합한 발현 벡터는 일반적으로 프로모터(예를 들어, 폴리오마(polyoma), 아데노바이러스 2(Adenovirus 2), 사이토메갈로바이러스(cytomegalovirus) 및 시미안 바이러스 40(Simian Virus 40)과 같은 바이러스성 물질로부터 유래된 것) 뿐만 아니라 다른 전사 및 번역 조절 서열을 포함한다. 포유동물의 발현 벡터의 예는 pCDM8(Seed, B., 1987) 및 pMT2PC(Kaufman et al ., 1987)을 포함한다.

식물, 새 및 곤충 세포 내로 적절한 형태의 발현 벡터를 도입하기 위한 본원에 제공된 주어진 교시들, 프로모터, 터미네이터(terminators) 및 방법들 또한 쉽게 달성될 수 있다. 예를 들면, 일 구현 내에서, 본 발명의 단백질은 식물 세포로부터 발현될 수 있다(아그로박테리움 리조게네스(Agrobacterium rhizogenes) 벡터의 용도에 대하여 리뷰한 Sinker et al ., 1987; 특히 PAPS2022, PAPS2023 및 PAPS2034를 포함하는 식물 세포용 발현 벡터의 용도를 기술한 Zambryski et al ., 1984를 참조).

본 발명을 수행하는 데 적절한 곤충 세포는 봄빅스(Bombyx), 트리코플러시아(Trichoplusia) 또는 스포도테라 종으로부터의 세포 및 세포주(cell lines)를 포함한다. 배양된 곤충 세포(SF 9 cells)에서 단백질을 발현할 수 있는 바큘로바이러스(Baculovirus) 벡터는 pAc 시리즈(Smith et al ., 1983) 및 pVL 시리즈(Luckow and Summers 1989)를 포함한다. 본 발명의 재조합 단백질의 발현에 적합한 어떤 바큘로바이러스-곤충 세포 발현 시스템은 PCT/US/02442에 기재되어 있다.

대안적으로, 본 발명의 단백질은 또한 쥐, 토끼, 양 및 돼지와 같은 비-인간 형질전환 동물(non-human transgenic animals)에서 발현될 수 있다(Hammer et al ., 1995; Palmiter et al ., 1983; Brinster et al ., 1985; Palmiter and Brinster 1985 및 U.S. Patent No. 4,736,866).

본 발명의 단백질은 또한 고상합성(solid phase synthesis)(Merrifield(1964); Frische et al ., 1996) 또는 균질 용액에서의 합성(Houbenweyl, 1987)과 같은 단백질 화학에서 잘 알려져 있는 기술을 사용한 화학적 합성에 의해 제조될 수 있다.

단백질과 같은 다른 분자들과 결합된 본 발명의 항체 및 단백질을 포함하는 N-말단 또는 C-말단 융합 단백질은 재조합 기술을 통하여 융합시킴으로써 제조될 수 있다. 그 결과 생성된 융합 단백질은 본원에 기재된 것과 같은 선별된 단백질 또는 마커 단백질, 또는 태그 단백질과 융합된 본 발명의 항체 또는 단백질을 포함한다. 본 발명의 항체 및 단백질은 또한 공지의 기술에 의해 다른 단백질들과 결합될 수 있다. 예를 들면, 상기 단백질들은 WO 90/10457에 기재된 것과 같은 이관능성 티올함유 링커(heterobifunctional thio-containing linkers), N-숙신이미딜-3-(2-피리딜디티오-프로피오네이트)(N-succinimidyl-3-(2-pyridyldithio-propionate) 또는 N-숙신이미딜-5 티오아세테이트(N-succinimidyl-5 thioacetate)를 사용하여 결합될 수 있다. 융합 단백질 또는 접합체를 제조하는 데 사용될 수 있는 단백질의 예는 면역글로불린(immunoglobulins), 호르몬(hormones), 성장 인자(growth factors), 렉틴(lectins), 인슐린(insulin), 저밀도 지질단백질(low density lipoprotein), 글루카곤(glucagon), 엔돌핀(endorphins), 트랜스페린(transferrin), 봄베신(bombesin), 아시알로당단백질 글루타티온-S--트랜스퍼라아제(asialoglycoprotein glutathione-S-transferase; GST), 헤마글루티닌(hemagglutinin; HA) 및 결절된 myc(truncated myc)와 같은 세포 결합 단백질을 포함한다.

제1의 VEGFR2-차단성 항-VEGF 항체 핵산 절편(segment)를 제조하기 위한 방법에 상관없이, 그 이상의 적절한 항체 핵산 절편이 표준 분자 생물학적 기술에 의해 쉽게 제조될 수 있다. 임의의 변종(variant), 변이(mutant) 또는 제2세대 VEGFR-2 차단성 항-VEGF 항체 핵산 절편이 본 발명에 사용하기에 적합하다는 것을 확인하기 위하여, 상기 핵산 절편은 본 발명에 따른 VEGFR2-차단성 항-VEGF 항체의 발현을 확인하기 위하여 테스트될 것이다. 바람직하게는, 상기 변종, 변이 또는 제2세대 핵산 절편은 또한 표준, 더욱 바람직하게는 표준의 엄격한 혼성화 조건하에서의 혼성화를 확인하기 위하여 테스트될 것이다. 대표적인 적절한 혼성화 조건은 약 50℃에서 약 7% 소디움 도데실 설페이트(sodium dodecyl sulfate; SDS), 약 0.5M NaPO4, 약 1mM EDTA에서 혼성화시키고, 약 42℃에서 1% SDS로 세척하는 것을 포함한다.

다양한 인간 항체들이 쉽게 제조될 수 있으므로, 본 발명의 치료 방법은 환자에게 있어 본 발명의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체를 생물학적 유효량으로 발현하는 적어도 제2의 핵산 절편 또는 분자를 동물 또는 환자에게 제공함으로써 실행될 수 있다. 상기 "VEGFR2-차단성 인간 항-VEGF 항체를 발현하는 핵산 절편 또는 분자"는 일반적으로 적어도 발현 구조물 또는 벡터의 형태일 수 있고, 바이러스 내 또는 재조합 숙주 세포 내에 포함된 발현 구조물 또는 벡터의 형태일 수 있다. 본 발명의 바람직한 유전자 치료 벡터는 재조합 레트로바이러스, 허피스 단순포진 바이러스(herpes simplex virus; HSV), 아데노바이러스, 아데노-관련 바이러스(adeno-associated virus; AAV), 사이토메갈로바이러스(cytomegalovirus; CMV) 등의 내에 포함된 것과 같은 바이러스성 벡터일 것이다.

따라서, 본 발명은 본 발명의 항체를 암호화하는 뉴클레오티드 서열을 포함하는 핵산 절편 또는 분자를 더 제공한다. 이와 같은 서열과 실질적으로 동등한 핵산 분자 또한 포함된다. 바람직한 핵산 분자는 SEQ ID NO:21로 시작하는 아미노산 서열을 암호화한다. 더욱 바람직한 핵산 분자는 SEQ ID NO:20로 정의된 것과 같은 핵산 서열 또는 그것과 실질적으로 동일한 서열을 포함한다.

또 다른 양상은 본 발명의 하나 또는 그 이상의 핵산 절편 또는 분자를 포함하는 발현 구조물 또는 발현 벡터를 제공한다. 바람직하게는, 상기 발현 구조물 또는 벡터는 재조합물이다. 바람직하게는, 상기 구조물 또는 벡터는 본 발명의 핵산 분자에 의해 암호화되는 단백질 서열의 전자 및 번역에 필수적인 조절 서열을 더 포함한다.

또 다른 양상은 본 발명의 하나 또는 그 이상의 발현 구조물 또는 발현 벡터를 포함하는 숙주 세포 또는 바이러스를 제공한다. 본 발명의 하나 또는 그 이상의 핵산 분자를 포함하는 숙주 세포 또는 바이러스 또한 제공된다. 본 발명의 항체를 발현하는 숙주 세포 또는 바이러스는 또 다른 양상을 형성한다.

본 발명의 또 다른 양상은 본 발명의 숙주 세포를 배양하는 단계를 포함하는 본 발명의 항체를 생산하는 방법을 제공한다. 바람직한 방법은 (i) 암호화된 항체 또는 단백질의 발현에 적절한 환경 하에서 본 발명의 하나 또는 그 이상의 재조합 발현 벡터 또는 하나 또는 그 이상의 핵산 서열을 포함하는 숙주 세포를 배양하는 단계, 및 선택적으로 (ii) 숙주 세포 또는 성장 배지/상층액으로부터 항체 또는 단백질을 분리하는 단계를 포함하는 본 발명의 항체를 생산하는 방법을 제공한다. 이와 같은 생산 방법은 또한 항체 또는 단백질 생성물의 정제 단계 및/또는 약제학적으로 허용가능한 담체 또는 첨가제와 같은 적어도 하나의 추가 성분을 포함하는 조성물 내로 항체 또는 생성물을 제형화시키는 단계를 포함할 수 있다.

본 발명의 항체 또는 단백질이 많은 폴리펩티드 사슬로 구성된 경우(예를 들어, Fab 단편과 같은 어떤 단편)의 구현에서, 그 후 모든 폴리펩티드들은 완전 단백질(complete protein), 예를 들어, 본 발명의 결합 단백질이 숙주 세포에서 조립될 수 있고 거기로부터 분리되거나 정제될 수 있게하기 위하여, 동일하거나 서로 다른 발현 벡터 어느 한쪽의 숙주 세포에서 발현되는 것이 바람직하다.

본 발명의 항체들은 또한 VEGF에 결합하는 항체를 더 생산하는 데 사용될 수 있다. 이와 같은 용도는 예를 들어, 새로운 항체를 만들기 위하여 모 항체의 아미노산 서열에 하나 또는 그 이상의 아미노산 추가, 결실, 치환 또는 삽입을 포함하고, 여기에서 상기 모 항체는 본원에 어느 곳에 정의된 것과 같은 본 발명의 항체 중 하나이고, VEGF에 특이적인 항체를 확인하기 위하여 새로 생성된 항체를 테스트한다. 이와 같은 방법은 VEGF에 결합하는 그것들의 능력을 모두 테스트할 수 있는 다중의 새로운 항체들을 만드는 데 사용될 수 있다. 바람직하게는, 하나 또는 그 이상의 아미노산의 상기 추가, 결실, 치환 또는 삽입은 하나 또는 그 이상의 CDR 도메인 내에서 일어난다.

이와 같은 모 항체에 대한 변경 또는 변이는 당업계에 잘 알려지고 기술되어 있는 기술을 사용하는 임의의 적절한 방법으로, 예를 들어 랜덤 또는 위치 지정 돌연변이의 방법을 수행함으로써 수행될 수 있다. 만일 위치 지정 돌연변이가 사용된다면, 위치 지정 돌연변이는 항원 결합에 관련된 주요 잔기를 확인하기 위하여 결합 단백질-항원 복합체, 예를 들어 Ab-Ag 복합체의 결정 구조(crystal structure의 분해능(resolution)을 사용하는 적절한 잔기를 확인하기 위한 하나의 방법 후에 사용된다(Davies and Cohen, 1996). 그 후에, 이 잔기들은 상호작용을 강화시키기 위하여 변이될 수 있다. 대안적으로, 하나 또는 그 이상의 아미노산 잔기들은 위치지정 돌연변이를 위해 간단하게 표적화될 수 있고, 종양 세포를 평가하기 위한 결합에 영향을 미칠 수 있다.

랜덤 돌연변이는 임의의 적절한 방법, 예를 들어, 실수 유발 PCR(error-prone PCR), 사슬 셔플링(chain shuffling) 또는 돌연변이 유발 유전자(mutator) 대장균 균주에 의해 수행될 수 있다.

따라서, 본 발명의 하나 또는 그 이상의 VH 도메인은 임의의 적절한 소스(source) 및 VEGF에 특이적인 항체를 확인하기 위하여 테스트된 신규 항체로부터의 단일 VL 도메인 또는 VL 도메인의 레퍼토리와 조합될 수 있다. 반대로, 본 발명의 하나 또는 그 이상의 VL 도메인은 임의의 적절한 소스(source) 및 VEGF에 특이적인 항체를 확인하기 위하여 테스트된 신규 항체로부터의 단일 VH 도메인 또는 VH 도메인의 레퍼토리와 조합될 수 있다. 예를 들면, 상기에 논의된 바와 같이, 본 발명의 바람직한 항체(r84/PGN311)의 VL 도메인은 몇몇의 서로 다른 VH 도메인과 조합될 수 있으며, 여전히 VEGF와 결합하는 능력을 유지한다.

유사하게는, 본 발명의 VH 및/또는 VL 도메인의 하나 또는 그 이상, 또는 바람직하게는 모든 세개의 CDRs는 적절하다면 단일 VH 및/또는 VL 도메인 또는 VH 및/또는 VL 도메인의 레퍼토리 내로 융합될 수 있고, 그 결과 생성된 신규한 항체들은 VEGF에 특이적인 항체를 확인하기 위하여 테스트된다.

CDRs, 특히 경쇄 및/또는 중쇄의 CDR3의 표적 변이(targeted mutation)는 항체 친화력을 증가키는 데 효과적이며 바람직하다는 것을 보여준다. 바람직하게는, CDR3의 3 내지 4개의 아미노산의 차단 또는 "핫-스팟(hot-spots)"이라 불리는 특정 영역이 변이를 위해 표적화된다.

"핫-스팟"은 생체 내에서 체세포성 과변이(somatic hypermutation)가 일어나는 서열이다(Neuberger and Milstein, 1995). 상기 핫스팟 서열은 어떤 코돈에서의 공통 뉴클레오티드 서열로서 정의될 수 있다. 상기 공통 서열은 테트라뉴클레오티드(tetranucleotide), RGYW이고, 여기에서 R은 A 또는 G 모두일 수 있고, Y는 C 또는 T일 수 있고, W는 A 또는 T 모두일 수 있다(Neuberger and Milstein, 1995). 게다가, 뉴클레오티드 AGY에 의해 암호화된 세린 잔기는 잠재적인 핫스팟 서열에 대응하는 TCN에 의해 암호화된 것들에 걸쳐 가변 도메인의 CDRs 영역에 우세하게 존재한다(Wagner et al ., 1995).

따라서, 본 발명의 각각의 항체의 중쇄 및 경쇄의 CDRs의 뉴클레오티드 서열은 핫스팟 서열 및 AGY 코돈의 존재를 위하여 정밀검사될 수 있다. 경쇄 및 중쇄의 CDR 영역의 확인된 핫스팟은 그 후 선택적으로 국제 이뮤노겐 틱스 데이터베이스(International ImMunoGen Tics database; IMGT, http://imgt.cines.fr/textes/vquest/)를 사용하여 중쇄 및 경쇄의 초기 서열(germinal sequence)과 비교될 수 있다(Davies et al ., 1990). 배선(germ line)과 동일한 서열은 체세포성 돌연변이가 발생하지 않았음을 암시하므로, 생체 내에서 발생하는 체세포성 사건을 모방하는 랜덤 돌연변이가 도입될 수 있거나, 대안적으로는 예를 들어, 핫스팟 및/또는 AGY 코돈에서 부위 지정 돌연변이가 수행될 수 있다. 반대로, 서로 다른 서열은 어떤 체세포성 돌연변이가 이미 일어났음을 나타낸다. 만일 생체 내 체세포성 돌연변이가 최적이라면 결정되어져야만 할 것이다.

돌연변이에 바람직한 핫스팟은 노출된 아미노산을 코딩하는 것과 바람직하게는 항원 결합 부위의 일부분을 형성하는 아미노산을 암호화하는 것이다. 돌연변이를 위한 다른 바람직한 핫스팟은 비보존적 아미노산을 코딩하는 것이다. CDRs 내에 묻혀있거나 보존된 아미노산을 코딩하는 핫스팟은 돌연변이화시키는 데 바람직하지 않다. 이 잔기들은 보통 전체적인 구조에 중요하며, 그것들이 묻혀있기 때문에 항원과 상호작용하는 것 같지 않다.

상기에 기재된 아미노산 및 단백질 도메인의 조작을 수행하기 위한 방법은 당업자에게 잘 알려져 있다. 예를 들면, 상기 조작은 핵산 레벨에서 유전자 조작에 의해 전통적으로 수행될 수 있으며, 여기에서 적절한 결합 단백질 및 그것들의 도메인을 암호화하는 핵산 분자들은 그 결과 발현된 단백질의 아미노산 서열이 적절한 방법으로 차례차례 변경되도록 하기 위하여 변경된다.

VEGF에 특이적으로 결합하는지에 대하여 하나 또는 그 이상의 신규한 항체들의 능력을 테스트하는 것은 당업계에 잘 알려져 있고 기술되어 있는 임의의 적절한 방법에 의해 수행될 수 있다. VEGF 샘플들은 쉽게 입수가능하고(실시예 참조), 이것들은 예를 들어, ELISA, 친화성 크로마토그래피 등과 같은 기존의 방법에 의하여 결합 검정에 쉽게 사용될 수 있다.

이 방법들에 의해 생성된 신규한 항체들은 모 항체들 만큼 더욱 높거나 강한 친화력(또는 적어도 동등한 친화력)을 가지고, 본원에 어느 곳에 기재된 것과 같은 본 발명의 항체와 같이 동일한 방법으로 처리되고 사용될 수 있는 것이 바람직할 것이다.

이 방법들에 의해 생성되고, 얻어지거나 획득가능한 신규한 항체들은 본 발명의 또 다른 양상을 형성한다.

본 발명은 본 발명의 적어도 하나의 인간 항체 또는 항체 단편을 포함하고, 선택적으로 희석제를 포함하는 조성물을 더 제공한다. 이와 같은 조성물은 약제학적으로 허용가능한 조성물 또는 실험실 연구에 사용하기 위한 조성물일 수 있다. 약제학적 조성물에 관하여, 그것들은 정맥 투여 또는 안구 투여와 같은 비경구 투여를 위하여 제형화되는 것이 바람직할 것이다.

본 발명은 다수의 방법들 및 본 발명의 인간 항체 및 항체 단편의 용도를 제공한다. 모든 방법들을 고려하여, 상기 용어 "하나(a or an)"는 특정하게 언급되는 경우를 제외하고는 인용된 방법에서 단계의 "적어도 하나(at least one)", "적어도 제1의(at least a first)", "하나 또는 그 이상(one or more)" 또는 "많은 수(a plurality)"를 의미하는 것으로 사용된다. 이것은 특히 치료 방법에서의 투여 단계와 관련이 있다. 따라서, 본 발명에서 서로 다른 복용량이 사용될 수 있을 뿐만 아니라 상이한 수의 복용, 예를 들어 주사가 여러번 주사하는 것을 포함하여 그 이상으로 사용될 수 있다. 조합된 치료방법이 항-VEGF 치료학적 항체의 투여 전, 후 또는 동안에 사용되고, 투여될 수 있다.

중요한 생물학적 의미를 가지는 본 발명의 항체의 여러가지 유용한 생체 내 방법들 및 용도들이 제공된다. 첫째로, VEGF를 포함하는, 바람직하게는 VEGF를 포함하지 않는(비-수용체 결합) 조성물과 본 발명의 적어도 제1의 VEGFR2-차단성 항-VEGF 항체 또는 그것들의 항원-결합 단편을 효과적으로 접촉시키는 것을 포함하는 VEGF 결합에 사용하는 방법이 제공된다.

일반적으로 VEGF/항체 복합체를 형성하도록 하는 데 효과적인 조건하에서 VEGF를 함유하는 것으로 의심되는 조성물과 본 발명의 적어도 제1의 인간 항체 또는 그것들의 항원-결합 단편을 접촉시키고, 그렇게 형성된 복합체를 검출하는 것을 포함하는 VEGF를 검출하는 데 사용하는 방법이 제공된다. 상기 검출 방법 및 용도는 생물학적 샘플과 함께, 예를 들어 신생혈관형성 및 종양에 대한 진단에 사용될 수 있으며, 거기에 기초한 진단 키트 또한 제공된다.

본 발명은 일반적으로 VEGF 수용체 VEGFR2에 대한 VEGF의 결합을 억제하는 데 효과적인 조건하에서, 본 발명의 생물학적 유효량의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 포함하는 조성물과 VEGFR2(KDR/Flk-1)를 발현하는 내피 세포를 포함하는 세포 또는 조직의 집단을 VEGF의 존재하에서 접촉시키는 것을 포함하는, VEGF 수용체 VEGFR2에 결합하는 VEGF를 선택적으로(preferentially) 또는 특이적으로(specifically) 억제하는 데 사용하는 방법을 제공한다.

VEGF 수용체 VEGFR1에 결합하는 VEGF를 현저하게 억제하는 일 없이, VEGF 수용체에 결합하는 VEGF를 현저하게 억제하는 데 사용하는 방법이 제공된다. 이 방법들은 VEGF 수용체 VEGFR1에 결합하는 VEGF를 현저하게 억제하는 일 없이 VEGF 수용체 VEGFR2에 결합하는 VEGF를 억제하는 데 효과적인 조건하에서, 본 발명의 생물학적 유효량의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 포함하는 조성물과 VEGFR2(KDR/Flk-1) 및 VEGFR1(Flt-1)을 발현하는 내피 세포 집단을 포함하는 세포 또는 조직 집단을 VEGF의 존재하에서 접촉시키는 것을 포함한다.

본 발명의 추가 방법 및 용도는

(a) 본 발명의 생물학적 유효량의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 포함하는 조성물과 VEGF2(KDR/Flk-1) 및 VEGFR1(Flt-1)을 발현하는 세포 집단과 VEGF를 포함하는 생물학적 조성물 또는 조직을 접촉시키는 단계;

(b) VEGF에 대한 적어도 제1의 생물학적 반응에 대한 본 발명의 VEGFR2-차단성 항-VEGF 항체의 효과를 측정하는 단계, 여기에서:

(i) 본 발명의 VEGFR2-차단성 항-VEGF 항체의 존재하에서 생물학적 반응의 변화는 VEGFR2 수용체에 의해 매개되는 반응을 나타내고;

(ii) 본 발명의 VEGFR2-차단성 항-VEGF 항체의 존재하에서 생물학적 반응의 유지는 VEGFR1 수용체에 의해 매개되는 반응을 나타낸다.

를 포함하는, VEGFR2 및 VEGFR1으로 칭하는 VEGF 수용체의 생물학적 역할을 분석하는 것이다.

일반적으로 VEGF-유도성 내피 세포 증식 및/또는 이동을 억제하는 데 효과적인 조건하에서, 본 발명의 생물학적 유효량의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 본 발명의 VEGFR2-차단성 항-VEGF 항체의 항원-결합 단편을 포함하는 조성물과 내피 세포 집단을 포함하는 세포 또는 조직의 집단을 접촉시키는 것을 포함하는, VEGF-유도성 내피 세포 증식 및/또는 이동을 특이적으로 억제하는 것들을 포함하는 증식 억제 방법 및 용도가 제공된다.

일반적으로 EGFR2-유도성 대식세포 기능을 억제하는 데 효과적인 조건하에서, 본 발명의 생물학적 유효량의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 상기 항-VEGF 항체의 항원-결합 단편을 포함하는 조성물과 대식세포 및 VEGF를 함유하는 세포 또는 조직의 집단을 접촉시키는 것을 포함하는, VEGFR2-유도성 대식세포 기능을 억제하는 데 사용하는 방법 또한 제공된다.

앞서 언급한 방법들은 종양의 치료에 사용되는 것이 바람직하며, 여기에서 상기 방법은 VEGFR2-유도성 대식세포 기능을 억제하므로 종양의 진행 및/또는 전이를 촉진하기 위한 VEGFR2를 발현하는 종양-침투성(tumor-infiltrating) 대식세포의 능력을 감소시킨다.

용골세포 또는 연골파괴 세포의 VEGFR1-매개성 자극을 현저하게 억제하는 일 없이 VEGF-유도성 내피 세포 증식 및/또는 이동 및 선택적으로 신생혈관형성을 억제하는 데 사용하는 방법이 더 제공된다. 상기 방법은 일반적으로 용골세포 또는 연골파괴 세포의 VEGFR1-매개성 자극을 현저하게 억제하는 일 없이 VEGF-유도성 내피 세포 증식 및/또는 이동 또는 신생혈관형성을 억제하는 데 효과적인 조건하에서, 본 발명의 생물학적 유효량의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 상기 항체의 항원-결합 단편을 포함하는 조성물과, 내피 세포 및 적어도 하나의 용골세포 또는 연골파괴 세포를 포함하는 세포 또는 조직의 집단을 접촉시키는 것을 포함한다.

앞서 언급한 방법 및 용도들은 후자의 경우에 있어서 시험관 내(in vivo) 및 생체 내(in vivo)에서 수행될 수 있으며, 여기에서 상기 조직 또는 세포들은 동물 내에 위치하고, 상기 인간 항-VEGF 항체는 동물에게 투여된다. 두 경우 모두에 있어서, 상기 방법 및 용도들은 신생혈관형성을 억제하는 데 효과적인 조건하에서, 생물학적 유효량의 적어도 제1의 VEGFR2-차단성 항-VEGF 항체 또는 그것들의 항원-결합 단편을 포함하는 항신생혈관형성 조성물과, 신생혈관이 형성되거나 부분적으로 신생혈관이 형성된 혈관, 즉 VEGF에 노출되거나 잠재적으로 노출된 혈관을 포함하는 조직 또는 혈관의 집단과 접촉시키는 것을 포함하는, 신생혈관형성을 억제하기 위한 방법 및 용도가 된다.

신생혈관 형성의 가능성이 있는 혈관의 집단을 세포 외에서 유지할 경우, 본 발명은 약물 발견 프로그램에서의 유용성을 가진다. 시험관 내 스크리닝 검정에서, 믿을 수 있는 양성 및 음성 대조군을 사용하는 것은 신생혈관형성을 억제하거나 촉진하기 위한 약물의 개발에서 뿐만 아니라 신생혈관형성 과정상에서의 추가 정보의 설계에서도 제1 단계로서 유용하다. 신생혈관 형성의 가능성이 있는 혈관의 집단이 동물 또는 환자 내에 위치하는 경우, 항신생혈관형성 조성물은 치료학적 형태로서 동물에게 투여된다.

각각의 앞서 언급한 억제 방법의 견지에서 "생물학적 유효량(Biologically effective amounts)"은 따라서 VEGF-유도성 내피 세포 증식 및/또는 이동을 억제하고; VEGFR1-유도성 세포 활동(cellular events)을 현저하게 억제하는 일 없이 VEGF-유도성 내피 세포 증식 및/또는 이동을 억제하고; 용골세포 또는 연골파괴 세포의 VEGFR1 자극을 현저하게 억제하는 일 없이 VEGF-유도성 내피 세포 증식 및/또는 이동 또는 신생혈관형성을 억제하고, 결국 혈관 성장 또는 신생혈관형성을 억제하는 데 효과적인 방법으로 혈관 내피 세포 증식 및/또는 이동을 감소시키는 데 효과적인 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체의 양이다.

따라서, 본 발명은 용골세포 또는 연골파괴 세포의 VEGF 자극을 현저하게 억제하는 일 없이 VEGF-유도성 신생혈관형성을 억제하고, 바람직하게는 신생혈관형성성 질병을 치료하는 데 사용하는 방법을 제공한다. 상기 방법은 일반적으로 용골세포 또는 연골파괴 세포의 VEGF 자극을 현저하게 억제하는 일 없이 VEGF-유도성 신생혈관형성을 억제하고 신생혈관형성성 질병을 치료하는 데 효과적인 조건하에서, 본 발명의 생물학적 유효량의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 상기 항체의 항원-결합 단편을 포함하는 조성물과, 내피 세포 및 적어도 하나의 용골세포 또는 연골파괴 세포를 포함하는 세포 또는 조직의 집단을 접촉시키는 것을 포함한다.

골 대사에 현저한 부작용을 야기하는 일 없이 VEGF-유도성 신생혈관형성을 억제하고, 바람직하게는 신생혈관형성성 질병을 치료하는 데 사용하는 방법이 더 제공된다. 상기 방법은 일반적으로 용골세포 또는 연골파괴 세포의 활성을 현저하게 손상시키지 않음으로써 골 대사에 현저한 부작용을 야기하는 일 없이 VEGF-유도성 신생혈관형성을 억제하고 신생혈관형성성 질병을 치료하는 데 효과적이 조건하에서, 본 발명의 생물학적 유효량의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 상기 항체의 항원-결합 단편을 포함하는 조성물과, 혈관 내피 세포 및 적어도 하나의 용골세포 또는 연골파괴 세포를 포함하는 조직 또는 신생혈관이 형성된 혈관의 집단을 접촉시키는 것을 포함한다.

바람직하지 않고, 부적절하며, 비정상의, 과도한 병리학적 신생혈관형성을 특징으로 하는 임의의 질병을 가지거나 발병 위험이 있는 동물 및 환자의 견지에서, 항신생혈관형성 약물 스크리닝(시험관 내) 및 치료(생체 내)가 제공된다. 넓은 범위의 질병 및 질환에서 비정상의 신생혈관형성이 일어나기 때문에, 일단 임의의 허용가능한 모델 시스템에서 효과적인 것으로 나타난 주어진 항신생혈관형성 치료는 신생혈관형성과 관련된 전 범위의 질병 및 질환을 치료하는 데 사용될 수 있다는 것은 당업자에게 잘 알려져 있다.

본 발명의 방법 및 용도는 특히 신생혈관성 종양; 노인성 황반변성(age-related macular degeneration)을 포함하는 황반변성(macular degeneration); 류마티스성 관절염(rheumatoid arthritis)을 포함하는 관절염(arthritis); 아테롬성 동맥경화증(atherosclerosis) 및 아테롬성 플라크(atherosclerotic plaques); 당뇨병성 망막증(diabetic retinopathy) 및 다른 망막증; 그레이브스 병(Grave's disease)을 포함하는 갑상선 과형성증(thyroid hyperplasias); 혈관종(hemangioma); 신생혈관성 녹내장(neovascular glaucoma) 및 건선(psoriasis)의 임의의 형태를 가지거나 발병 위험이 있는 동물 및 환자의 치료를 위한 것이다.

본 발명의 방법 및 용도는 또한 뇌동정맥기형(arteriovenous malformations; AVM), 뇌수막종(meningioma) 및 혈관형성(angioplasty)에 따른 재협착(restenosis)을 포함하는 혈관 재협착(vascular restenosis)을 가지거나 발명 위험이 있는 동물 및 환자의 치료를 위한 것이다. 상기 치료학적 방법 및 용도의 다른 대상은 혈관섬유종(angiofibroma), 피부염(dermatitis), 자궁 내막증(endometriosis), 혈우병성 관절(hemophilic joints), 비후성 흉터(hypertrophic scars), 염증성 질병 및 질환, 화농성 육아종(pyogenic granuloma), 피부 경화증(scleroderma), 활막 세포염(synovitis), 트라코마(trachoma) 및 혈관 유착(vascular adhesions)을 가지거나 발병 위험이 있는 동물 및 환자이다.

각각 참조로서 본원에 특별히 통합되어 있는 미국 특허등록번호 제5,712,291호 및 제6,524,583호에 기재된 것과 같이, 각각의 앞서 언급한 다소 바람직한 치료군은 결코 본 발명에 의해 치료되는 증상의 형태를 총망라한 것이 아니다. 미국 특허등록번호 제5,712,291호 및 제6,524,583호는 각각 어떤 특정 목적을 위하여 참조로서 본원에 통합되어 있으며, 항신생혈관성 치료에 의해 효과적으로 치료될 수 있는 다수의 다른 증상들을 확인하기 위한 목적; 일단 신생혈관형성을 억제하는 화합물의 정의된 카테고리가 기재되고 청구된다면 모든 신생혈관성 질병의 치료가 단일화된 컨셉을 나타냄을 보여주기 위한 목적; 및 모든 신생혈관성 질병의 치료가 단지 단일의 모델 시스템으로부터 얻은 데이터에 의해 가능함을 보여주기 위한 목적을 포함한다.

또 다른 양상 및 참조로서 본원에 각각 통합되어 있는 미국 특허등록번호 제5,712,291호 및 제6,524,583호에 기재된 것과 같은 것에서, 본 발명의 방법 및 용도는 섬유혈관 조직(fibrovascular tissue)의 비정상적인 증식, 홍반성 여드름(acne rosacea), 후천성 면역결핍 증후군(acquired immune deficiency syndrome), 동맥 폐쇄(artery occulusion), 아토피성 각막염(atopic keratitis), 세균성 궤양(bacterial ulcers), 베체트 병(bechets disease), 혈행성 종양(blood borne tumor), 경동맥 폐쇄성 질병(carotid obstructive disease), 화학적 화상(chemical burns), 맥락막 신생혈관형성(choroidal neovascularization), 만성 염증(chronic inflammation), 만성 망막 박리(chronic retinal detachment), 만성 포도막염(chronic uveitis), 만성 유리체염(chronic vitritis), 콘텍트 렌즈 과도착용(contact lens overwear), 각막이식 거부(corneal graft rejection), 각막 신생혈관형성(cornealneovascularization), 각막 이식 신생혈관형성(corneal graft neovascularization), 크론병(Crohn's disease), 일스병(eales disease), 유행성 각결막염(epidemic keratoconjunctivitis), 진균성 궤양(fungal ulcers), 허피스 단순포진 감염(Herpes simplex infection), 대상포진 감염(herpes zoster infection), 과점도 증후군(hyperviscosity syndromes), 카포시 육종(kaposi's sarcoma), 백혈병(leukemia), 지방 변성증(lipid degeneration), 라임병(Lyme's disease), 주변성 각질용해증(marginal keratolysis), 무렌 궤양(mooren ulcer), 나병(leprosy)을 제외한 마이코박테리아 감염(mycobacteria infection), 근시(myopia), 신생혈관성 안질환(ocular neovascular disease), 유두공(optic pits), 오슬러-웨버 증후군(Osler-Weber syndrome)(오슬러-웨버-렌두 증후군(Osler-Weber-Rendu syndrome)), 골관절염(osteoarthritis), 페이젯병(Pagets disease), 주변부 포도막염(pars planitis), 유천포창(pemphigoid), 플릭텐성 각결막염(phlyctenulosis), 다발성 동맥염(polyarteritis), 포스트-레이져 합병증(post-laser complications), 원충 감염(protozoan infections), 탄력섬유 가성황색종(pseudoxanthoma elasticum), 익상편 건선 각막염(pterygium keratitis sicca), 방사상 각막절개술(radial keratotomy), 망막 신생혈관형성(retinal neovascularization), 미숙아 망막증(retinopathy of prematurity), 수정체후부 섬유증식증(retrolental fibroplasias), 사르코이드증(sarcoid), 공막염(scleritis), 겸상 적혈구 빈혈증(sickle cell anemia), 쇼그렌 증후군(Sogrens syndrome), 고형 종양(solid tumors), 스타가츠병(Stargarts disease), 스티브 존슨병(Steven's Johnson disease), 상각막윤부 각막염(superior limbic keratitis), 매독(syphilis), 전신성 홍반(systemic lupus), 테리엔 변연성 각막변성증(Terrien's marginal degeneration), 톡소플라스마증(toxoplasmosis), 정신적 외상(trauma), 유잉 육종의 종양(tumor of Ewing sarcoma), 신경아세포종의 종양(tumor of neuroblastoma), 골육종의 종양(tumor of osteosarcoma), 망막모세포종의 종양(tumor of retinoblastoma), 횡문근 육종의 종양(tumor of rhabdomyosarcoma), 궤양성 대장염(ulcerative colitis), 정맥 폐쇄(vein occlusion), 비타민 A 결핍증(Vitamin A deficiency) 및 베게너 유육종증(Wegeners sarcoidosis)을 가지거나 발병 위험이 있는 동물 및 환자의 치료를 위한 것이다.

본 발명은 참조로서 본원에 특별히 통합되어 있는 미국 특허등록번호 제5,753,230에 기재된 면역제를 사용하는 관절염의 치료와 마찬가지로 관절염을 가지거나 발병 위험이 있는 동물 및 환자의 치료를 위한 방법 및 용도를 더 제공한다. 미국 특허등록번호 제5,972,922호 또한 당뇨병(diabetes), 기생병(parasitic diseases), 비정상적 상처 치유(abnormal wound healing), 수술에 따른 비대(hypertrophy), 화상, 손상 또는 외상, 두발 성장의 저해, 배란(ovulation) 및 황체 형성(corpus luteum formation)의 저해, 이식(implantation)의 저해 및 자궁에서의 배아 발달의 저해와 관련된 바람직하지 않은 신생혈관형성의 치료를 위한 항신생혈관형성 방법의 명세서를 더 예시하기 위하여 참조로서 본원에 특별히 통합되어 있다. 따라서, 앞서 언급한 모든 증상들은 본 발명의 방법 및 용도에 의한 치료를 위하여 고려된다.

미국 특허등록번호 제5,639,757호는 이식 거부의 일반적인 치료를 위한 항신생혈관형성 방법의 용도를 예시하기 위하여 참조에 의해 본원에 특별히 더 통합되어 있다. 폐 감염(lung inflammation), 신증후군(nephrotic syndrome), 임신중독증(preeclampsia), 심낭염(pericarditis)과 관련된 것과 같은 심낭 삼출증(pericardial effusion)의 일반적인 치료를 위한 항신생혈관형성 방법의 용도를 예시하기 위하여 참조로서 본원에 특별히 더 통합되어 있고, VEGF 억제에 기초한 항신생혈관형성 방법을 사용하는 흉막 삼출증(pleural effusion)은 참조로서 본원에 특별히 통합되어 있는 국제공개특허번호 제98/45331호에 기재되어 있다. 따라서, 임의의 앞서 언급된 증상들을 가지거나 발병 위험이 있는 동물 및 환자는 본 발명의 방법 및 용도에 의한 치료를 위하여 고려된다.

참조에 의해 본원에 특별히 통합되어 있는 국제공개특허번호 제98/16551에 기재된 바와 같이, VEGF 기능을 길항(antagonize)시키는 생물학적 분자 또한 바람직하지 않은 혈관 침투성을 특징으로 하는 질병 및 질환의 치료에서 사용하기에 적합하다. 따라서, 본 발명의 VEGF 길항성 항체, 방법 및 용도는 바람직하지 않은 혈관 침투성을 특징으로 하는 질병 및 질환, 예를 들어, 뇌종양과 관련된 부종(edema), 악성 종양과 관련된 복수(ascites), 메이그스 증후군(Meigs' syndrome), 폐 감염, 신증후군, 심낭 삼출증 및 흉막 삼출증 등을 가지거나 발병 위험이 있는 동물 및 환자의 치료에 적용할 수 있다.

비록 앞서 언급한 모든 질병들의 치료가 현재의 단일화된 발명 내에서 가능하다 하더라도, 본 발명의 방법 및 용도의 특히 바람직한 양상은 신생혈관성 고형 종양, 전이성 종양(metastatic tumor) 또는 1차 종양으로부터의 전이를 가지거나 발병 위험이 있는 동물 및 환자에 대한 항신생혈관형성 치료에 대한 특허이다.

용골세포 또는 연골파괴 세포의 VEGF 자극을 현저하게 억제하는 일 없이, VEGF-유도성 신생혈관형성을 억제하고, 바람직하게는 항종양 또는 향상된 항종양 효과를 발휘하는 데 사용하는 방법을 더 제공한다. 상기 방법은 일반적으로 용골세포 또는 연골파괴 세포의 VEGF 자극을 현저하게 억제하는 일 없이 VEGF-유도성 신생혈관형성을 억제하고 항종양 또는 향상된 항종양 효과를 발휘하는 데 효과적인 조건하에서, 본 발명의 생물학적 유효량의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 상기 항체의 항원-결합 단편을 포함하는 조성물과, 혈관 내피 세포 및 적어도 하나의 대식세포, 용골세포 또는 연골파괴 세포를 포함하는 조직, 종양 환경 또는 신생혈관성 혈관의 집단과 접촉시키는 것을 포함한다.

따라서, 본 발명은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 또는 이와 같은 항-VEGF 항체의 항원-결합 단편 또는 면역접합체를 포함하는 약제학적 유효량의 적어도 제1의 약제학적 조성물을 이와 같은 질병 또는 암을 가지는 동물 또는 환자에게 투여하는 것을 포함하는, 신생혈관형성에 관련된 모든 형태의 암을 포함하는 신생혈관형성과 관련된 질병을 치료하는 데 사용하는 방법을 더 제공한다.

게다가, 본 발명의 방법 및 용도는 림프관 형성(lymphangiogenesis)을 억제하는 데 효과적인 조건하에서 본 발명의 생물학적 유효량의 적어도 제1의 VEGFR2-차단성 항-VEGF 항체 또는 그것들의 항원-결합 단편을 포함하는 항신생혈관성 조성물과 림프관(lymphatic vessels, "lymphatics"), 특히 VEGF에 노출되거나 잠재적으로 노출된 림프관을 포함하는 조직 또는 림프관의 집단을 접촉시키는 것을 포함하는, 림프관 형성을 억제하기 위한 방법 및 용도를 포함한다.

림프관의 집단을 세포 외에서 유지시킬 경우, 본 발명은 약물 발견 프로그램에서의 유용성을 가진다. 림프관의 집단이 동물 또는 환자의 내에 위치하는 경우, 본 발명의 조성물은 치료의 형태로서 동물에게 투여된다.

림프관 형성을 억제하는 것에 관하여, "생물학적 유효량(biologically effective amounts)"은 VEGF-유도성 림프관 형성, 즉 VEGFR2에 의해 유도된 VEGF-A 자극성 림프관 형성을 억제하는 데 효과적인 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체의 양이다. 바람직하게는, VEGF-유도성 림프관 형성은 용골세포 또는 연골파괴 세포 자극과 같은 VEGFR1-자극성 활동을 현저하게 억제하는 일 없이 유도될 것이다.

따라서, 본 발명은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 또는 이와 같은 항-VEGF 항체의 항원-결합 단편 또는 면역접합체를 포함하는 치료학적 유효량의 적어도 제1의 약제학적 조성물을 이와 같은 질병 또는 암을 가지는 동물 또는 환자에 투여하는 것을 포함하는, 림프관 형성에 관련된 모든 형태의 암을 포함하는 림프관 형성에 관련된 질병을 치료하는데 사용하는 방법을 포함한다.

본 발명의 또 다른 양상은 치료, 이미지화 또는 진단에 사용하기 위한 조성물 또는 약제의 제조에서의 본 발명의 인간 항체 또는 이와 같은 항체의 항원-결합 단편 또는 면역접합체의 용도를 제공한다.

또 다른 양상은 치료, 진단 또는 이미지화에 사용하기 위한 본 발명의 인간 항체 또는 이와 같은 항체의 항원-결합 단편 또는 면역접합체를 제공한다.

게다가, 본 발명은 하나 또는 그 이상의 약제학적으로 허용가능한 첨가제, 담체, 희석제, 버퍼 또는 안정화제와 함께 본 발명의 인간 항체 또는 이와 같은 항체의 항원-결합 단편 또는 면역접합체를 포함하는 조성물을 제공한다.

본원에 기재된 것과 같은 생체 내 방법은 일반적으로 포유동물에서 수행된다. 예를 들어, 인간 및 임의의 가축류, 가축 또는 실험실 동물과 같은 임의의 포유동물이 치료될 수 있다. 특정 예는 마우스, 쥐, 돼지, 고양이, 개, 양, 토끼, 소 및 원숭이를 포함한다. 그러나 바람직하게는, 상기 포유동물은 인간이다.

따라서, 본원에 사용된 것으로서 상기 용어 "동물(animal)" 또는 "환자(patient)"는 임의의 포유동물, 예를 들어, 인간 및 임의의 가축류, 가축 또는 실험실 동물을 포함한다. 특정 예는 마우스, 쥐, 돼지, 고양이, 개, 양, 토끼, 소 및 원숭이를 포함한다. 그러나 바람직하게는, 상기 동물 또는 환자는 인간 피험자이다.

본 발명은 비접합되거나 나출된(naked) 항체 및 그것들의 단편을 사용하는 항신생혈관성 방법 및 본 발명의 인간 항체 또는 그것들의 항원-결합 단편이 치료제에 작동가능하도록 부착되어 있는 면역접합체를 사용하는 혈관 표적 방법 모두가 연결된다. 특별히 언급하거나 과학 용어로 명확하게 하지 않는 한, 본원에 사용된 것으로서 상기 용어 "항체 및 그것들의 단편(antibody and fragment thereof)"는 따라서 다른 약제, 특히 치료제 또는 진단제에 부착되지 않은 "비접합되거나 나출된(unconjugated or naked)" 인간 항체 또는 단편을 의미한다. 이러한 정의는 실시예만을 통하여 항체 또는 다른 작동자(effector)와 항체의 조합의 항체의 반감기, 친화력, 결합력(avidity) 또는 다른 특성을 향상시키기 위한 변경과 같은 항체의 변경을 제외하지 않는다.

본 발명의 항신생혈관성 치료 방법 및 용도는 또한 비접합되거나 나출된(naked) 항체 및 면역접합체 모두의 용도를 포함한다. 면역접합체 기재의 항신생혈관성 치료 방법에서, 본 발명의 인간 항체 또는 그것들의 항원-결합 단편은 제2의 항신생혈관성 약제(항-VEGF 항체 그 자체, 제1의 항신생혈관성 약제)에 작동가능하도록 부착되는 것이 바람직하다. 상기 부착된 항신생혈관성 약제는 직접 또는 간접적인 항신생혈관성 효과를 가지는 것들일 수 있다.

상기 항신생혈관성 치료 방법 및 용도는 본 발명의 적어도 제1의 비접합되거나 나출된 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 포함하는 치료학적 유효량의 적어도 제1의 약제학적 조성물을 신생혈관형성과 관련된 모든 형태의 암을 포함하는 신생혈관형성 관련된 질병을 가지는 동물 또는 환자에게 투여하는 것을 포함한다. 동등하게는, 상기 투여된 항체는 제2의 항신생혈관성 약제와 작동가능하게 결합될 수 있다.

전이성 암을 치료하는 데 사용하는 방법은 본 발명의 적어도 제1의 비접합되거나 나출된 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 포함하는 치료학적 유효량의 적어도 제1의 약제학적 조성물을 전이성 암을 가지는 동물 또는 환자에게 투여하는 것을 포함한다. 또 다른 방법은 여기에서 상기 투여된 항체가 제2의 항신생혈관성 약제와 작동가능하게 결합될 수 있는 것이다.

일차 암(primary cancer)으로부터의 전이를 감소시키는 데 사용하는 방법은 일차 암을 가지거나 일차 암에 대한 치료를 받은 동물 또는 환자에 대하여, 본 발명의 적어도 제1의 비접합되거나 나출된 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 포함하는 치료학적 유효량의 적어도 제1의 약제학적 조성물을 전이성 암을 가지는 동물 또는 환자에게 투여하는 것을 포함한다. 유사하게는, 상기 투여된 항체는 제2의 항신생혈관성 약제와 작동가능하게 결합될 수 있다.

신생혈관형성에 관련된 암의 모든 형태를 포함하는 신생혈관형성에 관련된 질병을 치료하는 데 사용하는 방법은 질병 부위 또는 신생혈관성 종양 내에서 신생혈관형성을 억제하는 데 효과적인 양으로 본 발명의 적어도 제1의 비접합되거나 나출된 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 이와 같은 질병, 예를 들어, 신생혈관성 종양을 가지는 동물 또는 환자에게 투여하는 것을 더 포함한다. 동등하게는, 상기 투여된 항체는 제2의 항신생혈관성 약제와 작동가능하게 결합될 수 있다.

신생혈관형성에 관련된 암의 모든 형태를 포함하는 신생혈관형성에 관련된 질병을 치료하는 데 사용하는 방법은 VEGF 수용체 VEGFR2에 결합하는 VEGF를 억제하는 데 효과적인 양으로 본 발명의 적어도 제1의 비접합되거나 나출된 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 이와 같은 질병 또는 암을 가지는 동물 또는 환자에게 투여하는 것을 더 포함하며, 그것에 의하여 질병 또는 암에 걸린 부위 내에서 신생혈관형성을 억제한다. 상기 투여된 항체는 대안적으로 제2의 항신생혈관성 약제와 작동가능하게 결합될 수 있다.

신생혈관형성에 관련된 암의 모든 형태를 포함하는 신생혈관형성에 관련된 질병을 치료하는 데 사용하는 방법은 또한 본 발명의 치료학적 유효량의 적어도 제1의 비접합되거나 나출된 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 신생혈관성 종양을 가지는 동물 또는 환자에게 투여하는 것을 포함하며, 여기에서 상기 항-VEGF 항체는 VEGF 수용체 VEGFR1(Flt-1)에 결합하는 VEGF를 현저하게 억제하는 일 없이 VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 실질적으로 억제한다. 동등하게는, 상기 투여된 항체는 대안적으로 제2의 항신생혈관성 약제와 작동가능하게 결합될 수 있다.

신생혈관형성에 관련된 암의 모든 형태를 포함하는 신생혈관형성에 관련된 질병을 치료하는 데 사용하는 또 다른 방법은 본 발명의 치료학적 유효량의 적어도 제1의 비접합되거나 나출된 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 이와 같은 질병, 암 또는 신생혈관성 종양을 가지는 동물 또는 환자에게 투여하는 것을 포함하고, 여기에서, 상기 항-VEGF 항체는 VEGF 수용체 VEGFR1(Flt-1)에 결합하는 VEGF를 현저하게 억제하는 일 없이 VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 실질적으로 억제하며, 그것에 의하여 동물에서 VEGFR1-매개성 활동을 현저하게 손상시키는 일 없이 질병 부위, 암 또는 신생혈관성 종양 내에서 신생혈관형성을 억제한다. 상기 투여된 항체 또한 제2의 항신생혈관성 약제와 작동가능하게 결합될 수 있다.

신생혈관형성에 관련된 암의 모든 형태를 포함하는 신생혈관형성에 관련된 질병을 치료하는 데 사용하는 부가적인 방법은 본 발명의 치료학적 유효량의 적어도 제1의 비접합되거나 나출된 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 이와 같은 질병, 암 또는 신생혈관성 종양을 가지는 동물 또는 환자에게 투여하는 것을 포함하고, 여기에서, 상기 항-VEGF 항체는 VEGF 수용체 VEGFR1(Flt-1)에 결합하는 VEGF를 현저하게 억제하는 일 없이 VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 실질적으로 억제하며, 그것에 의하여 질병 부위에서 VEGFR2를 발현하는 대식세포, 특히 VEGFR2를 발현하는 종양침투성 대식세포의 억제를 포함하는 질병 부위, 암 또는 신생혈관성 종양 내에서 신생혈관형성을 억제한다. 상기 투여된 항체 또한 제2의 항신생혈관성 약제와 작동가능하게 결합될 수 있다.

신생혈관형성에 관련된 암의 모든 형태를 포함하는 신생혈관형성에 관련된 질병을 치료하는 데 사용하는 여전히 다른 방법은 본 발명의 치료학적 유효량의 적어도 제1의 비접합되거나 나출된 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 이와 같은 질병, 암 또는 신생혈관성 종양을 가지는 동물 또는 환자에게 투여하는 것을 포함하고, 여기에서 상기 항-VEGF 항체는 VEGF 수용체 VEGFR1(Flt-1)에 결합하는 VEGF를 현저하게 억제하는 일 없이 VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 실질적으로 억제하며, 그것에 의하여 동물세포에서 용골세포 및/또는 연골파괴 세포의 활성을 현저하게 손상시키는 일 없이 질병 부위, 암 또는 신생혈관성 종양 내에서 신생혈관형성을 억제한다. 동등하게는, 상기 투여된 항체는 제2의 항신생혈관성 약제와 작동가능하게 결합될 수 있다.

신생혈관형성에 관련된 암의 모든 형태를 포함하는 신생혈관형성에 관련된 질병을 치료하는 데 사용하는 방법은 골 대사상에 현저한 부작용을 미치는 일 없이 질병 부위 또는 신생혈관성 종양 내에서 신생혈관형성을 억제하는 데 효과적인 양으로, 본 발명의 적어도 제1의 비접합되거나 나출된 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 이와 같은 질병, 예를 들어 신생혈관성 종양을 가지는 동물 또는 환자에게 투여하는 것을 더 포함한다.

앞서 언급된 항신생혈관성 치료 방법 및 용도는 일반적으로 동물 또는 환자에 대하여 전신적으로, 경피적(transdermal) 주사, 근육내(intramuscular) 주사, 정맥(intravenous) 주사 등에 의한 약제학적으로 효과적인 조성물의 투여를 포함한다. 그러나, 종양 또는 종양 내부의 혈관 내피 세포를 포함하는 신생혈관형성 부위 또는 부위들에 치료학적 약제를 위치시킬 수 있게 하는 임의의 투여 방법들이 적용될 수 있을 것이다. 따라서, 운반의 다른 적절한 방법은 경구(oral), 직장(rectal), 비강(nasal), 국부(topical) 및 질(vaginal)을 포함한다. 미국 특허등록번호 제5,712,291호는 신생혈관성 질병 또는 질환의 치료와 관련하여 포함될 수 있는 투여의 다양한 방법을 더 설명하는 것을 포함할 목적으로 참조로서 본원에 특별히 통합되어 있다.

관절염의 치료를 위한 용도 및 방법을 위하여, 참조로서 본원에 특별히 통합된 미국 특허등록번호 제5,753,230호에서의 다른 면역학적 약제에 대하여 기재된 것과 같이, 예를 들어, 활액막내 투여(intrasynovial administration)가 적용될 수 있다. 눈과 관련된 증상을 위하여, 안구 제형 및 투여가 고려된다.

본원에 사용된 것으로서, "투여(administration)"은 항신생혈관형성 및/또는 항종양 효과를 발휘하는데 효과적인 양과 시간으로 VEGFR2-차단성 인간 항-VEGF 항체 치료제의 공급 또는 운반하는 것을 의미한다. 부분적으로는 투여의 간편성 및 재현성을 위하여 단백질성 치료제(proteinaceous therapeutics)의 수동적 투여가 일반적으로 바람직하다.

그러나, 상기 용어 "투여(administration)"는 본 발명의 VEGFR2-차단성 항-VEGF 항체가 임의의 모든 수단에 의하여 종양의 맥관구조에 운반되거나 만약 그렇지 않으면 제공되는 것을 칭하는 것으로 본원에 사용된다. 따라서, "투여"는 종양에 운반하는 데 효과적인 방법으로 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체를 생산하는 세포의 공급을 포함한다. 이와 같은 구현에서, 그것은 일반적으로 치료를 중단하기 위하여 제거될 수 있는 선택적 투과가 가능한 막(selectively permeable membrane), 구조 또는 이식가능한 기구에 세포를 제형화하거나 패키지하는 것이 바람직할 것이다. 본 발명의 외인성 VEGFR2-차단성 인간 항-VEGF 항체는 용량이 면밀히 관찰되고 조절되도록 하는 비침습성(non-invasive) 방법이기 때문에 여전히 일반적으로 바람직할 것이다.

본 발명의 치료학적 방법 및 용도는 또한 종양의 근처에서 발현하거나 종양에 위치하도록 하는 데 유효한 방법으로 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체를 암호화하는 핵산을 공급하기 위한 것이다. 환자 세포의 생체 외(ex vivo) 조작 등을 포함하는 나상 DNA(naked DNA) 운반, 재조합 유전자 및 벡터, 세포-기반의 운반과 같은 임의의 유전자 치료 기술이 사용될 수 있다.

또 다른 구현에서, 본 발명은 선택된 치료제 또는 진단제를 질병과 관련된 신생혈관성 혈관으로 운반하는 데 사용하기 위한 방법을 제공한다. 이와 같은 구현은 선택된 치료제 또는 진단제를 종양 또는 종양 내 맥관구조 또는 기질(stroma)로 운반하는 데 사용되는 것이 바람직하며, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편에 진단제 또는 치료제가 작동가능하게 부착되어 있는 적어도 제1의 면역접합체를 포함하는 조성물의 생물학적 유효량을 신생혈관성 종양을 가지는 동물 또는 환자에게 투여하는 것을 포함한다.

비록 이와 같은 구현을 실행하기 위하여 본 발명이 목표로 하는 양상의 기초를 이루는 작용 메커니즘을 이해할 필요가 있으나, 본 발명의 항체들은 부착된 약제를 거기에서 발현된 VEGFR1에 결합하는 VEGF에 의해서 신생혈관 및 종양 맥관구조로 운반한다고 여겨진다. 따라서, 본 발명의 이 방법 및 용도들은 선택된 치료제 또는 진단제를 신생혈관성 혈관, 종양 또는 종양 내 맥관구조로 운반하는 것에 관여하며, 신생혈관성 혈관, 종양 또는 종양 내 맥관구조 상에서 발현되고, 과발현되거나 상향조절된 VEGR1에 결합하는 VEGR에 대한 항체의 결합을 가능하게 하여 신생혈관성 혈관, 종양 또는 종양 내 맥관구조 상의 VEGF-VEGFR1에 진단제 또는 치료제를 운반하도록 하는 데 효과적인 방법으로, 본 발명의 적어도 제1의 VEGFR2-차단성 항 인간-VEGF 항체 또는 그것들의 항원-결합 단편에 진단제 또는 치료제가 작동가능하게 부착되어 있는 면역접합체를 포함하는 생물학적 유효량의 조성물을 치료를 필요로 하는 동물 또는 환자에게 투여하는 것을 포함한다.

종양 또는 종양 내 맥관구조 또는 기질에 대한 선택된 치료제의 운반은 혈류를 정지, 특히 종양 맥관구조에서의 혈류를 정지시키고; 파괴 또는 특히 종양 맥관구조를 파괴하고; 괴사(necrosis)를 유도, 특히 종양 내에서의 괴사를 유도한다. 이 방법 및 용도는 따라서 치료제에 작동가능하게 부착된 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 포함하는 적어도 제1의 면역접합체를 포함하는 치료학적 유효량의 적어도 제1의 약제학적 조성물을 동물 또는 환자에게 투여하는 것을 포함하는, 신생혈관성 종양을 가지는 동물 또는 환자를 치료하기 위한 방법으로 요약될 수 있다.

본 발명에서 사용하기 위한 "치료학적 유효량(therapeutically effective amount)"은 선택된 동물 또는 환자에게 투여를 통하여 종양 또는 종양 내 혈관 내피 세포의 적어도 일부분을 특이적으로 죽이고; 종양 또는 종양 내 혈관 내피 세포의 적어도 일부분에서 아포토시스(apoptosis)를 특이적으로 유도하고; 종양 또는 종양 내 혈관의 적어도 일부분에서 응고를 특이적으로 촉진하고; 종양의 혈액이 이동하는 맥관의 적어도 일부분을 특이적으로 폐쇄하거나 파괴하고; 종양의 적어도 일부분에서 괴사를 특이적으로 유도하고/하거나 종양의 퇴화(regression) 또는 경감(remission)을 유도하는 데 유효한, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 면역접합체의 양이다.

종양의 맥관구조에서 응고를 촉진하거나 종양의 맥관구조를 파괴하는 것의 맥락 및/또는 종양 기질에 결합 및/또는 종양의 괴사를 야기하는 것의 맥락에서 본원에서 사용된 것으로서, 상기 용어 "선택적으로(preferentially)" 및 "특이적으로(specifically)"는 따라서 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 면역접합체가 종양 기질, 맥관구조 및 종양 부위로 실질적으로 제한되는 기질 결합, 응고, 파괴 및/또는 종양 괴사를 달성하지만, 실질적으로 동물 또는 피험자의 정상적이고 건강한 조직에서는 응고, 파괴 및/또는 조직의 괴사를 야기하지 않도록 기능하는 것을 의미한다.

비록 본 발명의 항체가 VEGFR1과 연관된 VEGR에 결합함으로써 신생혈관 및 종양 맥관구조에 약제를 효과적으로 전달하지만, 다른 방법 및 용도는 치료제를 종양 기질에 전달하는 것에 기초하여 작동하며, 여기에서 그것은 근처의 혈관에 치료 효과를 발휘한다. 이 방법 및 용도들은 종양 기질 내에서 면역접합체를 수용체에 결합하지 않은 VEGF에 결합시키는 데 효과적인 양으로, 본 발명의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편에 작동가능하게 부착된 치료제를 포함하는 면역접합체를 신생혈관성 종양을 가지는 동물 또는 환자에게 투여하는 것을 포함한다.

이 방법 및 용도들은 부착된 치료제가 주변의 종양 맥관구조 및/또는 종양 세포에 항종양 효과를 발휘하게 하도록 하기 위하여 종양 기질 내에 면역접합체를 위치시키는 데 효과적인 양으로, 본 발명의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편이 작동가능하게 부착된 치료제를 포함하는 면역접합체를 신생혈관성 종양을 가지는 동물 또는 환자에게 투여하는 것을 포함한다.

본 발명의 항체 및 조성물 뿐만 아니라 방법 및 용도는 따라서 적어도 제1의 치료제 또는 진단제, 더욱 상세하게는 제1의 "별개의(distinct) 또는 외인성(exogenous)" 치료제에 작동가능하게 부착된 본 발명의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 포함하는 VEGFR2-차단성 항-VEGF 항체를 포함하는 조성물을 위한 것이다. 이와 관련하여, "VEGFR2-차단성 인간 항-VEGF 항체"는 그 자체를 "제1의 치료제(first therapeutic agent)"로 칭할 수 있다. 따라서, 임의의 부착된 치료제는 제1의 "별개의 또는 외인성 치료제(distinct or exogenous therapeutic agent)"로 칭할 수 있고, 이것 또한 치료제를 의미하지만 VEGFR2-차단성 인간 항-VEGF 항체와는 구별되며, VEGFR2-차단성 인간 항-VEGF 항체에 부착된다. 이러한 접합체와 동등한 용어는 적어도 "제2의, 별개의" 치료제 또는 진단제에 작동가능하게 부착되는 것으로서, 본 발명의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편을 설명하기 위한 것이다.

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 또는 치료학적 접합체들은 바람직하게는 하나 또는 그 이상의 방사선 치료제, 항신생혈관성 약제, 아포토시스-유도제, 항튜불린성(anti-tubulin) 약물, 항종양(anti-cellular) 또는 세포독성 약제 또는 응고제(응고 인자)와 결합된다.

본 발명은 따라서 적어도 제1의 치료제 또는 진단제에 작동가능하게 부착된 인간 항체에서의 접합된 항체 및 단편들의 범위를 제공한다. 상기 용어 "면역접합체(immunoconjugate)"는 다른 효과적인 약제와 항체의 효과적인 조합을 정의하기 위하여 널리 사용되고, 임의의 형태의 효과적인 조합만을 단독으로 언급하고자 하는 것은 아니며 특히 화학적 "결합(conjugation)"으로 한정되지 않는다. 재조합 융합 단백질이 특히 고려된다. 운반 또는 표적 약제가 표적에 결합할 수 있는 한, 치료제 또는 진단제는 운반을 통하여 충분히 기능할 수 있고, 부착의 형태가 적합할 것이다.

항체 상의 탄수화물 부분(carbohydrate moieties)을 통한 약제의 부착 또한 고려된다. O-결합(O-linked) 글리코실화 및 N-결합(N-linked) 글리코실화 모두 항체에서 자연적으로 발생한다. 재조합 항체는 만일 원한다면 부가적인 글리코실화 부위를 재생성하거나 생성하도록 변경될 수 있으며, 이는 항체의 1차 서열(primary sequence) 내로 (Asn-X-Ser, Asn-X-Thr, Ser 또는 Thr과 같은) 적절한 아미노산 서열을 조작함으로써 간단히 달성된다.

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 또는 치료학적 접합체에 사용하기 위한 현재의 바람직한 약제 및 관련된 방법 및 용도들은 항체의 효과를 보충하거나 강화시키기 위한 것 및/또는 특정 종양의 형태 또는 환자를 위하여 선별된 것이다. "항체의 효과를 보충하거나 강화시키는 치료제(Therapeutic agents that complement or enhance the effect of the antibody)"는 방사선치료 약제, 항신생혈관성 약제, 아포토시스-유도제 및 항튜블린성 약제를 포함하며, 이것들 중 하나 또는 그 이상을 여기에 사용하는 것이 바람직하다.

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체와 바람직한 약제의 부착 또는 조합은 "면역접합체(immunoconjugates)"를 제공하며, 여기에서 이러한 면역접합체는 종종 강화되고 심지어는 상승된 항종양 특성을 가진다. 이런 식으로 사용하기 위한 현재의 바람직한 항신생혈관성 약제는 안지오스타틴(angiostatin); 엔도스타틴(endostatin); 안지오포이에틴(angiopoietins), 바스큘로스타틴(vasculostatin), 칸스타틴(canstatin) 및 마스핀(maspin) 중 임의의 하나이다. 현재의 바람직한 항튜불린성 약물은 콜히친(colchicine), 탁솔(taxol), 빈블라스틴(vinblastine), 빈크리스틴(vincristine), 빈데스신(vindescine) 및 하나 또는 그 이상의 콤브레타스타틴(combretastatins)을 포함한다.

항종양 및 세포독성 약제의 사용은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 "면역독소(immunotoxins)"를 야기하는 반면, 응고 인자의 사용은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 또는 "응고리간드(coaguligands)"를 야기한다. 하나 또는 그 이상의 방사선치료 약제, 항신생혈관성 약제, 아포토시스-유도제, 항튜불린성 약물, 항종양 또는 세포독성 약제 및 응고 인자의 조합과 같은 적어도 두개의 치료제의 사용 또한 고려된다.

어떤 적용에서, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 치료제는 내피 세포의 성장 또는 세포 분열을 멈추게 하거나 억제하는 능력을 가지는 세포독성 약제, 세포증식 억제제(cytostatic agent) 또는 다른 항종양 약제에 작동가능하게 부착될 것이다. 적절한 항종양 약제는 화학 치료제 뿐만 아니라 세포독성 약제 세포증식 억제제를 포함한다. 세포증식 억제제는 일반적으로 표적 세포 본연의 세포 주기를 저해하는 것이며, 바람직하게는 상기 세포는 세포 주기를 벗어나게 된다.

대표적인 화학 치료제는 스테로이드(steroids); 사이토카인(cytokines); 시토신 아라비노사이드(cytosine arabinoside), 플루오로우라실(fluorouracil), 메토트렉세이트(methotrexate) 또는 아미노프테린(aminopterin)과 같은 대사길항제(anti-metabolites); 안트라사이클린(anthracyclines); 미토마이신 C(mitomycin C); 빈카 알칼로이드(vinca alkaloids); 항생제(antibiotics); 데메콜친(demecolcine); 에토포시드(etoposide); 미트라마이신(mithramycin); 및 클로람부실(chlorambucil) 또는 멜파란(melphalan)과 같은 항종양 알킬레이팅제를 포함한다. 실제로, 표 3에 기재된 임의의 약제들이 사용될 수 있다. 어떤 바람직한 항종양 약제는 다우노루비신(daunorubicin), 독소루비신(doxorubicin)/아드리아마이신(adriamycin) 등과 같은 DNA 합성 억제제이다. 전반적으로, 탁솔(taxol)/파클리탁셀(paclitaxel), 도세탁셀(docetaxel), 시스플라틴(cisplatin), 젬시타빈(gemcitabine), 콤브레타스타틴(combretastatin) 및 독소루비신/아드리아마이신이 현재의 바람직한 항종양 약제이다.

사이토카인 및 케모카인(chemokines)들 중, 현재의 바람직한 약제는 IL-2, IL-12, TNF-α, 인터페론-α(IFN-α), IFN-β, IFN-γ 및 LEC(간-발현성 케모카인)이다. 살리실리할라마이드(salicylihalamide), 콘카나마이신(concanamycin) 또는 심베린(psymberin), 페데린(pederin), 이르시니아스타틴 A(irciniastatin A)와 같은 단백질 합성 억제제로서 바필로마이신(bafilomycin)과 같은 V-타입의 ATPase 억제제 또한 현재 바람직하다.

어떤 치료학적 적용에서, 독소 부분(toxin moieties)은 다른 잠재적인 약제들과 비교하여 대부분의 독소의 세포를 죽이는 효과를 주는 더욱 큰 능력때문에 바람직할 것이다. 따라서, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 구조물에 대한 어떤 바람직한 항종양 약제는 식물, 진균 또는 세균 유래의 독소이다. 대표적인 독소는 에피포도필로톡신(epipodophyllotoxins); 세균성 엔도톡신(bacterial endotoxin) 또는 세균성 엔도톡신의 지질 A 부분; 사포린(saporin) 또는 겔로닌(gelonin)과 같은 리보솜 불활성 단백질(ribosome inactivating proteins); α-사르신; 아스퍼질린(aspergillin); 레스트릭토신(restrictocin); 태반 피보뉴클레아제(placental)와 같은 리보뉴클레아제(ribonucleases); 디프테리아 독소(diphtheria toxin) 및 슈도모나스 엑소톡신(pseudomonoas exotoxin)을 포함한다. 현재의 바람직한 예들은 리신(ricin), 겔로닌(gelonin), 아브린(abrin), 디프테리아(diphtheria), 슈도모나스 및 퍼투시스(pertussis) 독소이다.

현재의 바람직한 독소는 리신 A 사슬과 같은 A 사슬 독소이다. 가장 바람직한 독소 부분은 종종 "탈글리코실화된 A 사슬(deglycosylated A chain; dgA)"라 불리는 탄수화물 잔기를 변경하거나 제거하도록 처리된 리신 A 사슬이다. 탈글리코실화된 리신 A 사슬은 그것의 극도의 효과, 긴 반감기때문에 바람직하며, 또한 그것은 그것을 임상 등급 및 스케일로 제조하기에 경제적으로 용이하기 때문에 바람직하다. 재조합 및/또는 절단된(truncated) 리신 A 사슬 또한 사용될 수 있다.

면역독소를 사용한 종양의 표적 및 치료에 대하여, 하기의 특허들이 항종양 및 세포독성 약제에 관련되는 현재의 교시를 더욱 보충하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있다: U.S. Patent No. 6,004,554; 5,855,866; 5,965,132; 5,776,427; 5,863,538; 5,660,827 및 6,051,230.

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 항튜불린성 약물과 결합될 수 있다. 본원에 사용된 것으로서, "항튜불린성 약물(Anti-tubulin drug(s))"은 세포의 유사분열(mitosis)을 억제, 바람직하게는 세포의 유사분열에 필수적인 튜불린 활성, 바람직하게는 튜불린 중합(polymerization) 또는 탈중합(depolymerization) 을 직접 또는 간접적으로 억제하는 임의의 약제, 약물, 프로드러그(prodrug) 또는 그것들의 조합을 의미한다.

여기에 사용하기 위한 현재의 바람직한 항튜불린성 약물은 콜키친(colchicine); 탁솔(taxol), 도세탁셀(docetaxel) 및 파클리탁셀(paclitaxel)과 같은 탁센(taxanes); 빈플라스틴(vinvlastine), 빈크리스틴(vincristine) 및 빈데스신(vindescine)과 같은 빈카 알칼로이드(vinca alkaloids); 및 콤브레타스타틴(combretastatin)이다. 대표적인 콤브레타스타틴은 A-1, A-2, A-3, A-4, A-5, A-6, B-1, B-2, B-3, B-4, D-1 및 D-2를 포함하는 콤브레타스타틴 A, B 및/또는 D, 및 그것들의 프로드러그 형태이다.

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 치료제는 응고를 촉진할 수 있는 성분, 즉 응고제를 포함할 수 있다. 여기에서, 표적 항체는 직접 또는 간접적으로, 예를 들어 다른 항체를 통하여 응고를 직접 또는 간접적으로 자극하는 인자에 결합될 수 있다.

이러한 용도를 위한 바람직한 응고 인자는 조직 인자(Tissue Factor(TF)) 및 절단된 TF(truncated TF(tTF))와 같은 TF 유도체, 이량체성(dimeric), 삼량체성(trimeric), 중합성(polymeric)/다중결합성(multimeric) TF 및 인자 VII를 활성화시키는 능력이 결여된 TF 변이체이다. 다른 적절한 응고 인자는 인자 II/IIa, 인자 VII/VIIa, 인자 IX/IXa 및 인자 X/Xa와 같은 비타민 K-의존성 응고제; Gla 변경이 결여된 비타민 K-의존성 응고 인자; 러셀 바이퍼 베놈 인자 X 활성제(Russell's viper venom Factor X activator); 트롬복산(thromboxane) A2 및 트롬복산 A2 신타아제와 같은 혈소판 활성 화합물(platelet-activating compounds); 및 α2-안티플라스민(α2-antiplasmin)과 같은 섬유소 분해(fibrinolysis)의 억제제이다. 결국, 절단된 조직 인자(tTF)가 현재 바람직하다.

응고리간드를 사용한 종양 표적화 및 치료는 각각 응고리간드 및 응고 인자들에 관련하여 현재의 교시를 더욱 보충하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있는 하기의 특허들에 기재되어 있다: U.S. Patent No. 5,855,866; 5,965,132; 6,093,399; 6,004,555; 5,877,289 및 6,036,955.

면역접합체 및 면역독소의 제조는 일반적으로 당업계에 잘 알려져 있다(예를 들어, U.S. Patent No. 4,340,535를 참조). 각각의 하기의 특허들은 면역독소 생성, 정제 및 용도에 관련하는 현재의 교시를 더욱 보충하기 위한 목적으로 참조로서 본원에 더 통합되어 있다: U.S. Patent No. 6,004,554; 5,855,866; 5,965,132; 5,776,427; 5,863,538; 5,660,827 및 6,051,230.

면역접합체 및 면역독소의 제조에서, 이점은 어떤 링커(linker)의 사용을 통하여 달성될 수 있다. 예를 들면, 생체 내에서의 그것들의 큰 안정성 때문에 작용 부위에 결합하기 전 독소 부분의 방출을 방해하기 때문에, 입체적 "장애 구조를 가진(hindered)" 이황화 결합을 포함하는 링커가 종종 바람직하다. 접합체는 우수한 "방출(release)" 특성을 가지는 것이 바람직하다는 점에서 작용의 의도된 부위를 제외한 신체의 어느 곳에서든 발견되는 조건 하에서 변하지 않을 접합체를 가지는 것이 바람직하다.

사용된 특정 독소 화합물에 따라, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 및 독소 화합물에 작동가능하게 부착되는 펩티드 스페이서(peptide spacer)를 제공할 필요가 있을 것이며, 여기에서 상기 펩티드 스페이서는 이황화 결합된 루프 구조 내로 폴딩될 수 있다. 상기 루프 내에서의 단백질 가수분해성 절단(proteolytic cleavage)은 그 후 이종 이량체성(heterodimeric) 폴리펩티드를 생성할 수 있으며, 여기에서 상기 항체 및 독소 화합물은 단지 단일 이황화 결합만으로 연결된다.

어떤 다른 독소 화합물이 사용되는 경우, 비절단성 펩티드 스페이스가 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 및 독소 화합물에 작동가능하게 부착되도록 제공될 수 있다. 비절단성 펩티드 스페이서와 함께 사용될 수 있는 독소는 그 자체가 단백질 가수분해성 절단에 의해 세포독성을 가지는 이황화 결합된 형태로 전환될 수 있는 것이다. 이러한 독소 화합물의 예는 슈도모나스 엑소톡신 화합물이다.

다양한 화학치료제 및 다른 약제(pharmacological agents)들 또한 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 치료제에 성공적으로 접합될 수 있다. 항체에 접합되는 대표적인 항신생물 약제(antineoplastic agents)는 독소루비신, 다우노마이신, 메토트렉세이트 및 빈블라스틴을 포함한다. 게다가, 네오카르지노스타틴(neocarzinostatin), 마크로마이신(macromycin), 트레니몬(trenimon) 및 α-아마니틴(α-amanitin)과 같은 다른 약제의 부착은 하기에 기재되어 있다: 본원에 각각 통합되어 있는 U.S. Patent No. 5,660,827; 5,855,866 및 5,965,132를 참조.

응고리간드의 제조 또한 쉽게 수행된다. 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체와 하나 또는 그 이상의 응고 인자의 작동가능한 결합은 면역독소에 대하여 상기에 기재된 것과 같은 직접적인 결합일 수 있다. 대안적으로, 상기 작동가능한 결합은 항체가 제2의 결합 영역, 바람직하게는 응고 인자에 결합하는 항체의 항체 또는 항원 결합 영역에 작동가능하게 부착되는 경우와 같은 간접적인 부착일 수 있다. 상기 응고 인자는 특히 공유결합이 분자를 결합시키는 데 사용되는 경우그것의 기능적 응고 부위로부터 구별되는 부위에서 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체에 부착되어야만 한다.

간접적으로 결합된 응고리간드는 종종 이중 특이성(bispecific) 항체에 기반한다. 이중 특이성 항체의 제조 또한 당업계에 잘 알려져 있다. 하나의 예비적 방법은 표적 종양 성분에 대한 특이성, 한편으로는 다른 응고 약제에 대한 특이성을 가지는 항체의 제조물을 분리하는 것을 포함한다. 그 후, 두개의 선별된 항체로부터 얻은 펩틱 F(ab'γ)2 단편이 생성된 후, 개별적인 Fab'γSH 단편을 얻기 위하여 각각 환원시켰다. 두개의 파트너 중 하나에 있는 SH 기가 결합된 후, o-페닐렌디말레이미드(o-phenylenedimaleimide)와 같은 가교결합제(cross-linkage reagent)를 사용하여 알킬레이트화시켜 하나의 파트너 상의 유리된 말레이미드기를 얻었다. 이 파트너는 그 후 원하는 F(ab'γ)2 이종 접합체를 얻기 위하여 티오에테르 결합(thioether linkage)으로 다른 쪽과 접합될 수 있다(Glennie et al ., 1987). SPDP 또는 단백질 A와의 가교결합과 같은 다른 접근법 또한 수행될 수 있다.

면역접합체, 면역독소 및 응고리간드의 제조에서, 재조합 발현이 사용될 수 있다. 본 발명의 선택된 VEGFR2-차단성 인간 항-VEGF 항체를 암호화하는 핵산 서열 및 치료제, 독소 또는 응고제는 발현 벡터 내에 인프레임(in-frame)으로 부착된다. 따라서, 재조합 발현은 핵산을 번역하여 원하는 면역접합체를 얻는다. 화학적 가교결합 및 아비딘:비오틴 가교(avidin:biotin bridges) 또한 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체에 치료제를 결합시킬 수 있다.

하기의 특허들은 이중 특이성 항체 응고리간드를 포함하는 응고리간드의 제조, 정제 및 용도에 관련하여 현재의 교시를 더 보충하기 위한 목적으로 참조로서 본원에 각각 통합되어 있다: U.S. Patent No. 5,855,866; 5,965,132; 6,093,399; 6,004,555; 5,877,289 및 6,036,955.

화학적 접합에 의해 제조되던지 재조합 발현에 의해 제조되던지 간에, 방사선치료 약제, 항신생혈관성 약제, 아포토시스-유도제, 항튜불린성 약물, 독소 및 응고제와 함께 면역접합체는 생물학적으로 해리가능한(biologically-relesable) 결합 및/또는 선택적으로 절단가능한 스페이서 또는 링커를 사용할 수 있다. 이와 같은 조성물은 바람직하게는 순환(circulation)하는 동안 상당히 안정하며, 질병 또는 종양 부위로의 운반을 통하여 선택적으로 또는 특이적으로 해리된다.

어떤 바람직한 예는 산 민감성 스페이서(acid sensitive spacers)이고, 여기에서 콜히친 또는 독소루비신과 결합된 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체가 특히 고려된다. 다른 바람직한 예는 종양의 환경과 같은 질병 부위 내에서 특이적 또는 선택적으로 존재하거나 활성화되는 펩티다아제 및/또는 프로테이나아제에 대한 절단 부위를 포함하는 펩티드 링커이다. 질병 또는 종양 부위로의 면역접합체의 운반은 절단 및 응고 인자의 상대적으로 특이적인 해리를 야기한다.

이러한 목적들을 위한 참조로서 본원에 각각 통합되어 있는 U.S. Patent No. 5,877,289 및 6,342, 221에 기재되어 있고 실시가능한 것과 같은, 유로키나아제(urokinase), 프로-유로키나아제(pro-urokinase), 플라스민(plasmin), 플라스미노겐(plasminogen), TGFβ, 스타필로키나아제(staphylokinase), 트롬빈(Thrombin), 인자 IXa, 인자 Xa 또는 간질성 콜라게나아제(interstitial collagenase)와 같은 메탈로프로테이나아제(metalloproteinase; MMP), 겔라티나아제(gelatinase) 또는 스트로멜라이신(stromelysin)에 대한 절단 부위를 포함하는 펩티드 링커가 특히 바람직하다.

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 또한 생물학적으로 해리가능한 결합을 통하여 치료제의 부착을 가능하게 하는 작용기를 도입하기 위하여 유도체화될 수 있다. 따라서, 표적 항체는 하이드라지드(hydrazide), 하이드라진(hydrazine), 1차 아민기 또는 2차 아민기로 종결되는 측쇄를 도입하기 위하여 유도체화될 수 있다. 치료제는 쉬프 염기(Schiff's base) 결합, 하이드라존(hydrazone) 또는 아실 하이드라존(acyl hydrazone) 결합 또는 하이드라지드 링커를 통하여 접합될 수 있다(U.S. Patent No. 5,474,765 및 5,762,918).

우선 제1차 항신생혈관성 또는 혈관-표적 기반의 여부에 관계없이, 본 발명의 조성물 및 방법은 다른 치료제 및 진단제와 조합하여 사용될 수 있다. 본 발명에 따른 VEGFR2-차단성 인간 항-VEGF 항체와 "조합하여(in combination)" 사용하기 위한 생물학적 약제, 바람직하게는 진단제 또는 치료제의 면에서, 상기 용어 "조합하여"는 구현의 범위를 포함하기 위하여 간결하게 사용된다. 따라서, 특별히 언급하거나 과학 용어로 명확하게 하지 않는 한 "조합하여"라는 용어는 조합된 조성물, 약물, 칵테일, 키트, 방법 및 제1 및 제2의 의학 용도의 다양한 형식에 적용된다.

따라서, 본 발명의 "조합된(combined)" 구현은 예를 들어, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체가 나상의(naked) 항체이고, 거기에 작동가능하게 부착되지 않은 약제 또는 치료제와 조합하여 사용되는 경우를 포함한다. 이러한 경우에 있어서, 상기 약제 또는 치료제는 비표적화되거나 표적화된 형태로 사용될 수 있다. "비표적화된 형태(non-targeted form)"에서, 상기 약제, 특히 치료제는 일반적으로 당업계에서의 그것의 표준 용도에 따라 사용될 것이다. "표적화된 형태(targeted form)"에서, 상기 약제는 일반적으로 신생혈관성 질병 부위 또는 종양으로 약제 또는 치료제를 운반하는 개별적인 항체 또는 표적 부위에 작동가능하게 부착될 것이다. 생물학적 약제, 진단제 및 치료제 모두의 이러한 표적화된 형태의 용도 또한 당업계에서 꽤 표준화되어 있다.

본 발명의 다른 "조합된" 구현에서, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 면역접합체이며, 여기에서 상기 항체는 그 자체가 약제 또는 치료제에 작동가능하게 결합되거나 조합된다. 상기 작동가능한 부착은 본원에 기술되고 당업계에서 공지된 것과 같은 직접적이고 간접적인 부착의 모든 형태를 포함한다.

특히 치료제와 조합된 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체의 면에서, "조합된" 용도는 또한 조합된 조성물, 약물, 칵테일, 키트, 방법 및 제1 및 제1의 의학 용도를 포함하며, 여기에서 상기 치료제는 프로드러그의 형태이다. 이러한 구현에서, 활성 성분은 프로드러그를 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체와 다시 작동가능하게 결합되는 약물의 기능적 형태로 전환할 수 있다.

어떤 바람직한 구현에서, 치료학적 조성물, 조합물, 약물, 칵테일, 키트, 방법 및 제1과 제2의 의학 용도는 "프로드러그의 조합(prodrugs combinations)"일 수 있다. 당업자들에 의해 이해될 수 있는 바와 같이, 별다른 언급이 없는 한, 상기 용어 "프로드러그의 조합"은 본 발명의 항체가 프로드러그 그 자체에 부착되는 것이 아니라 프로드러그를 활성 약물로 전환시킬 수 있는 성분에 작동가능하게 부착됨을 의미한다. 그러나, 본 발명의 프로드러그 구현은 프로드러그 조합으로서 사용될 필요는 없다. 따라서, 프로드러그는 그것들이 ADEPT 및 다른 형태를 포함하는 당업계에서 사용되는 임의의 방식으로 사용될 수 있다.

따라서, 바람직하게는 진단제, 더욱 바람직하게는 치료제의 면에서, 조합된 조성물, 약물, 칵테일, 키트, 방법 및 제1과 제2의 의학 용도가 기재되어 있는 경우, 상기 조합은 나상의 항체와 면역접합체인 VEGFR2-차단성 인간 항-VEGF 항체를 포함하며, 여기에서 본 발명의 생체 내 구현의 수행은 어떤 접합 또는 비접합 형태에서 상기 항체의 어떤 형태 및 생물학적 진단제 또는 치료제의 어떤 형태의 전반적인 공급이 달성되는 한, 나상 항체 또는 면역접합체와 생물학적 진단제 또는 치료제의 전, 동시 또는 후 투여를 포함한다.

본 발명의 특히 바람직한 조합된 조성물, 방법 및 용도는 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 및 엔도스타틴을 포함하는 것이다(U.S. Patent No. 5,8454,205). 이것들은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체가 나상 항체 또는 면역접합체인 경우를 포함하며; 면역접합체일 때 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 엔도스타틴, 선택적으로 안지오스타틴과 함께 결합되고; 여기에서 어떤 접합되거나 비접합된 형태로 항체, 엔도스타틴 및 선택적으로 안지오스타틴의 전체적인 공급이 달성되는 한 조합된 치료 방법 또는 용도는 선택적으로 안지오스타틴과 함께 엔도스타틴의 전, 동시 또는 후 투여를 포함한다. 콜라게나아제와 작동가능하게 연결된 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 또한 종양에 특이적으로 운반될 때 콜라게나아제로서 제공되며, 유사한 이점을 달성하는 원 위치에서(in situ) 엔도스타틴을 생성할 것이다.

종양에서의 본 발명의 효과의 앞선 다른 설명들은 조합된 방법의 작용, 부착된 약제의 형식 등을 간단하게 설명할 수 있게 만들어 준다. 이 기술적 접근법은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체의 유익한 특성을 절제되거나 지나치게 단순화하는 것으로 이해되어서는 안된다. 따라서, 이와 같은 항체 그 자체는 항신생혈관성 특성 및 (VEGF의 생존 기능을 중화시키는 것과 같은) VEGF 중화(neutralization) 특성을 가지고, 이와 같은 항체들의 면역접합체는 이러한 특성들을 유지할 것이며 부착된 약제의 특성들을 가지는 그것들과 조합하며, 더 나아가 상기 항체 및 임의의 부착된 약제의 조합된 효과는 전형적으로 강화되고/되거나 증대될 것이다.

따라서, 본 발명은 선택적으로 적어도 제1의 조성물 또는 용기에 생물학적 유효량의 본 발명의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 이러한 항-VEGF 항체의 항원-결합 단편 또는 면역접합체; 및 생물학적 유효량의 적어도 제2의 생물학적 약제, 성분 또는 시스템을 포함하는 조성물, 약제학적 조성물, 치료 키트 및 약용 칵테일을 제공한다.

"적어도 제2의 생물학적 약제, 성분 또는 시스템(at least a second biological agent, component or system)"은 종종 치료제 또는 진단제, 성분 또는 시스템일 것이지만 그렇지 않을 수도 있다. 예를 들면, 적어도 제2의 생물학적 약제, 성분 또는 시스템은 항체의 변경을 위한 성분 및/또는 다른 시약을 항체에 부착시키기 위한 성분을 포함할 수 있다. 어떤 바람직한 제2의 생물학적 약제, 성분 또는 시스템은 프로드러그 그 자체를 만들기 위한 성분 및 이러한 프로드러그 또는 ADEPT 구현에서 기능하도록 본 발명의 항체를 개조하기(adapting) 위한 성분을 포함하는, 프로드러그를 만들고 사용하기 위한 프로드러그 또는 성분이다.

치료제 또는 진단제가 적어도 제2의 생물학적 약제, 성분 또는 시스템에 포함되는 경우, 상기 치료제 및/또는 진단제는 전형적으로 항신생혈관성 질병과 관련된 용도를 위한 것일 것이다. 이러한 약제들은 하기 특허들 중 임의의 하나에 기재된 것과 같은 질병을 치료하거나 진단하는 데 사용하기에 적합한 것이다: 참조로서 본원에 각각 특별히 통합되어 있는 U.S. Patent No. 5,712,291; 5,753,230; 5,972,922; 6,639,757; WO 98/45331 및 WO 98/16551.

치료될 질병이 암인 경우, "적어도 제2의 항암제(anti-cancer agent)"가 치료학적 키트 또는 칵테일에 포함될 것이다. 상기 용어 "적어도 제2의 항암제(at least a second anti-cancer agnet)"는 제1의 항암제인 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체와 관련하여 선택된다. 본 발명의 항체는 따라서 화학 치료제, 방사선 치료제, 사이토카인, 항신생혈관성 약제, 아포토시스-유도제 또는 항암 면역독소 또는 응고리간드와 조합될 수 있다.

본원에 사용된 것으로서, "화학 치료제(chemotherapeutic agents)"는 악성 종양의 치료에 사용되는 전형적인 화학 치료제 또는 약물을 말한다. 이 용어는 다른 화합물들이 항암 효과를 발휘하는 화학 치료제로서 전문적으로 기재될 수 있다는 사실에도 불구하고 간편성을 위하여 사용된다. 그러나, "화학요법(chemotherapeutic)"은 당업계에서 명확한 의미를 가지며, 이러한 표준의 의미에 따라 사용된다. 다수의 대표적인 화학 치료제가 본원에 기재되어 있다. 당업자들은 비록 투약량이 본 발명과 조합하여 사용될 때 감소될 수 있다 하더라도, 화학 치료제의 용도 및 적절한 용량을 쉽게 이해할 것이다.

"화학 치료제"로 또한 불릴 수 있는 새로운 분류의 약물은 아포토시스를 유도하는 약제이다. 적절하게는, 유전자, 벡터, 역배열(antisense) 구조물 및 리보자임(ribozymes)을 포함하는 임의의 하나 또는 그 이상의 이러한 약물은 또한 본 발명과 함께 사용될 수 있다. 현재의 바람직한 제2의 약제는 안지오스타틴, 엔도스타틴, 바스큘로스타틴, 칸스타틴 및 마스핀과 같은 항신생혈관성 약제이다.

다른 대표적인 항암제는 예를 들어, 네오마이신(neomycin), 포도필로톡신(podophyllotoxin(s)), TNF-α, αγβ3 길항제(αγβ3 antagonist), 칼슘 이오노포어(calcium ionophores), 칼슘-플럭스 유도제(clacium-flux inducing agents) 및 그것들의 임의의 유도체 또는 프로드러그를 포함한다. 현재의 바람직한 항튜불린 약물은 콜히친(colchicine), 탁솔(taxol), 빈블라스틴(vinblastine), 빈크리스틴(vincristine), 빈데스신(vindescine), 콤브레타스타틴(combretastatins) 또는 그것들의 유도체 또는 프로드러그를 포함한다.

항암 면역독소 또는 응고리간드는 항암제에 더욱 적합하다. "항암 면역독소 또는 응고리간드(anti-cancer immunotoxins or coaguligands)" 또는 표적제(targeting agents)에 기반하는 표적제/치료제 구조물은 종양 세포, 종양 맥관구조 또는 종양 기질의 표적가능하거나 접근가능한 성분에 결합하고, 세포독성 약제(면역독소) 및 응고 인자(응고리간드)를 포함하는 치료제에 작동가능하게 부착된 항체 또는 그것들의 항원 결합 단편을 포함한다. 비록 세포내 및/또는 핵의 종양 세포 항원을 포함하는 괴사되거나 그렇지 않다면 손상된 종양 세포 또는 혈관 내피 세포로부터 방출된 성분 또한 표적될 수 있다 하더라도, 종양 세포, 종양 맥관구조 또는 종양 기질의 "표적가능하거나 접근가능한 성분(targetable or accessible component)"은 바람지갛게는 표면에서 발현되고, 표면에 접근가능하거나 표면에 위치가능한 성분이다.

VEGF 및 FGF와 같은 성장인자; 종양 맥관구조에 특이적으로 결합하는 트리펩티드 R-G-D를 포함하는 펩티드; 및 아넥신(annexins) 및 관련 리간드를 포함하는 항체 및 비항체 표적제 모두 사용될 수 있다.

항종양 세포 면역독소 또는 응고리간드는 B3(ATCC HB 10573), 260F9(ATCC HB 8488), D612(ATCC HB 9796) 및 KS1/4로 불리는 항체로 이루어지는 군으로 예시되는 항체들을 포함할 수 있고, 상기 KS1/4 항체는 벡터 pGKC2310(NRRL B-18356) 또는 벡터 pG2A52(NRRL B-18357)를 포함하는 세포로부터 얻어진다.

괴사성 종양 세포로부터 방출된 세포내 성분과 결합하는 항체 또는 그것들의 항원-결합 단편을 포함하는 항종양 세포 표적제 또한 고려된다. 바람직하게는, 이러한 항체들은 침투가능하도록 유도될 수 있는 세포 또는 실질적으로 모든 신생 및 정상 세포의 세포막(cell ghosts)에 존재하지만, 포유동물의 정상의 살아있는 세포의 외부 상에 존재하거나 접근가능하지는 않은 불용성 세포내 항원에 결합하는 단일클론 항체 또는 그것들의 항원-결합 단편이다.

각각 앨런 앱스타인 및 동료들에 의해 출원된 미국 특허등록번호 제5,019,368호, 제4,861,581호 및 제5,882,626호는 각각 생체 내의 악성종양 세포로 접근가능하게 된 세포내 항원에 특이적인 항체를 어떻게 만들고 사용하는지를 더 기술하고 교시하기 위한 목적으로 참조로서 본원에 각각 특별히 통합되어 있다. 기재된 항체들은 포유동물의 악성종양 세포의 내부 세포 성분에는 충분히 특이적이지만, 외부의 세포 성분에는 그렇지 않았다. 대표적인 표적은 히스톤(histones)을 포함하지만, 괴사성 종양 세포로부터 특이적으로 방출된 모든 세포내 성분들도 포함된다.

신생혈관성 종양을 가지는 동물 또는 환자에 대한 투여에 대하여, 생체 내에서 발생하는 종양의 재구성(tumor remodeling)의 진행때문에 신생혈관성 종양이 괴사성 종양 세포를 자연적으로 포함하며, 최소한의 악성 종양의 비율만이 괴사되도록 한다는 사실 때문에 이러한 항체들은 악성종양 세포에 위치된다. 게다가, 종양의 괴사를 강화시키는 다른 치료와 함께 이러한 항체들의 사용은 표적화와 그 후의 치료의 유효성을 강화시킨다.

이러한 형태의 항체들은 따라서 본원에 일반적으로 기재된 바와 같이 안지오포이에틴과 직접적 또는 간접적으로 결합하여 사용될 수 있고, 신생혈관성 종양 내의 괴사성 악성 종양 세포에 안지오포이에틴을 투여하기 위하여 사용될 수 있다.

각각 참조로서 본원에 통합되어 있는 미국 특허등록번호 제5,019,368호, 제4,861,581호 및 제5,882,626호에 또한 기재되어 있는 것과 같이, 이 항체들은 조합된 진단 방법(하기를 참조) 및 항종양 치료의 유효성을 측정하기 위한 방법에 사용될 수 있다. 이러한 방법들은 일반적으로 표지된 형태의 항체들의 제조 및 투여를 포함하고, 괴사성 조직 내에 우점적으로 결합된 내부 세포 성분에 대한 표지된 항체의 결합을 측정하는 것을 포함한다. 그것에 의하여 상기 방법은 괴사성 조직을 이미지화하고, 여기에서 위치된 항체의 농도는 종양의 존재를 나타내며, 항종양 치료에 의해 죽은 세포의 막을 나타낸다.

항종양 기질 면역독소 또는 응고리간드는 일반적으로 피브린, RIBS 또는 LIBS에 대한 결합으로 예시되는 것으로서, 연결 조직 성분(connective tissue component), 기저막 성분(basement membrane component) 또는 활성화된 혈소판 성분(activated platelet components)에 결합하는 항체를 포함할 것이다.

항종양 맥관구조 면역독소 또는 응고리간드는 혈액이 이동하는 맥관(blood transporting vessels), 바람직하게는 신생혈관성 종양의 종양내 혈관의 표면에 발현된, 표면에 접근이 가능하거나 표면에 위치된 성분에 결합하는 리간드, 항체 또는 그것의 단편을 포함할 수 있다. 이러한 항체들은 엔도글린(endoglin; TEC-4 및 TEC-11 항체), TGFβ 수용체, E-셀렉틴(E-selectin), P-셀렉틴(P-selectin), VCAM-1, ICAM-1, PSMA, VEGF/VPF 수용체, FGF 수용체, TIE, αγβ3 인테그린(αγβ3 integrin), 플레이오트로핀(pleiotropin), 엔도시아린(endosialin) 및 MHC 분류 II 단백질(MHC class II proteins)과 같은 종양내 맥관구조 세포 표면 수용체(intratumoral vasculature cell surface receptor)를 포함하는 신생혈관성 종양의 내부 혈관의 표면에 발현된 성분에 결합하는 것들을 포함한다. 상기 항체들은 또한 종양 내부 혈관의 사이토카인 유도성 또는 응고 유도성 성분에 결합할 수 있다. 어떤 바람직한 약제는 포스파티딜세린(phosphatidylserine) 또는 포스파티딜에탄올아민(phosphatidylethanolamine)과 같은 아미노포스포리피드(aminophospholipids)에 결합할 것이다.

다른 항종양 맥관구조 면역독소 또는 응고리간드는 종양내 맥관구조 세포 표면 수용체에 결합하는 리간드 또는 성장인자에 결합하는 항체 또는 그것들의 단편을 포함할 수 있다. 이러한 항체들은 VEGF/VPF(GV39 및 GV97 항체), FGF, TGFβ, TIE에 결합하는 리간드, 종양관련 피브로넥틴의 아형(tumor-associated fibronectin isoform), 분산인자(scatter factor)/간세포 성장인자(hepatocyte growth factor; HGF), 혈소판 인자 4(platelet factor 4; PF4), PDGF 및 TIMP에 결합하는 것들이다. 항체 또는 그것들의 단편들은 또한 리간드 또는 성장 인자 또는 수용체가 리간드:수용체 또는 성장인자:수용체 복합체에 있지 않은 경우, 리간드:수용체 복합체 또는 성장인자:수용체 복합체에 결합할 수 있지만, 리간드 또는 성장인자 또는 수용체에 결합하지는 않는다.

항종양 세포, 항종양 기질 또는 항종양 맥관구조 항체-치료제 구조물은 항신생혈관성 약제, 아포토시스-유도제, 항튜불린성 약물, 식물, 진균 또는 세균 유래의 독소와 같은 세포독성 약제를 포함할 수 있다. 리신 A 사슬 및 탈글리코실화된 리신 A 사슬이 종종 바람직할 것이다. 항종양 세포, 항종양 기질 또는 항종양 맥관구조 항체-치료제 구조물은 응고제(직접 또는 간접적으로 작용하는 응고 인자) 또는 응고 인자에 결합하는 제2의 항체 결합 부위를 포함할 수 있다. 절단된 조직 인자와 같이 조직 인자 또는 조직 인자 유도체와 작동가능하게 결합되는 것이 종종 바람직할 것이다.

본 발명의 조성물, 키트 및/또는 약제의 면에서, 유효량의 조합된 치료제는 단일 용기 또는 용기 수단(container means)내에 구성될 수 있거나, 개별 용기 또는 용기 수단 내에 구성될 수 있다. 칵테일은 일반적으로 조합된 사용을 위하여 함께 혼합될 것이다. 정맥 투여용으로 제형화된 약제가 종종 바람직할 것이다. 이미지화 성분(imaging components) 또한 포함될 것이다. 키트는 또한 포함되어 있는 적어도 제1의 항체 및 하나 또는 그 이상의 다른 생물학적 약제를 사용하기 위한 설명서를 포함할 것이다.

일반적으로 말하자면, 적어도 제2의 항암제는 단일 약제학적 조성물의 형태 또는 상호 근접하게 투여되는 두개의 약제학적 조성물의 형태와 같이, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체와 실질적으로 동시에 동물 또는 환자에게 투여될 수 있다.

대안적으로, 적어도 제2의 항암제는 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체의 투여에 대하여 시간 순차적으로 동물 또는 환자에게 투여될 수 있다. 본원에 사용된 것으로서, "시간 순차적으로(at a time sequential)"는 적어도 제2의 항암제가 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체에 대하여 구별된 시간에 동물 또는 환자에게 투여되기 위하여 "시차를 둔(staggered)" 것을 의미한다. 일반적으로, 두개의 약제가 그것들 각각의 치료 효과를 발휘하게 하는 데 효과적인 간격의 시간에, 즉 그것들은 "생물학적으로 효과적인 시간 간격(biologically effective time intervals)"으로 투여된다. 적어도 제2의 항암제는 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 이전의 생물학적으로 효과적인 시간 또는 치료 후의 생물학적으로 효과적인 시간에 동물 또는 환자에게 투여될 수 있다.

따라서, 본 발명은

(a) 동물 또는 환자에게 종양의 부하(tumor burden)를 실질적으로 감소시키는 제1의 치료를 하고;

(b) 그 후에 임의의 살아있는 종양 세포로부터의 전이를 억제하는 데 효과적인 향으로 동물 또는 환자에게 적어도 제1의 항신생혈관성 약제를 투여하고; 여기에서 상기 제1의 항신생혈관성 약제는 본 발명의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편이며, 여기에서 상기 항체 또는 단편은 제2의 항신생혈관성 약제와 작동가능하게 결합되는 것

을 포함하는, 신생혈관성 종양을 가지는 동물 또는 환자를 치료하기 위한 방법을 제공한다.

바람직한 제1의 치료는 외과적 절제(surgical resection) 및 화학치료적 중재(chemotherapeutic intervention)을 포함한다. 조합된 항신생혈관제 또한 사용될 수 있다.

신생혈관성 종양을 가지는 동물 또는 환자의 다른 치료 방법은

(a) 상당한 양의 종양 괴사를 유도하는 데 효과적인 양으로 동물 또는 환자에게 제1의 항체-치료제 구조물을 투여하고; 여기에서 상기 제1의 항체-치료제 구조물은 종양 세포, 종양 맥관구조 또는 종양 기질의 표면에 발현되고, 표면에 접근가능하거나 표면에 위치한 성분에 결합하는 제1의 항체 또는 그것들의 항원 결합 단편에 작동가능하게 결합된 치료제를 포함하고;

(b) 그 후에 임의의 살아있는 종양 세포로부터의 전이를 억제하는 데 효과적인 양으로 동물 또는 환자에게 제2의 항체를 투여하고; 여기에서 상기 제2의 항체는 본 발명의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편이며, 또한 선택적으로 여기에서 상기 항체 또는 단편은 제2의 항신생혈관성 약제와 작동가능하게 결합되는 것

을 포함한다.

특히 바람직한 구현에서, 본 발명의 인간 VEGFR2-차단성 항-VEGF 항체는 프로드러그 및 ADEPT와 조합하여 사용하기 위하여 제공된다. 이러한 조성물, 조합, 약물, 키트, 방법 및 용도에서, 상기 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 단편들은 전환 또는 효소 능력을 제공하기 위하여 변경되거나, 적어도 하나의 프로드러그를 활성형의 약물로 전환할 수 있는 적어도 제1의 전환제 또는 효소와 작동가능하게 결합, 바람직하게는 공유적으로 결합되거나 접합될 것이다.

효소적(enzymatic) 또는 효소에 접합된(enzyme-conjugated) 항체 또는 단편은 "프로드러그"의 처음으로 분리된 제형과 조합될 것이다. 상기 프로드러그는 본 발명의 VEGFR2-차단성 인간 항-VEGF와 연관된 효소 능력, 전환 기능 또는 효소와 접촉하여 활성형의 약물로 전환되는 불활성이거나 약한 활성형의 약물일 것이다.

따라서, 키트는 바람직하게는 개별의 조성물 및/또는 용기에

(a) 바람직하게는 항체 또는 단편이 적어도 제1의 효소에 작동가능하게 결합되고, 공유적으로 연결되거나 접합되는 경우, 효소적 기능을 가지는 생물학적 유효량의 본 발명의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 단편; 및

(b) VEGFR2-차단성 인간 항-VEGF 항체의 효소적 기능 또는 VEGFR2-차단성 인간 항-VEGF 항체와 결합되고, 연결되거나 접합된 효소에 의해 실질적으로 활성 약물로 전환되는 적어도 제1의 실질적으로 불활성인 프로드러그;

를 포함하여 제공된다.

본 발명은

(a) 본 발명의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것의 항원-결합 단편을 포함하는 생물학적 유효량의 적어도 제1의 약제학적 조성물을 신생혈관성 종양을 가지는 동물 또는 환자에게 투여하고, 여기에서 상기 항체 또는 단편은 효소적 기능을 가지며, 바람직하게는 여기에서 상기 항체 또는 단편은 적어도 제1의 효소에 작동가능하게 결합되고, 공유적으로 연결되거나 접합되며; 여기에서 상기 항체 또는 단편은 투여 후 신생혈관성 종양의 맥관구조, 종양내 맥관구조 또는 기질에 위치되고;

(b) 그 후에 생물학적 유효량의 적어도 하나의 실질적으로 불활성인 프로드러그를 포함하는 생물학적 유효량의 적어도 제2의 약제학적 조성물을 효과적인 시간 간격후에 동물 또는 환자에게 투여하고; 여기에서 상기 프로드러그는 상기 신생혈관성 종양의 맥관구조, 종양내부 맥관구조 또는 기질 내에 위치된 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 또는 단편의 효소적 기능 또는 결합되고, 연결되거나 접합된 효소에 의해 실질적으로 활성 약물로 전환되는 것,

을 포함하는 유리한 방법 및 용도를 더 제공한다.

어떤 다른 구현에서, 본 발명의 항체 및 면역접합체는 하나 또는 그 이상의 진단제, 전형적으로는 신생혈관성 질병과 관련하여 사용하기 위한 진단제와 조합될 수 있다. 진단 조성물, 키트 및 방법의 범위는 따라서 본 발명 내에 포함된다.

또 다른 양상은 적절한 양의 본원에 정의된 것과 같은 본 발명의 인간 항체 또는 다른 단백질을 피험자에게 투여하고, 피험자에게서 본 발명의 항체 또는 다른 단백질의 존재 및/또는 양 및/또는 위치를 검출하는 것을 포함하는 진단 방법 또는 피험자의 영상이다.

상기에 기술된 용도 및 방법에 따라 이미지화되거나 진단될 적절한 질병은 본원의 어느 곳에 기재된 것과 같은 신생혈관형성에 관련된 임의의 질병을 포함한다.

일 구현에서, 본 발명은

(a) 임의의 하나 또는 그 이상의 본 발명의 항체와 상기 포유동물로부터 얻은 시료(test sample)를 접촉시키는 단계

를 포함하는, 포유동물에서 신생혈관형성과 관련된 질병을 진단하는 방법을 제공한다.

다른 구현에서, 본 발명은

(a) 하나 또는 그 이상의 본 발명의 항체와 상기 포유동물로부터 얻은 시료를 접촉시키는 단계;

(b) 시료에서 항체-항원 복합체의 존재 및/또는 양 및/또는 위치를 측정하는 단계; 및 선택적으로

(c) 대조군에 대하여 시료에서의 항체-항원 복합체의 존재 및/또는 양을 비교하는 단계;

를 포함하는, 포유동물에서 신생혈관형성과 관련된 질병을 진단하는 방법을 제공한다.

상기 방법에서, 상기 접촉하는 단계는 항체-항원 복합체의 형성을 가능하게 하는 조건하에서 수행된다. 적합한 조건은 당업자에 의해 쉽게 결정될 수 있다.

상기 방법에서, 임의의 적절한 시료는 예를 들어, 질병 또는 조직학적 절편(histological section)에 의해 영향을 받았다고 의심되는 생검 세포(biopsy cells), 조직 또는 기관이 사용될 수 있다.

상기의 어떤 방법에서, 시료에서의 임의의 양의 항체-항원 복합체의 존재는 질병의 존재를 나타낼 것이다. 바람직하게는, 양성 진단이 되기 위해서, 시료 내의 항체-항원 복합체의 양은 적절한 대조군 샘플에서 발견된 양보다 많고, 바람직하게는 현저하게 많다. 더욱 바람직하게는, 현저하게 높은 농도를 통계적으로 유의하며, 바람직하게는 <0.05의 확률값을 가진다. 통계적 유의성을 측정하기 위한 적절한 방법은 당업계에 잘 알려져 있으며 상세히 기록되어 있으며, 이들 중 임의의 방법이 사용될 수 있다.

적절한 대조군 샘플은 예를 들어, 특정 질병의 진단의 경우에 있어서 당업자에 의해 쉽게 선택될 수 있고, 적절한 대조군은 질병에 걸리지 않은 피험자로부터의 샘플일 수 있다. 적절한 대조군 "값(values)" 또한 매회의 실험에서 대조군 "샘플"로 테스트할 필요 없이, 즉 당업계에 공지된 정상 피험자의 범위를 참조하여 쉽게 결정될 수 있다.

진단 또는 이미지화 적용에 사용하기 위하여, 본 발명의 항체는 3H, 14C, 32P, 35S, 123I, 125I, 131I와 같은 방사선 비투과체(radio-opaque) 또는 방사성 동위원소(radioisotope); 방사성 방출체(radioactive emitter)(예를 들어, α, β 또는 γ 방출체); 플루오르세인 이소티오시아네이트(fluorescein isothiocyanate) 또는 양고추냉이 퍼록시다아제(horseradish peroxidase)와 같은 형광성(형광단(fluorophore)) 또는 화학발광성(발색단(chromophore)) 화합물; 조영제(imaging agnet); 또는 금속 이온; 또는 특정 동족(cognate)을 검출가능한 부분에 결합함으로써 검출될 수 있는 비오틴과 같은 화학적 부분, 예를 들어 표지된 아비딘/스트렙타비딘과 같은 검출가능한 마커로 표지될 수 있다. 항체 또는 항체 단편과 같은 결합 단백질에 표지를 부착하는 방법은 당업계에 공지되어 있다. 이러한 검출가능한 마커들은 시료 내에서의 결합 단백질-항원 복합체의 존재, 양 또는 위치를 검사할 수 있게 한다.

생체 내에서 사용하기에 바람직한 검출가능한 마커는 비스무스(bismuth) (III), 금(gold) (III), 란타늄(lanthanum) (III) 또는 납(lead) (II)과 같은 X-레이 검출가능 화합물; 구리(copper)67, 갈륨(gallium)67, 갈륨(gallium)68, 인듐(indium)111, 인듐(indium)113, 요오드(iodine)123, 요오드(iodine)125, 요오드(iodine)131, 수은(mercury)197, 수은(mercury)203, 레늄(rhenium)186, 레늄(rhenium)188, 루비듐(rubidium)97, 루비듐(rubidium)103, 테크네튬(technetium)99 m 또는 이트륨(yttirum)90과 같은 방사성 이온; 코발트(cobalt) (II), 구리(copper) (II), 크로뮴(chromium) (III), 디스프로슘(dysprosium) (III), 에르븀(erbium) (III), 가돌리늄(gadolinium) (III), 홀뮴(holmium) (III), 철(iron) (II), 철(iron) (III), 망간(manganese) (II), 네오디뮴(neodymium) (III), 니켈(nickel) (II), 사마리움(samarium) (III) , 테르븀(terbium) (III), 바나듐(vanadium) (II) 또는 이테르븀(ytterbium) (III)과 같은 핵자기 스핀 공명 동위원소(nuclear magnetic spin-resonance isotope); 또는 로다민(rhodamine) 또는 플로오르세인(fluorescein)을 포함한다.

본 발명은 또한 직접 또는 간접적으로 검출가능한 시그널을 생산하는 표지에 부착된 본 발명의 항체를 포함하는 진단 또는 조영제를 포함한다. 적절한 표지는 본원의 어느 곳에 기재되어 있다.

본 발명은 하나 또는 그 이상의 본 발명의 항체 또는 조성물, 또는 하나 또는 그 이상의 본 발명의 항체를 암호화하는 핵산 분자, 또는 하나 또는 그 이상의 본 바렴의 핵산 서열을 포함하는 재조합 발현 벡터, 또는 하나 또는 그 이상의 본 발명의 재조합 발현 벡터 또는 핵산 서열을 포함하는 숙주 세포 또는 바이러스를 포함하는 키트를 더 포함한다. 바람직하게는, 상기 키트는 본원에 기재된 것과 같은 방법 및 용도, 예를 들어, 본원에 기재된 것과 같은 치료, 진단 또는 이미지화 방법에 사용하기 위한 것이거나, 본원에 기재된 것과 같은 시험관 내(in vitro) 검정 또는 방법에 사용하기 위한 것이다. 이러한 키트에서의 항체는 본원의 어느 곳에 기재된 것, 예를 들어, 검출가능한 부분에 접합될 수 있거나 면역접합체일 수 있는 항체 접합체인 것이 바람직하다. 바람직하게는, 상기 키트는 키트 성분의 용도, 예를 들어, 진단에 사용하기 위한 설명서를 포함한다. 바람직하게는, 상기 키트는 신생혈관형성에 관련된 질병을 진단하기 위한 것이며, 선택적으로 이러한 질병을 진단하기 위한 키트 성분의 용도를 위한 설명서를 포함한다.

본원에 정의된 것과 같은 본 발명의 항체들은 또한 시험관 내 또는 생체 내 적용 및 검정을 위한 분자적 수단으로서 사용될 수 있다. 항체는 항원 결합 부위를 가지므로, 이것들은 특정 결합 쌍(binding pair)의 구성원으로서 작용할 수 있고, 이 분자들은 특정 결합 쌍의 구성원이 요구될 때 임의의 검정에서 사용될 수 있다.

따라서, 본 발명의 또 다른 양상은 본원에 정의된 것과 같은 본 발명의 항체 를 포함하는 시약 및 예를 들어, 시험관 내 또는 생체 내 검정에서 분자적 수단으로서의 이러한 항체들의 용도를 제공한다.

암 진단 및 치료의 면에서, 본 발명의 진단 및 이미지화 조성물, 키트 및 방법은 생체 내 및 시험관 내 진단을 포함한다. 예를 들면, 신생혈관성 종양은 생체 내 진단 조영제에 작동가능하게 부착된 종양 세포, 종양 맥관구조 또는 종양 기질에 접근가능한 성분에 결합하는 적어도 제1의 결합 부위를 포함하는, 진단학적 유효량의 종양 진단 성분을 사용하여 이미지화될 수 있다.

종양 이미지화는 종양 맥관구조 또는 종양 기질에 접근가능한 성분과 결합하는 적어도 제1의 결합 부위를 포함하는 진단 성분을 사용하여 신생혈관성 종양의 기질 및/또는 맥관구조의 이미지를 제공하기 위하여 수행되는 것이 바람직하다. 치료학적 구조물의 면에서 상기에 기재된 것들과 같은 임의의 적절한 결합 부위 또는 항체가 사용될 수 있다. 본 발명의 구조물의 검출가능하게 표지된 VEGFR2-차단성 인간 항-VEGF 항체를 사용함으로써 어떤 이점들이 제공될 것이며, 여기에서 형성된 이미지는 사용될 치료제의 결합 부위를 예측할 수 있게 한다.

검출가능하게 표지된 생체 내 종양 진단제, 바람직하게는 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 비스무스(bismuth) (III), 금(gold) (III), 란타늄(lanthanum) (III) 또는 납(lead) (II)과 같은 X-레이 검출가능 화합물; 구리(copper)67, 갈륨(gallium)67, 갈륨(gallium)68, 인듐(indium)111, 인듐(indium)113, 요오드(iodine)123, 요오드(iodine)125, 요오드(iodine)131, 수은(mercury)197, 수은(mercury)203, 레늄(rhenium)186, 레늄(rhenium)188, 루비듐(rubidium)97, 루비듐(rubidium)103, 테크네튬(technetium)99 m 또는 이트륨(yttirum)90과 같은 방사성 이온; 코발트(cobalt) (II), 구리(copper) (II), 크로뮴(chromium) (III), 디스프로슘(dysprosium) (III), 에르븀(erbium) (III), 가돌리늄(gadolinium) (III), 홀뮴(holmium) (III), 철(iron) (II), 철(iron) (III), 망간(manganese) (II), 네오디뮴(neodymium) (III), 니켈(nickel) (II), 사마리움(samarium) (III) , 테르븀(terbium) (III), 바나듐(vanadium) (II) 또는 이테르븀(ytterbium) (III)과 같은 핵자기 스핀 공명 동위원소(nuclear magnetic spin-resonance isotope); 또는 로다민(rhodamine) 또는 플로오르세인(fluorescein)을 포함할 수 있다.

종양 치료 전의 전이미지화(pre-imaging)는

(a) 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 구조물에 작동가능하게 부착된 진단제를 포함하는, 종양 세포, 종양 맥관구조(바람직하게는) 또는 종양 기질(바람직하게는)에 접근가능한 성분에 결합하는 적어도 제1의 결합 부위에 작동가능하게 부착된 진단제를 포함하는 진단학적 유효량의 약제학적 조성물을 동물 또는 환자에게 투여하고;

(b) 그 후에 종양 세포, 종양 혈관(바람직하게는) 또는 종양 기질(바람직하게는)에 결합하는 검출가능하게 표지된 제1의 결합 부위(또는 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체)를 검출하여 종양, 종양 맥관구조 및/또는 종양 기질의 이미지를 얻는 것

에 의하여 수행될 수 있다.

암 치료는 또한

(a) 종양 결합제 또는 본 발명의 VEGFR2-차단성 항-VEGF 항체에 작동가능하게 부착된 진단제를 포함하는 진단학적 최소량의 적어도 제1의 검출가능하게 표지된 종양 결합제, 바람직하게는 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 구조물을 신생혈관성 종양을 가지는 동물 또는 환자에게 투여함으로써 신생혈관성 종양의 이미지를 만들고, 그것에 의하여 종양, 종양 맥관구조(바람직하게는) 또는 종양 기질(바람직하게는)의 검출가능한 이미지를 만들고,

(b) 그 후에 치료학적으로 최적화된 양의 본 발명의 적어도 제1의 나상의 VEGFR2-차단성 인간 항-VEGF 항체 또는 이러한 항체를 사용하는 치료제-항체 구조물을 동일한 동물 또는 환자에게 투여함으로써 항종양 효과를 야기하는 것

에 의하여 수행될 수 있다.

따라서, 일반적으로

(a) 종양 결합제 또는 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체에 작동가능하게 부착된 검출가능한 약제를 포함하는, 진단학적 유효량의 검출가능하게 표지된 종양 결합제, 바람직하게는 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 구조물을 포함하는 제1의 약제학적 조성물; 및

(b) 치료학적 유효량의 본 발명의 적어도 하나의 나상의 VEGFR2-차단성 인간 항-VEGF 항체 또는 이러한 항체를 사용하는 치료제-항체 구조물을 포함하는 제2의 약제학적 조성물

을 포함하는 조영제 및 치료 제형 또는 약제가 제공된다.

본 발명은 또한 본 발명의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 항원-결합 단편과 작동가능하게 결합된 생물학적 유효량의 적어도 하나의 진단제를 포함하는 적어도 제1의 조성물 또는 약제학적 조성물을 포함하는 시험관 내 진단 키트를 제공한다.

본 발명은 여전히 신체의 외부, 바람직하게는 동물 또는 환자로부터 얻어진 생물학적 샘플 상에서 수행되는 테스트와 관련하여 사용하기 위한 진단제를 포함하는 조합된 키트를 더 제공한다. 이와 같이, 본 발명은 일반적으로 생물학적 유효량의 본 발명의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 이러한 항-VEGF 항체의 항원-결합 단편 또는 면역접합체 및 시험관 내에서의 사용을 위한 생물학적 유효량의 적어도 하나의 진단제, 성분 또는 시스템을 포함하는, 적어도 두개의 개별 용기, 적어도 제1의 조성물, 약제학적 조성물 또는 약용 칵테일을 포함하는 키트를 제공한다.

"시험관 내에서의 사용을 위한 진단제, 성분 또는 시스템(diagnostic agent, component or system for in vitro use)"은 신생혈관성 성분을 가지는 하나 또는 그 이상의 질병의 진단을 가능하게 하는 임의의 진단제 또는 약제의 조합일 것이다. 따라서, 상기 시험관 내 진단은 하기의 특허 중 임의의 하나에 기재된 것과 같은 질병 또는 장애에 관련된 진단 또는 예측 정보를 만드는 데 사용하는 데 적합한 것들을 포함한다: 각각 참조로서 본원에 특별히 통합되어 있는 U.S. Patent No. 5,712,291; 5,753,230; 5,972,922; 5,639,757; WO 98/45331 및 WO 98/16551.

암 진단 및 치료의 면에서, 시험관 내 진단은 시험관 내 진단 테스트에 의하여 직접 또는 간접적으로 검출가능한 "검출가능 또는 지시 약제(detectable or reporter agent)에 작동가능하게 부착된, 종양 세포, 종양 맥관구조(바람직하게는) 또는 종양 기질(바람직하게는)에 접근하능한 성분에 결합하는 적어도 제1의 결합 부위를 포함하는 진단 성분을 포함하는 것이 바람직할 것이다. 시험관 내에서 직접적으로 검출가능한 "검출가능 또는 지시 약제"는 면역형광에 의해 검출가능한 방사성표지 및 지시 약제와 같은 것들을 포함한다.

시험관 내에서 간접적으로 검출가능한 "검출가능 또는 지시 약제"는 발색 기질(chromogenic substrate)과 접촉하여 착색된 산물을 생성하는 검출가능 효소와 같은 추가 외인성 약제(exogenous agents)와 함께 작용하는 것들을 포함한다. 시험관 내 간접 검출은 또한 제1의 결합 부위에 대하여 면역특이성을 가지는 적어도 하나의 검출 항체와 조합하여 종양 세포, 종양 맥관구조(바람직하게는) 또는 종양 기질(바람직하게는)에 접근가능한 성분에 결합하는 제1의 결합 부위를 포함하는 검출가능 또는 지시 성분 또는 시스템에 이른다. "검출 항체(detecting antibody)"는 바람직하게는 방사성 표지 또는 효소와 같은 직접 또는 간접적으로 검출가능한 약제에 부착된 "제2의 항체"이다. 대안적으로, 직접 또는 간접적으로 검출가능한 약제에 부착될 제1의 검출 항체, 제2의 검출 항체에 대한 면역특이성을 가지는 제1의 검출 항체와 조합하여 제1의 결합 부위에 대한 면역특이성을 가지는 제1의 검출 항체를 포함하는, "제2 및 제3의 항체 검출 시스템(secondary and tertiary antibody detection system)"이 사용될 수 있다.

예시적 구현의 설명

고형 종양(solid tumors) 및 암종(carcinomas)이 인간에서의 모든 암의 90% 이상을 차지한다. 비록 단일클론 항체 및 면역독소들의 용도가 림프종(lymphomas) 및 백혈병(leukemias)의 치료에서 조사되었으나, 이 약제들은 암종 및 다른 고형 종양에 대한 임실 실험에서는 실망스럽게도 효과가 없었다(Abrams and Oldhan, 1985). 항체에 기초한 치료의 효과 없음에 대한 주된 이유는 거대분자는 고형 조양 내로 쉽게 이동할 수 없다는 것이다. 오히려 일단 종양 덩어리 내에서, 이 거대분자들은 종양 세포, 섬유성 기질(fibrous stroma), 간질압 기울기(intestinal pressure gradients) 및 결합 부위 장벽(binding site barriers) 사이의 단단한 결합의 존재 때문에 고르게 분포될 수 없다(Dvorak et al., 1991a).

고형 종양을 치료하기 위한 새로운 방법을 개발하는 데 있어서, 종양 세포보다는 종양의 맥관구조를 표적으로 하는 것을 포함하는 방법이 명확한 이점을 제공한다. 종양 혈관의 효과적인 파괴 또는 봉쇄(blockade)는 종양을 통한 혈액의 흐름을 차단하여 종양 세포사(cell death)의 쇄도를 야기한다. 항-독소 및 항-응고제 구조물은 이미 종양 혈관의 특이적인 표적화 및 파괴에 효과적으로 사용되고 있으며, 이는 종양의 괴사를 일으킨다(Burrows et al., 1992; Burrows and Thorpe, 1993; WO 93/17715; WO 96/01653; U.S. Patent No. 5,855,866; 5,877,289; 5,965,132; 6,051,230; 6,004,555; 6,093,399).

항체, 성장인자 또는 다른 결합 리간드가 응고제를 종양 맥관구조에 특이적으로 운반하는 데 사용되는 경우, 이와 같은 약제들을 "응고리간드(coaguligands)"라고 칭한다. 응고리간드에 사용하기 위한 현재의 바람직한 응고제는 절단된 조직 인자(truncated Tissue Factor(tTF))이다(Huang et al., 1997; WO 96/01653; U.S. Patent No. 5,877,289). TF는 혈액 응고의 주요 개시자(initiator)이다. 손상 부위에서, 혈액 내의 인자 VII/VIIa는 혈관주위 조직(perivascular tissue)에서 세포 상의 TF와 접촉하거나 결합하게 된다. 인지질 표면의 존재하에서 TF:VIIa 복합체는 인자 IX 및 X를 활성화시킨다. 이것은 결국 트롬빈(thrombin)과 피브린(fibrin) 및 최후에는 혈전(blood clot)의 형성을 야기한다.

종양의 내피 상에서는 입수할 수 있으나 정상적인 내피에는 많이 결여되어 있는 적절한 표적 분자의 범위를 기재하였다. 예를 들면, 엔도글린(endoglin), E-셀렉틴(E-selectin), P-셀릭틴(P-selectin), VCAM-1, ICAM-1, PSMA, TIE, LAM-1과 반응하는 리간드, VEGF/VPF 수용체, FGF 수용체, αγβ3 인테그린(αγβ3 integrin), 플레이오트로핀(pleiotropin) 또는 엔도시알린(endosialin)과 같은 발현된 표적들이 사용될 수 있다(U.S. Patent No. 5,855,866; 5,877,289 및 6,004,555; Burrows et al ., 1992; Burrows and Thorpe, 1993; Huang et al ., 1997; 각각 참조로서 본원에 통합되어 있음).

천연의 종양 환경 또는 인간에 의한 하기의 중재에 의하여 유도될 수 있는 다른 표적 또한 미국 특허등록번호 제5,776,427호 및 제6,036,955호(각각 참조로서 본원에 통합되어 있음)에 기재된 것과 같이 표적가능한 실체이다. 정상 조직에서의 전 억제(prior suppression) 및 종양 혈관 유도가 함께 사용될 때, MHC 클래스 II 항원 또한 표적으로서 사용될 수 있다(U.S. Patent No. 5,776,427; 6,004,554 및 6,036,955; 각각 참조로서 본원에 통합되어 있음).

흡착된 표적들은 VEGF, FGF, TGFβ, HGF, PF4, PDGF, TIMP, TIE에 결합하는 리간드 또는 종양관련 피브로넥틴의 아형(tumor-associated fibronectin isoform)과 같은 다른 적절한 그룹이다(U.S. Patent No. 5,877,289 및 5,965,132; 각각 참조로서 본원에 통합되어 있음). 피브로넥틴 아형은 수용체의 인테그린 패밀리에 결합하는 리간드이다. 종양관련 피브로넥틴 아형은 종양 맥관구조 및 종양 기질 모두의 표적가능한 성분이다.

이와 같은 임상학적 표적화 적용을 위한 하나의 현재의 바람직한 마커는 수용체-관련 VEGF(receptor-associated VEGF)이다. 사실, VEGF:수용체 복합체의 어셈블리는 현재까지 발견된 종양 맥관구조의 가장 특이적인 마커 중 하나이다(U.S. Patent No. 5,877,289; 5,965,132 및 6,051,230; Lin-Ke et al ., 1996; Dvorak et al., 1991b).

종양은 사이토카인 및 성장인자가 풍부하며, VEGF 수용체는 대부분의 고형 종양에서 발견되는 저산소증 조건하에서 상승조절되기 때문에, VEGF:수용체 복합체는 종양 내피에 대한 약물 특이적 운반을 위한 관심 표적 또는 다른 작동자(effector)를 나타낸다(Mazure et al ., 1996; Forsythe et al ., 1996; Waltenberger et al ., 1996; Gerber et al ., 1997; Kremer et al ., 1997). 종양의 미세환경에서 리간드 및 그것의 수용체 모두의 특이적인 상승조절은 정상 조직에서의 내피와 비교하여 높은 농도의 수용체가 종양 혈관 내피를 점령하도록 한다(U.S. Patent No. 5,877,289 및 5,965,132). 드보락과 그 동료들 또한 VEGF의 N-말단에 유도된 토끼의 다클론성 항체가 동계 종양을 가지는 마우스에 주입된 후 종양 혈관을 선택적으로 착색시킴을 보여주었다(Lin-Ke et al ., 1996).

임상학적 중재를 위한 표적으로서 VEGF의 역할은 면역독소 또는 응고리간드 치료에 제한되지 않는다. 실제로, VEGF는 강력한 투과성 약제(Senger et al ., 1983; Senger et al ., 1990; Senger et al ., 1986) 및 내피 세포 마이토겐(Keck et al., 1989; Connolly et al ., 1989; Thomas, 1996)이 모두 되는, 고형 종양의 신생혈관형성에 관여하는 중요 인자 중 하나이다(Ferrara, 1995; Potgens et al ., 1995). VEGF와 신생혈관형성 간의 관련은 VEGF 중재를 겨냥한 다양한 치료 방법의 제안을 이끌어내었다(Siemeister et al ., 1998).

A. VEGF VEGF 수용체

혈관 내피 성장 인자 아형 A(Vascular endothelial growth factor isoform A)(VEGF-A, 본 명세서에서는 간결하게 "VEGF"로 칭한다)는 저산소성 및 발암성 변이에 의해 유도된 다기능성 사이토카인(multifunctional cytokine)이다. VEGF는 배발생(embryogenesis)에서 혈관 네트워크의 발달 및 유지의 1차 자극물(primary stimulant)이다. 그것은 강력한 투과-유도제(potent permeability-inducing agent), 내피세포 화학주성 물질(endothelial cell chemotactic agent), 내피 생존 인자(endothelial survival factor) 및 내피세포 증식 인자(endothelial cell proliferation factor)로서 작용한다(Thomas, 1996; Neufeld et al ., 1999). 그것의 활성은 배아 치사율(embryonic lethality)을 야기하는 하나 또는 양쪽의 VEGF의 대립유전자(allele)의 표적화된 파괴때문에(Carmeliet et al ., 1996; Ferrara et al., 1996) 정상적인 배아 발생(embryonic development)에 필요하다(Fong et al ., 1995; Shalaby et al ., 1995).

VEGF는 상처 치유(wound healing)(Frank et al ., 1995; Bruke et al ., 1995), 당뇨병성 망막증(diabetic retinopathy)(Alon et al ., 1995; Malecaze et al., 1994), 건선(psoriasis)(Detmar et al ., 1994), 아테롬성 동맥 경화증(atherosclerosis)(inoue et al ., 1998), 류마티스성 관절염(rheumatoid arthritis)(Harada et al ., 1998; Nagashima et al ., 1999), 고형 종양 성장(solid tumor growth)(Plate et al ., 1994; Claffey et al ., 1996)을 포함하는 다수의 생리학적이고 병리학적인 과정에서 신생혈관형성(angiogenesis) 또는 혈관형성(vasculogenesis)을 구동하는 중요 인자이다.

다양한 세포 및 조직들이 동일한 유전자에 의해 암호화된 접합 변이체(splice variants)인 적어도 다섯개의 아형(121, 145, 165, 189 및 206 아미노산)으로 존재하는 VEGF를 생성한다(Houck et al ., 1991; Ferrara et al ., 1991; Tischer et al ., 1991). 두개의 더 작은 아형인 121 및 165는 세포로부터 분비된다(Houck et al., 1991; Anthony et al ., 1994). 분비된 VEGF는 두개의 이황화 결합으로 연결된 모노머에서 38-46 kDa 사이의 절대 이량체(obligate dimer)이다.

VEGF 이량체는 내피 세포에서 선택적으로 발현(Flt-1 및 Flk-1은 마우스 동족체(homologues)이다)되는 두개의 잘 특성화된 수용체인 VEGFR1(FLT-1) 및 VEGFR2(KDR/Flk-1)에 높은 친화력으로 결합한다. VEGFR1 및 VEGFR2에 결합하는 VEGF의 Kd는 각각 15-100 pM 및 400-800 pM이다(Terman et al ., 1994). 최근 확인된 제3의 세포 표면 단백질인 뉴로필린-1(neuropilin-1) 또한 VEGF와 높은 친화력으로 결합한다(Olander et al ., 1991; De Vries et al., 1992; Terman et al ., 1992; Soker et al ., 1998).

VEGFR1 및 VEGFR2는 7개의 세포외 IgG 유사 반복(seven extracellular IgG-like repeats), 단일 스패닝 막통과 도메인(single spanning transmembrane domain), 및 세포내 분할성 티로신 키나아제 도메인(intracellular split tyrosine kinase domain)으로 특징지워지는 타입 II 수용체 티로신 키나아제(receptor tyrosine kinase; RTK III) 패밀리의 구성원이다(Mustonen and Alitalo, 1995). 가장 최근까지, VEGFR1 및 VEGFR2는 오직 거의 내피세포 상에서만 발현되는 것으로 생각되었다(Mustonen and Alitalo, 1995). 비록 VEGFR1 및 VEGFR2가 내피세포 증식, 이동 및 분화를 자극하는 것과 관련하여 서로 다른 기능을 가진다고 보고되어 있으나(Valtenberger et al ., 1994; Guo et al ., 1995), VEGF의 생태(biology) 및 내피세포 항상성(homeostasis)에서 각각의 수용체가 수행하는 정확한 역할은 본 발명 이전에 정확하게 정의되어 있지 않다.

넉아웃 마우스(knockout mice)를 이용한 최근의 연구들은 각각의 VEGF, VEGFR1 및 VEGFR2가 혈관형성, 신생혈관형성 및 배아 발생에 필수적임을 보여주었다(Fong et al ., 1995; Shalaby et al ., 1995; Hiratsuka et al ., 1998). 치사 넉아웃(lethal knockouts)의 연구에 있어서, 각각의 수용체의 결여에 관련된 표현형은 서로 다르다. VEGFR2의 표적화된 파괴는 내피 세포 분화가 결여되고, 난황난 혈도(yolk sac blood island)의 형성에 실패하거나 혈관이 형성되는 배아를 야기한다(Shalaby et al ., 1995). VEGFR1 결손 돌연변이체(null mutants)는 손상된 혈관형성, 조직이 파괴된 내피세포의 어셈블리 및 확대된 혈관을 보인다(Fong et al ., 1995; Hiratsuka et al ., 1998). VEGFR1은 명백히 생명유지에 필수적인 생물학적 역할을 가진다.

VEGFR1은 비록 더욱 낮은 티로신 키나아제 활성을 가지지만, VEGFR2보다 VEGF에 대하여 더욱 높은 친화력을 가진다. 이것은 VEGFR1의 세포외 도메인이 특히 중요함을 암시한다. 이 가설은 VEGFR1의 티로신 키나아제 도메인이 손상되지 않은 VEGF 결합 도메인을 떠나는 동안에 제거된다는 넉아웃 마우스에서의 연구로부터 얻은 결과에 의해 강력하게 지지된다(Hiratsuka et al ., 1998). VEGFR1-티로신 키나아제 결손 배아는 정상적인 혈관을 발현시키고, 일정기간 살아남는다(Hiratsuka et al ., 1998).

초기의 넉아웃 뿐만 아니라(Fong et al ., 1995; Shalaby et al ., 1995), 히라츠카 등은 VEGFR1이 필수적인 생물학적 역할을 함을 나타내는 연구도 하였다(Hiratsuka et al ., 1998). 그러나, 티로신 키나아제 신호전달은 중요한 인자로 보이지 않았다. VEGFR1 넉아웃 마우스에서의 대식세포는 VEGF-유도성 주화성(chemotaxis)을 나타내지 않았으며(Hiratsuka et al ., 1998; 참조로서 본원에 통합되어 있음), 그것에 의하여 VEGF에 대한 이 중요한 생물학적 반응을 매개하는 데 관여하는 수용체로서 VEGFR1을 포함한다는 것에 주목해 보면 흥미롭다.

어떤 그룹은 VEGF-유도성 세포분화(mitogenesis) 및 투과성(permeability)에 우세한 신호전달 수용체가 되는 VEGFR2를 보고하였다(Waltenberger et al., 1994; Zachary, 1998; Korpelainen and Alitalo, 1998). 비록 대식세포 이동 및 주화성에서의 작용이 상기에 논의된 히라츠카 등(Hiratsuka et al ., 1998)의 연구에 기술되어 있지만, 내피세포 기능에서의 VEGFR1의 역할은 그다지 명확하지 않다.

클라우스 등도 또한 VEGFR1이 단핵세포(monocyte) 활성 및 주화성에 중요한 역할을 한다는 것을 보고하였다. 사실, 대식세포/단핵세포 계통의 세포들은 단지 단핵세포 구축(recruitment) 및 전응고인자(procoagulant) 활성을 매개하는 데 관여하는 수용체인 VEGFR1만을 발현한다(Clauss et al ., 1996). 단핵세포와 대식세포 상의 VEGFR1에 결합하는 VEGF는 또한 세포내 칼슘을 증가시키고, 티로신 인산화를 유도함으로써 작용한다(Clauss et al ., 1996).

VEGF 수용체에 대한 VEGF 이량체의 결합은 수용체 이량체화를 유도한다고 간주된다. 그 후, 수용체의 이량체화는 각각 VEGFR2 및 VEGFR1의 세포 내부 쪽에서 특정 티로신 잔기, Y801 및 Y1175, 및 Y1213 및 Y1333의 자동인산전달반응(autotransphosphorylation)을 야기한다. 이것은 포스포리파아제 Cγ(phospholipase Cγ; PLCγ) 및 포스파티딜이노시톨 3-키나아제(phosphatidylinositol 3-kinase; PI3K)의 활성화를 포함하는 신호전달 캐스캐이드(signal transduction cascade) 및 세포내 칼슘 이온의 증가를 야기한다(Hood and Meininger, 1998; Hood et al ., 1998; Kroll and Waltenberger, 1998).

비록 많은 수의 그룹들이 VEGFR2의 VEGF 활성화 후 일산화 질소(nitroc oxide; NO)가 생성됨을 나타내지만, VEGF-유도성 신호전달에 있어서 더 하류 부분에서의 세포내 사건은 그다지 명확하지 않다(Hood and Meininger, 1998; Hood et al., 1998; Kroll and Waltenberger, 1998). VEGF에 의한 VEGFR1이 아닌 VEGFR2의 활성화는 또한 MAP 키나아제(MAP kinases), ERK1 및 ERK2를 포함하는 Src 및 Ras-MAP 키나아제 캐스캐이드를 활성화시킴을 보여준다(Waltenberger et al ., 1994; 1996; Kroll and Waltenberger, 1997).

내피세포 기능에서 VEGFR1의 역할, 특히 Flt-1 타이로신 키나아제-결손 마우스가 정상 혈관을 성장시키고 발달시키는가에 대해서는 그다지 명확하지 않다(Hiratsuka et al ., 1998). 내피 상에서 VEGFR1의 주요 생물학적 역할은 비신호전달성 리간드 결합 분자(non-signaling ligand-binding molecule) 또는 VEGF를 VEGFR2에 제공하는 데 요구되는 "유인(decoy)" 수용체와 같다.

VEGF와 병리학적 신생혈관형성 조건 사이의 관계는 VEGF 활성을 차단하기 위한 다양한 시도를 촉구하였다. 이것들은 VEGF에 대한 어떤 중화 항체(neutralizing antibodies)의 개발을 포함한다(Kim et al ., 1992; Presta et al., 1997; Sioussat et al., 1993; Kondo et al ., 1993; Asano et al ., 1995). 미국 특허등록번호 제5,840,301호 및 제5,874,542호 및 본 발명 이후의 국제특허출원번호 제99/40118호에 기재된 것과 같은 VEGF 수용체에 대한 항체 또한 기재되어 있다. 미국 특허등록번호 제5,840,301호 및 제5,874,542호는 사실 VEGF 그 자체보다는 VEGF 수용체를 차단하는 것이 다양한 이유의 이점을 가짐을 암시한다.

VEGF 또는 VEGF 수용체에 대한 수용성 수용체 구조물(Kendall and Thomas, 1993; Aiello et al ., 1995; Lin et al ., 1998; Millauer et al ., 1996), 티로신 키나아제 억제제(Siemeister et al ., 1998), 역배열 방법(antisense strategies), RNA 압타머(RNA aptamers) 및 리보자임(ribozymes) 또한 보고되어 있다(Saleh et al., 1996; Cheng et al ., 1996; 각각 참조로서 본원에 통합되어 있음).

B. 항- VEGF 항체

B1. 항체 특성

다양한 억제 방법의 적용은 VEGF 신호전달을 방해함으로써 신생혈관형성을 차단하고/하거나 종양의 성장을 억제하는 데 적어도 어느정도 효과과 있음을 보여준다. 사실, VEGF에 대한 단일클론 항체는 마우스에서 인간 종양 이종이식 성장 및 복수(ascites)의 형성을 억제함을 보여준다(Kim et al ., 1993; Asano et al ., 1995; 1998; Mesiano et al ., 1998; Luo et al ., 1998a, 1998b; Borgstrom et al ., 1996; 1998).

항체 A4.6.1은 VEGFR1 및 VEGFR2 모두와 결합하는 VEGF를 차단할 수 있는 고친화성 항-VEGF 항체이다(Kim et al ., 1992; Wiesmann et al ., 1997; Muller et al., 1998). A4.6.1의 Fab 단편에 결합한 VEGF의 알라닌 스캐닝 돌연변이 생성(alanine scanning mutagenesis) 및 X-선 결정학(X-ray crystallography)은 A4.6.1이 결합하는 VEGF 상의 에피토프가 아미노산 89-94 주위에 집중되어 있음을 보여준다. 이 구조 데이터는 A4.6.1이 VEGFR2에 결합하는 것에 의하여 VEGF를 경쟁적으로 억제하지만, 입체적 장애(steric hindrance)에 의해 VEGFR1에 결합하는 것에 의하여 VEGF를 억제하는 것이 분명하다는 것을 증명한다(Muller et al., 1998; Keyt et al., 1996; 각각 참조로서 본원에 통합되어 있음).

A4.6.1은 지금까지의 문헌에서 가장 널리 사용되는 중화 항-VEGF 항체이다. 그것은 마우스에서 다양한 인간 종양의 성장 및 VEGF-유도성 혈관 투과성을 억제하는 것으로 나타났다(Brem, 1998; Baca et al ., 1997; Presta et al ., 1997; Mordenti et al ., 1999; Borgstrom et al ., 1999; Ryan et al ., 1999; Lin et al ., 1999; 각각 참조로서 본원에 특별히 통합되어 있음). A4.6.1은 또한 잘 특성화된 인간 난소암 마우스 모델에서의 복수 형성을 억제하고, 전이 마우스 모델에서 종양의 확산(tumor dissemination)을 억제한다. A4.6.1은 1가의 파지 디스플레이(phage display) 기술에 의해 인간화된다(Brem, 1998; Baca et al ., 1997; Presta et al ., 1997; 각각 참조로서 본원에 통합되어 있음). 그 결과 생성된 아바스틴(bevacizumab)이라 칭하는 인간화된 항체는 임상 용도로 승인되었다(Hurwitz et al ., 2004).

VEGF에 대한 중화 항체를 사용한 당업계에서의 성공에도 불구하고, 본 발명은 VEGFR1(FLT-1) 및/또는 VEGFR2(KDR/Flk-1)과 함께 더욱 정확하게 정의된 형태의 상호작용을 하는 새로운 항체, 특히 인간 항체가 여러가지 이유로 유익할 것이라는 것을 깨달았다. 예를 들면, 두개의 VEGF 수용체들 중 단지 하나와의 VEGF의 상호작용을 선택적으로 차단하는 항-VEGF 항체의 개발은 VEGFR1 및 VEGFR2를 모두 발현하는 세포에서 VEGF에 의해 활성화되는 경로의 더욱 정확한 분석을 가능하게 한다.

본 발명자들은 단지 하나의 수용체(VEGFR2)와 결합하는 VEGF를 차단하는 정의된 에피토프 특이적인 인간 항체가 임상학적 유용성을 가질 것이라고 간주하였다. 히라츠카 등(Hiratsuka et al ., 1998)의 넛아웃 마우스 연구는 VEGFR1 및 VEGFR2 모두가 중요한 생물학적 역할을 함을 보여준다. 본 발명 이전에, 두개의 수용체 중 단지 하나를 통하여 VEGF에 의해 매개되는 효과를 억제하는 것을 목표로 하는 치료 중재에 대한 현실적인 기회는 효과, 인간의 투여에 대하여 최적화된 맞춤 억제제의 부족에 의하여 제한되었다.

신생혈관형성을 차단하는 치료학적으로 특이적인 인간 항체의 필요성에 대하여, 인간 항체들은 VEGF 수용체 2(VEGFR2, KDR/Flk-1)과의 상호작용을 특이적 및 실질적으로 차단하지만 VEGF 수용체 1(VEGFR1, Flt-1)과의 상호작용은 실질적으로 차단하지 않는 VEGF 상의 에피토프에 대하여 반응한다는 것을 확인하였다.

본 발명자들은 VEGF에 결합하기 위하여 마우스 유래의 항체 2C3와 결쟁하는 다양한 전 인간 항-VEGF 항체를 처음으로 개발하였다. VEGF에 대하여 높은 친화력을 나타내고, VEGF와 VEGFR1이 아닌 VEGF와 VEGFR2 간의 상호작용에 대한 선택적 파괴를 보여주는 다수의 항체 클론들을 추가 분석을 위하여 선별하였다. 명백하게는, "모 클론(mother clone)"이라 칭하는 이 클론들 중 하나를 성숙(maturation)시킨 후 더욱 중요하고 현저한 향상을 나타내는, 예를 들어 마우스 VEGF 및 인간 VEGF 모두에 대한 더욱 나은 결합 친화력, 혈청에서의 높은 안정성 및 scFv 형태에서 집합체(aggregates)를 형성하는 경향이 감소된 새로운 클론을 선별하였다. 이 항체는 r84(및 PGN311)로 불리며, IgG에서 인간의 치료에 효과를 나타내는 범위 내에 충분히 포함되는 대략 7nM 또는 그보다 적은 Kd와 함께 VEGF에 대한 우수한 결합 친화력을 나타낸다.

게다가, 상기 r84 항체는 본원에서 몇몇의 당업계에서 허용된 생체 내 종양 모델(특히, A673 횡문근육종(rhabdomyosarcoma) 종양 모델, MDA-MB 231 유방암 종양 모델, 다양한 인간 비소세포 폐암 모델, Panc 1 췌장암 세포 종양 모델 및 4T1 유방 종양 모델)에서의 종양 크기/종양 성장을 현저하게 감소시킴을 보여주었다. 특히, r84를 사용한 결과는 적어도 임상 용도로 승인된 아바스틴이라 불리는 인간화된 항-VEGF 항체만큼 우수하였다. r84와 같은 전 인간 항체는 이용할 수 있는 인간화된 항체를 뛰어넘는 이점을 제공할 것이다. 게다가, r84는 마우스 VEGF 및 인간 VEGF에 대한 유리한 결합 특성을 가진다. 마우스 VEGF에 결합하는 능력은 r84 항체가 2C3 및 아바스틴을 뛰어넘음을 보여주는 중요한 이점이다. 더욱이, MDA-MB 231 종양 모델로부터의 결과 또한 r84가 암의 발달 및 전이에 결정적인 역할을 하여 환자에게 해롭다고 알려져 있는 대식세포에 관련된 종양의 침윤을 현저하게 감소시킨다. 이와 관련하여, r84는 대식세포 마커인 Mac-3의 발현을 현저하게 감소시킴을 알 수 있다(p<0.01). 게다가, MDA-MB 231 종양 모델에서의 결과는 r84가 종양에서 다수의 혈관을 현저하게 감소시키므로(p<0.0001), 종양에서 미세혈관의 밀도(microvessel density; MVD)를 현저하게 감소시킴을 보여준다.

r84는 또한 VEGFR2를 발현하는 세포의 VEGF에 의해 유도된 이동을 현저하게 억제하고, MDA-MB 231 종양에서 림프관 밀도를 현저하게 감소시킨다. 림프관 밀도에의 효과는 림프관 형성을 억제하기 위한 본 발명의 인간 항체의 용도를 뒷받침한다.

r84에 의해 나타난 또 다른 유익한 특성은 종양 내에서 골수 유래의 억제 세포(myeloid-derived suppressor cells), 특히 CD11b+/Gr1+ 세포의 침윤을 현저하게 감소시키는 능력이다. 게다가, 이 특성은 2C3 항체에서는 나타나지 않았으며, 아바스틴에 의해서는 단지 좀 더 감소된 수준으로 나타났다. 따라서, MDA-MB-231 종양을 가지는 마우스에서의 추가 연구는 r84 처리된 동물에서 대조군과는 대조적으로 현저하게 보다 적은 수의 CD11b/Gr1+ 이중 양성 세포가 종양을 침윤함을 보여주었다. 비교 연구에 있어서, 비록 다소의 감소가 아바스틴 처리된 동물에서 측정된다고 하여도, 2C3 항체 뿐만 아니라 아바스틴 또한 CD11b+/Gr1+ 침윤에서 통계적으로 현저한 감소를 보여주지 못하였다. r84/PGN311 처리된 동물에서 관찰된 이중 양성 세포 수의 감소는 39%이다(도 25).

골수 유래의 억제 세포 CD11b+/Gr1+의 감소된 침윤은 최근에 항-VEGF 치료에 대한 종양 불응성(tumor refractoriness)의 개입에 관련된 마커 모두를 발현하는 세포로서 특히 흥미로운 것이다(Shojaei et al., 2007). 골수 유래의 억제 세포(CD11b+Gr1+)는 또한 종양의 진행에 중요한 공헌자이다. 종양의 미세환경에서, 이 세포들은 면역억제성 매개물질(immunosuppressive mediators)을 분비하고, T-임파구(T lymphocyte)의 기능장애를 유도한다(Gabrilovich et al ., 2001; Serafini et al ., 2004).

CD11b+/Gr1+ 세포는 항-VEGF 치료에 대한 종양 불응성과 관련되어 있으며 종양의 진행에 기여하기 때문에, 종양 내에서 이 세포들의 침윤 또는 구축을 감소시키기 위한 r84/PGN311의 효과는 r84의 치료학적 적용, 특히 암을 포함하는 신생혈관성 질병의 치료에 관련된 치료학적 적용에 강력한 중요성을 가진다.

실제로, 본원에서의 결과는 CD11b+/Gr1+ 세포의 종양 침윤이 r84/PGN311로 처리된 동물에서 적어도 우세하게/현저하게 낮음을 보여주므로, r84를 이용한 치료는 VEGF를 표적으로 하는 다른 약물, 예를 들어 다른 항-VEGF 항체를 사용한 치료보다 항-VEGF 치료에 대한 약물 내성 또는 불응성이 덜 발생하는 경향이 있다는 것을 암시한다. 게다가, 종양의 진행에서 CD11b+/Gr1+ 세포의 제안된 역할이 주어지면, 종양 내에서 이와 같은 세포의 침윤 또는 구축을 감소시키기 위한 r84/PGN311의 능력은 항종양 활성에 연관된, 예를 들어 r84/PCN311에 의해 보여지는 종양 성장의 억제 메카니즘의 일부분을 잘 형성할 것이다.

r84/PGN311의 장기 투여는 마우스에서 독성을 유도하지 않음을 또한 알 수 있었다.

이것들은 또 다른 긍정적인 r84 항체의 치료학적 가능성을 나타낸다.

B2. VEGFR2 - 차단성 인간 항- VEGF 항체

ELISA, 수용체 결합 검정 및 수용체 활성화 검정을 사용하여 확인된 본 발명의 중요한 부분은 VEGFR2(KDR/Flk-1)와 VEGF의 상호작용은 선택적으로 차단하지만 VEGFR1(FLT-1)은 차단하지 않는 본 발명의 항체이다. 상기 항체는 VEGFR2의 VEGF-유도성 인산화을 억제하고, VEGFR2를 통한 신호전달을 억제한다. 상기 항체는 또한 당업계에서 허용된 인간 암의 동물 모델에서 확립된 인간 고형 종양의 성장을 정지시키는 강력한 항종양 활성을 가진다. 게다가, 본 발명의 인간 항체는 항신생혈관형성 특성을 가지며, 종양에서 미세혈관의 밀도를 감소시킨다.

이러한 특성들은 VEGFR1 및 VEGFR2 모두를 발현하는 세포에서 VEGF에 의해 활성화되는 경로를 세밀히 조사할 뿐만 아니라, 종양 성장의 진행 및 생존에서의 VEGFR2 활성의 중요성을 강조하는 데 있어서의 항체의 유용성을 설명한다. 더욱 중요하게는, 그것들은 용골세포 및 연골파괴 세포의 기능과 같은 VEGFR1에 의하여 매개되는 사건의 부수적인 억제 없이, VEGFR2-유도성 신생혈관형성을 특이적으로 억제할 수 있게 하는, 인간 항체에 대한 고유한 형태의 치료학적 중재를 제공한다.

간략하게 "VEGFR2-차단성 인간 항-VEGF 항체"라 칭하는 본 발명의 항체는 당해 분야에서 진보성을 나타내며, 다른 치료제와 접합되거나 결합되는 경우 비접합되거나 나상된 형태로 사용하는 모든 면에 있어서 다수의 이점을 제공한다.

본 발명의 시험관 내 연구는 상기 인간 항체가 VEGFR2에 대한 VEGF의 결합은 차단하지만, VEGFR1에 대한 VEGF의 결합은 억제하지 않음을 증명한다.

본 발명의 인간 항체는 따라서 마우스 유래의 A4.6.1 항체 및 그것의 인간화된 대응물(counterpart), 아바스틴(bevacizumab)을 포함하는 VEGF에 대한 다른 차단성 항체보다 현저하게 향상되었다. 상기 A4.6.1 및 아바스틴 항-VEGF 항체는 VEGF 수용체 모두에 대한 VEGF의 결합을 차단한다. 결정학 및 돌연변이 연구는 VEGFR2 및 VEGFR1에 대한 결합 에피토프가 VEGF 이량체의 두개의 대칭적인 극(symmetrical poles)을 향하여 집중되어 있음을 보여준다(Wiesmann et al., 1997; Muller et al ., 1997). 두개의 수용체와 상호작용하는 VEGF 상의 결합 결정인자(binding determinant)는 부분적으로 겹쳐져 있고, 이량체 표면의 도처에 걸쳐있는 4개의 서로 다른 단편(segment)에 기여한다(Muller et al ., 1998). 항체 4.6.1은 수용체 모두의 수용체 결합 부위 내의 VEGF 부위에 결합한다(Muller et al., 1998).

수용체의 VEGF-유도성 인산화에서의 본 발명의 인간 항체의 효과에 대한 연구는 상기 항체들이 VEGFR2의 VEGF-유도성 인산화를 차단함을 보여준다. 연구는 또한 본 발명의 인간 항체가 VEGFR2를 통한 세포 신호전달을 억제함을 보여주며, 예를 들면, 상기 항체는 시험관 내 검정에서 Erk 1/2 및 PLC-γ의 인산화를 억제함을 보여준다.

본 발명의 인간 항체는 생체 내에서 인간 종양 타입의 성장을 억제한다. 본 발명의 인간 항체에 의한 종양 성장 억제의 크기는 아바스틴을 포함하는 서로 다른 중성화 항-VEGF 항체를 사용한 것과 유사하다. 다른 발명자들이 서로 다른 항-VEGF 항체를 사용하여 발견한 것들과 유사한 이 인간 항체들의 효능은 종양의 신생혈관형성 및 종양의 성장에서의 VEGF의 역할을 더 설명한다. 그러나, 본 발명의 인간 항체는 본원에 논의된 특이적인 억제 특성에 기초하고 전 인간 항체가 되는 것을 고려하여 치료용으로 더욱 안전하게 제공되어야만 한다.

사실 종양의 정지(stasis) 보다는 퇴화(regression)가 달성될 수 있으며, VEGF는 단순히 종양 내피에 대한 신생혈관성 신호만을 제공한다는 것을 암시한다. 벤자민 등은 최근 종양이 아직까지 혈관주변 세포와 접촉하지 않은 미성숙 혈관의 큰 단편들을 포함하며, 이 혈관들은 생존을 위하여 VEGF에 의존적이라는 것을 보고하였다(Benjamin et al ., 1999). VEGF의 중성화는 이 미성숙 혈관들이 아포토시스를 겪도록 하며, 이것에 의하여 종양에 존재하는 혈관 네트워크를 감소시킬 수 있다. 맥관 형성 및 맥관 퇴화 모두를 포함하는 혈관 리모델링의 동적 과정(dynamic process) 또한 종양에서 일어날 수 있으며, VEGF의 중성화는 맥관 퇴화를 향한 넷 쉬프트(net shift)를 야기하는 맥관 형성을 예방할 수 있다.

본 발명의 인간 항체가 (그 이상은 아닐지라도) 아바스틴만큼 완전하게 종양의 성장을 억제한다는 발견은 종양의 신생혈관형성에서의 VEGFR2의 지배적인 역할을 나타낸다. 신생혈관형성의 다중단계의 과정은 내피세포 주화성(endothelial cell chemotaxis), 메탈로프로테이나아제 생성(metalloproteinase production), 침습(invasion), 증식(proliferation) 및 분화(differentiation)를 필요로 한다. VEGFR1은 이 과정에서 어떠한 역할도 하지 않거나, VEGF에 결합하고 그것을 신호전달 수용체인 VEGFR2에 제공함으로써 과정에 도움을 줄 수 있다.

종양의 치료에서 본 발명의 인간 항체 및 아바스틴에 대한 지수는 매우 관련이 높다: 비록 그것들이 단지 VEGFR1이 아닌 VEGFR2에 결합하는 VEGF만을 억제한다 할지라도, 본 발명의 인간 항체는 적어도 아바스틴 만큼 효과적이다. 따라서, 현재의 연구들은 VEGFR1이 VEGF-매개성 종양 신생혈관형성에 주목할만한 역할을 하지 않는다는 것을 보여주며, VEGF1 특이적 억제제들은 종양의 신생혈관형성에 형향을 주지 않을 것이라는 것을 더 암시한다. 이 결과들은 또한 본 발명의 인간 항체는 아바스틴과 동등하거나 또는 더욱 효과적인 반면 더욱 적은 부작용을 야기한다는 것을 의미한다.

VEGFR1(Flt-1)이 아닌 VEGFR2에 결합하는 VEGF를 특이적으로 차단하는 능력 및 VEGFR2의 활성화는 임상적 중요성을 가진다. 따라서, 본 발명의 인간 항체는 VEGF의 신생혈관형성 활성은 차단하지만, 어떤 면역 세포 및 골 세포 상에서와 같이 VEGFR1을 통하여 매개되는 VEGF의 다른 유익한 작용은 억제하지 않는다. 따라서, 임상적 중요성의 한 부분은 용골세포 및 연골파괴 세포의 유익한 효과를 억제하는 일 없이 생체 내에서 기능하기 위한 본 발명의 인간 항체의 능력을 고려한다. 이것은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 치료제의 용도가 뼈 및/또는 연골 상에서의 부작용과 관련되지 않을 것이라는 것을 의미한다.

생체 내 연구들은 VEGF가 연골내골화 뼈 형성(endochondral bone formation) 동안의 비후성 연골 리모델링, 골화작용(ossification) 및 신생혈관형성과 결부되며, VEGF는 연골의 리모델링에 필수적임을 보여준다(Gerber et al., 1999; 참조로서 본원에 특별히 통합되어 있음). 수용성 VEGFR1 수용체 키메라 단백질(Flt-(1-3)-IgG)의 투여에 의한 VEGFR1을 통한 VEGF 신호전달의 불활성화는 연골파괴 세포의 구축 및/또는 분화를 감소시킴으로써, 지주골(trabecular bone) 형성 및 비후성 연골세포 존(chondrocyte zone)의 팽창을 약화시킨다(Gerber et al ., 1999).

VEGF는 생체 내 용골세포 기능을 지지하는 대식세포 콜로니-자극 인자(macrophage colony-stimulating factor; M-CSF)를 대신할 수 있음을 더 보여준다(Niida et al ., 1999; 참조로서 본원에 특별히 통합되어 있음). 용골세포에 결함을 가지는 골화성(osteopetrotic (op/op)) 마우스를 사용한 연구에서, 용골세포의 구축 및 생존을 가능하게 하는 재조합 인간 M-CSF(rhM-CSF)를 주사하여 M-CSF 유전자에 변이를 일으켰다. 최근의 연구에서, 재조합 인간 VEGF의 단일 주사는 골화성 마우스에서 용골세포 구축을 유사하게 유도할 수 있음을 보여준다(Niida et al., 1999).

니다 등은 용골세포가 VEGFR1을 우세하게 발현하기 때문에 용골세포 구축에서 재조합 인간 태반 성장 인자 1(human placenta growth factor 1)의 활성은 rhVEGF의 활성과 견줄만하며, 골화성 마우스에서 VEGF 신호전달의 유익한 효과는 VEGF 수용체 1(VEGFR1)을 통하여 매개됨을 보고하였다(Niida et al ., 1999). 이 저자들은 rhM-CSF에 의해 유도된 용골세포들이 VEGF가 (VEGF 수용체 키메라 단백질, VEGFR1/Fc을 사용하여) 억제된 후에 죽었으나, 이러한 효과들은 rhM-CSF의 부수적인 주사에 의해 억제됨을 더 보여주었다. rhM-CSF 또는 내생적 VEGF에 의해 유지되는 용골세포는 생체 내 활성에서 현저한 차이점을 보여주지 않았다(Niida et al., 1999).

골화석증(osteopetrosis)의 노화관련 분해(resolution)를 겪은 변종 골화성 마우스는 용골세포 수의 증가를 수반한다. 니다 등의 연구에서, 대부분의 용골세포들은 항-VEGF 항체의 주사 후 사라지며, 이는 내생적으로 생성된 VEGF가 변종 마우스에서 용골세포의 출현에 관여한다는 것을 설명한다(Niida et al ., 1999). 게다가, rhVEGF는 생체 내 용골세포 분화를 지지하는 M-CSF를 대신한다. 이 결과들은 M-CSF 및 VEGF가 용골세포 기능을 지지하는 데 겹치는 기능을 가지며, VEGF는 VEGFR-1 수용체를 통하여 작용한다는 것을 설명한다(Niida et al ., 1999).

따라서, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 VEGFR1에 결합하고 활성화되는 VEGF는 차단하지 않지만, VEGFR2에 결합하고 활성화되는 VEGF는 차단함을 고려할 수 있다. 이와 같은 VEGFR2 억제의 항종양 효과는 명백하게 증명되어 있다. 이 결과들은 VEGFR2가 종양의 신생혈관형성에서 투과성 및 가장 중요한 그것의 역할을 매개하는 VEGF 수용체가 된다는 것을 보여준다.

따라서, 본 발명은 고형 종양의 치료를 위한 치료로서 VEGF 억제를 더 확인하였다. 더욱 상세하게는, 본 발명은 치료학적 개입을 위한 새로운 VEGFR2-차단성 인간 항-VEGF 항체의 범위, 특히 종양 및 다른 질병에서 신생혈관형성을 억제하기 위한 안전하고 효과적인 약물로서의 용도를 제공한다.

본 발명의 이점은 부작용이 없다는 것에 제한되지 않는다. 비록 이것들이 특히 골 질환을 가지는 어린이 및 환자들의 치료에서 주목할만한 이점을 가질 중요한 특징일지라도, 본 발명의 항체들은 다수의 다른 이점을 가진다.

예를 들면, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 종양관련 대식세포의 유해한 작용을 억제하는 데 중요한 이점을 가진다. 종양관련 대식세포는 암의 초기 발생 단계 및 종양의 진행 및 전이에서 중요한 역할을 한다는 것이 현재 공지되어 있다. 하기에 상세히 설명한 바와 같이, 본 발명의 인간 항체는 이 대식세포들의 역효과(adverse effect)를 중화시키는 데 이상적으로 적합하다.

숙주 맥관구조에 대한 종양 맥관구조의 형성 및/또는 접근은 악성 종양의 발생에서 중대한 단계이다. 실제로, "신생혈관형성 스위치(the angiogenic switch)"라 불리는 고밀도 혈관 네트워크의 형성은 악성종양으로의 변화와 밀접하게 관련되어 있다(Hanahan and Folkman, 1996). 초기 종양과 관련되는 대식세포는 신생혈관형성 스위치와 악성종양으로의 진행 모두에서 주요 역할을 한다는 것이 이미 공지되어 있다(Lin et al ., 2006). 게다가, 종양 내로의 대식세포 침윤을 억제하는 것은 신생혈관형성 스위치 및 악성의 전이를 지연시킴을 보여준다(Lin et al ., 2006).

암을 가진 많은 환자들에서, 전이는 죽음의 결정적인 원인이다. 초기 종양에서 주변 연결 조직 및 혈관으로의 종양 세포의 침입은 전이 과정의 주요 단계이다. 대식세포는 종양의 진행 및 전이와 관련된다는 것이 이미 보고되어 있다(Lin et al ., 2006). 후속의 연구들은 종양 세포와 대식세포간의 상호작용이 초기 종양에서 암종 세포의 이동을 용이하게 하며, 이 과정은 측분비 루프(paracrine loop)를 포함한다는 것을 보여준다(Wyckoff et al ., 2004; Goswami et al ., 2005).

더욱이, 종양-침윤 또는 종양-관련 대식세포는 침입 부위, 기질 및 혈관주변(perivascular) 부위 및 무혈성(avascular) 부위 및 괴사주변(perinecrotic) 부위를 포함하는 다양한 종양의 미세환경에서 두드러진다고 현재 알려져 있다. 각각의 이러한 종양의 미세환경에서 대식세포의 작용은 각각 암세포의 운동성(motility), 전이(metastasis) 및 신생혈관형성을 촉진함으로써 종양의 진행 및 전이를 자극한다(Lewis and Pollard, 2006). 따라서, 대식세포는 최근 암에 대항한 싸움에 있어서 중요한 표적이 되고 있다.

이와 관련하여, 본 발명의 인간 항체는 그것들이 VEGFR2의 활성화를 차단하여 종양 내에서 대식세포의 침윤을 감소시키고, 따라서 악성종양으로의 전이, 종양의 진행 및/또는 전이를 감소시킬 수 있다는 중요한 이점을 가진다. 이것은 종양관련 대식세포가 VEGFR2를 발현하며, 그 VEGFR2는 이 세포들의 VEGF에 의해 유도된 주화성을 매개한다는 것을 보여주는 본원에 제공된 동물 연구로부터의 결과에 의하여 입증되었다. 본원에서는 또한 본 발명의 인간 항체에 의하여 야기된 VEGFR2의 선택적 차단은 강력한 항암 효과를 발휘한다는 것을 보여준다. 이 항암 효과는 종양 내에서의 대식세포 침윤의 감소를 동반하며, 숙주 대식세포에서의 VEGF-VEGFR2 상호작용의 선택적 차단은 관찰된 치료 효과에 기여함을 나타낸다.

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 또한 종양에서 림프관 밀도를 감소시키는 것과 관련한 이점을 가진다. 종양 세포의 종양 혈관으로의 탈출 뿐만 아니라 전이는 림프관 형성, 즉 이미 존재하는 관으로부터의 새로운 종양내(intratumoral) 또는 종양주변(peritumoral) 림프관의 성장에 의해 용이해진다. 실제로, 유방암을 포함하는 몇몇 형태의 암에서, 림프계를 통한 종양 세포의 탈출은 초기 종양으로부터의 악성 세포가 멀리 떨어진 부위로 시드(seeded)됨으로서 널리 퍼진다고 간주된다.

몇 년 동안, 림프관 형성은 VEGF-C 및/또는 VEGF-D에 의하여 일차적으로 유도된다고 생각하였다. 그러나, 현재 림프관 형성에 VEGF-A가 밀접하게 관련된다는 광대한 증거들이 축적되어 있다. 게다가, 최근의 연구들은 VEGF-A에 대한 마우스 유래의 항체들이 생체 내 종양 림프관 형성 및 전이를 억제하는 데 효과적임을 보여준다(Whitehurst et al ., 2007).

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체들이 실제로 종양의 림프관 밀도를 감소시킨다는 것을 나타내는 결과들을 본원에 제공하였다(도 18A, 도 18B 및 도 18C). 따라서, 본 발명의 인간 항체들은 종양의 림프관 형성을 억제할 것이며, 림프적 수단을 통한 전이를 감소시킬 뿐만 아니라 종양의 혈관을 통한 신생혈관형성 및 전이적 탈출(metastatic escape)을 억제하는 데 부가적인 이점을 제공할 것이다. 따라서, 본 발명의 인간 항체는 개입의 몇몇의 지점을 통하여 전이 또는 전이 발생을 감소시키는 능력을 가짐을 알 수 있다.

더욱이, 도 18A의 데이터는 본 발명의 항체가 포도플라닌(podoplanin) 및 PROX1의 감소에 의하여 측정된 것과 같이 종양 림프관 밀도를 감소시킴을 보여준다. 포도플라닌은 연골육종(chondrosarcoma)과 같은 연조직 암, 수상돌기 세포육종(follicular dendritic cell sarcoma)와 같은 림프성 종양에 대한 마커이고(Xie et al ., 2008), PROX1은 대장암(colon cancer)의 침입성(invasiveness)을 예측하는 데 관련된 것이므로(Petrova et al ., 2008), 이것들은 특정 질병의 징조(indication)를 치료하기 위한 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체의 용도를 강조한다.

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체에 의해 보여진 추가적인 유리한 특성은 종양 내에서 골수 유래의 억제 세포, 특히 CD11b+/Gr1+ 세포의 침윤 또는 구축을 현저하게 감소시키는 능력이다. 게다가, 이 특성은 2C3 항체에서는 나타나지 않았으며, 아바스틴에 의해서는 단지 좀 더 감소된 수준으로 나타났다. 본 발명의 바람직한 항체는 종양 내에서 대조군(예를 들어, 처리되지 않은 종양 또는 대조군 항체로 처리된 종양)의 수준과 비교하여, CD11b+/Gr1+ 세포의 침윤 또는 구축을 30% 또는 그 이상, 바람직하게는 32%, 34%, 36%, 38% 또는 그 이상으로 감소시킬 수 있다.

따라서, MDA-MB-231 종양을 가지는 마우스에서의 추가 연구는 대조군과는 대조적으로 r84 처리된 동물에서 현저하게 적은 CD11b/Gr1 이중 양성 세포가 종양을 침윤함을 보여준다. 비교 연구에서, 비록 아바스틴 처리된 동물에서의 어떤 감소가 측정되었다 할지라도, 2C3 항체 뿐만 아니라 아바스틴 또한 CD11b+/Gr1+ 침윤에 통계적으로 현저한 감소를 보여주지 않았다. 관찰된 이중 양성 세포 수의 감소는 39%이다(도 25).

골수 유래의 억제 세포 CD11b+/Gr1+의 감소된 침윤은 최근에 항-VEGF 치료에 대한 종양 불응성(tumor refractoriness)의 개입에 관련된 마커 모두를 발현하는 세포로서 특히 흥미로운 것이다(Shojaei et al., 2007). 골수 유래의 억제 세포(CD11b+Gr1+)는 또한 종양의 진행에 중요한 공헌자이다. 종양의 미세환경에서, 이 세포들은 면역억제성 매개물질(immunosuppressive mediators)을 분비하고, T-임파구(T lymphocyte)의 기능장애를 유도한다(Gabrilovich et al ., 2001; Serafini et al ., 2004).

CD11b+/Gr1+ 세포는 항-VEGF 치료에 대한 종양 불응성과 관련되어 있으며 종양의 진행에 기여하기 때문에, 종양 내에서 이 세포들의 침윤을 감소시키기 위한 본 발명의 항체의 효과는 본 발명의 항체의 치료학적 적용, 특히 암을 포함하는 신생혈관성 질병의 치료에 관련된 치료학적 적용에 잠재적인 중요성을 가진다.

실제로, 본원에서의 결과는 CD11b+/Gr1+ 세포의 종양 침윤이 본 발명의 항체로 처리된 동물에서 적어도 우세하게/현저하게 낮음을 보여주므로, 본 발명의 항체를 이용한 치료는 VEGF를 표적으로 하는 다른 약물, 예를 들어 다른 항-VEGF 항체를 사용한 치료보다 항-VEGF 치료에 대한 약물 내성 또는 불응성이 덜 발생하는 경향이 있다는 것을 암시한다. 게다가, 종양의 진행에서 CD11b+/Gr1+ 세포의 제안된 역할이 주어지면, 종양 내에서 이와 같은 세포의 침윤 또는 구축을 감소시키기 위한 본 발명의 항체의 능력은 항종양 활성에 연관된, 예를 들어 본 발명의 항체에 의해 보여지는 종양 성장의 억제 메카니즘의 일부분을 잘 형성할 것이다.

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 또한 생체 내 마우스 모델에 임상학적으로 투여될 때 독성을 유도하지 않음을 보여준다.

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 바람직하게는 마우스의 VEGF 및 인간의 VEGF에 결합하는 유리한 특성을 가진다. 마우스의 VEGF에 결합하는 능력은 항체 2C3 및 아바스틴을 뛰어넘는 중요한 이점이다.

게다가, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체에 기초한 항체 접합체는 종양 환경으로 치료제를 운반하는 데 사용될 수 있는 데 반하여, 다른 항-VEGF 항체들은 사용될 수 없다. 본 발명의 인간 항체는 생체 내로 투여되어 종양의 맥관구조 및 종양의 기질 모두에 결합하지만, 정상 기관 또는 조직에서의 맥관구조 또는 연결 조직에 결합하지는 않는다. 따라서, 본 발명의 인간 항체에 기초한 치료학적 구조물은 하나의 분자 내에 두개의 기능을 조합한 이점을 가진다: 항체 또는 그것의 단편의 항신생혈관성 특성 및 부착을 위하여 선택된 치료제의 특성. 요약하면, 본 발명의 인간 항체는 항신생혈관성 약제 및 혈관 표적 약제로서 모두 사용될 수 있는 반면에, 종래의 많은 항-VEGF 항체들은 혈관을 표적화 능력을 가지는 것으로 사용될 수 없다.

VEGFR2는 내피 상의 주요 수용체이기 때문에, VEGFR2에 결합하는 VEGF를 차단하는 것은 항신생혈관성 효과에 매우 중요하다. 비록 VEGFR1이 내피 상에서 발현되지만, 그것은 문맥상에서 비신호전달(non-signal transducing)적이거나 수동적이다. 따라서, VEGFR1에 결합하는 VEGF를 차단하기 위한 본 발명의 인간 항체의 불능(inability)은 항신생혈관성 약제 및 항종양 약제로서의 그것들의 유효성을 부여하지 않는다. 사실, 종래의 차단 항체를 사용하여 발생하는 VEGFR1에 결합하는 VEGF의 억제보다는, VEGF에 결합하며 아직은 VEGF-VEGFR1의 상호작용을 실질적으로 파괴하지 않기 위한 본 발명의 인간 항체의 능력은 이 새로운 항체의 약물 운반 특성을 강화한다.

본 발명자들은 차단성 항체들이 수용체에 결합되지 않은 종양에 위치한 VEGF에 결합함으로써 종양의 환경으로 치료제를 운반하기 위하여 작용할 것으로 여전히 기대될 것임을 깨달았다. 특별하게는, 이와 같은 인간 항체들은 종양 기질에서 VEGF에 결합하고, 그곳으로 치료제를 운반할 것임을 이해할 수 있다. 이것은 혈관 내피 세포에서 세포 독성 또는 다른 파괴 효과를 야기하고 항종양 효과를 발휘하는, 내피 주변의 약물 공급원(reservoir)을 제공한다.

기질 또는 연결 조직과 관련된 VEGF는 표준 감각기관(classic sense), 즉 세포 표면 수용체에서 VEGF 수용체에 결합하지 않는다. 오히려, VEGF는 VEGF의 염기성 영역을 통하여 헤파란 설페이트 프로테오글리칸(heparan sulfate proteoglycan)과 같은 프로테오글리칸(proteoglycan)을 포함하는 하나 또는 그 이상의 연결 조직 성분에 결합한다. 이 서열들(및 그것들을 암호화하는 엑손들)은 VEGF121 단백질(및 근원적인 DNA)에 없으므로, 이 아형은 현저한 양으로 기질에 존재해서는 안된다. 종양 기질에서 VEGF는 비록 종양 내에 여전히 위치하고 있지만 종종 "유리되어 있는(free)"것으로 불리므로, "유리되어 있는"은 본질적으로 수용체에 결합되어 있지 않음(non-receptor-bound)을 의미한다.

본 발명자들은 두개의 수용체가 아닌 하나에만 결합하는 VEGF를 차단하는 인간 항체가 여전히 맥관구조에서 VEGF가 결합된 수용체에 결합함으로써 여전히 종양의 환경으로 치료제를 운반할 수 있을 것이라는 것을 더 추론하였다. 이것은 본 발명의 유리한 특징 중 하나이다. 즉, 인간 항체의 공급은 VEGFR2에 결합하는 VEGF를 차단하므로 VEGF로부터의 신생혈관성 신호를 억제하지만, VEGFR1에 결합하는 VEGF는 차단하지 않는다. 다른 세포 타입 및 조직에서 VEGFR1을 통한 VEGF 신호전달을 유지함으로써 전신적(systemic) 부작용을 감소시킬 뿐만 아니라, 이 인간 항체들은 종양의 맥관구조에 VEGF-VEGFR1 복합체를 위치시킬 수 있으며 그곳으로 치료제를 직접적으로 운반할 수 있다.

VEGFR1 및 VEGFR2 모두 정상 조직에서의 내피 세포와는 대조적으로, 종양의 내피 세포에서 상승조절된다. VEGFR1은 본 발명의 표적 양상을 더욱 효과적으로 만들어주는 종양의 혈관 내피에서 높게 발현된다. 사실, 비록 내피에서는 "논시그널링(non-signaling)"이지만, VEGFR1은 더욱 높은 수준은 아닐지라도 적어도 VEGFR2와 동일한 수준으로 발현된다. 이 현상의 기초를 이루는 인자는 저산소증(hypoxia) 및 VEGF 모두에 반응하여 상승조절된 VEGFR1인 반면에, VEGFR2는 단지 VEGR에만 반응하여 상승조절되며 저산소증에는 영향을 받지 않는다.

비록 내피에서 VEGFR1의 역할은 명확하지 않은 채로 남아있으나, VEGFR1은 "포획(capture)" VEGF에 대한 디코이 수용체(decoy receptor)로서 작용할 수 있고, 신호전달 수용체인 VEGFR2 상의 리간드를 통과한다. 이것이 사실이라면, 디코이 수용체가 신호전달 수용체보다 VEGF에 대하여 더욱 높은 친화력을 가지는 것이 실제 상황임을 예상할 수 있다. 이를 고려하고 아마도 또한 강화된 발현 레벨 때문에, 본 발명의 VEGFR2-차단성의 비-VEGFR1 차단성 인간 항체는 종양 치료를 위한 이상적인 운반 약제이다. 이러한 항체들의 치료학적 접합체는 동시에 VEGFR2를 통한 신생혈관형성을 억제하고, VEGF-VEGFR1 수용체 복합체로 치료제를 운반함으로써 존재하는 맥관구조를 파괴할 수 있다.

본 발명자들은 결코 본 발명의 인간 항체의 유익한 항신생혈관 및 종양배치(tumor-localizing) 특성에 대한 설명으로서 앞서 언급한 과학적 이유들을 제한하지 않는다. 비록 본 발명의 유용성이 자명하며 실행되어야 할 이론에 기초할 필요가 없을지라도, 본 발명자들은 VEGFR2-차단성의 비-VEGFR1-차단성 인간 항체들이 종양의 맥관구조에 효과적이고 특이적으로 위치되는 대안적인 메카니즘을 고려하였다.

이와 같은 인간 항체들은 세포 표면의 다른 공지되거나 아직까지 특성화되지 않은 VEGF 결합 단백질과 관련된 VEGF에 결합할 수 있거나, 내피 세포 표면의 헤파란 설페이트 프로테오글리칸에 결합하는 VEGF와 결합할 수 있다. 항체의 국소화(localization)는 또한 비록 가능성은 적으나 VEGF 패밀리 단백질의 다른 구성원, 즉 혈관과 관련된 VEGF-B, VEGF-C, VEGF-D에 결합함으로써 강화될 수 있다.

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체의 또 다른 유익한 특성은 이 항체들이 VEGFR2를 통하여 매개되는 VEGF의 생존 신호(survival signal) 또는 "보호 효과(protective effect)"를 중성화시킨다는 것이다. 이 특성은 인간 항체 그 자체를 더욱 효과적으로 만들 뿐만 아니라, VEGF의 생존 기능에 의해 제한되는 다른 약제와 조합하여 그것들을 특히 유용하게 만들어 준다.

예를 들면, VEGF는 방사선 치료로부터 내피를 보호한다. 따라서, 본 발명의 나상 항체 및 면역접합체 모두는 방사선 치료와 조합하여 사용하는 데 이상적이다. 한층 더한 이점은 방사선 치료제에 부착된 이와 같은 인간 항체의 용도로써 제공된다. 이러한 타입의 구조물은 3가지의 이점을 가질 수 있다: (1) 항체 부분(antibody portion)을 통하여 항신생혈관 효과를 발휘하고; (2) 방사선 치료제의 운반을 통하여 종양의 맥관구조 파괴 효과를 발휘하며; (3) 방사선 치료의 효과를 중화시키는 VEGF의 국소적 생존 시그널로부터 보호한다.

유사한 상승 효과를 가지는 다른 구조물은 항-튜불린성 약물 또는 프로드러그, 항아포토시스 약제 및 다른 항신생혈관성 약제에 관련된 VEGFR2-차단성 인간 항-VEGF 항체이다. 아포토시스를 야기하는 약제 또는 약물의 작용은 VEGF에 의하여 중화된다. 따라서, 본 발명은 VEGF를 중화시킴으로써 이러한 약물의 효능을 향상시킨다. VEGF 생존 신호는 또한 이 치료를 제한하는 엔도스타틴에 대항한다. 따라서, 엔도스타틴과의 조합된 사용에 있어서, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 VEGF를 중성화하고 엔도스타틴의 항종양 효과를 증폭시킬 것이다. 상기 VEGFR2-차단성 인간 항-VEGF 항체는 또한 유사한 이점을 달성하는 콜라게나아제가 그 위치에서(in situ) 엔도스타틴을 생성할 수 있는 경우, 종양으로 콜라게나아제를 특이적으로 운반하는 데 사용될 수 있다.

이와 같이 강화되거나 상승된 모든 조합에서, 상기 인간 항체 및 다른 약제들은 개별적으로 투여될수 있거나, 제2의 약제가 특이적 운반(즉, VEGFR1에 표적화된 운반)을 위한 인간 항체에 연결될 수 있다. 엔도스타틴과의 조합에서, 화학적 접합체 또는 재조합 융합 단백질은 일반적으로 잠재적인 엔도스타틴 치료를 제한하는 엔도스타틴의 짧은 반감기를 중화시킬 것이기 때문에 바람직할 것이다. 조직 플라스미노겐 활성제(tissue plasminogen activator; tPA)와의 조합 또는 조직 플라스미노겐 활성제의 표적화된 형태 또한 사용될 수 있다.

본 발명의 인간 치료제의 또 다른 이점은 간질압(intestinal pressure)을 낮추는 능력을 포함한다. VEGF에 의해 매개되는 증가된 투과성은 간질압에 기여하기 때문에, VEGFR2를 통한 감소된 신호전달은 투과성 및 간질압 모두를 감소시킬 것이다. 이것은 맥관구조로부터 멀리 떨어진 종양 세포들을 죽일 수 있게 하기 위하여, 종양 조직 전체를 가로지르는 약물에 대한 장벽을 차례차례 감소시킬 것이다. 본 발명의 조성물은 면역성을 가지지 않거나, 면역성이 대수롭지 않거나, 낮은 면역성을 가지므로 장기 치료 또한 달성될 수 있다.

B. 항체 CDR 서열

항체와 관련하여 본원에 사용된 것으로서, 용어 "가변성(variable)"은 가변성 도메인의 어떤 부분이 항체들 사이에서의 서열에서 광범위하게 다르다는 것을 의미하며, 그것의 특정 항원에 대한 각각의 특정 항체의 결합 및 특이성에 사용된다. 그러나, 가변성은 항체의 가변성 도메인의 구석구석까지 골고루 퍼져있지 않다. 그것은 경쇄 및 중쇄 가변성 도메인 모두에서 "고변이 영역(hypervariable regions)"으로 불리는 세개의 단편에 집중되어 있다.

가변 영역의 더욱 높게 보존된 부분은 골격부(framework region; FR)라 칭한다. 천연의 중쇄 및 경쇄의 가변성 도메인은 주로 루프 연결(loop connecting)을 형성하는 세개의 고변이 영역에 의하여 연결된 β-쉬트 구성을 취하고, 어떤 경우에는 β-쉬트 구조의 일부분을 형성하는 4개의 FRs(각각 FR1, FR2, FR3 및 FR4)를 각각 포함한다.

각각의 사슬에서 고변이 영역은 항체의 항원-결합 부위의 형성에 기여하는 다른 사슬로부터의 고변이 영역과 함께 FRs에 의하여 서로 아주 근접하게 유지된다(Kabat et al., 1991, 참조로서 본원에 특별히 통합되어 있음). 불변성 도메인은 항원에 대한 항체의 결합에 직접적으로 관여하지는 않지만, 항체 의존성 세포 독성에서 항체의 관여와 같은 다양한 작동자(effector) 기능을 나타낸다.

본원에 사용된 것으로서 상기 용어 "고변이 영역"은 항원-결합에 관여하는 항체의 아미노산 잔기를 말한다. 상기 고변이 영역은 "상보성 결정 부위(complementarity determining region)" 또는 "CDR"로부터의 아미노산 잔기(즉, 경쇄 가변성 도메인에서 잔기 24-34(L1), 50-56(L2) 및 89-97(L3), 및 중쇄 가변성 도메인에서 31-35(H1), 50-56(H2) 및 95-102(H3); Kabat et al ., 1991, 참조로서 본원에 특별히 통합되어 있음) 및/또는 "고변이 루프(hypervariable loop)"로부터의 아미노산 잔기(즉, 경쇄 가변성 도메인에서 잔기 26-32(L1), 50-52(L2) 및 91-96(L3), 및 중쇄 가변성 도메인에서 26-32(H1), 53-55(H2) 및 96-101(H3))를 포함한다. "골격(framework)" 또는 "FR" 잔기는 본원에 정의된 것과 같은 고변이 영역 잔기를 제외한 그것들의 가변성 도메인 잔기이다.

r84 ScFv 단편의 VH와 VL 사슬의 DNA 및 연역된(deduced) 아미노산 서열은 SEQ ID NO:1(VH, 핵산), SEQ ID NO:2(VL, 핵산), SEQ ID NO:3(VH, 아미노산) 및 SEQ ID NO:4(VL, 아미노산)으로서 본원에 제공된다. r84 전장 IgG의 VH 및 VL 사슬의 DNA 서열은 SEQ ID NO:26(VH, 핵산) 및 SEQ ID NO:27(VL, 핵산)으로서 본원에 제공된다. 이 서열들은 항체의 중쇄 및 경쇄의 가변 영역의 CDR1-3을 포함한다.

생물학적 분자에 대한 구조 및 기능 정보의 공급과 함께 본원에 기재된 것과 같이(단락 C7), 동등한 범위 또는 심지어 더욱 향상된 분자들이 생성될 수 있다. 이것은 r84 항체로 예시된 것과 같은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체를 적용한다. 비록 항체의 항원결합 특성 및 다른 기능적 특성은 보존되어야만 할지라도, 일단 참조 항체가 제공되면 동등하고 더욱 향상된 항체를 만들 때 당업계에서 극도로 높은 등급의 기술이 필요하다. 이와 같은 기술적인 기술은 유사한, 향상되거나 그렇지 않으면 바람직한 특성을 가지는 또 다른 항체의 생산에 적용될 본원에서 제공되는 서열 및 정보를 고려할 수 있다.

동등한 항체에 대하여, 어떤 아미노산은 상호작용적 결합능(interactive binding capacity)의 상당한 손실 없이 항체의 불변성 또는 가변성 도메인 골격부에서 다른 아미노산으로 치환될 수 있다. 이와 같은 변화는 항원 부분을 암호화하는 DNA 서열에서 만들어지며, 상기 변화는 사실상 보존적인 것이 바람직하다(단락 C7, 표 1에서의 코돈 정보 및 부위 특이적 돌연변이 생성에 관한 지지 기술적 세부사항을 참조). 물론, 만들어지는 변화의 수는 제한되어 있지만, 이것은 당업자에게 잘 알려져 있을 것이다.

다른 형태의 변이체(variants)는 그것들이 생성된 모 항체와 관련하여 향상된 생물학적 특성을 가지는 항체이다. 이와 같은 변이체, 또는 제2세대 화합물은 모 항체의 하나 또는 그 이상의 치환된 고변이 영역 잔기를 포함하는 국소적 치환 변이체이다. 이와 같은 치환 변이체를 생성하기에 편리한 방법은 파지 디스플레이(phage display)를 사용하는 친화력 성숙(affinity maturation)이다.

파지 디스플레이를 사용하는 친화력 성숙에서, 몇몇의 고변이 영역 부위(예를 들어, 6-7 부위)는 각 부위에서 모든 가능한 아미노 치환을 생성하도록 변이된다. 이렇게 생성된 항체 변이체는 각 입자 내에 패키지된 M13의 유전자 III 생성물에 대한 융합과 같이 섬유형 파지(filamentous phage)에서 1가의 방식(monovalent fashion)으로 나타난다. 그 후 본원에 기재된 것과 같이 파지-디스플레이된 변이체의 생물학적 활성(예를 들어, 결합 친화력)을 선별하였다. 변경을 위한 후보 고변이 영역 부위를 확인하기 위하여, 항원 결합에 현저하게 기여하는 고변이 영역 잔기를 확인하는 데 알라닌 스캐닝 돌연변이법을 수행할 수 있다.

대안적으로 또는 덧붙여서, 항원-항체 복합체의 결정 구조는 항체와 VEGF 간의 접촉 포인트를 확인하기 위하여 묘사되고 분석된다. 이와 같은 접촉 잔기 및 이웃하는 잔기들은 치환을 위한 후보물질이다. 일단 이와 같은 변이체들이 생성되면, 변이체의 패널(panel)은 본원에 기재된 것과 같이 선별되고, 하나 또는 그 이상의 관련 검정에서 유사하지만 다르거나 심지어 더욱 우수한 특성을 가지는 항체를 더 개발하기 위하여 선별된다.

따라서, 본 발명의 또 다른 양상은 r84 중쇄 및 경쇄와 같은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체의 중쇄 및 경쇄의 CDR 영역을 암호화하는 분리되거나 정제된 DNA 절편 및 재조합 벡터, 및 이와 같은 CDR 영역을 발현하는 DNA 기술의 적용을 통한 재조합 숙주 세포의 생성 및 용도를 고려한다.

따라서, 본 발명은 전체 지노믹 DNA(genomic DNA)를 포함하지 않고, r84의 중쇄 및/또는 경쇄와 같은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체의 중쇄 및/또는 경쇄의 CDR 영역을 발현할 수 있는 인간 또는 합성 DNA 절편을 고려한다. 본원에 사용된 것으로서, 용어 "DNA 절편(DNA segment)"은 특정한 종의 전체 지노믹 DNA가 없이 분리되거나 정제된 DNA 분자를 말한다. DNA 절편 및 이와 같은 절편의 더욱 작은 단편은 상기 용어 "DNA 절편" 내에 포함되며, 예를 들어, 플라스미드, 코스미드, 파지, 바이러스 등을 포함하는 재조합 벡터 또한 포함된다.

유사하게는, r84의 중쇄 및/또는 경쇄와 같은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체의 중쇄 및/또는 경쇄의 CDR 영역을 암호화하는 코딩 절편(coding segment) 또는 분리되거나 정제된 유전자 부분을 포함하는 DNA 절편은 이와 같은 코딩 서열 및 어떤 양상에서 다른 자연적으로 발생된 유전자 또는 단백질 암호화 서열로부터 실질적으로 떨어져서 분리되거나 정제된 조절 서열을 포함하는 DNA 절편을 말한다. 이러한 점에서, 상기 용어 "유전자(gene)"는 기능 단백질(functional protein), 폴리펩티드 또는 펩티드 암호화 유닛을 간단하게 칭하기 위하여 사용된다. 당업자들에 의해 이해될 수 있는 바와 같이, 이 기능적 용어는 천연의 항체를 암호화하는 서열 및 적절한 항원 결합 단백질, 폴리펩티드 또는 펩티드를 발현하거나 발현하도록 개조될 수 있는 더욱 작게 조작된 절편을 포함한다.

"다른 코딩 서열로부터 실질적으로 떨어져서 분리되거나 정제된(isolated or purified substantially away from other coding sequences)'은 관심있는 코딩 절편 또는 분리된 유전자 부분이 DNA 절편의 코딩 영역의 중요 부분을 형성하며, 상기 DNA 절편은 거대 염색체성 단편(large chromosomal fragment) 또는 다른 기능성 유전자(functional gene) 또는 cDNA 코딩 영역(cDNA coding regions)과 같은 자연적으로 생성된 코딩 DNA의 넓은 부분을 포함하지 않음을 의미한다. 물론, 이것은 최초에 분리된 것으로서의 DNA 절편을 말하며, 후에 상기 절편에 사람의 손에 의하여 더 첨가된 유전자 또는 코딩 영역을 제외하지 않는다.

특정 구현에서, 본 발명은 SEQ ID NO:3 또는 SEQ ID NO:4의 아미노산 서열에 대하여 적어도 약 75%, 더욱 바람직하게는 적어도 약 80%, 더욱 바람직하게는 적어도 약 85%, 더욱 바람직하게는 적어도 약 90% 및 가장 바람직하게는 적어도 약 95% 정도의 아미노산 서열 동일성을 가지는 아미노산 서열 영역을 포함하는 적어도 제1의 서열 영역을 포함하는, r84의 중쇄 및/또는 경쇄와 같은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체의 중쇄 및/또는 경쇄의 CDR 영역을 암호화하는, 분리되거나 정제된 코딩 절편 또는 분리되거나 정제된 유전자 부분 및 DNA 서열을 통합하고 있는 재조합 벡터를 고려하며, 여기에서 상기 CDR 영역은 적어도 아미노산 서열 SEQ ID NO:3 또는 SEQ ID NO:4의 CDR 영역의 생물학적 특성을 실질적으로 유지한다.

본원에 기재된 바와 같이, 상기 서열들은 어떤 생물학적 기능이 동등한 아미노산 또는 "보존적 치환(conservative substitutions)"을 포함할 수 있다. 다른 서열들은 CDR 또는 CDR을 포함하는 항체의 특성을 향상시키기 위하여 당업자들에게 공지되고 본원에 더 기재되는 것과 같이 신중하게 조작된 기능적으로 동등하지 않은 아미노산 또는 "비보존적 치환(non-conservative substitutions)"을 포함할 수 있다.

아미노산 및 핵산 서열은 부가적인 N-말단 또는 C-말단 아미노산 또는 5' 또는 3' 서열과 같은 부가적인 잔기를 포함할 수 있고, 그럼에도 불구하고 여전히 서열이 상기에 언급한 기준을 충족시키는 한 본 발명의 서열과 일치하며, 바람직하게는 단백질 발현을 고려하는 경우 생물학적 단백질 활성의 유지 또는 향상을 포함한다는 것 또한 이해할 수 있을 것이다. 말단 서열의 부가는 코딩 영역 및 대조 영역의 5' 또는 3' 부분 중 어느 한쪽의 측면에 있는 다양한 논코딩(non-coding) 서열을 포함한다.

따라서, 본 발명의 핵산 절편은 그것들의 전체 길이가 매우 상당할 수 있기 때문에 프로모터, 폴리아데닐화 시그널(polyadenylation signal), 부가적인 제한 효소 부위, 다중 클로닝 부위, 다른 코딩 절편 등과 같은 다른 DNA 서열과 조합될 수 있다. 따라서, 대부분의 임의의 길이의 핵산 단편이 바람직하게는 제조 및 계획된 재조합 DNA 프로토콜에 사용하기 용이하도록 제한되는 전체 길이와 함께 사용될 수 있다고 생각된다.

따라서, 재조합 벡터는 본 발명의 다른 양상을 형성한다. 특히 유용한 벡터는 DNA 절편의 코딩 부분이 프로모터의 조절 하에 위치되어 있는 벡터가 되도록 고려된다. 일반적으로, 비록 배타적이기는 하지만, 재조합 또는 이종 기원의 프로모터, 즉 그것의 천연 환경에서의 코딩 서열과 일반적으로 관련되지 않은 프로모터가 사용될 것이다. 이와 같은 프로모터는 상기 프로모터가 발현을 위하여 선택된 세포 형태, 기관 또는 심지어는 동물에서 DNA 절편의 발현을 효과적으로 유도하는 한, 박테리아성, 바이러스성, 진핵성 및 포유동물성 프로모터를 포함할 수 있다.

단백질 발현을 위한 프로모터 및 세포 형태 조합의 용도는 분자 생물학 업계의 당업자들에게 공지되어 있다. 사용된 프로모터는 구성성(constitutive)이거나 유도성(inducible)일 수 있고, 도입된 DNA 절편의 고농도 발현을 유도하기 위하여 재조합 단백질 또는 펩티드의 대규모 생산에 유리한 것과 같은 적절한 환경 하에서 사용될 수 있다.

본 발명의 핵산 서열의 발현은 당업자들에게 공지되고 본원에 더 기재되어 있는 임의의 하나 또는 그 이상의 표준 기술에 의하여 편리하게 달성될 수 있다. 예를 들면, 융합 단백질의 재조합 발현에 대한 이후의 서술은 핵산 수준에서 다른 코딩 서열과 작동가능하게 결합되어 있지 않은 항체 및 항체 단편에도 똑같이 잘 적용된다.

B4. 파지미드 라이브러리( Phagemid Libraies )로부터의 항체

재조합 기술은 현재 다양한 항체들을 암호화하는 재조합 유전자로부터 원하는 특이성을 가지는 항체를 제조할 수 있게 한다(Van Dijk et al ., 1989; 참조로서 본원에 통합되어 있음). 어떤 재조합 기술은 면역화된 동물의 비장으로부터 분리된 RNA로부터 제조된 조합 면역글로불린 파지 발현 라이브러리(combinatorial immunoglobulin phage expression libraries)의 면역학적 선별에 의한 항체 유전자의 분리를 포함한다(Morrison et al ., 1986; Winter and Milstein, 1991; 각각 참조로서 본원에 통합되어 있음).

이와 같은 방법에 대하여, 조합 면역글로불린 파지 발현 라이브러리는 면역화된 동물의 비장으로부터 분리된 RNA로부터 제조되며, 파지미드를 발현하는 적절한 항체들은 항원 및 대조 세포를 발현하는 세포를 사용하여 패닝(panning)함으로써 선별된다. 기존의 하이브리도마 기술(hybridoma techniques)에 대한 이 접근방법의 이점은 단일 라운드(single round)에서 대략 104배 만큼의 항체가 생성되고 선별된다는 것과, 새로운 특이성이 생성되는 적절한 항체의 비율을 더 증가시키는 H 및 L 사슬 조합에 의해 생성된다는 것이다.

박테리아에서 많은 수의 레퍼토리의 다양한 항체 분자의 생성을 위한 하나의 방법은 벡터로서 박테리오파지 람다(bacteriophage lambda)를 사용한다(Huse et al., 1989; 참조로서 본원에 통합되어 있음). 람다 벡터를 사용하는 항체의 생산은 DNA 서열의 중쇄 및 경쇄 집단을 개별적인 개시 벡터(starting vector) 안으로 클로닝하는 것을 포함한다. 상기 벡터는 그 후 항체 단편을 형성하기 위한 중쇄 및 경쇄의 공통발현(co-exression)을 유도하는 단일 벡터(single vector)를 형성하기 위하여 램덤하게 조합된다. 중쇄 및 경쇄 DNA 서열은 선별된 항원을 사용하여 면역화된 동물로부터 얻은 비장 세포(또는 그것들의 하이브리도마)로부터 분리된 mRNA에서 증폭, 바람직하게는 PCRTM 또는 관련 증폭 기술에 의하여 얻어진다. 상기 중쇄 및 경쇄 서열은 전형적으로 개시 벡터 내로의 중쇄 및 경쇄 절편의 클로닝을 용이하게 하기 위하여 증폭된 DNA 절편의 말단으로 제한 부위를 통합시키는 프라이머를 사용하여 증폭된다.

많은 라이브러리의 전체적 또는 부분적으로 합성된 항체 결합 부위(combining site) 또는 파라토프(partopes)의 생성 및 선별을 위한 다른 방법은 M13, fl 또는 fd와 같은 섬유성 파지로부터 유래된 디스플레이 벡터(display vector)를 사용한다. "파지미드(phagemids)"로서 불리는 이 섬유성 파지 디스플레이 벡터들은 다양하고 신규한 면역특이성을 가지는 많은 라이브러리의 단일클론 항체를 생산한다. 상기 기술은 섬유성 파지 복제의 어셈블리 단계 동안 유전자-산물(gene-product)과 유전자를 연결시키기 위한 수단으로서 섬유성 파지가 코팅된 단백질 막 연결 도메인을 사용하며, 결합 라이브러리로부터 항체를 클로닝하고 발현시키기 위하여 사용된다(Kang et al ., 1991; Barbas et al., 1991; 각각 참조로서 본원에 통합되어 있음).

섬유성 파지 디스플레이를 위한 이 일반적인 기술은 참조로서 본원에 통합되어 있는 미국 등록특허번호 제5,658,727호에 기재되어 있다. 가장 일반적인 의미로, 상기 방법은 단일 벡터 시스템을 사용하는 항체 유전자 레퍼토리로부터 미리 선별된 리간드 결합 특이성을 동시에 클로닝하고 선별하기 위한 시스템을 제공한다. 미리 선별된 리간드-결합능을 위한 라이브러리의 분리된 구성원의 선별은 라이브러리로부터의 구성원을 암호화하는 유전자를 분리하기 위한 편리한 수단을 사용하여 발현된 항체 분자의 결합능의 상호작용을 가능하게 한다.

발현과 선별의 연계는 기능성 항체의 어셈블리를 가능하게 하는 박테리아 세포의 주변 세포질(periplasm) 내로의 융합 폴리펩티드의 표적화 및 관심 라이브러리 구성원의 편리한 선별이 가능하도록 하는 파지 어셈블리 동안 섬유성 파지 입자의 코팅 상에서의 융합 폴리펩티드의 표적화의 조합에 의해 달성된다. 주변 세포질성 표적화는 융합 단백질에서 분비 시그널 도메인(secretion signal domain)의 존재에 의해여 제공된다. 파지 입자에 대한 표적화는 융합 폴리펩티드에서 섬유성 파지가 코팅된 단백질 막 연결 도메인의 존재에 의하여 제공된다(즉, cpIII-유래 또는 cpVIII-유래의 막 연결 도메인).

다양한 섬유성 파지에 기초한 결합 항체 라이브러리는 라이브러리의 클론된 중쇄 유전자의 하나 또는 그 이상의 상보성 결정 영역을 변경하거나, 실수 유발 PCR에 의하여 라이브러리 내로 랜덤 돌연변이를 도입함으로써 중쇄 및 경쇄 유전자의 셔플링에 의하여 증가될 수 있다. 파지미드 라이브러리를 선별하기 위한 부가적인 방법은 각각 참조로서 본원에 통합되어 있는 미국 등록특허번호 제5,580,717호, 제5,427,908호; 제5,403,484호 및 제5,223,409에 기재되어 있다.

많은 결합 항체 라이브러리의 선별을 위한 다른 방법은 M13, fl 또는 fd와 같은 섬유성 박테리오파지의 표면 상에서의 다양한 중쇄 및 경쇄 서열 집단의 발현을 사용하여 개발되었다(U.S. Patent No. 5,698,426; 참조로서 본원에 통합되어 있음). 다양한 중쇄(Hc) 및 경쇄(Lc) 서열 중 두개의 집단이 중합효소 연쇄반응(PCRTM)에 의하여 합성되었다. 이 집단들은 발현에 필수적인 요소를 포함하는 개별적인 M13에 기초한 벡터 내로 클론되었다. 상기 중쇄 벡터는 중쇄 서열의 번역이 gVIII-Hc 융합 단백질을 생산하도록 하기 위하여 유던자 VIII(gVIII) 코팅 단백질 서열을 포함한다. 두 벡터의 집단은 단지 Hc 및 Lc 서열을 포함하는 벡터 부분만이 단일 원형 벡터 내로 접합되도록 하기 위하여 랜덤하게 조합된다.

상기 조합된 벡터는 M13 상에서 두개의 폴리펩티드의 어셈블리를 위한 Hc 및 Lc 서열 모두의 공통 발현 및 표면 발현을 유도한다(U.S. Patent No. 5,698,426; 참조로서 본원에 통합되어 있음). 상기 조합 단계는 두개의 다른 집단 내에서 서로 다른 Hc 및 Lc 암호화 서열을 단일 벡터 내로 랜덤하게 합친다. 각각의 독립적인 벡터로부터 제공된 벡터 서열은 실용적인 파지의 생산에 필수적이다. 게다가, 슈도(pseudo) gVIII 서열은 두개의 개시 벡터 중 하나에만 포함되기 때문에, 벡터 서열이 단일 벡터에 연결될 때까지 파지 표면상에서 Lc에 결합된 gVIII-Hc 융합 단백질과 같은 기능성 항체 단편의 공통발현은 달성될 수 없다.

항체 라이브러리의 표면 발현은 암버 서프레서 균주(amber suppressor strains)에서 수행된다. Hc 서열과 gVIII 서열 사이의 암버 스탑 코돈(amber stop codon)은 비-서프레서(non-suppressor) 균주에서 두개의 성분과 연결되지 않는다. 비-서프레서 균주로부터 생성된 파지를 분리하고 서프레서 균주를 감염시키는 것은 발현 동안에 Hc 서열을 gVIII 서열에 연결시킬 것이다. 감염 후 서프레서 균주를 배양하는 것은 gVIII 융합 단백질(gVIII-Fab 융합 단백질)로서 라이브러리 내에 모든 항체 종류의 M13의 표면 상에서 공통발현을 가능하게 한다. 대안적으로, 상기 DNA는 비-서프레서 균주로부터 분리될 수 있고, 그 후 동일한 효과를 달성하기 위하여 서프레서 균주 안으로 도입될 수 있다.

표면 발현 라이브러리는 표준 친화성 분리 방법에 의하여 미리 선별된 분자에 결합하는 특정 Fab 단편을 위하여 선별된다. 이와 같은 방법은 예를 들어, 패닝(Parmely and Smith, 1988; 참조에 의하여 본원에 통합되어 있음), 친화성 크로마토그래피 및 고체상 블롯팅(solid phase blotting) 방법을 포함한다. 패닝은 높은 역가(titer)의 파지가 쉽고, 빠르게 적은 양으로도 선별될 수 있기 때문에 바람직하다. 게다가, 이 방법은 집단 내에서의 마이너한, 만약 그렇지 않다면 검출가능하지 않고 실질적으로 동일한 집단에 대하여 증폭된, Fab 단편 종류들을 선별할 수 있다. 선별된 Fab 단편들은 파지 집단의 증폭 후 폴리펩티드를 암호화하는 핵산을 서열화함으로써 특성화할 수 있다.

항체의 다양한 라이브러리를 생산하고 바람직한 결합 특성을 선별하기 위한 다른 방법은 각각 참조로서 본원에 통합되어 있는 미국 특허등록번호 제5,677,988호 및 제5,759,817호에 기재되어 있다. 상기 방법은 축퇴성 올리고뉴클레오티드(degenerate oligonucleotide)를 사용하는 파지미드 라이브러리의 형태로 이종이량체성(heterodimeric) 면역글로불린 분자 라이브러리의 제조, 및 면역글로불린의 가변성 중쇄 및 경쇄 가변성 도메인의 CDR 영역 내로 축퇴(degeneracy)를 통합시키기 위한 프라이머 확장 반응(primer extension reaction) 및 파지미드 표면 상에서 돌연변이를 일으킨 폴리펩티드의 디스플레이를 포함한다. 그 후에, 상기 디스플레이 단백질은 미리 선별된 항원에 결합하는 능력에 대하여 선별된다.

이종이량체성 면역글로불린 분자를 생산하기 위한 방법은 일반적으로 (1) 파지미드 디스플레이 벡터 내로 관심있는 중쇄 또는 경쇄 V 영역-코딩 유전자를 도입하고; (2) 항체 V 영역 유전자의 CDR에 대한 상동성 영역을 포함하고, 파지미드 표면 디스플레이 단백질 상에 나타난 서로 다른 추정(putative) 결합 부위를 각각 발현할 수 있는 많은 집단의 디스플레이 벡터를 형성하기 위하여 랜덤화된 코딩 서열을 생산하기 위한 축퇴 영역을 포함하는 올리고뉴클레오티드를 사용하여 프라이머 확장에 의하여 파지미드 디스플레이 단백질 벡터 내로 랜덤화된 결합 부위를 도입하고; (3) 섬유성 파지 입자의 표면상에 디스플레이 단백질 및 결합 부위를 발현시키고; (4) 미리 선별된 항원에 대한 파지 입자의 패닝과 같은 친화성 기술을 사용하여 표면에 발현된 파지 입자를 분리(선별)하여 미리 선별된 항원에 결합하는 결합 부위를 포함하는 디스플레이 단백질을 포함하는 하나 또는 그 이상의 종류의 파지미드를 분리하는 것을 포함한다.

다양한 라이브러리의 항체를 생산하고 바람직한 결합 특이성을 위하여 선별하기 위한 이 방법의 또 다른 형태는 참조로서 본원에 통합되어 있는 미국 특허등록번호 제5,702,892호에 기재되어 있다. 이 방법에서, 단지 중쇄 서열만이 사용되며, 상기 중쇄 서열은 CDRI 또는 CDRIII 고변이 영역 중 하나를 암호화하는 모든 뉴클레오티드 위치에서 랜덤화될 수 있고, CDRs에서의 유전적 가변성은 임의의 생물학적 과정과는 관계없이 생성된다.

상기 방법에서, 두개의 라이브러리는 중쇄 유전자 구조의 골격 내에서 올리고뉴클레오티드 모티프(motifs)를 유전적으로 셔플하기 위하여 조작된다. CDRI 또는 CDRIII 중 하나의 랜덤 돌연변이를 통하여, 중쇄 유전자의 고변이 영역은 매우 다양한 서열의 수집물을 위하여 재구성된다. 돌연변이된 유전자 서열의 수집물에 의하여 암호화된 중쇄 단백질은 면역글로불린의 모든 결합 특성을 가지기 위한 가능성을 가지지만, 두개의 면역글로불린 사슬 중 하나만을 필요로 한다.

특별하게는, 상기 방법은 면역글로불린 경쇄 단백질의 부재하에서 실행된다. 변경된 중쇄 단백질을 표시하는 파지의 라이브러리는 고정화된 리간드와 특이적으로 결합하는 재조합 단백질을 암호화하는 클론을 선별하기 위하여 고정화된 리간드와 함께 배양된다. 결합된 파지는 그 후 고정화된 리간드로부터 해리되고, 박테리아 숙주 세포에서 성장에 의하여 증폭된다. 각각 서로 다른 재조합 단백질을 발현하는 개개의 바이러스성 플라크(plaques)가 확장되고, 개개의 클론들은 그 후 결합 활성을 위하여 검정될 수 있다.

B5. 인간 항체 라이브러리를 포함하는 형질전환 마우스

재조합 기술은 현재 항체의 제조를 위하여 사용할 수 있다. 상기에 기재된 결합 면역글로불린 파지 발현 라이브러리 뿐만 아니라, 다른 분자 클로닝 접근법 또한 인간 항체 라이브러리를 포함하는 형질전환 마우스로부터 항체를 제조하기 위한 것이다. 이와 같은 기술들은 참조로서 본원에 통합되어 있는 미국 특허등록번호 제5,545,807호에 기재되어 있다.

가장 일반적인 의미에서, 이 방법들은 인간 기원의 면역글로불린의 적어도 일부분을 암호화하거나 면역글로불린의 레퍼토리를 암호화하기 위하여 재배열될 수 있는 배선 유전 물질(germline genetic material)을 삽입한 형질전환 동물의 생산을 포함한다. 삽입된 유전 물질은 인간원(human source)으로부터 생성될 수 있거나 합성적으로 생성될 수 있다. 상기 물질은 공지의 면역글로불린의 적어도 일부분을 코딩할 수 있거나, 변경된 면역글로불린의 적어도 일부분을 코딩하도록 변경될 수 있다.

상기 삽입된 유전 물질은 형질전환 동물에서 발현되어 삽입된 인간의 면역글로불린 유전 물질로부터 적어도 부분적으로 유래된 면역글로불린을 생산한다. 유전 물질은 상기 삽입된 유전 물질이 잘못된 위치에서 또는 잘못된 기하학적 배열(geometry)로 배선에 통합된다 할지라도, 삽입된 유전 물질로부터 유래된 부분 또는 부분들을 사용하여 면역글로불린의 레퍼토리를 생산할 수 있다.

상기 삽입된 유전 물질은 플라스미드 및/또는 코스미드와 같은 원핵성 벡터 내로 클론된 DNA의 형태일 수 있다. 더욱 큰 DNA 단편들은 효모의 인공 염색체 벡터(artificial chromosome vectors)를 사용하거나(Burke et al., 1987; 참조로서 본원에 통합되어 있음) 염색체 단편의 도입(Richer and Lo, 1989; 참조로서 본원에 통합되어 있음)에 의하여 삽입된다. 상기 삽입된 유전 물질은 기존의 방법, 예를 들어 수정란(fertilized eggs) 또는 배아줄기세포 내로 주입 또는 다른 방법에 의해 숙주로 도입될 수 있다.

바람직한 양상에서, 만들어진 형질전환 동물은 면역글로불린을 생산할 때 삽입된 인간 유전 물질만을 사용하도록 하기 위하여, 처음에 면역글로불린 불면 영역을 암호화하는 유전 물질을 가지지 않는 숙주 동물이 사용된다. 이것은 관련 유전 물질이 결여되어 있는 자연적으로 발생한 돌연변이 숙주를 사용하거나, 예를 들어 궁극적으로 관련 유전 물질이 제거된 숙주를 만들기 위하여 세포주에서 돌연변이를 인공적으로 만듦으로써 달성될 수 있다.

상기 숙주 동물이 면역글로불린 불변 영역을 암호화하는 유전 물질을 가지는 경우, 상기 형질전환 동물은 자연적으로 발생한 유전 물질 및 삽입된 유전 물질을 가질 것이며, 자연적으로 발생한 유전 물질, 삽입된 유전 물질 및 두가지 형태의 유전 물질의 혼합물로부터 유래된 면역글로불린을 생산할 것이다. 이 경우에 있어서, 바람직한 면역글로불린은 예를 들어, 항체 유전자 발현의 대립 유전자 제외(allelic exclusion) 현상 또는 특이적인 염색체 손실(differential chromosome loss)을 활용함으로써 형질전환 동물로부터 유래된 하이브리도마를 선별하여 얻을 수 있다.

일단 적합한 형질전환 동물이 만들어지면, 상기 동물을 원하는 면역원(immunogen)을 사용하여 간단하게 면역화시킨다. 삽입된 물질의 특성에 따라, 상기 동물은 예를 들어, 외래 기원의 유전 물질이 면역글로불린의 일부분만을 암호화하는 경우에 혼합된 마우스/인간 기원의 키메라 면역글로불린을 생산할 수 있고, 또는 상기 동물은 외래 기원의 유전 물질이 전체의 면역글로불린을 암호화하는 경우 완전한 인간 기원의 완전한 외래 면역글로불린을 생산할 수 있다.

대안적인 접근법에서, 상기 유전 물질은 원하는 항체가 우유, 초유(colostrum) 또는 침(saliva)와 같은 동물의 혈청 또는 외부 분비물(external secretion)과 같은 체액에서 생산되도록 하는 그러한 방법으로 동물에 통합될 수 있다. 예를 들면, 우유 단백질을 코딩하는 포유동물의 유전자 내로 인간 면역글로불린의 적어도 일부분을 암호화하는 유전 물질을 생체 내로 삽입하고, 그 후 예를 들어 주입에 의하여 포유동물의 수정란에 유전자를 도입함으로써, 상기 달걀은 삽입된 인간 면역글로불린 유전 물질로부터 적어도 부분적으로 유래된 면역글로불린을 포함하는 우유를 생산하는 성숙한 암컷 포유동물로 발달할 수 있다. 상기 원하는 항체는 그 후 우유로부터 얻을 수 있다. 이와 같은 공정들을 수행하는 데 적합한 기술들은 당업자들에게 공지되어 있다.

앞서 언급한 형질전환 동물은 단일 이성체, 더욱 특별하게는 IgM 및 될 수 있는 한 IgD와 같은 B 세포 성숙에 필수적인 이성체의 인간 항체를 생산하는 데 주로 사용된다. 인간 항-VEGF 항체를 생산하기 위한 다른 바람직한 방법은 각각 참조로서 본원에 통합되어 있는 미국 특허등록번호 제5,545,806호, 제5,569,825호, 제5,625,126호, 제5,633,425호, 제5,661,016호 및 제5,770,429호에 기재되어 있는 기술을 사용하는 것이며, 여기에서 형질전환 동물은 B 세포 발달에 필요한 이성체에서 다른 이성체로 전환될 수 있다고 기재되어 있다.

B 림프구의 발달에서, 세포는 생산적으로 재배열된 VH 및 VL 영역에 의하여 결정된 결합 특이성을 가지는 IgM을 처음으로 생산한다. 그 후에, 각각의 B 세포 및 그것의 자손 세포들(progeny cell)은 동일한 L 및 H 사슬 V 영역을 가지는 항체를 합성하지만, 그것들은 H 사슬의 이성체를 전환할 수 있다. 뮤(mu) 또는 델타(delta) 불변 영역의 용도는 주로 단일 세포에서 공통발현되는 IgM 및 IgD를 교대절단(alternate splicing), 허가(permitting)함으로써 결정된다. 다른 중쇄 이성체(감마, 알파 및 엡실론)은 단지 C 뮤 및 C 델타를 삭제하는 유전자 재배열 사건 후에만 자연적으로 발현된다. 이성체 스위칭(isotype switching)이라 불리는 이 유전자 재배열 과정은 전형적으로 (델타를 제외한) 각각의 중쇄 유전자의 상류(upstream)에 인접하여 위치되어 있는 소위 스위치 절편(switch segments) 사이에서 재조합에 의해 발생한다. 개개의 스위치 절편은 2 및 10kb 사이의 길이이고, 주로 짧은 반복 서열로 구성된다.

이러한 이유들로, 이식 유전자(transgenes)들은 이성체 스위칭에 사용될 각각의 스위치 영역(switch region)의 약 1-2kb의 상류(upstream) 안에 전사 조절 서열(transcriptional regulatory sequence)을 포함하는 것이 바람직하다. 이 전사 조절 서열들은 바람직하게는 프로모터 및 인핸서 요소(enhancer element)를 포함하며, 더욱 바람직하게는 스위치 영역과 자연스럽게 결합된(즉, 배선 구성(germline configuration)에서 발생한) 5' 플랭킹(즉, 상류) 영역을 포함한다. 비록 하나의 스위치 영역으로부터의 5' 플랭킹 서열이 이식 유전자 구조를 위하여 다른 스위치 영역과 작동가능하게 연결될 수 있다 할지라도, 어떤 구현에서 이식 유전자 구조에 통합되어 있는 각각의 스위치 영역은 자연적으로 발생한 배선 구성에서 상류에 인접하여 발생하는 5' 플랭킹 영역을 가지는 것이 바람직하다. 면역글로불린 스위치 영역 서열에 관련된 서열 정보는 공지되어 있다(Mills et al ., 1990; Sideras et al., 1989; 각각 참조로서 본원에 통합되어 있음).

미국 특허등록번호 제5,545,806호; 제5,569,806호; 제5,625,126호; 제5,633,425호; 제5,661,016호 및 제5,770,429호에 기재된 방법에서, 형질전환 동물의 기능 내에 포함된 인간 면역글로불린 이식 유전자는 이성체 스위칭을 야기하는 B-세포 발달의 경로에 정확하게 걸쳐져 있다. 따라서, 이 방법에서 이 이식 유전자들은 이성체 스위칭 및 하나 또는 그 이상의 하기의 것들을 생성하기 위하여 구성된다: (1) 고농도 및 세포 형태 특이적 발현, (2) 기능적 유전자 재배열, (3) 대립 유전자 배제(allelic exclusion)의 활성화 및 대립 유전자 배제에 대한 반응, (4) 충분한 초기 레퍼토리의 발현, (5) 신호 전달, (6) 체세포성 초돌연변이(somatic hypermutation) 및 (7) 면역 반응 동안 이식 유전자 항체 유전자좌(locus)의 우세(domination).

이식 유전자 기능에 중요한 요건은 다양한 항원에 대하여 제2차 면역 반응을 일으키는 데 충분할 만큼 다양한 초기 항체 레퍼토리의 생성이다. 재배열된 중쇄 유전자는 시그널 펩티드 엑손, 가변 영역 엑손 및 다중-도메인 불변 영역의 탠덤 어레이(tandem array) 영역으로 구성되며, 그것들 각각은 몇몇의 엑손에 의해 암호화된다. 각각의 상기 불명 영역 유전자는 서로 다른 종류의 면역글로불린의 불변 부분을 암호화한다. B-세포 발달 동안에, V 영역에 인접하는 불변 영역은 결실되어 새로운 중쇄 종류의 발현을 야기한다. 각각의 중쇄 종류에 대하여, RNA 스플라이싱(RNA splicing)의 다른 패턴은 막통과(transmembrane) 및 분비된 면역글로불린 모두를 야기한다.

인간 중쇄 유전자좌는 2Mb를 신장(spanning)하는 대략 200V의 유전자 절편, 약 40kb를 신장하는 대략 30D의 유전자 절편, 3kb 길이(span) 내에 무리지어 있는 여섯개의 J 절편, 및 대략 300kb에 걸쳐 퍼져있는 9개의 불변 영역 유전자로 구성된다. 전체 유전자좌의 길이는 대략 2.5Mb의 체세포 14의 장완(long arm)의 말초부분(distal portion)이다. 중쇄 이식 유전자 단편은 모두 여섯개의 공지된 VH 패밀리 구성원, D 및 J 절편을 포함하며, 게다가 뮤, 델타, 감마 3, 감마 1 및 알파 1 불변 영역 또한 공지되어 있다(Berman et al ., 1988; 참조로서 본원에 통합되어 있음). 인간 경쇄 유전자좌로부터의 모든 필수 유전자 절편 및 조절 서열을 포함하는 유전자 절편은 유사하게 구성되어 있다.

성공적으로 재배열된 면역글로불린 중쇄 및 경쇄 이식 유전자의 발현은 주로 형질전환 비인간 동물에서 내생적 면역글로불린 유전자의 재배열을 억제하기 위한 우성 효과(dominant effect)를 가진다. 그러나, 어떤 구현에서, 인간의 가변 영역 및 비인간(예를 들어, 마우스 유래의) 불변 영역을 포함하는 하이브리드 면역글로불린 사슬이 형성될 수 없도록, 예를 들어 이식 유전자와 내생적 Ig 서열간의 트랜스-스위칭(trans-switching)에 의하여 내생적 Ig 유전자좌들의 완전한 불활성화를 달성하는 것이 바람직하다. 배아 줄기 세포 기술 및 상동 재조합을 사용하여, 재생적 면역글로불린 레퍼토리는 쉽게 제거될 수 있다. 게다가, 내생적 Ig 유전자의 억제는 역배열(antisense) 기술과 같은 다양한 기술을 사용하여 달성될 수 있다.

본 발명의 다른 양상에서, 트랜스-스위치된 면역글로불린을 생산하는 것이 바람직하다. 이와 같은 키메라 트랜스-스위치된 면역글로불린을 포함하는 항체들은 다양한 적용을 위하여 사용될 수 있으며, 예를 들어 숙주에서의 효과 기능의 유지를 위한 비인간(예를 들어, 마우스 유래의) 불변 영역을 가지는 것이 바람직하다. 마우스 유래의 불변 영역의 존재는 이와 같은 키메라 항체가 마우스의 질병 모델에서 테스트될 수 있기 때문에 인간 불변 영역 이상의 이점, 예를 들어, 마우스의 효과 기능(예를 들어, ADCC, 마우스 보체 고정(complement fixation)을 제공하기 위한 이점을 제공할 수 있다. 동물 실험 다음에, 서열을 암호화하는 인간의 가변 영역이 소스(하이브리도마 클론)로부터의 PCRTM 증폭 또는 cDNA 클로닝에 의해 분리되고, 인간의 치료용으로 더욱 적합한 인간 서열 항체를 암호화하기에 바람직한 인간 불변 영역을 암호화하는 서열을 접합할 수 있다.

B6. PCR TM 에 의한 돌변연이 유발

부위 특이적 돌연변이 유발(site-specific mutagenesis)는 잠재적인(underlying) DNA의 특이적 돌연변이 유발을 통한 개개의 항체의 제조에 유용한 기술이다. 상기 기술은 인간화되어 있는가의 여부와는 관계없이 하나 또는 그 이상의 뉴클레오티드 서열을 도입하여 DNA를 변화시킴으로써, 하나 또는 그 이상의 앞서 말한 고려사항들을 포함하는 서열 변이체를 제조하고 테스트하기 위한 신속한 능력을 더 제공한다.

비록 많은 방법들이 돌연변이 유발에 적합하다 할지라도, 중합 효소 연쇄반응(polymerase chain reaction; PCRTM)이 현재 일반적으로 바람직하다. 이 기술은 주어진 DNA 서열 내로 원하는 돌연변이를 도입하기 위한 빠르고 효과적인 방법을 제공한다. 하기의 본문은 특히 주어진 서열에 의해 암호화된 아미노산을 변경하기 위하여 사용되는 것과 같이 서열 내로 점 돌연변이(point mutations)를 도입하기 위한 PCRTM의 용도를 기술한다. 이 방법의 개작(adaptation) 또한 DNA 분자 내로 제한 효소 부위를 도입하는 데 적합하다.

이 방법에서, 합성 올리고뉴클레오티드는 증폭된 절편의 한쪽 말단에 점 돌연변이를 포함하도록 설계된다. PCRTM 후에, 증폭된 단편들은 크레나우 단편(Klenow fragments)으로 처리하여 평활 말단화되고(blunt-ended), 상기 평활 말단화된 단편들은 그 후 서열 분석을 용이하게 하기 위하여 연결되어 벡터 안으로 서브클론된다.

돌연변이를 일으키기에 바람직한 주형 DNA를 제조하기 위하여, 상기 DNA는 돌연변이될 영역을 플랭킹하는 제한 부위를 사용하는 pUC19와 같은 고복제수(high copy number) 벡터 안으로 서브클론된다. 주형 DNA는 그 후 플라스미드 미니프렙을 사용하여 제조된다. 모 서열을 기초로 하지만 원하는 점 돌연변이를 포함하며 제한 효소 부위에 의해 5' 말단에서 플랭크된 적절한 올리고뉴클레오티드 프라이머는 자동화 합성기(automated synthesizer)를 사용하여 합성된다. 상기 프라이머는 일반적으로 약 15 염기 정도로 주형 DNA에 대하여 일치할 필요가 있다. 프라이머는 비록 PCRTM 에서 사용하는 데 절대적으로 필요하지는 않지만, 변성 폴리아크릴아마이드 겔 전기영동(denaturing polyacrylamide gel electrophoresis)에 의하여 정제될 수 있다. 그 후, 올리고뉴클레오티드의 5' 말단은 인산화되어야만 한다.

상기 주형 DNA는 원하는 점 돌연변이를 포함하는 올리고뉴클레오티드를 사용하여 PCRTM 에 의하여 증폭되어야만 한다. 증폭 버퍼에서 MgCl2의 농도는 일반적으로 약 15mM이 될 것이다. 일반적으로 약 20-25 주기의 PCRTM 이 하기와 같이 수행되어야만 한다: 95℃에서 변성(denaturation), 35초; 50℃에서 혼성화(hybridization) 2분; 및 72℃에서 연장(extension) 2분. PCRTM 은 일반적으로 72℃에서 약 10분의 마지막 주기 연장을 포함할 것이다. 최후의 연장 단계 후, 약 5 유닛의 클레나우 단편이 반응 혼합물에 첨가되고 약 30℃에서 15분간 더 배양되어야만 한다. 클레나우 단편의 엑소뉴클레아제(exonuclease) 활성은 말단을 평평하게 만드는데 필요하며, 평활-말단(blunt-end) 클로닝에 적합하다.

그 결과로서 생기는 반응 혼합물은 일반적으로 증폭이 예상되는 생성물을 산출하였는가를 확인하기 위하여 비변성 아가로오스(nondenaturing agarose) 또는 아크릴아마이드 겔 전기영동에 의해 분석되어야만 한다. 그 후, 그것은 대부분의 미네랄 오일을 제거하고, 남아있는 오일을 제거하기 위하여 클로로포름으로 추출하고, 완충된 페놀을 사용하여 추출한 후, 100% 에탄올을 사용하여 침전시킴으로써 농축하여 반응 혼합물을 처리할 수 있다. 다음으로, 그것은 올리고뉴클레오티드에서 사용된 플랭킹 서열에서 잘리는 제한효소를 사용하여 증폭된 단편의 약 절반을 절단하여야만 한다. 상기 절단된 단편은 낮은 겔화/용해 아가로오스 겔 상에서 정제된다.

단편을 서브클론하고 점 돌연변이를 체크하기 위하여, 그것은 두개의 증폭된 단편을 평활말단 연결에 의하여 적절하게 절단된 벡터 내로 서브클론될 것이다. 이것은 E. coli를 형질전환시키는 데 사용될 수 있을 것이며, 플라스미드 DNA는 그 후 그것으로부터 미니프렙을 사용하여 제조될 수 있다. 상기 플라스미드 DNA의 증폭된 부분은 그 후 정확한 점 돌연변이가 생성되었는지를 확인하기 위하여 DNA 시퀀싱에 의해 분석될 것이다. Taq DNA 폴리머라이제로서 중요한 이것은 부가적인 돌연변이를 DNA 단편 내로 도입할 수 있다.

점 돌연변이의 도입은 또한 연속적 PCRTM 단계를 사용하여 달성될 수 있다. 이 방법에서, 돌연변이를 포함하는 두개의 단편은 서로 풀리고, 서로 초회 감작된 합성에 의해 연장된다. 이 단편은 그 후 2차 PCRTM 단계에 의하여 증폭되고, 그것에 의하여 상기 프로토콜에서 요구되는 평활-말단 연결을 피하게 된다. 이 방법에서, 주형 DNA의 제조, 올리고뉴클레오티드 프라이머의 생성 및 1차 PCRTM 증폭은 상기에 기재된 것과 같이 수행된다. 그러나 이 과정에서, 선택된 올리고뉴클레오티드는 약 15 및 약 20 염기 사이의 범위에 대하여 주형 DNA와 일치하여야만 하며, 또한 약 10 염기 또는 그 이상이 서로 일치하여야만 한다.

제2차 PCRTM 증폭에서, 그것은 각 증폭된 단편 및 각 플랭킹 서열 프라이머를 사용할 것이고, 상기에 기재된 것과 같은 조건을 사용하여 약 20 및 약 25 주기 사이에서 PCRTM 을 수행할 것이다. 그것은 다시 단편들을 서브클론 할 것이고, 상기에 설명된 단계를 사용함으로써 점 돌연변이가 정확한지를 확인할 것이다.

앞서 언급한 방법들 중 하나의 사용에서, 가능한 작은 단편을 증폭시킴으로써 돌연변이를 도입하는 것이 일반적으로 바람직하다. 물론, 일반적으로 GC 함량 및 올리고의 길이에 의하여 영향을 받을 수 있는 것과 같은 올리고뉴클레오티드의 용융 온도와 같은 파라미터들은 또한 신중하게 고려되어야만 한다. 이 방법의 수행과 필요하다면 그것의 최적화는 당업자들에게 공지되어 있으며, 참조로서 본원에 통합되어 있는 분자생물학 실험(Current protocols in Molecular Biology, 1995)과 같은 다양한 간행물에 더 기재되어 있다.

부위 특이적 돌연변이 유발을 수행할 때, 표 1이 참조로서 사용될 수 있다.

Figure 112013109092908-pat00001

B7. 항체 단편 및 유도체

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체의 원래 소스에 상관없이, 손상되지 않은(intact) 항체, 항체 다량체(multimers) 또는 항체의 임의의 하나의 다양한 기능적, 항원결합 영역 중 어느 하나가 본 발명에서 사용될 수 있다. 대표적인 기능 영역은 Fab', Fab, F(ab')2와 같은 항원 결합 도메인, 단일 도메인 항체(single domain antibodies; DABs), TandAbs 다이머(dimer), Fv, scFv(단일쇄(single chain) Fv), dsFv, ds-scFv, Fd, 선형 항체, 미니항체(minibodies), 2가 항체(diabodies), 이중 특이성 항체 단편 등을 포함하는 항체 단편들을 포함한다. 이와 같은 구조물을 제조하기 위한 기술은 당업자들에게 잘 알려져 있으며 본원에 더 기재되어 있다.

항체 구조물의 선택은 다양한 인자에 의하여 영향을 받을 수 있다. 예를 들면, 연장된 반감기는 신장 내의 손상되지 않은 항체의 면역글로불린의 Fc 조각의 특성인 활성적인 재흡착(readsorption)으로부터 야기될 수 있다. 따라서, IgG에 기초한 항체는 그것들의 Fab'의 대응부 보다는 더욱 느린 혈액 여과율(blood clearance)을 나타낼 것으로 기대된다. 그러나, Fab' 단편에 기초한 조성물은 일반적으로 더욱 나은 조직 침윤 능력(tissue penetrating capability)을 나타낼 것이다.

만일 원한다면, 특정 Fc 영역은 지속성(longevity)을 제공하기 위하여 선택될 수 있다. 예를 들어, Fcγ 수용체, FcγRI, RcγRII 및 RcγRIII에 대한 실질적으로 감소된 결합에 의하여 달성되는 강화된 순환 반감기(circulating half-lives)를 가지는 불변 도메인에 관련된 국제특허번호 제99/43713호를 참조하라(Fridman, 1991). 부가적으로, 미국 특허등록번호 제7,083,784호는 FcRn(neonatal Fc receptor; 신생아의 Fc 수용체)에 대한 그것들의 친화력을 증가시키는 변경에 의하여 야기되는 증가된 생체 내 반감기를 가지는 변경된 불변 도메인과 관련이 있다. 미국 특허등록번호 제7,083,784호의 기술은 상당한 효과 기능을 가지거나 가지지 않는, 더욱 나은 지속성을 가지는 항체를 만들기 위하여 사용될 수 있다.

항체 단편들은 비특이적 티올 프로테아제(non-specific thiol protease), 파파인(papain)에 의한 전 인간 면역글로불린의 단백질 가수분해(proteolysis)에 의하여 얻어질 수 있다. 파파인 분해는 각 단일 항원-결합 부위를 가지는 "Fab 단편(Fab fragments)" 및 잔기 "Fc 단편(Fc fragment)"으로 불리는 두개의 동일한 항원-결합 단편을 산출한다.

파파인은 첫번째로 시스테인(cystein), 2-머캅토에탄올(2-mercaptoethanol) 또는 디티오트레이톨(dithiothreitol)을 사용하여 활성 부위에서 설피드릴 기(sulfhydryl group)를 감소시킴으로써 활성화되어야만 한다. 저장 효소에서의 중쇄는 최대의 효소 활성을 확보하기 위하여 EDTA(2mM)를 사용한 킬레이트화(chelation)에 의하여 제거되어야 한다. 효소 및 기질은 보통은 1:100 중량비로 함께 혼합된다. 배양 후, 이오도아세트아마이드(iodoacetamide)를 사용하거나 간단하게 투석에 의한 티올기의 불가역적인 알킬화(alkylation)에 의하여 반응을 멈출 수 있다. 완전한 분해는 SDS-PAGE에 의하여 관찰되어야 하며, 다양한 단편들이 단백질 A-세파로오즈 또는 이온교환 크로마토그래피에 의하여 분리된다.

인간 기원 IgG로부터의 F(ab')2의 제조를 위한 통상의 방법은 효소 펩신에 의한 단백질 가수분해로 제한된다. 37℃, pH 4.5의 아세테이트 버퍼에서의 100x 항체 과잉 w/w 조건은 항체가 중쇄 이황화 결합 사이의 C-말단측에서 절단됨을 암시한다. 서브클래스 및 조건에 의하여 변할 수 있는 마우스 IgG의 분해율은 상당량의 완전하게 분해된 IgG를 피하기 위하여 선택되어야 한다. 다른 서브클래스들은 최적의 결과를 내기 위하여 서로 다른 배양 조건을 필요로 하며, 이것들 모두는 당업계에 공지되어 있다.

손상되지 않은 항체의 펩신 처리는 두개의 항원-결합 부위를 가지는 F(ab')2 단편을 산출하며, 그것들은 여전히 항원과 가교결합할 수 있다. 펩신에 의한 IgG의 분해를 위한 대표적인 조건은 pH 4.5, 0.1M 아세테이트 버퍼에서의 투석 후 1% w/w 펩신을 사용한 4시간 동안의 배양을 포함하는 조건을 필요로 하며; 만일 16시간 동안 4℃, pH 2.8의 0.1M 포름산염 버퍼(formate buffer)후 아세테이트 버퍼에 대하여 첫번째로 투석된다면 IgG1 및 IgG2a 분해는 향상된다.

Fab 단편은 또한 경쇄의 불변 도메인 및 중쇄의 제1 불변 도메인(CH1)을 포함한다. Fab' 단편은 항체 힌지 영역(hinge region)으로부터의 하나 또는 그 이상의 시스테인을 포함하는 중쇄 CH1 도메인의 카르복시 말단에 약간의 잔기의 첨가에 의하여 Fab 단편과는 다르다. F(ab')2 항체 단편은 원래 그것들 사이에 힌지 시스테인을 가지는 Fab' 단편의 쌍으로서 생산된다. 항체 단편의 다른 화학적 결합 또한 공지되어 있다.

"Fv" 단편은 완전한 항원-인식 및 결합 부위를 포함하는 최소의 항체 단편이다. 이 영역은 단단하고 비공유적인 결합으로 하나의 중쇄 및 하나의 경쇄 가변 도메인의 이량체로 이루어진다. 이 구성에서 각 가변 도메인의 세개의 고변이 영역(hypervariable regions; CDRs)은 VH-VL 이량체의 표면상에서 항원-결합 부위를 특징짓기 위하여 상호작용한다. 집합적으로, 6개의 고변이 영역(CDRs)이 항체에 대한 항원-결합 특이성을 부여한다. 그러나, 단일 가변 도메인(또는 단지 항원에 틀이적인 세개의 고변이 영역만을 포함하는 Fv의 절반) 조차도 항원을 인식하며 항원에 결합하는 능력을 가진다.

"단일-사슬 Fv" 또는 "sFv" 또는 "scFv" 항체 단편은 항체의 VH 및 VL 도메인을 포함하며, 여기에서 이 도메인들은 단일 폴리펩티드 사슬로 존재한다. 일반적으로, Fv 폴리펩티드는 sFv가 항원 결합을 위한 바람직한 구조를 형성할 수 있도록 VH 및 VL 도메인 사이에 폴리펩티드 링커를 더 포함한다.

하기의 특허들은 항-VEGF 항체들의 svFv, Fv, Fab', Fab 및 F(ab')2 단편을 포함하는 항체의 기능적인 항원 결합 영역의 제조 및 용도에 관련된 현재의 교시를 더 보충하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있다: U.S. Patent No. 5,855,866; 5,965,132; 6,051,230; 6,004,555; 5,877,289 및 6,093,399. 국제특허출원번호 제98/45331호 또한 항체의 가변적이고, 고변이적인 상보성 결정 부위(CDR) 영역의 제조를 더 기재하고 교시하는 것을 포함할 목적으로 참조로서 본원에 통합되어 있다.

"이가 항체(diabodies)"는 두개의 항원-결합 부위를 가지는 작은 항체 단편이며, 단편들은 동일한 폴리펩티드 사슬(VH-VL)에 경쇄 가변 도메인(VL)에 연결된 중쇄 가변 도메인(VH)을 포함한다. 동일한 사슬 상의 두개의 도메인 사이에서 쌍을 이루도록 하기에는 너무 짧은 링커를 사용함으로써, 상기 도메인들은 다른 사슬의 상보적 도메인과 쌍을 이루게 되어 두개의 항원 결합 부위를 생성한다. 이가 항체는 유럽 특허출원번호 제404,097호 및 국제특허출원번호 제93/11161호에 기재되어 있다. 이중 특이성(bispecific) 또는 단일 특이성(monospecific)일 수 있는 "선형 항체(linear antibodies)"는 자파타 등에 기재된 것(Zapata et al ., 1995)과 같이 한쌍의 항원 결합 영역을 형성하는 한쌍의 탠덤 Fd 절편(VH-CH1-VH-CH1)을 포함한다.

조직 침윤 상에서의 부수적인 이익과 함께 항체의 Fab' 또는 항원 결합 단편을 사용하는 것에 있어서, 그것은 그것의 반감기를 증가시키기 위하여 단편을 변경하는 것으로부터 부가적인 이점을 얻을 수 있다. 항체 분자 그 자체의 조작 또는 변경 및 활성이 없는 담체와 접합되는 것과 같은 다양한 기술들이 사용될 수 있다. 약제를 표적으로 운반하는 것보다는 반감기를 증가시키는 유일한 목적을 위한 임의의 접합(conjugation)은 그 Fab'에 신중하게 시도되어야 하며, 다른 단편들은 조직을 침투하도록 선택된다. 그럼에도 불구하고, PEG 등과 같은 비-단백질 폴리머에 대한 접합이 고려된다.

따라서 접합이 아닌 변경은 그것을 더욱 안정하게 하고/하거나 신체에서의 분해대사율(rate of catabolism)을 감소시키기 위하여 항체 단편의 구조를 변경하는 것에 기초한다. 이와 같은 변경에 대한 하나의 메카니즘은 L-아미노산 대신에 D-아미노산을 사용하는 것이다. 당업자들은 이와 같은 변경의 도입은 바람직한 생물학적 특성을 여전히 유지하도록 하게 하기 위하여 그 결과 생성된 분자의 엄격한 테스트를 뒤이어 할 필요가 있음을 이해할 것이다. 또한 안정화 변경은 생물학적 분자의 반감기를 늘이기 위하여 일반적으로 사용되는, N-말단 또는 C-말단 중 하나 또는 모두에 대한 안정화 부분의 첨가의 이용을 포함한다. 단지 실시예의 형태로, 그것은 아실화 또는 아미노화에 의하여 말단을 변경할 수 있다.

본 발명과 함께 사용하기 위한 적당한 접합-형태 변경은 항체 단편 내로 샐비지 수용체 결합 에피토프(salvge receptor binding epitope)를 통합시키는 것을 포함한다. 이것을 달성하기 위한 기술들은 항체 단편의 적절한 영역의 돌연변이 또는 항체 단편에 부착되는 펩티드 태그로서 에피토프를 통합시키는 것을 포함한다. 국제특허출원번호 제96/32478호는 이와 같은 기술을 더 설명하기 위한 목적을 위하여 참조로서 본원에 특별히 통합되어 있다. 샐비지 수용체 결합 에피토프는 전형적으로 항체 단편 상의 유사한 위치로 옮겨진 Fc 도메인의 하나 또는 두개의 루프로부터의 세개 또는 그 이상의 아미노산 영역이다. 국제특허출원번호 제98/45331호의 샐비지 수용체 결합 에피토프는 본 발명과 함께 사용하기 위하여 차조로서 본원에 통합되어 있다.

B8. 결합 및 기능 검정

비록 본 발명이 동물 및 인간 치료 처방에서 현저한 유용성을 가진다 할지라도, 그것은 또한 많은 시험관 내 용도를 포함하는 다른 많은 실용적인 용도를 가진다. 이 용도들은 인간 항체 또는 면역접합체의 특이적 결합 특성과 관련이 있다고 확신한다. 본 발명의 모든 화합물은 적어도 하나의 VEGF 결합 성분을 포함한다는 점에서, 그것들은 임의의 항-VEGF 항체가 사용될 수 있는 사실상 모든 결합 구현에 사용될 수 있다.

비록 유익한 특성을 제공하기는 하지만, 필요할 경우 부착제(attached agent)의 존재는 임의의 결합 검정에서 인간 항체 영역의 유용성을 무효화시키지 않는다. 적절하게 유용한 결합 검정은 따라서 본원에 더 기재되는 것과 같이 면역블롯(immunoblots), 웨스턴 블롯(Western blots), 도트 블롯(dot blots), RIAs, ELISAs, 면역조직화학법(immunohistochemistry), 형광 활성화 세포 분류(fluorescent activated cell sorting; FACS), 면역침강법(immunoprecipitation), 친화성 크로마토그래피(affinity chromatography) 등과 같은 당업계에서 통상적으로 사용되는 것들을 포함한다.

어떤 표준 결합 검정은 면역블롯, 웨스턴 블롯 및 관련된 검정에서와 같이, 항원이 고체 지지 매트릭스, 예를 들어 니트로셀룰로오스, 나일론 또는 그것들의 조합 상에 고정화되는 것이다. 다른 중요한 검정법은 ELISAs이다. 모든 이와 같은 검정들은 신생혈관성 질병의 진단에 적용할 수 있기 때문에 VEGF의 검출에 사용하기 쉽게 개조될 수 있다. 본 발명의 약제 또한 면역조직화학법에서; 형광 활성화 세포 분류, 유세포 분석기(flow cytometry) 또는 유동 미소형광 측정(flow microfluorometry)에서; 면역침강법에서; 이중 특이성 항체의 경우에 동시에 하나 또는 그 이상의 항원의 원스텝 신속 정제를 더 포함하는 친화성 크로마토그래피에서; 그리고 본원에 존재하는 정보로서 존재하는 당업자에게 잘 알려져 있을 많은 다른 결합 검정에서, 신선동결(fresh-frozen)되고 포르말린에 고정된 파라핀 포매 조직 블록(paraffin embedded tissue blocks)과 접합하여 사용될 수 있다.

본 발명의 인간 항체의 또 다른 실용적인 용도는 기능 검정에서의 조절(control)과 같다. 이것들은 많은 시험관 내(in vitro) 및 생체 외(ex vivo) 검정 및 시스템 뿐만 아니라 동물 모델 연구 또한 포함한다. 본 발명의 인간 항체의 결합 및 기능 특성이 특히 특이적이므로, 즉 그것들은 VEGFR2에 결합하는 VEGF를 억제하고 VEGFR2를 통한 신호전달을 억제하지만 VEGFR1에는 그렇지 않으므로, 이와 같은 "조절(control)" 용도는 실제로 매우 유익하다. 본 발명의 이와 같은 실용적인 적용에서 이익을 얻는 검정은 예를 들어, VEGF-매개성 내피세포 성장, VEGF-유도성 인산화 및 VEGF-유도성 혈관 투과성을 고려하는 검정 뿐만 아니라, 신생혈관형성(neovascularization)의 각막 미세주머니 검정(corneal micropocket assay) 및 닭의 융모막 요막(chick chorio-allantoic membrane; CAM) 검정도 포함한다. 이 검정 시스템들은 또한 시험관 내 또는 생체 외 약물 선별 검정으로 개발될 수 있으며, 여기에서 잘 정의된 특성을 가지는 생물학적 물질의 현재의 공급이 특히 중요하다.

C. 면역접합체

비록 본 발명이 항신생혈관형성 방법에 사용하기 위한 놀랍도록 효과적인 나상의 또는 접합된 인간 항체를 제공한다 할지라도, VEGFR2-차단성 인간 항-VEGF 항체 면역접합체, 면역독소 및 응고리간드 또한 이에 의하여 제공된다. VEGF-차단성 인간 항-VEGF 항체 치료 접합체에 사용하기 위한 현재의 바람직한 약제는 (본원에 기재된 방사선 진단제로서 예시된 것과 같은) 방사선 치료제, 화학치료제, 항신생혈관성 약제, 아포토시스-유도제, 항튜블린성 약제, 항종양제 또는 세포종양제, 사이토카인, 케모카인, V-타입 ATPase 억제제 및 응고제(응고 인자)이다.

면역접합체, 면역독소 및 응고리간드를 만들기 위하여, 당업자들에게 공지되고 본원에 또한 기재되어 있는 것과 같은 재조합 발현이 융합 단백질을 만들기 위하여 사용될 수 있다. 동등하게는, 면역접합체, 면역독소 및 응고리간드는 아비딘:비오틴 연결 또는 임의의 화학적 접합 및 항체 접합체와 관련하여 개발된 가교결합 기술을 사용하여 생성될 수 있다.

C1 . 독소 및 항종양제

어떤 적용을 위하여, 치료제는 세포독성 또는 약제학적 약제, 특히 세포독성, 세포성장 억제(cytostatic) 또는 그렇지 않다면 내피 세포를 죽이거나 내피 세포의 성장 또는 세포 분열을 억제하는 능력을 가지는 항종양제일 것이다. 일반적으로, 본 발명의 이 양상들은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체와 접합되고 표적 내피로 활성형(active form)으로 운반될 수 있는 임의의 약제학적 약제의 용도를 고려한다.

대표적인 항종양제는 화학 치료제 뿐만 아니라 세포독소도 포함한다. 사용될 수 있는 화학 치료제는 스테로이드와 같은 호르몬; 사이토신 아라비노사이드(cytosine arabinoside), 플루오로우라실(fluorouracil), 메토트렉세이트(methotrexate) 또는 아미노프테린(aminopterin)과 같은 항대사물질(anti-metabolites); 안트라시클린(anthracyclines); 미토마이신 C(mitomycin C); 빈카 알카로이드(vinca alkaloids); 데메콜친(demecolcine); 에토포시드(etoposide); 미트라마이신(mithramycin); 클로람부실(chlorambucil) 또는 멜파란(melphalan)과 같은 항종양 알킬화제(anti-tumor alkylating agents)를 포함한다. 다른 구현들은 사이토카인과 같은 약제를 포함할 수 있다. 기본적으로, 그것이 표적화된 내피 세포 부위에서 혈액 성분에 대한 그것의 표적화(targeting), 내면화(internalization), 방출(release) 및/또는 표시(presentation)를 가능하게 할 수단으로 항체와 성공적으로 접합하거나 결합될 수 있는 한, 임의의 항종양제가 사용될 수 있다.

표적 항원이 독소 화합물에 의한 효과적인 중독(intoxication)과 일치하는 방법에 의해 내재화되지 않는 경우, 표적 항원이 항종양 약물, 사이토카인, 항대사물질, 알킬화제, 호르몬 등과 같은 화학치료제를 목표로 할 경우와 같은 상황이 있을 수 있다. 다양한 화학 치료제 및 다른 약제학적 약제들이 현재 성공적으로 항체와 접합되고 있으며, 독소루비신, 다우노마이신, 메토트렉세이트, 빈블라스틴, 네오카르지노스타틴, 마크로마이신, 트레니몬 및 α-아마니틴을 포함하는 약제학적 기능을 나타낸다.

다른 상황에 있어서, 세포독성에 기초한 치료로부터의 임의의 잠재적인 부작용은 다우노루비신, 독소루비신, 아드리아마이신 등과 같은 DNA 합성 억제제의 사용에 의하여 제거될 수 있다. 따라서, 이 약제들은 본 발명에서 사용하기 위한 항종양 약제의 바람직한 예이다. 세포성장 억제제의 견지에서, 이와 같은 화합물들은 일반적으로 바람직하게는 세포가 세포 주기를 이탈하도록 하기 위하여 표적 세포의 자연적인 세포 주기를 파괴한다.

다양한 세포독성 약제들이 VEGFR2-차단성 인간 항-VEGF 항체에 접합될 수 있다고 공지되어 있다. 예들은 예를 위하여 굳이 몇가지만 대자면 다양한 A 사슬 독성(A chain toxins), 특히 리신 A 사슬(ricin A chain); 사포린(saporin) 또는 겔로닌(gelonin)과 같은 리보솜 불활성화 단백질(ribosome inactivating proteins); α-사르신(α-sarcin); 아스퍼질린(aspergillin); 레스트릭토신(restrictocin); 태반의 리보뉴클레아제(ribonuclease)와 같은 리보뉴클레아제; 디프테리아 독소(diphtheria toxin) 및 슈도모나스 외독소(pseudomonas exotoxin)를 포함하는, 다수의 유용한 식물 유래, 곰팡이 유래 또는 박테리아 유래의 독소를 포함한다.

잘 알려져 있는 1992년도의 독소에 관한 책인 아서 E. 프랑켈(Arthur E. Frankel)에 의해 편집된, 다수의 독소의 초기 아미노산 서열을 포함하는 부록을 포함하는 "유전적으로 조작된 독소(Genetically Engineered Toxins)"는 표적화된 구조물에서의 독소의 사용을 더 기재하고 사용가능하게 하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있다.

독소 중에서, 겔로닌 및 리신 A 사슬이 바람직하다. 본원에서 사용하기에 가장 바람직한 독소 부분은 소위 탈글리코실화된 A 사슬(deglycosylated A chain; dgA)이라 불리는 탄수화물 잔기를 변경하거나 제거하기 위하여 처리된 독소 A 사슬이다. 탈글리코실화된 리신 A 사슬은 그것의 극도의 효능, 긴 반감기 및 그것을 임상 등급 및 스케일로 경제적으로 제조할 수 있기 때문에 바람직하다.

그럼에도 불구하고 적절한 생물학적 반응을 제공할 수 있는 가장 작은 분자를 사용하기 위한 약제학적 견해가 바람직할 수 있다. 따라서, 그것은 충분한 항종양 반응을 제공할 더욱 작은 A 사슬 펩티드를 사용하기를 원할 수 있다. 이 때문에, 리신 A 사슬은 나가라아제(Nagarase, Sigma)에 의하여 30 N-말단 아미노산의 제거에 의하여 "절단(truncated)"될 수 있으며, 여전히 충분한 독소 활성을 유지한다. 원한다면, 이 절단된 A 사슬은 본 발명에 따라 접합체에 사용될 수 있다고 가정된다.

대안적으로, 독소 A 사슬 부분에 대한 재조합 DNA 기술의 적용은 본 발명에 따라 부가적인 이익을 제공할 것임을 발견할 수 있다. 생물학적으로 활성형인 리신 A 사슬의 클로닝 및 발현이 달성된다는 점에서, 현재 그럼에도 불구하고 적절한 독소 활성을 나타내는 더욱 작거나 그렇지 않다면 변형 펩티드를 확인하고 제조할 수 있다. 게다가, 사실 현재 클론된 리신 A 사슬은 본 발명과 관련하여 사용하기 위하여 쉽게 제조되고, A 사슬로부터 유래된 펩티드를 선별하고 부가적으로 유용한 부분을 얻을 수 있는 부위 지정 돌연변이 유발의 적용을 가능하게 한다.

C2 . 응고 인자

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 응고 리간드를 형성하기 위하여 응고를 직접적으로 또는 간접적으로 자극할 수 있는 성분과 연결될 수 있다. 여기에서, 상기 항체들은 응고제 또는 응고 인자와 간접적으로 연결될 수 있거나, 응고제 또는 응고 인자와 결합한 후 방출되는 제2의 결합 영역과 연결될 수 있다. 본원에 사용된 것으로서, 상기 용어 "응고제(coagulant)" 및 "응고 인자(coagulation factor)"는 각각 적절한 환경 하에서, 바람직하게는 종양 맥관구조와 같은 특이적 생체 내 환경에 제공될 때, 응고를 직접적으로 또는 간접적으로 자극할 수 있는 성분을 말하는 데 사용된다.

바람직한 응고 인자는 절단된 TF(truncated TF; tTF), 이량체, 다량체 및 돌연변이 TF 분자와 같은 조직 인자 조성물(Tissue Factor composition)이다. "절단된 TF(truncated TF; tTF)"는 특성에 이 변경을 초래하기에 충분한 아미노산 서열의 제거에 의하여 막 결합이 결여되도록 만들어진 TF 구조물을 말한다. 이 문맥에서 "상당한 양(sufficient amount)"은 처음부터 막에서 TF 분자를 들여보내기에 충분하거나, 그렇지 않다면 TF 단백질의 기능적 막 결합을 매개하는 막통과 아미노산 서열의 양이다. 따라서, 이와 같은 "유효량의 막통과 스패닝 서열(sufficient amount of transmembrane spanning sequence)"의 제거는 단백질이 인지질막에 현저하게 결합하지 않는 실질적으로 수용성인 단백질이 되도록 인지질 막 결합능에서 절단된 조직 인자 단백질 또는 폴리펩티드 결여체를 생성한다. 절단된 TF는 따라서 실질적으로 표준 TF 검정에서 인자 VII를 인자 VIIa로 전환시키는 데 실패하며, 여전히 인자 VIIa의 존재하에서 인자 X를 활성하시키는 것을 포함하는 소위 촉매 활성화(catalytic activity)를 유지한다.

미국 특허등록번호 제5,504,067호는 이와 같은 절단된 조직 인자 단백질을 더 기재하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있다. 바람직하게는, 본 발명의 이 양상에서 사용하기 위한 상기 조직 인자는 일반적으로 단백질의 막통과 및 세포질성 영역(아미노산 220-263)이 결핍될 것이다. 그러나, 상기 절단된 TF 분자들이 정확한 219의 아미노산 길이의 분자로 제한될 필요는 없다.

조직 인자 조성물들은 또한 이량체로서 유용할 수 있다. 임의의 절단된, 돌연변이되거나 다른 조직 인자 구조물들은 본 발명에서 사용하기 위한 이량체 형태로 제조될 수 있다. 당업자들에게 공지될 것과 같이, 이와 같은 TF 이량체들은 발현 벡터로부터 뼈대가 제조되고 발현된 두개의 코딩 영역에서 분자 생물학 및 재조합 발현의 표준 기술을 사용함으로써 제조될 수 있다. 동등하게는, 다양한 화학적 접합 기술들이 TF 이량체의 제조와 관련하여 사용될 수 있다. 개개의 TF 단량체들은 접합 이전에 유도체화된다. 모든 이와 같은 기술들은 당업자들이 손쉽게 알 수 있을 것이다.

만일 원한다면, 상기 조직 인자 이량체 또는 다량체는 선택적으로 절단가능한(selectively-cleavable) 링커 또는 아미노산 서열과 같은 생물학적으로 방출가능한(biologically-releasable) 결합을 통하여 연결될 수 있다. 예를 들면, 종양의 환경 내에 선택적으로 위치하거나 활성화되는 효소에 대한 절단 부위를 포함하는 펩티드 링커가 고려된다. 이와 같은 펩티드 링커의 대표적인 형태는 유로키나아제, 플라스민, 트롬빈, 인자 IXa, 인자 Xa 또는 콜라게나아제, 젤라티나아제 또는 스트로멜라이신(stomelysin)과 같은 메탈로프로테이나아제에 의하여 절단된 것들이다.

어떤 구현에서, 상기 조직 인자 이량체는 나중에 인지질 막과 함께 조직 인자의 기능적 결합을 촉진하기 위하여 방해된 소수성막 삽입 부위(hindered hydrophobic membrane insertion moiety)를 더 포함할 수 있으나, 단지 어떤 정의된 조건하에서만이다. 절단된 조직 인자의 맥락에서 기재된 바와 같이, 소수성 막-결합 서열은 일반적으로 그것들의 소수적 특성 때문에 인지질 환경과의 결합을 촉진하는 아미노산의 범위이다. 동등하게는, 지방산은 잠재적 막 삽입 부위를 제공하는 데 사용될 수 있다.

이와 같은 막 삽입 서열은 TF 분자의 N-말단 또는 C-말단 중 하나에 위치될 수 있거나, 일반적으로 그것의 부착이 거기에서 TF 구조물의 기능적 특성을 방해하지 않는 한 분자의 임의의 다른 포인트에서 부가된다. 방해된 삽입 부분의 목적은 TF 구조물이 종양의 환경 내에 위치할 때까지 비기능성을 유지하고, 소수성 첨가물이 접근가능하도록 하고, 심지어는 막과의 물리적 결합을 더 촉진하고자 하는 것이다. 또한, 생물학적으로 방출가능한 결합 및 선택적으로 절단가능한 서열은 단지 종양의 환경 내에 위치하도록 절단되거나 그렇지 않다면 변경되고 특정 효소 또는 다른 생물활성 분자에 노출될 결합 또는 서열과 함께 이러한 점에서 특히 유용할 것이다.

다른 구현에서, tTF 구조물은 다량체성 또는 중합체성이다. 이와 관련하여, "중합체성 구조물(polymeric construct)"은 3 또는 그 이상의 조직 인자 구조물을 포함한다. "다량체성 또는 중합체성 TF 구조물(multimeric or polymeric TF construct)"은 제1의 TF 분자 또는 적어도 제2 및 제3의 TF 분자 또는 유도체에 작동가능하게 부착된 유도체를 포함하는 구조물이다. 다량체는 약 3 및 약 20 사이의 이와 같은 TF 분자들을 포함할 수 있다. 다량체 또는 중합체들 내에서 개개의 TF 유닛은 또한 원하는 만큼 선택적으로 절단가능한 펩티드 링커 또는 다른 생물학적으로 방출가능한 결합에 의해 연결될 수 있다. 또한, 상기에 논의된 TF 이량체와 마찬가지로, 상기 구조물들은 재조합 조작 및 발현을 사용하거나 표준 합성 화학을 사용하여 쉽게 만들어질 수 있다.

본 발명과 관련하여 더욱 더 유용한 TF 구조물은 인자 VII를 활성화시키는 능력이 결여된 돌연변이이다. 이와 같은 "인자 VII 활성화 돌연변이(Factor VII activation mutants)"는 일반적으로 기능 인자 VII/VIIa와 결합하고, 인자 X를 단백질분해적으로 활성화시키지만, 인자 VII를 단백질 분해적으로 활성화시키는 능력은 실질적으로 없는 TF 돌연변이로서 본원에 정의된다. 따라서, 이와 같은 구조물들은 인자 VII 활성화 활성이 결여된 TF 돌연변이이다.

종양 특이적 응고를 촉진하는 기능에 대한 이와 같은 인자 VII 활성화 돌연변이의 능력은 종양의 맥관구조 및 혈장에서의 낮은 농도의 인자 VIIa의 존재에 대한 그것들의 특이적 운반에 기초한다. 이와 같은 인자 VII 활성화 돌연변이 접합체의 투여에 관련하여, 상기 돌연변이는 신생혈관이 형성된 종양의 맥관구조 내에 위치될 것이다. 위치화되기 이전에, TF 돌연변이체는 일반적으로 인자 VII를 인자 VIIa로 전환하지 못하는 그것의 능력에 기초하여, 임의의 다른 신체 부위에서 응고를 촉친할 수 없을 것이다. 그러나, 종양 영역 내에서의 위치화 및 축적에 관련하여, 돌연변이는 그 후 외인성 응고 경로(extrinsic coagulation pathway)를 개시하기 위하여 혈장으로부터 충분한 인자 VIIa와 만나 종양 특이적 혈전 생성(thrombosis)을 야기할 것이다. 외인성 인자 VIIa는 또한 환자에게 투여될 수 있다.

임의의 하나 또는 그 이상의 다양한 인자 VII 활성화 돌연변이는 본 발명과 관련하여 제조되고 사용될 수 있다. 인자 VII/VIIa에 대한 TF 분자 상의 인식 부위를 고려한 상당한 양의 과학적 지식들이 있다. 따라서, 인자 VII 활성화 영역은 일반적으로 TF 분자의 약 아미노산 157 및 약 아미노산 167 사이에 놓인다는 것을 이해할 수 있을 것이다. 그러나, 이 영역 밖의 잔기들 또한 인자 VII 활성화 활성에 관련된다고 입증될 수 있고, 따라서 TF 서열의 약 아미노산 106 및 약 아미노산 209의 사이에 일반적으로 위치된 임의의 하나 또는 그 이상의 잔기 내로 돌연변이를 도입하는 것을 고려할 수 있음이 고려된다(WO 94/07515; WO 94/28017, 각각 참조로서 본원에 통합되어 있음).

다양한 다른 응고 인자들이 하기에 설명하는 약제들로 예시되는 바와 같이 본 발명과 관련하여 사용될 수 있다. 트롬빈, 인자 V/Va 및 유도체들, 인자 VIII/VIIIa 및 유도체들, 인자 IX/IXa 및 유도체들, 인자 X/Xa 및 유도체들, 인자 XI/XIa 및 유도체들, 인자 XII/XIIa 및 유도체들, 인자 XIII/XIIIa 및 유도체들, 인자 X 활성제 및 인자 V 활성제들이 본 발명에서 사용될 수 있다.

러셀의 바이퍼 베놈 인자 X 활성제(Russell's viper venom Factor X activator)는 본 발명에 사용하기 위하여 고려된다. 러셀의 바이퍼 베놈에 존재하는 인자 X 활성제에 특이적인 단일클론 항체 또한 생성되고, 이중 특이적 결합 리간드의 일부분으로서 약제를 특이적으로 운반하는 데 사용될 수 있다.

트롬복산 A2(Thromboxane A2)는 혈소판 마이크로솜(platelet microsomes)에서 효소 사이클로옥시게나아제(cyclooxygenase) 및 트롬복산 신테타아제(thromboxane synthetase)의 연속 작용에 의하여 엔도퍼록시드(endoperoxides)로부터 형성된다. 트롬복산 A2는 혈소판으로부터 쉽게 생성되며, 그것의 혈소판 응집을 생성하는 능력 때문에 강력한 혈관수축제(vasoconstrictor)이다. 트롬복산 A2 및 그것들의 활성 유사체 모두는 본 발명에 사용하기 위하여 고려된다.

트롬복산 신테타아제 및 혈소판 활성화 프로스타글란딘(platelet-activating prostaglandins)을 합성하는 다른 효소들 또한 본 발명과 관련하여 "응고제(coagulants)"로서 사용될 수 있다. 트롬복산 신타아제에 대한 단일클론 항체 및 트롬복산 신타아제의 면역친화성 정제는 잘 알려져 있으며, 인간 트롬복산 신타아제에 대한 cDNA와 같다.

α2-안티플라스민(α2-antiplasmin) 또는 α2-플라스민 억제제(α2-plasmin inhibitor)는 플라스미노겐 활성제(plasminogen activator)에 의하여 유도된 피브린 클롯(fibrin clots)의 용해를 효과적으로 억제하는 기능을 하는, 인간 혈장에 자연적으로 존재하는 프로테이나아제 억제제이다. α2-안티플라스민은 특히 강력한 억제제이며, 본 발명에 사용하기 위하여 고려된다.

α2-안티플라스민에 대한 cDNA 서열은 입수가능하므로, 재조합 발현 및/또는 융합 단백질이 바람직하다. α2-안티플라스민에 대한 단일클론 항체 또한 입수가능하며, 본 발명의 이중 특이적 리간드 구현에 사용될 수 있다. 이 항체들은 모두 표적 부위로 외생적 α2-안티플라스민을 운반하거나 표적 영역 내에서 내생적 α2-안티플라스민을 얻고 그것을 농축하기 위하여 사용될 수 있다.

C3 . 항튜불린성 약물

다수의 약물들은 튜불린 활성을 방해함으로써 그것들의 효과를 발휘한다. 튜불린의 기능은 유사분열(mitosis)과 세포 생존능력(viability)에 필수적이기 때문에, 어떤 "항튜불린성 약물(anti-tubulin drugs)"은 강력한 화학 치료제이다. 본원에 사용된 것으로서 "항튜불린성 약물"은 세포의 유사분열을 억제, 바람직하게는 세포의 유사분열에 필수적인 튜불린 활성, 바람직하게는 튜불린 중합(polymerization) 또는 탈중합(depolymerization)을 직접적 또는 간접적으로 억제하는 임의의 약제, 약물, 프로드러그 또는 그것들의 조합을 의미한다.

본 발명과 함께 사용하기 위한 몇몇의 더욱 잘 알려지고 현재의 바람직한 항튜불린성 약물은 콜히친, 탁솔(파클리탁셀) 및 도세탁셀과 같은 탁센; 빈블라스틴, 빈크리스틴 및 빈데스신과 같은 빈카 알카로이드; 및 콤브레타스타틴이다. 다른 적절한 항튜불린성 약물은 (B, J, E를 포함하는) 시토칼라신(cytochalasins), 도라스타틴(dolastatin), 아우리스타틴 PE(auristatin PE), 파클리탁셀(paclitaxel), 우스틸록신 D(ustiloxin D), 리족신(rhizoxin), 1069C85, 콜세미드(colcemid), 알벤다졸(albendazole), 아자톡신(azatoxin) 및 노코다졸(nocodazole)이다.

미국 특허등록번호 제5,892,069호, 제5,504,074호 및 제5,661,143호에 기재된 것과 같이, 콤브레타스타틴은 일반적으로 세포의 유사분열을 억제하는 에스트라디올(estradiol) 유도체이다. 본 발명과 접합하여 사용될 수 있는 대표적인 콤브레타스타틴은 콤브레타스타틴 A, B 및/또는 D에 기초한 것들 및 미국 특허등록번호 제5,892,069호, 제5,504,074호 및 제5,661,143호에 기재된 것들을 포함한다. 콤브레타스타틴 A-1, A-2, A-3, A-4, A-5, A-6, B-1, B-2, B-3 및 B-4는 앞서 언급한 타입들의 예이다.

미국 특허등록번호 제5,569,786호 및 제5,409,953호는 각 콤브레타스타틴 A-1, A-2, A-3, B-1, B-2, B-3 및 B-4의 분리, 구조적 특성화 및 합성과 종양(neoplastic)의 성장을 치료하기 위한 이와 같은 콤브레타스타틴을 사용하는 제형 및 방법을 기재하고 있다. 임의의 하나 또는 그 이상의 이와 같은 콤브레타스타틴은 본 발명과 함께 접합하여 사용될 수 있다.

미국 특허등록번호 제5,892,069호, 제5,504,074호, 제5,661,143호 및 제4,996,237호에 기재된 것과 같은 콤브레타스타틴 A-4 또한 이와 함께 사용될 수 있다. 미국 특허등록번호 제5,561,122는 본 발명과의 조합된 사용을 위하여 고려되는 적절한 콤브레타스타틴 A-4 약물을 더 기재하고 있다.

미국 특허등록번호 제4,940,726호는 특히 각각 본 발명의 조성물 및 방법과 함께 조합하여 사용될 수 있는, '콤브레타스타틴 D-1' 및 '콤브레타스타틴 D-2'이라고 명명된 마크로시클릭 락톤(macrocyclic lactones)이 기재되어 있다. 미국 특허등록번호 제5,430,062호는 본 발명과 조합하여 사용될 수 있는 항암 활성을 가지는 스틸벤(stilbene) 유도체 및 콤브레타스타틴 유사체에 관한 것이다.

C4 . 항신생혈관성 약제

본 발명은 주로 조합된 항신생혈관제를 제공한다. 본 발명의 인간 항체는 안지오포이에틴-1(angiopoietin-1; Ang-1), 안지오포이에틴-2(angiopoietin-2; Ang-2), 안지오포이에틴-3(마우스) 또는 안지오포이에틴-4(인간)과 같은 안지오포이에틴(Davis and Yancopoulos, 1999; Holash et al ., 1999; 참조로서 본원에 통합됨)에 부착될 수 있다(Valenzuela et al., 1999; Kim et al ., 1999).

이와 함께 사용하기 위한 대표적인 항신생혈관제는 안지오스타틴 및 엔도스타틴을 포함한다. 안지오스타틴은 각각 참조로서 본원에 통합되어 있는 미국 특허등록번호 제5,776,704호, 제5,639,725호 및 제5,733,876호에 기재되어 있다. 안지오스타틴은 대략 플라스미노겐 분자의 크링글(Kringle) 영역 1 내지 4를 포함하는 환원성 폴리아크릴아마이드 겔 전기영동(reducing polyacrylamide gel electrophoresis)에 의하여 측정되는 것과 같은 약 38kD 및 약 45kD 사이의 분자량을 가지는 단백질이다. 안지오스타틴은 일반적으로 손상되지 않은 마우스 유래의 플라스미노겐 분자의 아미노산 번호 98에서 시작하는 마우스 유래의 플라스미노겐의 단편과 실질적으로 유사한 아미노산 서열을 가진다.

안지오스타틴의 아미노산 서열은 종들 사이에서 약간 다르다. 예를 들면, 비록 활성형 인간 안지오스타틴 서열은 손상되지 않은 인간의 플라스미노겐 아미노산 서열의 아미노산 번호 97 또는 99 중 어느 하나에서 시작할 수 있다 할지라도, 인간 안지오스타틴에서의 아미노산 서열은 상기에 기재된 마우스 유래의 플라스미노겐 단편의 서열과 실질적으로 유사하다.

안지오스타틴 및 엔도스타틴은 마우스에서 종양의 성장을 억제할 뿐만 아니라 종양의 퇴화를 야기하는 것으로 증명된 능력을 가지는 제1의 신생혈관형성 억제제이기 때문에, 심도있는 연구의 중심이 된다. 여기에 엘라스타아제(elastase), 대식세포 메탈로엘라스타아제(macrophage metalloelastase; MME), 매트릴라이신(matrilysin; MMP-7) 및 92 kDa의 젤라티나아제 B/타입 IV 콜라게나아제(MMP-9)를 포함하는, 플라스미노겐으로부터 안지오스타틴을 생산함을 보여주는 다중 프로테아제가 있다.

MME는 종양에서 플라스미노겐으로부터 안지오스타틴을 생산할 수 있으며, 과립구-대식세포 콜로니 자극 인자(granulocyte-macrophate colony-stimulating factor; GMCSF)는 안지오스타틴의 생성을 유도하는 대식세포에 의한 MME의 발현을 상승조절한다. 안지오스타틴 생성에서 MME의 역할은 MME가 사실 환자로부터의 간암 임상 샘플에서 발현된다는 사실에 의하여 지지된다. 안지오스타틴을 생산할 수 있다고 여겨지는 다른 프로테아제는 스트로멜라이신-1(stromelysin-1)(MMP-3)이다. MMP-3는 시험관 내에서 플라스미노겐으로부터 안지오스타틴 유사 단편(angiostatin-like fragments)을 생산함을 보여주었다. 안지오스타틴에 대한 작용 메카니즘은 현재는 명확하지 않으며, 그것은 내피 세포가 프로그램된 세포 죽음 또는 유사분열 정지(mitotic arrest)를 겪도록 유도하는 내피세포 상의 확인되지 않은 세포 표면 수용체에 결합한다고 가정하였다.

엔도스타틴은 심지어 더욱 강력한 항신생혈관성 약제 및 항종양제인 것처럼 보이며, 특히 VEGFR2-차단성 인간 항-VEGF 항체에 연결하기에 바람직하다. 엔도스타틴은 마우스에서의 다수의 종양 모델에서 퇴화를 야기하는 데 효과적이다. 종양은 다중 주기(multiple cycle)의 치료 후에도 엔도스타틴에 대한 저항성을 나타내지 않으며, 종양은 크기가 커지지 않는 동안 휴지 상태(dormant state)에 들어간다. 이 휴지 상태에서, 아포토시스를 겪는 종양 세포의 비율이 증가하고, 집단이 본질적으로 동일한 크기를 유지하도록 한다.

참조로서 본원에 특별히 통합되어 있는 미국 특허등록번호 제5,854,205호(Folkman and O'Reilly)는 엔도스타틴 및 그것의 내피 세포 증식 및 신생혈관형성의 억제제로서의 용도에 관한 것이다. 엔도스타틴 단백질은 콜라겐 타입 XVIII의 C-말단에 대응하고, 상기 단백질은 다양한 소스(source)로부터 분리될 수 있다. 미국 특허등록번호 제5,854,205호 또한 엔도스타틴이 콜라겐 타입 XVIII, 콜라겐 타입 XV 또는 BOVMPE1 프리가스트릭 에스테라아제(pregastric esterase) 단편의 아미노산 서열을 가질 수 있다는 것을 교시한다. 다른 항신생혈관성 단백질, 특히 안지오스타틴과 엔도스타틴의 조합 또한 미국 특허등록번호 제5,854,205호에 기재되어 있고, 조합된 조성물은 신생혈관형성 의존성 종양의 덩어리를 효과적으로 퇴화시킬 수 있다.

엔도스타틴 및 안지오스타틴, 특히 엔도스타틴은 본 발명에 따른 종양 운반을 위한 바람직한 약제이다. 엔도스타틴 융합 단백질은 참조로서 본원에 통합되어 있는 미국 특허등록번호 제6,342,221호에 기재된 것과 같이 제조될 수 있다. 다양한 형태의 화학적으로 연결된 엔도스타틴 구조물 또한 미국 특허등록번호 제6,342,221호에 다시 설명되어 있는 것과 같이 제조될 수 있다.

C5 . 아포토시스 - 유도제

본 발명은 또한 종양 세포 및 종양 혈관 내피 세포를 포함하는 종양 내의 임의의 세포로 아포토시스를 유도하는 약제를 운반하는 데 사용될 수 있다. 비록 많은 항종양제가 그것들의 작용 메카니즘의 일부로서 아포토시스 유도 효과를 가질 수 있다 할지라도, 어떤 약제는 하기에 기재된 것과 같이 주된 메카니즘으로서 이러한 효과를 가지는 것이 발견되고, 설계되거나 선택되었다.

많은 형태의 암들이 p53과 같은 종양 억제 유전자에 돌연변이를 가진다고 보고되어 있다. p53의 불활성화는 아포토시스 촉진의 실패를 야기한다. 이 실패와 함께, 암 세포들은 세포 죽음으로 향하기보다는 종양 형성(tumorigenesis)으로 진행된다. 따라서, 종양 억제제의 운반 또한 세포 죽음을 자극하도록 본 발명에서 사용하기 위하여 고려된다. 대표적인 종양 억제제는 p53, 망막아세포종 유전자(Retinoblastoma gene; Rb), 빌름스 종양(Wilms's tumor; WT1), bax alpha, 인터루이킨-1b 전환 효소(interleukin-1b-converting enzyme) 및 패밀리, MEN-1 유전자, 신경섬유종증(neurofibromatosis), 타입 1(NF1), cdk 억제제 p16, 대장암(colorectal cancer) 유전자(DCC), 가족성 선종성 용종증(familial adenomatosis polyposis gene; FAP), 다발성 종양 억제 유전자(multiple tumor suppressor gene; MTS-1), BRCA1 및 BRCA2를 포함하나 이에 제한되지는 않는다.

사용하기에 바람직한 것은 p53 유전자(U.S. Patent No. 5,747,469; 5,677,178 및 5,756,455; 각각 참조로서 본원에 통합되어 있음), 망막앙세포종 유전자, BRCA1 유전자(U.S. Patent No. 5,750,400; 5,654,155; 5,710,001; 5,756,294; 5,709,999; 5,693,473; 5,753,441; 5,622,829 및 5,747,282; 각각 참조로서 본원에 통합되어 있음), MEN-1 유전자(GeneBank accession number U93236) 및 아데노바이러스 E1A 유전자(U.S. Patent No. 5,776,743; 참조로서 본원에 통합되어 있음)이다.

VEGFR2-차단성 인간 항-VEGF 항체에 의해 운반될 수 있는 다른 조성물은 TRAIL이라 불리는 종양 괴사 인자 관련 아포토시스 유도성 리간드(tumor necrosis factor related apoptosis inducing ligand)를 암호화하는 유전자 및 TRAIL 폴리펩티드(U.S. Patent No. 5,763,223; 참조로서 본원에 통합되어 있음); 24kD 아포토시스 관련 프로테아제(apoptosis-associated protease)(U.S. Patent No. 5,605,826; 참조로서 본원에 통합되어 있음); 파스 관련 인자 1(Fas-associated factor 1; FAF1)(U.S. Patent No. 5,750,653; 참조로서 본원에 통합되어 있음)를 포함한다. 또한, 본 발명의 이 양상들에 사용하기 위하여 고려되는 것들은 아포토시스를 자극하는 것으로 또한 보고되어 있는 인터루이킨-1β-전환 효소 및 패밀리 구성원의 공급이다.

카르보스티릴(carbostyril) 유도체(U.S. Patent No. 5,672,603 및 5,464,833; 각각 참조로서 본원에 통합되어 있음); 분지된 아포제닉 펩티드(branched apogenic peptides)(U.S. Patent No. 5,591,717; 참조로서 본원에 통합되어 있음); 포스포티로신 억제제(phosphotyrosine inhibitors) 및 비가수분해성 포스포티로신 유사체(non-hydrolyzable phosphotyrosine analogs)(U.S. Patent No. 5,565,491 및 5,693,627; 각각 참조로서 본원에 통합되어 있음); RXR 레티노이드 수용체의 작용제(agonists of RXR retinoid receptor)(U.S. Patent No. 5,399,586; 참조로서 본원에 통합되어 있음); 및 심지어 항산화제(antioxidants)(U.S. Patent No. 5,571,523; 참조로서 본원에 통합되어 있음)와 같은 화합물들 또한 사용될 수 있다. (참조로서 본원에 통합되어 있는 U.S. Patent No. 5,587,459에 의해 지지되는 것과 같이) 제니스테인(genistein)과 같은 티로신 키나아제 억제제 또한 세포 표면 수용체 VEGFR1을 표적으로 하는 본 발명의 약제와 연결될 수 있다.

DIABLO로 또한 알려져 있는 "카스파아제의 제2의 미토콘드리아로부터 유래된 활성제(second mitochondria-derived activator of caspase; SMAC)"는 아포토시스 동안 미토콘드리아로부터 방출되며 "아포토시스 단백질의 억제제(inhibitor of apoptosis proteins; IAPs)"라 불리는 단백질의 패밀리에 결합하는 단백질이다. 따라서, IAP 길항제(antagonists) 또는 SMAC 모방체(mimetics)는 항암제로서 개발되었다. 이것들은 치료와 접합되고 조합되어 본 발명과 함께 사용될 수 있다.

대표적인 IAP 억제제는 X-연결된 IAP의 BIR3 도메인(XIAP, 또한 BIRC4로도 알려져 있음)과 SMAC의 결정구조의 상호작용에 기초하여 개발된 것과 구조에 기초한 접근법을 사용하여 설계된 1가 및 2가의 IAP(Vince et al., 2007; Varfolomeev et al ., 2007)를 포함한다. XIAP의 BIR3 도메인과 상호작용하는 SMAC의 N-말단 아미노산을 닮도록 설계된 SMAC 모방체 또한 사용될 수 있다(Petersen et al ., 2007). SMAC 모방체는 치료된 동물의 40%가 종양이 없는 상태를 유지함과 동시에 심지어 단일 약제로서도 민감성 인간 폐암 이종 이식의 퇴화를 유도할 수 있다(Petersen et al ., 2007).

C6 . 사이토카인

사이토카인 및 케모카인(chemokines)은 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체를 위한 약제의 특정 예이다. 다양한 사이토카인들이 사용될 수 있으며, IL-3, IL-4, IL-5, IL-7, IL-8, IL-9, IL-11, IL-13, TGF-β, M-CSF, G-CSF, TNFβ, LAF, TCGF, BCGF, TRF, BAF, BDG, MP, LIF, OSM, TMF, IFN-α, IFN-β를 포함한다. 더욱 바람직한 사이토카인은 IL-1α, IL-1β, IL-2, IL-6, IL-10, GM-CSF, IFN-γ, 단핵세포 화학유인 단백질-1(monocyte chemoattractant protein-1; MCP-1), 혈소판 유래의 성장 인자-BB(platelet-derived growth factor-BB; PDGF-BB) 및 C-반응성 단백질(C-reactive protein; CRP) 등을 포함한다. 특히 바람직한 예는 TNFα, TNFβ 유도인자(inducer), IL-2, IL-12, IFN-α, IFN-β, IFN-γ 및 LEC이다.

예를 들어, IL-12는 VEGFR2-차단성 인간 항-VEGF 항체에 부착될 수 있고, 종양의 맥관을 공격하기 위하여 숙주의 방어 방향을 바꾸는 데 사용될 수 있다. 케모카인 LEC(간-발현성 케모카인(liver-expressed chemokine), 또한 NCC-4, HCC-4 또는 LMC로도 알려져 있음)은 또 다른 바람직한 성분이다(Giovarelli et al ., 2000). LEC는 수지상 세포(dendritic cell), 단핵세포(monocyte), T 세포(T cells), NK 세포(NK cells) 및 호중성 백혈구(neutrophils)에 대하여 주화성을 가지므로, 숙주-매개성 항종양 반응을 향상시킬 수 있다.

C7 . 생물학적 기능 동등체

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체의 동등체(equivalents) 또는 보다 향상된 것이 현재 만들어질 수 있다. 변경 및 변화는 이와 같은 항체의 구조에서 만들어질 수 있고, 닮거나 그렇지 않다면 바람직한 특성을 가지는 분자를 여전히 얻을 수 있다. 예를 들면, 어떤 아미노산은 단백질 구조에서 상호작용적 결합 능력의 상당한 손실 없이 다른 아미노산을 대신할 수 있다. 이러한 고려들 또한 독소, 항신생혈관성 약제, 아포토시스-유도제, 응고제 등에 적용한다.

그것은 그 단백질의 생물학적 기능의 활성을 정의하는 단백질의 상호작용적 능력 및 특성이기 때문에, 어떤 아미노산 서열 치환은 단백질 서열(또는 물론 DNA 서열 상에 위치)에서 만들어질 수 있고, 그럼에도 불구하고 유사한(작용제의) 특성을 가지는 단백질을 얻을 수 있다. 따라서 다양한 변화들이 그것들의 생물학적 유용성 또는 활성의 상당한 손실 없이 항체 또는 치료제의 서열(또는 DNA 서열 상에 위치)에서 만들어질 수 있다. DNA 서열 상에 위치하는 돌연변이로부터 만들어지는 생물학적 기능 동등체는 표 1에서 본원에서 제공된 코돈 정보 및 부위 특이적 돌연변이 유발을 지지하는 기술적 상세사항을 사용하여 만들어질 수 있다.

"생물학적 기능 동등체(biologically functional equivalent)" 단백질 또는 펩티드에 내재된 정의는 분자의 정의된 부분 내에 만들어질 수 있는 변화의 수에 제한이 있으며, 여전히 허용가능한 수준의 동등한 생물학적 활성을 가지는 분자를 만들어낼 수 있다는 개념이라는 것 또한 당업자들은 잘 이해할 것이다. 생물학적 기능 동등체 단백질 및 펩티드는 따라서 대개 또는 모든 아미노산이 아닌 어떤 아미노산이 치환될 수 있다. 물론, 서로 다른 치환을 가지는 대다수의 별개의 단백질/펩티드들이 쉽게 만들어질 수 있으며, 본 발명에 따라 사용된다. 이와 같은 "생물학적 기능 동등체" 펩티드들은 본원에 기재된 것과 같은 "실질적으로 동등한(substantially homologous)" 서열의 추가 예로서 간주될 수 있다.

아미노산 치환은 일반적으로 아미노산 측쇄 치환기의 상대적 유사성, 예를 들어 그것들의 소수성(hydrophobicity), 친수성(hydrophilicity), 전하(charge), 크기(size) 등에 기초한다. 아미노산 측쇄 치환기의 크기, 모양 및 타입의 분석은 아르기닌, 리신 및 히스티딘이 모두 양으로 대전된 잔기이며; 알라닌, 글라이신 및 세린이 모두 유사한 크기이고; 페닐알라닌, 트립토판 및 티로신이 모두 일반적으로 유사한 모양을 가진다는 것을 보여준다. 따라서, 이러한 고려들에 기초한, 아르기닌, 리신 및 히스티딘; 알라닌, 글라이신 및 세린; 및 페닐알라닌, 트립토판 및 티로신은 생물학적 기능 동등체로서 본원에 정의된다.

더욱 정량적인 변화를 만드는 것에서, 아미노산의 수치적 지수(hydropathic index)가 고려될 수 있다. 각각의 아미노산은 그것들의 소수성 및 전하 특성에 기초하여 수치적 지수를 정하였으며, 이것들은: 이소루이신(+4.5); 발린(+4.2); 루이신(+3.8); 페닐알라닌(+2.8); 시스테인/시스틴(+2.5); 메티오닌(+1.9); 알라닌(+1.8); 글리신(-0.4); 쓰레오닌(-0.7); 세린(-0.8); 트립토판(-0.9); 티로신(-1.3); 프롤린(-1.6); 히스티딘(-3.2); 글루타메이트(-3.5); 글루타민(-3.5); 아스파테이트(-3.5); 아스파라긴(-3.5); 리신(-3.9) 및 아르기닌(-4.5)이다.

단백질에 상호작용적 생물학적 기능을 부여하는 수치적 아미노산 지수의 중요성은 일반적으로 당업계에서 양해가 되었다(Kyte and Doolittle, 1982, 참조로서 본원에 통합되어 있음). 어떤 아미노산은 유사한 수치적 지수 또는 점수(score)를 가지는 아미노산을 대신할 수 있으며, 여전히 유사한 생물학적 활성을 유지한다. 수치적 지수에 기초한 변화를 만드는 것에서, 수치적 지수가 ±2 이내인 아미노산의 치환이 바람직하며, 수치적 지수가 ±1 이내인 것이 특히 바람직하며, ±0.5 이내인 것이 심지어 더욱 특히 바람직하다.

따라서, 아미노산은 유사한 수치값을 가지는 다른 것으로 치환될 수 있으며, 여전히 생물학적으로 동등한 단백질을 얻을 수 있다는 것을 알 수 있다. 미국 특허등록번호 제4,554,101호(참조로서 본원에 통합되어 있음)에 상세히 설명되어 있는 바와 같이, 하기의 친수성 값들이 아미노산 잔기에 지정된다: 아르기닌(+3.0); 리신(+3.0); 아스파테이트(+3.0±1); 글루타메이트(+3.0±1); 세린(+0.3); 아스파라긴(+0.2); 글루타민(+0.2); 글리신(0); 쓰레오닌(-0.4); 프롤린(-0.5±1); 알라닌(-0.5); 히스티딘(-0.5); 시스테인(-1.0); 메티오닌(-1.3); 발린(-1.5); 루이신(-1.8); 이소루이신(-1.8); 티로신(-2.3); 페닐알라닌(-2.5); 트립토판(-3.4).

친수성 값에 기초한 변화를 만드는 것에서, 친수성 값이 ±2 이내인 아미노산의 치환이 바람직하며, ±1 이내인 것이 특히 바람직하며, ±0.5 이내인 것이 심지어 더욱 특히 바람직하다.

C8 . 융합 단백질 및 재조합 발현

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 분자 생물학 기술을 사용하여 융합 단백질로서 쉽게 제조될 수 있다. 임의의 융합 단백질이 본원에 기재된 임의의 치료제 및 당업계에 공지된 것들을 사용하여 설계되고 만들어질 수 있다. 융합 단백질 기술은 두개의 부분이 선택적으로 절단가능한 펩티드 서열에 연결되는 융합 단백질을 제조하기 위하여 쉽게 개조될 수 있다. 임의의 치료제는 항체의 말단 또는 CDRs로부터 멀리 떨어진 임의의 지점에 부착될 수 있다. 치료제는 또한 "완전체로(integrally)" 제조될 수 있으며, 여기에서 그것들은 바람직하게는 표적화 후 약제를 방출할 수 있도록 선택적으로 절단가능한 펩티드와 결합된다.

이와 같은 목적을 달성하기 위한 재조합 DNA 기술의 사용은 현재 당업계에 알려진 관행이다. 이 방법들은 예를 들어, 시험관 내 재조합 DNA 기술, 합성 기술 및 생체 내 재조합/유전학적 재조합을 포함한다. DNA 및 RNA 합성은 부가적으로 자동화된 합성기(automated synthesizer)를 사용하여 수행될 수 있다(예를 들어, 참조에 의해 본원에 통합되어 있는 샘브룩 등(Sambrook et al., 1989)에 의해 개시된 기술을 참조하라).

이와 같은 융합 단백질의 제조는 일반적으로 원하는 융합 단백질을 암호화하는 단일 코딩 영역을 제조하기 위한 제1 및 제2 DNA 코딩 영역의 제조 및 골격에 맞도록 이와 같은 영역의 기능적 연결 및 접합을 수반한다. 이와 관련하여, VEGFR2-차단성 인간 항-VEGF 항체 서열은 치료제를 암호화하는 DNA 서열과 골격에 맞게 접합될 것이다. 구조물의 부분이 N-말단 영역으로 또는 C-말단 영역으로 제조되는 것은 일반적으로 밀접하게 관련된다고 간주되지 않는다.

일단 원하는 코딩 영역이 생산되면, 발현 벡터가 생성된다. 발현 벡터는 DNA의 전사를 촉진하기 위하여 작용하고 따라서 암호화된 재조합 단백질의 발현을 촉진하는 삽입된 DNA 영역의 상류에 하나 또는 그 이상의 프로모터를 포함한다. 이것이 "재조합 발현(recombinant expression)"을 의미한다.

소위 본 발명의 "재조합" 형태의 VEGFR2-차단성 인간 항-VEGF 항체 또는 그것들의 면역접합체를 얻기 위하여, 그것은 재조합 세포에서 발현된다. 원핵 또는 진핵 시스템에서의 발현을 위한 DNA 절편의 조작은 재조합 발현에서 당업계에 일반적으로 공지된 기술에 의해 수행될 수 있다. 사실상 임의의 발현 시스템이 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체 구조물의 발현에 사용될 수 있다고 간주된다.

이와 같은 단백질은 진핵 발현 시스템, 예를 들어, CHO 세포에서 성공적으로 발현될 수 있으나, E. coli pQE-60과 같은 박테리아의 발현 시스템은 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체의 대규모 제조 및 뒤이은 정제에 특히 유용할 것이라고 전망된다. cDNA 또한 α-갈락토시다아제(α-galactosidase), 유비퀴틴(ubiquitin), 시스토소마 자포니쿰 글루타치온 S-트랜스퍼라아제(Schistosoma japonicum glutathione S-transferase) 등과의 융합으로서 발현될 암호화된 단백질과 함께 박테리아의 시스템에서 발현될 수 있다. 박테리아의 발현은 사용의 용이성 및 그것에 의하여 얻어지는 물질의 품질의 면에서 원핵성 발현 이상의 이점을 가질 것이라고 간주하였다.

세균성 발현의 면에서, 미국 특허등록번호 제5,583,013호, 제5,221,619호, 제4,785,420호, 제4,704,362호 및 제4,366,246호는 재조합 숙주 세포에서의 유전자의 발현과 관련하여 본 명세서를 더 보충하기 위한 목적으로 참조에 의하여 본원에 통합되어 있다.

재조합적으로 생산된 VEGFR2-차단성 인간 항-VEGF 항체 면역접합체는 인간 투여용으로 정제되고 제형화될 수 있다. 대안적으로, 면역접합체를 암호화하는 핵산이 유전자 치료를 통하여 운반될 수 있다. 비록 나상의 재조합 DNA 또는 플라스미드가 사용될 수 있다 할지라도, 리포좀 또는 벡터의 사용이 바람직하다.

수용체 매개성 엔도시토시스(endocytosis)를 통하여 세포로 들어가고, 숙주 세포의 게놈 안으로 통합되며, 바이러스 유전자를 안정하고 효과적으로 발현하기 위한 어떤 바이러스의 능력은 그것들이 포유동물의 세포 안으로 외래 유전자를 전달하기 위한 강력한 후보물질이 되도록 한다. 본 발명에 사용하기 위한 바람직한 유전자 치료 벡터는 일반적으로 바이러스성 벡터일 것이다.

레트로바이러스는 그것들의 유전자를 숙주 게놈 안으로 통합시키고, 많은 양의 외래 유전 물질을 전달하며, 넓은 범위의 종 및 세포 타입을 감염시키고, 고유 세포주에 패키지될 수 있는 그것들의 능력 때문에, 유전자 운반 벡터로서의 가능성을 가진다. (참조로서 본원에 통합되어 있는) 미국 특허등록번호 제5,139,941호에 기재된 것들과 같은 아데노바이러스, 단순포진 바이러스(HSV), 사이토메갈로바이러스(CMV) 및 아데노 관련 바이러스(AAV)와 같은 다른 바이러스들 또한 유전자 전달을 위한 벡터로서 제공되도록 조작될 수 있다.

비록 외래 유전 물질을 받아들일 수 있는 몇몇의 바이러스가 그것들이 수용할 수 있는 뉴클레오티드의 수 및 그것들이 감염시킬 수 있는 다양한 세포의 수로 제한된다 할지라도, 이 바이러스들은 유전자 발현을 성공적으로 달성한다고 증명되었다. 그러나, 아데노바이러스는 그것들의 유전 물질을 숙주 게놈 안으로 통합하지 않기 때문에 유전자 발현을 위한 숙주 세포의 복제를 필요로 하지 않고, 빠르고 효과적이며 이종 유전자 발현에 이상적으로 적합하도록 만들어 준다. 복제 결함 감염성 바이러스(replication-defective infective viruses)를 제조하기 위한 기술들은 당업계에 잘 알려져 있다.

어떤 다른 구현에서, 유전자 치료 벡터는 HSV일 것이다. HSV를 매력적인 벡터로 만들어 주는 인자는 게놈의 크기와 조직(organization)이다. HSV는 크기 때문에, 다중 유전자 또는 발현 카세트의 통합이 다른 더욱 작은 바이러스 시스템에서 보다 덜 문제된다. 게다가, 다양한 작업(예를 들어, 시간, 힘)을 사용하는 다른 바이러스 조절 서열의 유효성은 다른 시스템에서 보다 더욱 넓은 범위로 발현을 조절할 수 있게 한다. 상기 바이러스는 상대적으로 적게 접합된 메시지(spliced messages)를 가지며, 유전자 조작을 더욱 쉽게 한다. HSV는 또한 상대적으로 조작하기 쉽고, 고농도로 배양할 수 있다.

물론, 바이러스 운반 시스템을 사용하는 것에 있어서, 그것이 세포, 동물 또는 벡터 구조물을 받아들이는 개체에서 임의의 부적당한 반응을 야기하지 않게 하기 위하여, 결손 간섭 바이러스 입자(defective interfering viral particles) 또는 내독소(endotoxins)와 같은 바람직하지 않은 오염물질 또는 다른 발열인자(pyrogens)를 본질적으로 포함하지 않도록 만들기 위하여 충분히 비리온(virion)을 정제하는 것이 바람직할 것이다. 벡터를 정제하는 바람직한 방법은 세슘 클로라이드 기울기 원심분리와 같은 부력 밀도 기울기(buoyant density gradients)의 사용을 포함한다.

C9 . 항체 접합체

VEGFR2-차단성 인간 항-VEGF 항체는 "면역독소(immunotoxins)"를 제조하기 위하여 항종양 또는 세포독성 약제에 접합될 수 있거나; 직접적 또는 간접적으로 응고를 자극할 수 있는 성분과 작동가능하게 결합되어 "응고리간드(coaguligand)"를 형성한다. 응고리간드에서, 상기 항체는 직접 또는 간접 응고 인자와 간접적으로 연결될 수 있거나, 직접 또는 간접 응고 인자와 결합하여 방출되는 제2의 결합 영역에 연결될 수 있다. '제2의 결합 영역(second binding region)' 접근법은 일반적으로 제2의 결합 영역으로서 응고제-결합 항체를 사용하여 이중 특이성 항체 구조물을 생성한다. 일반적으로 이중 특이성 항체의 제조 및 용도는 당업계에 잘 알려져 있으며, 본원에 더 기재되어 있다.

면역독소, 응고 리간드 및 이중 특이성 항체의 제조에서, 재조합 발현이 사용될 수 있다. 발현 유닛 또는 벡터를 생성하기 위하여, 선택된 독소, 응고제 또는 제2의 결합 영역을 암호화하는 핵산 서열에 선택된 항체를 암호화하는 핵산 서열이 골격에 맞게 부착된다. 재조합 발현은 새로운 핵산의 번역을 야기하여 원하는 단백질 산물을 산출한다. 비록 단백질 결합 리간드보다 항체를 암호화하는 핵산이 사용된다 할지라도, 재조합적 접근은 여기에 기재되어 있는 것들과 본질적으로 동일하다.

접합 기술로 되돌아가서, 면역독소의 제조는 일반적으로 당업계에 잘 알려져 있다. 그러나, 어떤 이점은 면역독소의 제조 및 이후의 임상 투여를 위한 그것들의 정제 모두에서의 어떤 바람직한 기술의 적용을 통하여 달성될 수 있다. 예를 들면, IgG에 기초한 면역독소가 Fab' 대응물(counterparts)보다 전형적으로 더 나은 결합 능력 및 더욱 느린 혈액 청소율을 나타내는 반면, Fab' 단편에 기초한 면역독소는 일반적으로 IgG에 기초한 면역독소에 비하여 더 나은 조직 침투 능력을 나타낼 것이다.

부가적으로, 독소 부분을 VEGFR2-차단성 인간 항-VEGF 항체에 접합시키는 데 성공적으로 사용될 수 있는 다수의 형태의 이황화 결합을 포함하는 링커들이 공지되어 있는 반면, 어떤 링커들은 일반적으로 서로 다른 약제학적 특성 및 능력에 기초한 다른 링커들 이상으로 더 바람직할 것이다. 예를 들면, 입체적 "장애 구조를 가진(hindered)" 이황화 결합을 포함하는 링커들은 생체 내에서의 더 큰 안정성으로 인하여 작용 부위에 결합하기 이전에 독소 부위의 방출을 예방하기 때문에 바람직하다.

다양한 세포독성 약제가 VEGFR2-차단성 인간 항-VEGF 항체에 접합될 수 있다고 알려져 있으며, 식물 유래, 곰팡이 유래 및 리신 A 사슬 또는 탈글리코실화된 A 사슬과 같은 세균 유래의 독소를 포함한다. 어떤 경우에 있어서, 항체에 대한 독소 A 사슬의 가교결합은 이황화물 기능이 존재하는 가교 결합제를 필요로 한다. 이것에 대한 이유는 명확하지 않으나, 어떤 독소 부분은 항체로부터 쉽게 방출될 필요가 있으며 약제는 독소를 표적 세포로 "운반"해야 하기 때문일 것이다.

각 형태의 가교결합제 뿐만 아니라 어떻게 가교결합을 수행할 것인가는 그 결과 생성될 접합체의 약물동력학에 따라 달라질 것이다. 궁극적으로, 방출가능한 독소가 고려될 경우에, 그것은 작용의 의도된 부위를 제외한 신체의 어느 곳에서나 발견되는 조건 하에서 완전함을 유지할 접합체를 가지는 것이 바람직하며, 어느 시점에서 접합체는 우수한 "방출" 특성을 가지는 것이 바람직하다. 따라서, 사용된 특정 가교 결합제 및 가교결합된 구조를 특별히 포함하는 특정 가교결합 도식은 어떤 중요한 것일 것이다.

융합 단백질의 일부분으로서 사용된 특정 독소 화합물에 따라서, 이황화 결합된 루프 구조 안으로 폴딩될 수 있는 항체 및 독소 화합물에 작동가능하게 부착하는 펩티드 스페이서(peptide spacer)를 제공할 필요가 있을 것이다. 루프 내에서의 단백질 가수분해성 절단은 그 후 이종이량체성 폴리펩티드를 생성할 것이며, 여기에서 상기 항체 및 독소 화합물은 단지 단일 이황화 결합에 의해서만 연결된다. 이와 같은 독소의 예는 리신 A-사슬 독소이다.

어떤 다른 독소 화합물이 사용될 경우, 융합 단백질의 VEGFR2-차단성 인간 항-VEGF 항체 및 독소 화합물에 작동가능하게 부착하기 위하여 비절단성 펩티드 스페이서가 제공될 수 있다. 비절단성 펩티드 스페이서와 함께 사용될 수 있는 독소는 그것들 자신이 세포독성을 가진 이황화 결합된 형태로 단백질 분해성 절단에 의하여 전환될 수 있는 것들이다. 이와 같은 독소 화합물의 예는 슈도모나스 외독소 화합물(Pseudomonas exotoxin compound)이다.

표적 항원이 면역독소에 의한 효율적인 중독(intoxication)과 일치하는 방법으로 내면화되지 않는 경우, 그것이 항종양 약물, 다른 사이토카인, 항대사물질, 알킬화제, 호르몬 등과 같은 화학치료 약제를 표적으로 하는 것이 바람직할 경우와 같은 상황이 있을 것이다. 다양한 화학 치료제 및 다른 약제학적 약제가 현재 항체와 성공적으로 접합될 수 있고, 약제학적으로 기능함을 보여준다. 연구되고 있는 대표적인 항종양 약제는 독소루비신, 다우노마이신, 메토트렉세이트, 빈블라스틴 및 여러가지 다른 것들을 포함한다. 게다가, 네오카르지노스타틴, 마크로마이신, 트레니몬 및 α-아마니틴과 같은 다른 약제의 부착도 기재되어 있다.

C10 . 생화학적 가교결합제

상기에 제공된 일반적인 정보에 덧붙여, VEGFR2-차단성 인간 항-VEGF 항체는 어떤 바람직한 생화학적 가교결합제를 사용하여 하나 또는 그 이상의 치료제에 접합될 수 있다. 가교결합 시약은 두개의 서로 다른 분자의 작용기를 서로 연결하는 분자 가교(molecular bridge)를 형성하는 데 사용된다. 두개의 서로 다른 단백질을 순차적인 방법(step-wise manner)으로 연결하기 위하여, 원하지 않는 단일중합체(homopolymer) 형성을 제거하는데 이종의-두 기능을 가진 가교결합제(hetero-bifunctional cross-linkers)가 사용될 수 있다. 대표적인 이종의 두 기능을 가진 가교결합제는 표 2에 언급되어 있다.

이종의 두 기능을 가진 가교결합제 링커 반응성
(reactive toward)
이점 및 적용 가교결합 후
스페이서 암 길이
SMPT 1차 아민 설피드릴 더 큰 안정성 11.2A SPDP 1차 아민 설피드릴 티올화(thiolation)
절단가능한 가교결합
6.8A
LC-SPDP 1차 아민 설피드릴 확장된 스페이서 암 15.6A Sulfo-LC-SPDP 1차 아민 설피드릴 확장된 스페이서 암
수용성
15.6A
SMCC 1차 아민 설피드릴 안정한 말레이미드 반응기
효소-항체 접합
합텐-담체 단백질 접합
11.6A
Sulfo-SMCC 1차 아민 설피드릴 안정한 말레이미드 반응기
수용성
효소-항체 접합
11.6A
MBS 1차 아민 설피드릴 효소-항체 접합
합텐-담체 단백질 접합
9.9A
Sulfo-MBS 1차 아민 설피드릴 수용성 9.9A SIAB 1차 아민 설피드릴 효소-항체 접합 10.6A Sulfo-SIAB 1차 아민 설피드릴 수용성 10.6A SMPB 1차 아민 설피드릴 확장된 스페이서 암
효소-항체 접합
14.5A
Sulfo-SMPB 1차 아민 설피드릴 확장된 스페이서 암
수용성
14.5A
EDC/Sulfo-NHS 1차 아민 카복실기 합텐-담체 접합 0 ABH 탄수화물 비선택적 당 기와 반응 11.9A

이종의 두 기능을 가진 가교결합제는 두개의 반응기를 포함한다: 하나는 일반적으로 1차 아민기(예를 들어, N-하이드록시 숙신이미드(N-hydroxy succinimide))와 반응하고, 다른 하나는 일반적으로 티올기(예를 들어, 피리딜 디술파이드(pyridyl disulfide), 말레이미드(maleimides), 할로겐(halogens) 등)와 반응한다. 1차 아민 반응기를 통하여 가교결합제는 하나의 단백질(예를 들어, 선택된 항체 또는 단편)의 리신 잔기와 반응할 수 있고, 티올 반응기를 통하여 가교결합제는 다른 단백질(예를 들어, 응고제)의 (설피드릴기를 포함하지 않는) 시스테인 잔기와 반응하여 제1 단백질에 이미 연결된다.

따라서, 조성물들은 일반적으로 가교결합이 가능한 작용기를 가지거나, 가교결합이 가능한 작용기를 가지도록 유도체화된다. 이 필요조건은 이 방법에 사용될 수 있는 다양한 기들로 제한되는 것을 고려하지 않는다. 예를 들면, 1차 또는 2차 아민기, 하이드라지드(hydrazide) 또는 하이드라진기(hydrazine groups), 카르복실 알콜(carboxyl alcohol), 포스페이트(phosphate) 또는 알킬화기(alkylating groups)가 결합 또는 가교결합을 위하여 사용될 수 있다.

가교결합제의 두개의 반응기 사이의 스페이서 암(spacer arm)은 다양한 길이 및 화학적 조성을 가질 수 있다. 긴 스페이서 암은 접합체 성분의 유연성을 보다 좋게 함과 동시에, 몇몇의 특정 성분(예를 들어, 벤젠기)은 반응기에 대하여 여분의 안정성을 제공하거나 다양한 양상의 작용으로 연결된 화학물질의 증가된 저항성을 제공할 수 있다. 이와 같은 L-Leu-L-Ala-L-Leu-L-Ala와 같은 펩티드 스페이서의 사용 또한 고려된다.

혈액에서 상당한 안정성을 가지는 가교결합제가 사용되는 것이 바람직하다. 다양한 형태의 이황화 결합을 포함하는 링커들이 항체 및 독소 또는 응고제를 접합시키는 데 성공적으로 사용될 수 있다고 알려져 있다. 입체적 장애 구조를 가진 이황화 결합을 포함하는 링커들은 생체 내에서 작용 부위에 결합하기 이전에 시약의 방출을 예방하는, 더욱 큰 안정성을 제공하기 위하여 시험될 수 있다.

면역독소로 사용하기 위한 가장 바람직한 가교결합제 중 하나는 인접한 벤젠 고리 및 메틸기에 의하여 "입체적 장애 구조를 가진(sterically hindered)" 이황화 결합을 포함하는 이중 기능성 가교결합제인 SMPT이다. 이황화 결합의 입체적 장애는 조직 및 혈액에 존재할 수 있는 글루타치온과 같은 티올레이트 음이온에 의한 공격으로부터 결합을 보호하는 기능을 제공하며, 그것에 의하여 종양 부위로의 부착된 약제의 운반 이전에 접합체의 분리(decoupling)를 예방하는 데 도움이 된다고 여겨진다. SMPT 약제는 또한 본 발명의 이중 기능성 리간드와 함께 사용될 수 있다고 생각한다.

많은 다른 공지의 가교결합제들과 같이 SMPT 가교결합제는 시스테인 또는 1차 아민(예를 들어, 리신의 엡실론 아미노기)의 SH와 같은 가교결합 작용기에 대한 능력을 제공한다. 다른 가능한 형태의 가교결합제는 술포숙신이미딜-2-(p-아지도 살리실아미도) 에틸-1,3'-디티오프로피오네이트(sulfosuccinimidyl-2-(p-azido salicylamido) ethyl-1,3'-dithiopropionate)와 같은 절단가능한 이황화 결합을 포함하는 이종-이중 기능성 광반응성 페닐아지드(hetero-bifunctional photoreactive phenylazides)를 포함한다. N-하이드록시-숙신이미딜기는 1차 아미노기와 반응하며, (광분해 상에서) 페닐아지드는 임의의 아미노산 잔기와 비선택적으로 반응한다.

장애 구조를 가지는 가교결합제 뿐만 아니라, 장애 구조를 가지지 않는 링커들 또한 이와 함께 사용될 수 있다. 보호된 이황화물을 포함하거나 생성하는 것으로 고려되지 않는 다른 유용한 가교결합제들은 SATA, SPDP 및 2-이미노티올란(2-iminothiolane)을 포함한다. 이와 같은 가교결합제의 사용은 당업계에서 잘 이해된다.

일단 접합되면, 접합체는 비접합된 표적 및 치료제로부터 그리고 다른 오염물로부터 분리된다. 많은 수의 정제 기술들이 그것들이 임상적으로 유용할 정도로 충분한 정도의 순도를 가지는 접합체를 제공하는 데 사용될 수 있다. 겔 여과(gel filtration), 겔 침투(gel permeation) 또는 고성능 액체 크로마토그래피(high performance liquid chromatography)와 같은 크기 분별에 기초한 정제 방법이 가장 일반적으로 사용될 것이다. 블루 세파로오스 분리(Blue-Sepharose separation)와 같은 다른 크로마토그래피 기술 또한 사용될 수 있다.

C11 . 생물학적으로 방출가능한 링커

비록 임의의 연결 부분(linking moiety)가 혈액에서 상당한 안정성을 가질 것이라 할지라도, 어떤 양상에서 질병 또는 종양 부위에 대한 표적화 전에 부착된 시약의 실질적인 방출을 예방하기 위하여, 생물학적으로 방출가능한 결합 및/또는 선택적으로 절단가능한 스페이서의 사용이 고려된다. "생물학적으로 방출가능한 결합(biologically-releasable bonds)" 및 "선택적으로 절단가능한 스페이서(selectively cleavable spacers) 또는 링커(linkers)"는 여전히 순환에 있어서 상당한 안정성을 가진다.

따라서, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 생물학적으로 방출가능한 결합을 통하여 하나 또는 그 이상의 치료제와 연결될 수 있다. 비록 ScFv 단편이 어떤 구현에서 바람직할 것이라 할지라도, 임의의 형태의 VEGFR2-차단성 인간 항-VEGF 항체가 손상되지 않은 항체를 포함하여 사용될 수 있다.

"생물학적으로 방출가능한 결합" 또는 "선택적으로 가수분해가능한 결합(selectively hydrolyzable bonds)"는 어떤 조건 하에서 유일하게 또는 선택적으로 방출가능하고, 절단가능하거나 가수분해가능한 모든 결합을 포함한다. 이것은 각각 참조로서 본원에 특별히 통합되어 있는 미국 특허등록번호 제5,474,765호 및 제5,762,918호에 기재된 것과 같은 이황화(disulfide) 및 삼황화(trisulfide) 결합 및 산 불안정성(acid-labile) 결합을 포함한다.

본 발명의 항체에 치료제 또는 약물을 부착하기 위한 산 민감성 스페이서(acid sensitive spacer)의 사용이 특히 고려된다. 이와 같은 구현에서, 상기 치료제 또는 약물은 세포 내부에 있는 산성 구획(acidic compartments) 내로 방출된다. 산 민감성 방출은 세포외적으로 일어날 수 있지만, 여전히 바람직하게는 종양 부위에 대한 특이적 표적화 후에 일어날 수 있다. 어떤 현재의 바람직한 예는 산 민감성 스페이서를 통하여 콜키친 또는 독소루비신에 연결된 인간 항체를 포함한다. 항체의 탄수화물 부분을 통한 부착 또한 고려된다. 이와 같은 구현에서, 치료제 또는 약물은 세포 내부에 있는 산성 구획 내로 방출된다.

인간 항-VEGF 항체는 또한 생물학적으로 방출가능한 결합을 통하여 치료제의 부착을 가능하게 하는 작용기를 도입하기 위하여 유도체화될 수 있다. 따라서, 인간 항체는 하이드라지드, 하이드라진, 1차 아민기 또는 2차 아민기에 측쇄 종결(side-chain terminating)을 도입하기 위하여 유도체화될 수 있다. 치료제는 쉬프 염기 결합(Schiff's base linkage), 하이드라존(hydrazone) 또는 아실 하이드라존(acyl hydrazone) 결합 또는 하이드라지드 링커(hydrazide linker)를 통하여 접합될 수 있다(U.S. Patent No. 5,474,765 및 U.S. Patent No. 5,762,918; 각각 참조로서 본원에 통합되어 있음).

또한 각각 참조로서 본원에 특별히 통합되어 있는 미국 특허등록번호 제5,474,765호 및 제5,762,918호에 기재되어 있는 것과 같이, 인간 항-VEGF 항체는 펩티드 결합, 에스테르, 아미드, 포스포디에스테르 및 글리코시드를 포함하는 효소-민감성 결합(enzyme-sensitive bonds)인 하나 또는 그 이상의 생물학적으로 방출가능한 결합을 통하여 치료제에 작동가능하게 부착될 수 있다.

본 발명의 바람직한 양상은 질병 부위, 특히 종양의 환경 내에 선택적으로 위치된 펩티다아제 및/또는 프로테이나아제에 대한 적어도 제1의 절단 부위를 포함하는 펩티드 링커의 사용과 관련이 있다. 따라서, 부착된 치료제의 항체-매개성 운반은 질병 부위 또는 종양의 환경 내에 특이적인 절단을 야기하며, 활성제의 특이적 방출을 야기한다. 어떤 펩티드 링커는 리모델링에 관여하는 하나 또는 그 이상의 효소에 의해 인식되는 절단 부위를 포함할 것이다.

유로키나아제, 프로-유로키나아제, 플라스민, 플라스미노겐, TGFβ, 스태필로키나아제, 트롬빈, 인자 IXa, 인자 Xa 또는 간질성 콜라게나아제(interstitial collagenase), 젤라티나아제 또는 스트로멜리신과 같은 메탈로프로테이나아제에 대한 절단 부위를 포함하는 펩티드 링커가 특히 바람직하다. 미국 특허등록번호 제6,004,555호 및 제6,093,399호는 생물학적으로 방출가능한 결합 및 선택적으로 절단가능한 링커 및 펩티드를 포함하는 표적화 약제-치료제 구조물을 어떻게 만들고 사용할 수 있는가를 더 설명하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있다. 특히, 미국 특허등록번호 제5,877,289호 및 제6,342,221호는 종양의 환경 내에서 유로키나아제, 플라스민, 트롬빈, 인자 IXa, 인자 Xa 또는 간질성 콜라게나아제, 젤라티나아제 또는 스트로멜리신과 같은 메탈로프로테이나아제에 의하여 절단되는 선택적으로 절단가능한 펩티드 링커를 포함하는 항체 구조물을 어떻게 만들고 사용할 수 있는가를 더 설명하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있다.

현재의 바람직한 선택적으로 절단가능한 펩티드 링커는 플라스민 또는 간질성 콜라게나아제, 젤라티나아제 또는 스트로멜리신과 같은 메탈로프로테이나아제(또한 "매트릭스 메탈로프로테아제(matrix metalloproteases)" 또는 "MMPs"로도 알려져 있음)에 대한 절단 부위를 포함하는 것들이다. 본 발명과 함께 유익하게 사용될 수 있는 부가적인 펩티드 링커는 참조로서 본원에 특별히 통합되어 있는 미국 특허등록번호 제6,342,221호에 기재되고 청구되어 있는 특정 서열들을 포함하는, 예를 들어, 프로-유로키나아제, TGFβ, 플라스미노겐, 스태필로키나아제, 젤라티나아제 A, 다양한 콜라겐들, α2M, PZP, α1M, α1I3(2J) 및 α1I3(27J)로부터의 절단가능한 서열을 포함한다.

C12 . 이중 특이성 항체

이중 특이성 항체는 본 발명의 응고리간드 및 조합된 항신생혈관제 양상에 특히 유용하다. 그러나, 일반적으로 이중 특이성 항체는 하나의 암(arm)이 VEGF에 결합하는 한 사용될 수 있고, 상기 이중 특이성 항체는 치료제, 일반적으로 항원 결합 부위로부터 멀리 떨어진 부위에 부착된다.

일반적으로, 이중 특이성 항체의 제조는 당업계에 잘 알려져 있다. 하나의 방법은 표적 항원에 대한 특이성을 가지는 항체의 개별적인 제조를 포함하며, 다른 하나의 방법은 (본원에서와 같이) 응고제에 대한 특이성을 가지는 항체의 개별적인 제조를 포함한다. 펩틱 F(ab'γ)2 단편은 두개의 선택된 항체로부터 제조된 후, 각각 개별적인 Fab'γSH 단편을 제공하기 위하여 환원된다. 결합될 두개의 파트너 중 하나에서의 SH 기는 그 후 하나의 파트너 상에서 유리 말레이미드 기(free maleimide groups)를 제공하기 위하여 o-페닐렌디말레이미드(o-phenylenedimaleimide)와 같은 가교결합제를 사용하여 알킬화된다. 이 파트너는 그 후 원하는 F(ab'γ)2 이종접합체를 얻기 위하여 티오에티르 결합에 의하여 다른 쪽과 접합될 수 있다. 다른 기술도 공지되어 있으며, 여기에서 SPDP 또는 단백질 A를 사용한 가교결합이 수행되거나, 삼중특이성 구조물이 제조된다.

D. 약제학적 조성물

본 발명의 약제학적 조성물은 일반적으로 약제학적으로 허용가능한 담체 또는 수성 매질에 용해되거나 분산된 유효량의 적어도 제1의 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체를 포함할 것이다. 조합된 치료제들 또한 고려되며, 동일한 형태의 기본적인 약제학적 조성물이 단일 및 조합된 약제 모두에 대하여 사용될 수 있다.

문구 "약제학적으로 또는 약리학적으로 허용가능한(pharmaceutically or pharmacologically acceptable)"은 적절한 경우 동물 또는 인간에 투여될 때, 불리한(adverse), 알레르기성의(allergic) 또는 다른 부적당한 반응을 만들어내지 않는 분자 화합물(molecular entities) 및 조성물을 말한다. 수의적 용도는 본 발명 내에 동등하게 포함되며, "약제학적으로 허용가능한" 제형은 임상 및/또는 수의적 용도 모두를 위한 제형을 포함한다.

본원에 사용된 것으로서, "약제학적으로 허용가능한 담체(pharmaceutically acceptable carrier)"는 임의 및 모든 용매(solvents), 분산 매질(dispersion media), 코팅(coatings), 항균제 및 항진균제, 등장성 및 흡수 지연제 등을 포함한다. 약제학적 활성 물질을 위한 이와 같은 매질 및 약제의 사용은 당업계에 잘 알려져 있다. 임의의 기존의 매질 또는 약제가 활성 성분(active ingredient)과 맞지 않는 경우를 제외하고는, 치료학적 조성물에서의 그것의 사용이 고려된다. 인간에 대한 투여를 위하여, 제조는 FDA 부서의 생물학적 기준에 의해 요구되는 멸균(sterility), 발열원(pyrogenicity), 일반적인 안전성 및 순도 기준을 만족해야 한다. 추가의 활성 성분 또한 조성물 내로 포함될 수 있다.

"단위 투여형(unit dosage)" 제형은 특별히 시간차를 둔 운반을 위하여 개조된 1회 용량(dose) 또는 서브 용량(sub-dose)의 투여된 성분을 포함하는 것이다. 예를 들면, 대표적인 "단위 투여형" 제형은 일일 용량(daily dose) 또는 단위(unit) 또는 일일 서브 용량(daily sub-dose) 또는 1주 용량(weekly dose) 또는 단위 또는 1주 서브 용량 등을 포함하는 것이다.

D1 . 주사 가능한 제형

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체는 대단히 자주 비경구 투여를 위하여 제형화, 예를 들어 정맥내(intravenous), 근육내(intramuscular), 피하내(sub-cutaneous), 경피내(transdermal) 또는 종양 또는 질병 부위 내로의 연동식 투여(peristaltic administration) 및 직접적인 점적(instillation)을 포함하는 다른 이와 같은 경로를 통한 주사를 위하여 제형화될 것이다. 활성 성분으로서 이와 같은 항체 또는 면역접합체를 포함하는 수성 조성물의 제조는 본 발명의 명세서를 고려하여 당업자들에게 잘 알려져 있을 것이다. 전형적으로, 이와 같은 조성물들은 수용액 또는 현탁액 중 어느 하나로서 주사가능하게 제조될 수 있고; 주사 전에 액체의 첨가에 의해 용액 또는 현탁액을 제조하는 데 적합한 고체 형태 또한 제조될 수 있으며; 상기 제조물들은 또한 에멀젼화될 수 있다.

주사용으로 적합한 약제학적 형태는 멸균 수용액 또는 분산액; 참기름, 땅콩기름 또는 수성 프로필렌 글리콜을 포함하는 제형; 및 멸균 주사 용액 또는 분산액의 즉석 제조(extemporaneous preparation)을 위한 멸균 파우더를 포함한다. 모든경우에 있어서, 상기 형태는 멸균되고 주사능이 존재할 정도까지 유동적이어야 한다. 그것은 제조 및 저장의 조건 하에서 안정해야 하며, 박테리아 및 곰팡이와 같은 미생물의 오염 작용에 대하여 보호되어야 한다.

VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체 조성물은 중성 또는 염의 형태로 멸균된 수성 조성물 내로 제형화될 수 있다. 유리 염기(free base) 또는 약제학적으로 허용가능한 염과 같은 용액은 물에서 하이드록시프로필셀룰로오스(hydroxypropylcellulose)와 같은 계면활성제와 함께 적당하게 혼합하여 제조될 수 있다. 약제학적으로 허용가능한 염은 (단백질의 유리 아미노기를 사용하여 형성된) 산 부가 염(acid addition salts) 및 예를 들어, 염산(hydrochloric acid) 또는 인산(phosphoric acid)과 같은 무기산 또는 아세트산, 트리플루오로아세트산, 옥살산, 타르타르산, 만델산 등과 같은 유기산을 사용하여 형성된 것들을 포함한다. 유기 카르복실기를 사용하여 형성된 염은 또한 예를 들어, 소디움, 포타슘, 암모늄, 칼슘, 또는 페릭 하이드록사이드(ferric hydroxides)와 같은 무기 염기 및 이소프로필아민, 트리메틸아민, 히스티딘, 프로카인 등과 같은 유기 염기로부터 유래될 수 있다.

적절한 담체는 예를 들어, 물, 에탄올, 폴리올(예를 들어, 글리세롤, 프로필렌 글리콜 및 수성 폴리에틸렌 글리콜 등), 그것들의 적절한 혼합물 및 야채 오일을 포함하는 용매 및 분산 매질을 포함한다. 많은 경우에 있어서, 그것은 등장화제(isotonic agents), 예를 들어, 설탕(sugar) 또는 소디움 클로라이드(sodium chloride)를 포함하는 것이 바람직할 것이다. 적절한 유동성은 예를 들어, 레시틴과 같은 코팅의 사용에 의하여, 분산의 경우에 요구되는 입자 크기의 유지에 의하여, 및/또는 계면활성제의 사용에 의하여 유지될 수 있다.

저장 및 사용의 보통의 조건 하에서, 모든 이와 같은 제조는 미생물의 성장을 방지하기 위하여 방부제가 첨가되어야 한다. 미생물 작용의 예방은 다양한 항균제 및 항진균제, 예를 들어 파라벤(parabens), 클로로부탄올(chlorobutanol), 페놀(phenol), 소르빈산(sorbic acid), 티메로살(thimerosal) 등에 의하여 얻어질 수 있다. 주사 가능한 조성물의 장기적인 흡수는 흡수를 지연시키는 약제, 예를 들어 알루미늄 모노스테아레이트(aluminum monostearate) 및 젤라틴의 조성물에서의 사용에 의해 얻어질 수 있다.

제형화 이전 또는 중에, VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체는 바람직하지 않은 작은 분자량의 분자들을 제거하기 위하여 광범위하게 투석되어야 하고/하거나 적절한 경우 바람직한 비히클(vehicle) 내로 더욱 쉽게 제형화하기 위하여 감압하에 동결건조되어야 한다. 멸균된 주사 가능한 용액은 상기에 열거된 다양한 다른 성분과 함께 적절한 용매에 필수적인 양으로 활성 성분을 통합시키고, 원한다면 그 후 멸균시스템으로 여과됨으로써 제조된다. 일반적으로 분산액은 염기성 분산 매질 및 상기에 열거된 것들로부터의 필수의 다른 성분을 포함하는 멸균된 비히클 내로 다양한 멸균된 활성 성분을 통합시킴으로써 제조된다.

멸균된 주사 가능한 용액의 제조를 위한 멸균 파우더의 경우에 있어서, 제조의 바람직한 방법은 활성 성분의 파우더에 더하여 그것들의 이미 멸균-여과된 용액으로부터의 임의의 부가적인 바람직한 성분을 생성하는 진공 건조(vacuum-drying) 및 동결 건조(freeze-drying) 기술이다.

본 발명에 따른 적절한 약제학적 조성물은 일반적으로 발명의 용도에 따라 다양한 최종 농도를 제공하기 위하여, 멸균 수용액과 같은 약제학적으로 허용가능한 희석제 또는 첨가제와 함께 혼합된 상당한 양의 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체를 포함할 것이다. 제조를 위한 기술은 일반적으로 참조로서 본원에 통합되어 있는 레밍턴의 제약에 설명된 것과 같이 당업계에 잘 알려져 있다(Remington's Pharmaceutical Sciences, 16th Ed. Mack Publishing Company, 1980). 내독소 오염은 안전한 수준에서 최소한으로, 예를 들어 0.5ng/mg 단백질을 넘지 않게 유지되어야 함을 확인하여야 한다. 더욱이, 인간의 투여에 대하여, 제조는 FDA 부서의 생물학적 기준에 의해 요구되는 멸균(sterility), 발열원(pyrogenicity), 일반적인 안전성 및 순도 기준을 만족해야 한다. 제형화에서, 상기 항체 또는 면역접합체 용액은 투여 제형에 적합한 방법으로 투여될 것이며, 이와 같은 양은 치료학적으로 효과적이다.

D2 . 지속 방출형 제형

VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체 용액 제형은 상기에 기재된 주사 가능한 용액의 형태와 같은 다양한 투여 형태로 쉽게 투여될 수 있지만, 다른 약제학적으로 허용가능한 형태, 예를 들어 정제(tablets), 알약(pills), 캡슐(capsules) 또는 다른 경구 투여를 위한 고체, 좌약(suppositories), 페서리(pessaries), 비강(nasal) 용액 또는 스프레이, 에어로졸(aerosols), 흡입제(inhalants), 국부 제형(topical formulation), 리포좀성 형태(liposomal forms) 등도 고려된다. 투여를 위한 형태의 타입은 치료될 질병 또는 질환과 매치되어야 할 것이다.

약제학적 "서방형(slow release)" 캡슐 또는 "지속 방출형(sustained release)" 조성물 또는 제조물이 사용될 수 있고, 일반적으로 적용가능하다. 서방형 제형은 일반적으로 넓은 범위에 걸쳐 일정한 약물 농도를 제공하도록 설계되며, 본 발명에 따른 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체를 운반하는 데 사용될 수 있다. 서방형 제형은 전형적으로 질병 부위, 예를 들어 종양의 부위에 근접하여 이식된다.

지속 방출형 제조물의 적절한 예는 매트릭스가 성형품(shaped articles)의 형태, 예를 들어 필름 또는 마이크로캡슐인, 항체 또는 면역접합체를 포함하는 고형의 소수성 폴리머의 반투과성 매트릭스를 포함한다. 지속 방출형 매트릭스의 예는 폴리에스테르(polyesters); 하이드로겔(hydrogels), 예를 들어, 폴리(2-하이드록시에틸-메타크릴레이트)(poly(2-hydroxyethyl-methacrylate) 또는 폴리(비닐알코올)(poly(vinylalcohol)); 폴리락티드(polylactides), 예를 들어, 미국 특허등록번호 제3,773,919호; L-글루탐산과 γ-글루타메이트의 공중합체; 비분해성 에틸렌-비닐 아세테이트(non-degradable ethylene-vinyl acetate); 루프론 데포TM(Lupron DepotTM)(젖산-글리콜산 공중합체 및 류프롤라이드 아세테이트(leuprolide acetate)로 구성되는 주사 가능한 마이크로스피어)과 같은 분해성 젖산-글리콜산 공중합체(degradable lactic acid-glycolic acid copolymers); 및 폴리-D-(-)-3-하이드록시부티르산(poly-D-(-)-3-hydroxybutyric acid)을 포함한다.

에틸렌-비닐 아세테이트 및 젖산-글리콜산과 같은 폴리머가 100일에 걸쳐 분자들을 방출할 수 있게 하는 반면에, 어떤 하이드로겔은 더욱 짧은 시간 동안 단백질을 방출한다. 캡슐화된 항체가 신체에서 긴 시간동안 유지되는 경우, 그것들은 37℃에서 습기에 노출된 결과로서 변성되거나 응집될 수 있으므로, 생물학적 활성이 감소되고/되거나 면역성이 변한다. 합리적인 방법이 관련된 메카니즘에 따른 안정화에 사용될 수 있다. 예를 들면, 만일 응집 메카니즘이 티오-이황화물의 상호교환(interchange)을 통한 분자간 S-S 결합 형성을 수반한다면, 안정화는 설피드릴 잔기를 변경하고, 산성 용액에서 감압하에 동결건조시키고, 습기의 양을 조절하고, 적절한 첨가제를 사용하고, 특이적 폴리머 매트릭스 조성물을 개발하는 것 등에 의해 달성된다.

D3 . 리포좀 및 나노입자

어떤 구현에서, 리포좀 및/또는 나노입자들 또한 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체와 함께 사용될 수 있다. 리포좀의 형성 및 사용은 일반적으로 하기에 요약한 것과 같이 당업자들에게 잘 알려져 있다.

리포좀은 수성 매질에 분산된 인지질로부터 형성되며, 자발적으로 다층형 단축성 이중층 소포체(multilamellar concentric bilayer vesicles)(또한 다중층 소포체(multilamellar vesicles; MLVs) 라고도 불림)을 형성한다. MLVs는 일반적으로 25nm 내지 4μm 범위의 지름을 가진다. MLVs의 초음파 분해(sonication)는 중심 안에 수용액을 포함하는, 200 내지 500Å 범위의 지름을 가지는 작은 단일층 소포체(small unilamellar vesicles; SUVs)를 형성한다.

인지질은 물에 대한 지질의 몰비에 따라, 물에 분산될 때 리포좀 외에 다양한 구조를 형성할 수 있다. 낮은 비율에서, 리포좀은 바람직한 구조이다. 리포좀의 물리적 특성은 pH, 이온 세기 및 이가 양이온의 존재에 의존한다. 리포좀은 이온성 및 극성 물질에 대하여 낮은 투과성을 보일 수 있지만, 상승된 온도에서는 그것들의 투과성을 현저하게 변화시키는 상 전이(phase transition)를 겪는다. 상기 상 전이는 겔 상태(gel state)로 알려져 있는 밀집되고(closely packed) 질서정연한 구조에서 유동성 상태(fluid state)로 알려져 있는 덜 밀집되고(loosely packed), 덜 질서정연한(less-ordered) 구조로의 변화를 포함한다. 이것은 특징적인 상-전이 온도에서 일어나며, 이온, 설탕 및 약물에 대한 투과성을 증가시킨다.

리포좀은 4개의 서로 다른 메카니즘을 통하여 세포와 상호작용한다: 대식세포 및 호중성 백혈구와 같은 세망내피계 시스템(reticuloendothelial system)의 식세포(phagocytic cell)에 의한 엔도시토시스(endocytosis); 비특이적인 약한 소수성 또는 정전기적 힘 중 어느 하나에 의한 또는 세포 표면 성분과의 특이적 상호작용에 의한 세포 표면에의 부착; 세포질 내로의 리포좀성 내용물의 동시 방출과 함께 혈장막 내로의 지질 이중층의 삽입에 의한 혈장 세포막과의 융합; 및 리포좀 내용물의 임의의 연합 없이, 리포좀성 지질의 세포막 또는 세포내(subcellular)의 막으로의 이동 또는 그 반대에 의한 것. 리포좀 제형을 변화시키는 것은 비록 하나 이상이 동시에 작용할 수 있을지라도, 메카니즘이 작용하도록 변경될 수 있다.

나노캡슐은 일반적으로 안정하고 재현가능한 방법으로 화합물을 포함할 수 있다. 세포내의 중합성 과부하(intracellular polymeric overloading)에 따른 부작용을 피하기 위하여, 이와 같은 (약 0.1μm 크기의) 초미립자(ultrafine particles)들은 생체 내에서 분해될 수 있는 폴리머를 사용하여 설계되어야 한다. 이러한 요구사항을 만족하는 생분해성 폴리알킬-시아노아크릴레이트(biodegradable polyalkyl-cyanoacrylate) 나노입자가 본 발명에 사용하기 위하여 고려되며, 이와 같은 입자들은 쉽게 만들어질 수 있다.

D4 . 안과용 제형

신생혈관형성 성분을 가지는 많은 질병들이 눈과 연관이 있다. 예를 들면, 본 발명에 따라 치료될 수 있는 각막 신생혈관형성에 관련된 질병은 당뇨병성 망막증, 미숙아 망막증(retinopathy of prematurity), 각막이식 거부(corneal graft rejection), 신생혈관성 녹내장(neovascular glaucoma) 및 후수정체 섬유증식증(retrolental fibroplasia), 유행성 각결막염(epidemic keratoconjunctivitis), 비타민 A 결핍, 콘택트 렌즈 과도착용, 아토피성 각막염(atopic keratitis), 상각막윤부 각막염(superior limbic keratitis), 익상편 건선 각막염(pterygium keratitis sicca), 쇼그렌 증후군(sjogrens), 홍반성 여드름(acne rosacea), 플릭텐성 각결막염(phlyctenulosis), 매독(syphilis), 마이코박테리아 감염(mycobacteria infection), 지방 변성증(lipid degeneration), 화학적 화상(chemical burns), 세균성 궤양(bacterial ulcers), 진균성 궤양(fungal ulcers), 허피스 단순포진 감염(Herpes simplex infection), 대상포진 감염(herpes zoster infection), 원충 감염(protozoan infections), 카포시 육종(kaposi's sarcoma), 무렌 궤양(mooren ulcer), 테리엔 변연성 각막변성증(Terrien's marginal degeneration), 주변성 각질용해증(marginal keratolysis), 정신적 외상(trauma), 류마티스성 관절염(rheumatoid arthritis), 전신성 홍반(systemic lupus), 다발성 동맥염(polyarteritis), 베게너 유육종증(Wegeners sarcoidosis), 공막염(scleritis), 스티브 존슨병(Steven's Johnson disease), 주변반흔성 방사상 각막절개술(peripemphigoid radial keratotomy) 및 각막 이식 거부(corneal graft rejection)를 포함하나 이로 제한되지는 않는다.

본 발명에 따라 치료될 수 있는 망막/맥락막(choroidal) 신생혈관형성에 관련된 질병은 당뇨병성 망막증, 황반변성(macular degeneration), 겸상적혈구 빈혈증(sickle cell anemia), 사르코이드(sarcoid), 매독(syphilis), 가성황색종(pseudoxanthoma), 탄력섬유 가성황색종(pseudoxanthoma elasticum), 페이젯병(Pagets disease), 정맥 폐쇄(vein occlusion), 동맥 폐쇄(artery occulusion), 경동맥 폐쇄성 질병(carotid obstructive disease), 만성 포도막염(chronic uveitis)/유리체염(chronic vitritis), 마이코박테리아 감염(mycobacteria infection), 라임병(Lyme's disease), 루프스(systemic lupus erythematosus), 미숙아 망막증(retinopathy of prematurity), 일스병(eales disease), 베체트 병(bechets disease), 망막염(retinitis) 또는 맥락막염(choroiditis)을 야기하는 감염, 안구 히스토플라스마증(presumed ocular histoplasmosis), 베스트병(best's disease), 근시(myopia), 유두공(optic pits), 스타가츠병(Stargarts disease), 주변부 포도막염(pars planitis), 만성 망막 박리(chronic retinal detachment), 과점도 증후군(hyperviscosity syndromes), 톡소플라스마증(toxoplasmosis), 정신적 외상(trauma) 및 포스트-레이져 합병증(post-laser complications)을 포함하지만 이로 제한되지는 않는다.

본 발명에 따라 치료될 수 있는 다른 질병은 피부 홍조증(rubeosis)(전방각(angle)의 신생혈관형성)에 관련된 질병 및 당뇨병 관련 여부와 관계 없이, 모든 형태의 증식 유리체 망막병증(proliferative vitreoretinopathy)을 포함하는 섬유혈관성(fibrovascular) 또는 섬유상 조직(fibrous tissue)의 비정상적 증식에 의해 야기되는 질병을 포함하지만 이로 제한되지는 않는다.

따라서, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 및 면역접합체는 단일 약제로서 또는 다른 안과용 약물 또는 약제와의 조합 중 어느 하나로서, 안구내(intravitreal) 및/또는 전방내(intracameral) 투여를 위한 것들을 포함하는 안과용 용액으로서 사용하는 데 적합한 약제학적 조성물의 제조에 유익하게 사용될 수 있다. 임의의 앞서 언급한 것들 또는 다른 질환들의 치료를 위하여, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 조성물이 기존의 약제학적 관례에 따라 제조된 안과용 제조물의 형태로 치료가 필요한 피험자의 눈(eye or eyes)에 투여될 수 있다("Remington's Pharmaceutical Sciences" 15th Edition, pages 1488 to 1501; Mack Publishing Co., Easton, PA를 참조).

상기 안과용 제조물은 약제학적으로 허용가능한 용액, 현탁액 또는 연고에 적어도 약 0.01 내지 약 1 중량%, 바람직하게는 약 0.05 내지 약 0.5 중량%의 농도로 VEGFR2-차단성 인간 항-VEGF 항체를 포함할 것이다. 농도에서 다소간의 변화가 사용된 특정 화합물, 치료될 피험자의 상태 등에 따라 반드시 일어날 것이며, 치료를 담당하는 사람이 개개의 피험자에게 가장 적절한 농도를 결정할 것이다. 상기 안과용 제조물은 원한다면 부가적인 성분, 예를 들어 방부제, 버퍼, 등장화제(tonicity agents), 항산화제 및 안정화제, 비이온성 습윤제(wetting agent) 또는 정화제(clarifying agent), 점성강화제 등을 포함하는 멸균된 수용액의 형태인 것이 바람직할 것이다.

이와 같은 용액에 사용하기에 적합한 방부제는 벤잘코늄 클로라이드(benzalkonium chloride), 벤제토늄 클로라이드(benzethonium chloride), 클로로부탄올(chlorobutanol), 티메로살(thimerosal) 등을 포함한다. 적절한 버퍼는 약 pH 6 및 pH 8 사이, 바람직하게는 약 pH 7 및 pH 7.5 사이를 유지하는 데 충분한 양으로 붕산(boric acid), 소디움 및 포타슘 바이카보네이트(bicarbonate), 소디움 및 포타슘 보레이트(borate), 소디움 및 포타슘 카보네이트(carbonate), 소디움 아세테이트(sodium acetate), 소디움 비포스페이트(sodium biphosphate) 등을 포함한다. 적절한 등장화제는 덱스트란 40(dextran 40), 덱스트란 70(dextran 70), 덱스트로오스(dextrose), 글리세린(glycerin), 포타슘 클로라이드(potassium chloride), 프로필렌 글리콜(propylene glycol), 소디움 클로라이드(sodium chloride) 등이며, 안과용 용액의 소디움 클로라이드 동등체는 0.9 ± 0.2%의 범위이다.

적절한 항산화제 및 안정화제는 소디움 비설파이트(sodium bisulfite), 소디움 메타비설파이트(sodium metabisulfite), 소디움 티오설파이트(sodium thiosulfite), 티오우레아(thiourea) 등을 포함한다. 적절한 습윤제 및 정화제는 폴리소르베이트 80(polysorbate 80), 폴리소르베이트 20(polysorbate 20), 폴록사머 282(poloxamer 282) 및 티록사폴(tyloxapol)을 포함한다. 적절한 점도강화제는 덱스트란 40(dextran 40), 덱스트란 70(dextran 70), 젤라틴(gelatin), 글리세린(glycerin), 하이드록시에틸셀룰로오스(hydroxyethylcellulose), 하이드록시메틸프로필셀룰로오스(hydroxymethylpropylcellulose), 라놀린(lanolin), 메틸셀룰로오스(methylcellulose), 페트롤라튬(petrolatum), 폴리에틸렌 글리콜(polyethylene glycol), 폴리비닐 알코올(polyvinyl alcohol), 폴리비닐피롤리돈(polyvinylpyroolidone), 카복시메틸셀룰로오스(carboxymethylcellulose) 등을 포함한다. 상기 안과용 제조물은 기존의 방법, 예를 들어 점적약(drop)의 형태로 또는 안과용 용액에 눈을 씻어줌으로써 치료가 필요한 피험자의 눈에 국부적으로 투여될 것이다.

D5 . 국부 제형

가장 넓은 의미에서, 국부 투여를 위한 제형은 입(구강)과 피부를 통하여 운반하기 위한 것들을 포함한다. "국부 운반 시스템(topical delivery systems)" 또한 투여될 성분을 포함하는 경피적 패치를 포함한다. 피부를 통한 운반은 또한 원한다면 이온도입(iontophoresis) 또는 전기전달(electrotransport)에 의해 달성될 수 있다.

입에 국부적으로 투여하기에 적합한 제형은 향이 들어간 기제(flavored basis), 주로 수크로오스 및 아카시아 또는 트래거캔스(tragacanth)에 성분을 포함하는 로젠지(lozenges); 젤라틴 및 글리세린, 또는 수크로오스 및 아카시아와 같은 불활성 기제에 활성 성분을 포함하는 패스틸(pastilles); 및 적절한 액상 담체에 투여될 성분을 포함하는 양치질 물약(mouthwashes)을 포함한다.

피부에 국부적으로 투여하기에 적합한 제형은 약제학적으로 허용가능한 담체에 투여될 성분을 포함하는 연고, 크림, 겔 및 페이스트(paste)를 포함한다. 크림, 연고 및 겔과 같은 국부적 사용을 위한 VEGFR2-차단성 인간 항-VEGF 항체의 제형은 당업계에 잘 알려져 있는 것과 같은 유성(oleaginous) 또는 수용성 연고 기제(base)의 제조를 포함한다. 예를 들면, 이 조성물들은 야채 오일, 동물성 지방 및 더욱 바람직하게는 석유(petroleum)로부터 얻어진 반고체 탄화수소를 포함할 수 있다. 사용될 수 있는 특정 성분은 백색 연고(white ointment), 노란 연고(yellow ointment), 세틸 에스테르 왁스(cetyl esters wax), 올레산(oleic acid), 올리브 오일(olive oil), 파라핀(paraffin), 페트롤라튬(petrolatum), 백색 페트롤라튬(white petrolatum), 경랍(spermaceti), 녹말 글리세린제(starch glycerite), 백색 왁스(white wax), 노란 왁스(yellow wax), 라놀린(lanolin), 무수 라놀린(anhydrous lanolin) 및 글리세릴 모노스테아레이트(glyceryl monostearate)를 포함할 수 있다. 글리콜 에테르 및 유도체, 폴리에틸렌 글리콜, 폴리옥실 40 스테아레이트(polyoxyl 40 stearate) 및 폴리소르베이트(polysorbates)를 포함하는 다양한 수용성 연고 기제들 또한 사용될 수 있다.

직장내 투여를 위한 제형은 예를 들어, 코코아 버터 또는 살리실산을 포함하는 적절한 기제를 사용하여 좌약으로서 제공될 수 있다. 이 운반 방법은 또한 체순환 내로 약제를 운반하기에 적합하다. 비강 투여에 적합한 담체에 담긴 활성 성분의 제형, 예를 들어 비강 용액, 스프레이, 에어로졸 및 흡입제 또한 본 발명 내에 포함된다. 담체가 고체인 경우, 상기 제형은 예를 들어, 코에 인접하게 들고 파우더 용기로부터 비강 통로를 통한 빠른 흡입에 의해 투여되는, 예를 들어, 20 내지 500 미크론 범위의 입자 크기를 가지는 조분말(coarse powder)을 포함한다.

담체가 액체인 적절한 제형은 비강 투여에 유용하다. 비강 용액은 주로 점적제 또는 스프레이에서 비강 통로로 투여되도록 설계된 수용액이며, 그것들은 정상적인 섬모운동(ciliary action)이 유지되도록 하기 위하여 비강 분비를 매우 고려하여 유사하게 제조된다. 따라서, 수성의 비강 용액은 주로 pH 5.5 내지 6.5를 유지하도록 등장되고 가볍괴 완충된다. 게다가, 원한다면 안과용 제조물에 사용되는 것들과 유사한 항균성 방부제 및 적절한 약물 안정화제가 상기 제형 내에 포함될 수 있다. 다양한 상용 비강 제조물들이 공지되어 있고, 예를 들어 항생제 및 항히스타민제를 포함하며, 천식 예방을 위하여 사용된다.

흡입제(inhalation and inhalants)는 환자의 호흡수(respiratory tree) 내로 약물 또는 화합물을 운반하도록 설계된 약제학적 제조물이다. 증기(vapor) 또는 미스트(mist)가 투여되어 환부에 도달한다. 이 방법은 또한 체순환 내로 약제를 운반하는 데 사용될 수 있다. 흡입제는 비강 또는 경구적 호흡 경로에 의하여 투여될 수 있다. 만일 작은 방울(droplets)이 충분히 미세하고 크기가 일정하다면, 흡입 용액의 투여는 상기 미스트가 세기관지(bronchiole)에 도달하도록 하는 데에만 효과적이다.

또한 흡입제로서 알려져 있고 때때로 주입(insufflation)이라고 불리는 다른 군의 제품들은 액화 가스 추진제(liquefied gas propellant)에 약물의 용액 또는 현탁액을 담고있는 약제학적 에어로졸과 같은 특별한 운반 시스템의 사용에 의하여 호흡 통로 내로 운반되는 미세하게 분말화되거나 액체인 약물을 포함한다. 적절한 밸브 및 경구 아답터(oral adapter)를 통하여 방출될 때, 정량식 흡입제(metered dose of inhalation)가 환자의 호흡기 내로 나아간다. 입자 크기는 이러한 형태의 제조물의 투여에 매우 중요한 것이다. 폐낭(pulmonary cavity) 내로 침투하기 위한 최적의 입자 크기는 대략 0.5 내지 7μm인 것이다. 미세한 미스트는 가압된 에어로졸에 의해 제조되므로, 그것들의 사용은 유익하다고 고려된다.

E. 치료학적 키트

본 발명은 또한 본 발명의 치료 방법에 사용하기 위한 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체를 포함하는 치료학적 키트를 제공한다. 이와 같은 키트는 일반적으로 적어도 하나의 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체의 약제학적으로 허용가능한 제형을 적절한 용기 수단에 포함할 것이다. 상기 키트는 또한 진단/이미지화 또는 조합된 치료 중 어느 하나를 위한 다른 약제학적으로 허용가능한 제형을 포함할 수 있다. 예를 들면, 이와 같은 키트는 임의의 하나 또는 그 이상의 일련의 화학치료 또는 방사선치료 약물; 항신생혈관성 약제; 항종양 항생제; 및/또는 항종양 맥관구조 또는 항종양 기질 면역독소 또는 응고리간드를 포함할 수 있다.

상기 키트는 임의의 부가적인 성분을 포함하거나 포함하지 않는 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체를 포함하는 단일 용기(용기 수단)를 가질 수 있거나, 그것들은 각각 원하는 약제를 위한 별도의 용기를 가질 수 있다. 조합된 치료가 제공되는 경우, 단일 용액은 몰 동등체 조합에서 또는 다른 것을 초과하는 하나의 성분을 사용하여 미리 혼합될 수 있다. 대안적으로, 각각의 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체 및 키트의 다른 항암제 성분은 환자에게 투여되기 이전에 별도의 용기 내에 따로따로 유지될 수 있다.

키트의 성분들이 하나 또는 그 이상의 수용액으로 제공되는 경우, 상기 수용액은 수성 용액이 바람직하며, 멸균된 수성 용액을 사용하는 것이 특히 바람직하다. 그러나, 키트의 성분은 건조된 파우더로서 제공될 수 있다. 시약 또는 성분이 건조 파우더로서 제공될 경우, 상기 파우더는 적절한 용매의 첨가에 의해 재구성될 수 있다. 상기 용매는 또한 다른 용기에 제공될 수 있다는 것을 알 수 있다.

키트의 용기는 일반적으로 적어도 하나의 바이알(vial), 테스트 튜브(test tube), 플라스크(flask), 바틀(bottle), 주사기(syringe) 또는 다른 용기 수단(container means)을 포함할 것이며, VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체 및 임의의 다른 바람직한 약제가 거기에 위치되며, 바람직하게는 적절하게 엘리컷될 수 있다. 개별적인 성분들이 포함될 경우, 상기 키트는 또한 일반적으로 개별적으로 설계된 투여량을 투여가능하게 하는 제2의 바이알 또는 다른 용기를 포함한다. 상기 키트는 또한 멸균된 약제학적으로 허용가능한 버퍼 또는 다른 희석제를 포함하기 위한 제2의/제3의 용기 수단을 포함할 수 있다.

상기 키트는 또한 동물 또는 환자에게 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체를 투여하기 위한, 상기 제형이 동물 내로 주사될 수 있거나 또는 신체의 질병 부위에 적용될 수 있는, 예를 들어 하나 또는 그 이상의 바늘 또는 주사기, 또는 심지어는 점안기(eye dropper), 피펫(pipette), 또는 다른 이와 같은 기구들에 의한 수단을 포함할 수 있다. 본 발명의 키트는 또한 전형적으로 예를 들어, 원하는 바이알 및 다른 기구들이 위치되고 유지되는 주입식 또는 주조식 플라스틱 용기와 같은 상업적 판매를 위한 밀폐된 구역에 바이알 또는 그것과 유사한 것 및 다른 성분을 포함하기 위한 수단을 포함할 것이다.

F. 항신생혈관혈성 치료

본 발명은 다양한 질병 및 질환에 공헌하기 위하여 단독 또는 조합 치료에서 비정상적인 신생혈관형성을 가지는 동물 및 환자를 치료하는 데 사용될 수 있다. 암 치료 분야의 바깥에서 가장 일반적으로 행해지고/행해지거나 임상적으로 중요한 치료들은 관절염(arathritis), 류마티스성 관절염(rheumatoid arthritis), 건선(psoriasis), 아테롬성 동맥경화증(atherosclerosis), 당뇨병성 망막증(diabetic retinopathy), 노화관련 황반변성(age-related macular degeneration), 그레이브스병(Grave's disease), 혈관성형술(angioplasty), 뇌동정맥기형(arteriovenous malformations; AVM), 수막종(meningioma), 혈관종(hemangioma) 및 신생혈관성 녹내장(neovascular glaucoma)을 포함하는 혈관 재협착(vascular restenosis)을 포함한다. 본 발명을 위한 다른 잠재적인 표적은 혈관 섬유종(angiofibroma), 아테롬성 플라크(atherosclerotic plaques), 각막 이식 신생혈관형성(corneal graft neovascularization), 혈우병성 관절(hemophilic joints), 비후성 흉터(hypertrophic scars), 오슬러-웨버 증후군(Osler-Weber syndrome), 화농성 육아종(pyogenic granuloma), 수정체후부 섬유증식증(retrolental fibroplasias), 피부 경화증(scleroderma), 트라코마(trachoma), 혈관 유착(vascular adhesions), 활막 세포염(synovitis), 피부염(dermatitis), 다양한 다른 염증성 질병 및 질환 및 심지어는 자궁 내막증(endometriosis)을 포함한다.

신생혈관형성이 관련되어 있는 질병 중 하나는 류마티스성 관절염이며, 여기에서 관절의 활막 내벽(synovial lining)에 있는 혈관은 신생혈관형성을 겪는다. 새로운 혈관 네트워크를 형성할 뿐만 아니라, 내피 세포는 인자 및 반응성 산소종(reactive oxygen species)을 방출하여 판누스(pannus) 성장 및 연골 파괴를 야기한다. 신생혈관형성에 관여하는 인자들은 류마티스성 관절염의 장기적 염증 상태에 능동적으로 기여하고 이를 유지하는데 기여할 수 있다. 신생혈관형성에 관련된 인자들은 또한 관절의 파괴에 기여하는 골관절염에서의 역할을 가진다.

하라다 등은 VEGF가 류마티스성 관절염의 발병에 관여하며, 또한 VEGF의 혈청 농도의 측정은 류마티스성 관절염의 질병 활성을 관찰하기에 비침습성(noninvasive)이며 유용한 방법임을 보여주었다(Harada et al ., 1998; 참조로서 본원에 특별히 통합되어 있음). 이것은 류마티스성 관절염과 관련된 본 발명의 치료적 및 진단적 용도를 지지한다.

나가시마 등은 배양된 류마티스성 활막 세포에서의 VEGF에 대한 항류마티스성 약물의 억제 효과를 기재하고 있다(Nagashima et al ., 1999; 참조로서 본원에 특별히 통합되어 있음). VEGF는 류마티스성 관절염의 윤활막(synovium)에서 구성적으로 발현된다. 공지의 항류마티스성 약물인 부실라민(bucillamine; BUC)은 활막 세포에 의한 VEGF 생성을 억제하는 그것의 작용 메카니즘 내에 포함됨을 보여주었다. 따라서, BUC의 항류마티스성 효과는 활막 세포에 의한 VEGF 생성의 억제를 통하여 관절염에 걸린 윤활막에서의 신생혈관형성 및 활막 증식의 억제에 의해 매개된다. 항관절염 치료로서 본 발명의 용도는 이러한 현재의 치료의 VEGF 억제 작용에 의하여 지지된다.

신생혈관형성에 의하여 매개되는 질병의 다른 예는 안구의 신생혈관성 질병이다. 이 질병은 망막 또는 각막과 같은 눈의 구조 안으로의 새로운 혈관의 침입을 특징으로 한다. 그것은 실명의 가장 흔한 원인이며, 대략 20개의 안질환에 관여한다. 노화관련 황반변성에서, 연관된 시각적 문제들은 망막 색소 상피(retinal pigment epithelium) 바로 밑의 섬유혈관성 조직(fibrovascular tissue)의 증식에 관한 부르크 막(Bruch's membrane)에서의 결함을 통하여 맥락막성 모세관(choroidal capillaries)의 내성장(ingrowth)에 의해 야기된다. 신생혈관형성의 위험은 또한 당뇨병성 망막병증, 미숙아 망막증, 각막이식 거부, 신생혈관성 녹내장 및 수정체후부 섬유증식증과 관련되어 있다.

각막 신생혈관형성과 관련된 다른 질병들은 유행성 각결막염(epidemic keratoconjunctivitis), 비타민 A 결핍증(Vitamin A deficiency), 콘텍트 렌즈 과도 착용(contact lens overwear), 아토피성 각막염(atopic keratitis), 상각 막윤부 각막염(superior limbic keratitis), 익상편 건선 각막염(pterygium keratitis sicca), 쇼그렌 증후군(sjogrens), 홍반성 여드름(acne rosacea), 플릭텐성 각결막염(phlyctenulosis), 매독(syphilis), 마이코박테리아 감염(mycobacteria infection), 지방 변성증(lipid degeneration), 화학적 화상(chemical burns), 세균성 궤양(bacterial ulcers), 진균성 궤양(fungal ulcers), 허피스 단순포진 감염(Herpes simplex infection), 대상포진 감염(herpes zoster infection), 원충 감염(protozoan infections), 카포시 육종(kaposi's sarcoma), 무렌 궤양(mooren ulcer), 테리엔 변연성 각막변성증(Terrien's marginal degeneration), 주변성 각질용해증(marginal keratolysis), 류마티스성 관절염(rheumatoid arthritis), 전신성 홍반(systemic lupus), 다발성 동맥염(polyarteritis), 정신적 외상(trauma), 베게너 유육종증(Wegeners sarcoidosis), 공막염(scleritis), 스티브 존슨병(Steven's Johnson disease), 주변반흔성 방사상 각막절개술(peripemphigoid radial keratotomy) 및 각막 이식 거부(corneal graft rejection)를 포함하지만 이로 제한되지는 않는다.

망막/각막 신생혈관형성에 관련된 질병들은 당뇨성 망막증(diabetic retinopathy), 노인성 황반변성(age-related macular degeneration)을 포함하는 황반변성(macular degeneration), 겸상 적혈구 빈혈증(sickle cell anemia), 사르코이드증(sarcoid), 매독(syphilis), 탄력섬유 가성황색종(pseudoxanthoma elasticum), 페이젯병(Pagets disease), 정맥 폐쇄(vein occlusion), 동맥 폐쇄(artery occulusion), 경동맥 폐쇄성 질병(carotid obstructive disease), 만성 포도막염(chronic uveitis)/유리체염(chronic vitritis), 라임병(Lyme's disease), 루프스(systemic lupus erythematosus), 미숙아 망막증(retinopathy of prematurity), 일스병(eales disease), 베체트 병(bechets disease), 망막염(retinitis) 또는 맥락막염(choroiditis)을 야기하는 감염, 안구 히스토플라스마증(presumed ocular histoplasmosis), 베스트병(best's disease), 근시(myopia), 유두공(optic pits), 스타가츠병(Stargarts disease), 주변부 포도막염(pars planitis), 만성 망막 박리(chronic retinal detachment), 과점도 증후군(hyperviscosity syndromes), 톡소플라스마증(toxoplasmosis), 정신적 외상(trauma) 및 포스트-레이져 합병증(post-laser complications)을 포함하지만 이로 제한되지는 않는다.

황반변성, AMD 및 다른 안과 질병과 관련된 것과 같은 맥락막의 신생혈관형성에서와 같이, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 주로 치료에 사용하기에 매우 적합하다. 이것은 부분적으로는 그것들이 VEGFR1에 결합하는 VEGF를 실질적으로 차단하는 일 없이 VEGFR2에 결합하는 VEGF를 실질적으로 차단하며, 예를 들어, 아바스틴 및 관련 제품인 루센티스(Lucentis®)와 같은 현존하는 항-VEGF 치료 이상으로 본 발명의 다른 이점을 강조하는 그 결과가 눈에 유익하기 때문이다.

다른 질병들은 피부홍조(rubeosis)(전방각(angle)의 신생혈관형성)에 관련된 질병 및 모든 형태의 증식 유리체 망막병증(proliferative vitreoretinopathy)을 포함하는 섬유혈관성(fibrovascular) 또는 섬유상 조직(fibrous tissue)의 비정상적 증식에 의해 야기되는 질병을 포함하지만 이로 제한되지는 않는다.

만성 염증은 또한 병리학적 신생혈관형성을 수반한다. 궤양성 대장염(ulcerative colitis) 및 크론병(Crohn's disease)와 같은 질병 상태는 염증을 일으킨 조직 내로의 새로운 혈관의 내성장에 관련된 조직학적 변화를 나타낸다. 남아메리카에서 발견되는 세균성 감염인 바르토넬라증(bartonellosis)은 혈관 내피 세포의 증식을 특징으로 하는 만성적 단계(chronic stage)를 야기할 수 있다.

신생혈관형성에 관련된 다른 병리학적 역할은 아테롬성 동맥경화증에서 발견된다. 혈관의 내강(lumen) 내에 형성된 플라크(plaques)는 신생혈관성 자극 활성을 가짐을 가짐을 보여주었다. 인간의 관상동맥 아테롬경화성 병변(coronary atherosclerotic lesions)에서의 VEGF 발현은 이노우에 등에 의해 증명되었다(Inoue et al ., 1998; 참조로서 본원에 특별히 통합되어 있음). 이것은 인간의 관상동맥 아테롬성 동맥경화증의 진행에서 뿐만 아니라, 폐쇄성 관상동맥 질병에서의 재관통 과정(recanalization processes)에서의 VEGF의 병리생리학적 중요성을 증명하였다. 본 발명은 이와 같은 질환에 대한 효과적인 치료를 제공한다.

아이들에게서 가장 빈번한 신생혈관성 질병 중의 하나는 혈관종(hemangioma)이다. 대부분의 경우에 있어서, 종양은 중재(intervention) 없이 양성이며 퇴화된다. 더욱 심각한 경우에 있어서, 종양은 큰 해면상(cavernous)의 침윤성 형태로 진행되며 임상적 합병증을 생성한다. 전신형(systemic form) 혈관종, 혈관종증(hemangiomatosis)은 높은 치사율을 가진다. 쓰이고 있는 현재의 치료제를 사용하여 치료될 수 없는 치료-내성(therapy-resistant) 혈관종이 존재한다.

신생혈관형성은 또한 오슬러-웨버-렌두 증후군 또는 유전성 모세혈관 확장증(hereditary hemorrhagic telangiectasia)과 같은 유전성 질병에서 발견되는 위험에 관여한다. 이것은 혈액 또는 림프관의 다중성 소 혈관종(multiple small angiomas), 종양을 특징으로 하는 유전 질병이다. 상기 혈관종은 피부 및 점막(mucous membranes)에서 발견되며, 때때로 폐 또는 간의 동정맥루(arteriovenous fistula)와 함께 종종 코피(epistaxis, nosebleeds) 또는 위장관 출혈을 수반한다.

신생혈관형성은 또한 재생(reproduction) 및 상처 치유와 같은 정상적인 생리학적 과정에 관여한다. 신생혈관형성은 배란에서 또한 수정 후 포배(blastula)의 착상에서의 중요한 단계이다. 신생혈관형성의 방지는 수정을 차단하거나 포배에 의한 착생을 예방하기 위하여 무월경(amenorrhea)을 유도하는 데 사용될 수 있다.

상처 치유에서, 과도한 복구(repair) 또는 섬유 증식증(fibroplasia)은 수술의 해로운 부작용이며, 신생혈관형성에 의해 야기되거나 악화될 수 있다. 유착(adhesions)은 수술의 빈번한 합병증이며, 소장 폐색(small bowel obstruction)과 같은 문제를 야기한다.

바람직하지 않은 혈관 투과성을 특징으로 하는 질병 및 질환 또한 본 발명에 의해 치료될 수 있다. 이것들은 참조로서 본원에 특별히 통합되어 있는 국제특허출원번호 제98/16551호에 기재되어 있는 것과 같은, 뇌종양에 관련된 부종(edema), 악성 종양에 관련된 복수(ascites), 메이그스 증후군(Meigs' syndrome), 폐 염증(lung inflammation), 신장 증후군(nephrotic syndrome), 심낭 삼출(pericardial effusion) 및 흉막 삼출(pleural effusion)을 포함한다.

하기의 단락에 기재된 것과 같은 모든 형태의 종양과 마찬가지로 각각의 앞서 언급한 질병 및 질환들은 신생혈관성 질병의 치료에 대한 항신생혈관성 방법의 적용으로부터 얻은 이익들이 통합되어 있는 예를 들어, 미국 특허등록번호 제5,712,291호(참조로서 본원에 특별히 통합되어 있는)에 기재된 것과 같은 당업계에서의 지식에 따라 본 발명에 의하여 효과적으로 치료될 수 있다. 더욱이, 미국 특허등록번호 제6,524,583호는 항-VEGF 항체를 사용하는 넓은 범위의 질병 및 질환의 치료를 가능하게 하고 더 설명하는 것을 포함하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있다.

본 발명의 인간 항체 및/또는 면역접합체는 종양의 치료에 가장 바람직하게 사용된다. 신생혈관형성이 중요한 종양은 악성 종양, 및 청각신경 종양(acoustic neuroma), 신경 섬유종(neurofibroma), 트라코마(trachoma) 및 화농성 육아종(pyogenic granuloma)과 같은 양성 종양(benigh tumors)을 포함한다. 신생혈관형성은 주로 고형 종양 형성 및 전이에서 두드러진다. 그러나, 신생혈관형성은 또한 백혈병(leukemia)과 같은 혈액 매개 종양(blood born tumors), 및 주로 부종, 손상된 혈액 응괴(clotting) 및 림프절, 간 및 비장의 확장을 수반하는 백혈구의 억제되지 않은 증식이 일어나는 골수의 여러가지 급성 또는 만성 종양 질병과 관련이 있다. 신생혈관형성은 또한 백혈병 유사 종양을 생기게 하는 골수에서의 이상에 중요한 역할을 한다.

신생혈관형성은 종양 전이의 두개의 단계에서 중요하다. 원발성 종양(primary tumor)의 신생혈관형성에서, 신생혈관형성은 세포가 혈류에 들어가고 신체를 통하여 순환할 수 있도록 한다. 종양 세포가 원발 부위를 떠난 후 제2의 부위인 전위 부위에 자리를 잡게되며, 신생혈관형성은 새로운 종양이 성장하고 확장되기 전에 일어나야만 한다. 따라서, 신생혈관형성의 예방은 종양의 전이를 예방할 수 있으며, 다른 치료제, 주로 치료제-표적화제 구조물(하기를 참조)에 의해 치료될 수 있는 원발 부위에서의 종양의 성장을 저지한다.

본 발명에 의해 제공되는 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체 방법은 따라서 맥관 성분을 가지는 임의의 악성 종양의 치료에 넓게 적용될 수 있다. 종양, 특히 신생혈관이 형성된 악성 종양의 치료에 본 발명의 항체 및/또는 면역접합체를 사용하는 것에 있어서, 상기 약제는 단독 또는 예를 들어, 화학치료제, 방사선 체료제, 아포토시스 약제, 항신생혈관성 약제 및/또는 면역독소 또는 응고리간드와 함께 조합하여 사용될 수 있다.

치료를 위한 전형적인 신생혈관이 형성된 종양은 산소 및 영양분의 공급을 위한 혈관 성분을 필요로 하는 고형 종양, 특히 암종(carcinomas)이다. 본 발명을 사용하여 치료될 수 있는 대표적인 고형 종양은 폐(lung), 유방(breast), 난소(ovary), 위(stomach), 췌장(pancreas), 후두(larynx), 식도(esophagus), 고환(testes), 간(liver), 이하선(parotid), 담도(biliary tract), 결장(colon), 직장(rectum), 경부(cervix), 자궁(uterus), 자궁내막(endometrium), 신장(kidney), 방광(bladder), 전립선(prostate), 갑상선(thyroid), 편평상피 세포 암종(squamous cell carcinomas), 선암(adenocarcinomas), 소세포 암종(small cell carcinomas), 흑색종(melanomas), 신경교종(gliomas), 신경 교모세포종(glioblastomas), 신경아세포종(neuroblastomas) 등을 포함하지만 이로 제한되는 것은 아니다. 국제특허출원번호 제98/45331호는 또한 항-VEGF 항체를 사용하여 효과적으로 치료될 수 있는 다양한 종양의 형태를 더 설명하기 위하여 참조로서 본원에 통합되어 있다.

종양의 유지 및 전이에서의 신생혈관형성의 역할에 대한 지식은 유방암과 같은 암의 예후 인자(prognostic indicator)를 이끌어 낸다. 원발성 종양에서 발견되는 신생혈관 형성의 양은 침윤성 유방 암종(invasive breast carcinoma)에서 가장 신생혈관형성이 심한 부위에서의 미세혈관 밀도의 숫자를 셈으로써 측정된다. 높은 레벨의 미새혈관 밀도는 종양의 재발(recurrence)과 상호관련되어 있음을 발견하였다. 본 발명의 치료에 의한 신생혈관형성의 조절은 이와 같은 종양의 재발을 감소시키거나 상쇄시킬 것이다.

본 발명은 현재 고형 종양을 가지는 임의의 환자의 치료에 사용하기 위하여 고려된다. VEGFR2-차단성 인간 항-VEGF 항체 조성물의 특이적 특성을 고려하여, 본 발명의 치료제는 감소된 부작용을 가질 것이다. 특정 이점은 종양에 대한 숙주 면역 반응의 유지 또는 강화 및 골 조직 상에서 부작용의 결여를 가져올 것이다. 따라서, 본 발명은 소아암(pediatric cancer) 및 골다공증(osteoporosis) 및 다른 골 결핍(bone deficiencies)을 가지거나 발병 위험이 있는 환자의 치료를 위한 항신생혈관성 치료의 선택일 수 있다.

비록 모든 악성 종양들 및 고형 종양들이 본 발명에 의해 치료될 수 있을 지라도, 본 발명의 비접합된 VEGFR2-차단성 인간 항-VEGF 항체는 더 많은 신생혈관성 종양을 가지는 환자 또는 전이의 위험이 있는 환자를 치료하는 데 사용하기 위하여 특히 고려된다.

본 발명은 또한 예방적(preventative or prophylactic) 치료로서의 목적을 가지고 있다. 본 발명의 이러한 양상들은 전이성 종양 전파(seeding)의 초기 단계에서 전이성 종양 또는 종양 세포를 가질 수 있는 원발성 종양을 현재 가지고 있는 환자들을 치료하기 위한 본 발명의 능력을 포함한다. 항신생혈관성 방법으로서, 본 발명은 또한 유전성 암으로 고통받는 사람들의 예후 테스트 및/또는 밀접한 관련성에 기초한 것으로서, 종양 발병의 중간 또는 고위험의 피험자에서 종양 발생을 예방하기 위하여 사용될 수 있다.

본 발명의 접합되거나 면역독소 형태의 VEGFR2-차단성 인간 항-VEGF 항체는 주로 고형 종양을 파괴하거나 종양 감축술(de-bulking)에 사용하기 위하여 고려된다. 본 발명의 이러한 양상들은 본 발명의 비접합된 항신생혈관성 항체와 함께 또는 다른 항신생혈관 접근법과 함께 사용될 수 있다.

본 발명의 치료 방법의 면역접합체 및 프로드러그 형태는 항체 고유의 항신생혈관성 특성 및 부착된 약제(예를 들어, 세포독성 약제, 응고성 약제, 아포토시스성 약제 등)의 치료적 특성의 두개의 특성을 가지는 단일 치료제를 제공하는 명확한 이점을 가진다. 따라서, 본 발명의 접합된 치료 및 프로드러그 치료 형태는 암 치료의 분야를 통하여 놀라울 정도로 넓은 유용성을 가진다.

본 발명의 다른 양상과 함께 사용하기 위한 더욱 적절한 환자에 관하여 본원에 제공된 안내는 어떤 환자의 프로필은 본 발명에 의한 치료를 위한 환자의 선별에 도움을 줄 수 있음을 교시하는 것이다. 어떤 환자 또는 환자의 카테고리의 사전 선별은 상기에 기재된 것과 같은 신생혈관이 형성된 종양 또는 다른 신생혈관성 질병을 가지는 모든 환자의 치료와 관련하여 어떠한 방법으로든 본 발명의 유용성을 무효화하지 않는다. 본 발명에 의해 제공된 종양에 대한 공격은 사실 그 이후의 치료가 전체적인 시너지 효과를 가져오거나 심지어는 총체적인 완화(remission) 또는 회복(cure)를 가져오도록 하기 위하여, 또 다른 치료학적 치료를 위하여 종양을 미리 처치할 수 있다.

임의의 특정 형태의 종양은 본 발명을 사용하는 치료로부터 제외되어야 한다고 간주되지 않는다. 그러나, 종양 세포의 형태는 다른 치료제, 특히 화학치료제 및 항종양 면역독소와 조합하여 본 발명의 사용에 관련될 수 있다. 본 발명의 비조합 양상 및 조합된 양상 모두 종양의 맥관 증식을 억제할 항신생혈관 효과를 유도할 것이다. 조합된 프로드러그 치료 양상은 종양의 맥관구조를 더 파괴하거나 차단할 것이다. 모든 고형 종양에서의 맥관구조는 실질적으로 또는 본질적으로 동일하기 때문에, 본 발명의 방법은 종양 세포 자체들의 특정 표현형 또는 유전자형에 관계없이 모든 고형 종양의 치료에 광범위하게 또는 전적으로 적용될 수 있다는 것을 이해할 수 있을 것이다.

VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체 구조물의 치료학적으로 효과적인 투약량은 예를 들어 본원에 설명되어 있는 연구에 나타나 있는 것과 같은 동물 모델로부터 얻은 데이터를 사용하여 쉽게 결정할 수 있다. 고형 종양을 가지는 실험 동물은 임상 실험으로 옮겨가기 이전에 적절한 치료학적 투여량을 최적화시키기 위하여 빈번하게 사용된다. 이와 같은 모델들은 효과적인 항암 전략을 예측하는 데 매우 믿을만한 것으로 알려져 있다. 예를 들면, 실시예에서 사용된 것과 같은 고형 종양을 가지는 마우스들은 전임상 실험에 널리 사용된다. 본 발명자들은 최소한의 독성을 가지고 유익한 항암 효과를 주는 치료제의 작동 범위를 결정하기 위하여 이와 같은 당업계에 허용가능한 마우스 모델들을 사용하여 왔다.

항신생혈관 치료에 비접합된 VEGFR2-차단성 인간 항-VEGF 항체를 사용하는 것에 있어서, 그것은 또한 임상 치료를 위한 투약량의 제형화에 도움이 되기 위하여 다른 공개된 데이터에 의지할 수 있다. 예를 들면, 비록 본 발명의 항체들이 당업계의 것들보다 구별된 이점을 가진다 할지라도, 다른 항-VEGF 항체들을 이용한 치료들에 관련된 문헌에서의 정보는 여전히 치료 프로토콜 및 투약량을 설계 및/또는 최적화하기 위하여 본원 명세서에서 데이터와 조합하여 사용되고 교시될 수 있다.

예를 들면, 참조로서 본원에 특별히 통합되어 있는 보르그스트롬 등은 MAb A4.6.1을 사용하는 생체 내 유방암 신생혈관형성에서의 VEGF의 중요성을 기재하고 있다(Borgstrom et al ., 1999). 인간화된 형태의 A4.6.1 항체(아바스틴, bevacizumab)는 임상적 용도로 인가되었다(Hurwitz et al ., 2004). 본 발명의 인간 항체는 A4.6.1/아바스틴을 사용한 비교 연구에서 동등하거나 심지어는 향상된 항암 반응을 나타내었기 때문에, 이 항체들은 또한 유방암을 포함하는 인간의 암 치료에 현저한 유용성을 가질 것이다. 본 발명자들은 당업자들에 의해 확인될 수 있는 바와 같이 유방암을 가진 환자들은 전형적으로 중년 또는 그 이후 연령 그룹의 여성들이며, 여기에 골다공증에 관련된 근심 또한 존재한다는 것을 더 깨달았다. 따라서, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 골 대사에 부작용을 야기하지 않는다는 추가된 이점을 가지므로, 골다골증을 가지거나 발병 위험이 있는 유방암 환자에 사용하기에 바람직할 것이다.

동일한 형태의 이익을 만들어내는 VEGFR2-차단성 인간 항-VEGF 항체 치료제들은 소아암의 치료를 위한 바람직한 약물이다. 암을 가진 어린이들에서, 건강하고 실질적인 골 성장을 지속할 필요가 있다는 것은 분명하다. VEGFR2-차단성 인간 항-VEGF 항체들은 실질적으로 골 발생에 중요한 용골세포 및 연골파괴 세포의 활성을 손상시키지 않을 것이므로, 이 항체들은 아바스틴과 같은 다른 항체들 보다 중요한 이점들을 가질 것이다.

참조로서 본원에 특별히 통합되어 있는 보르그스트롬 등은 또한 MAb A4.6.1이 독소루비신과 조합하여 사용될 때 현저한 종양의 퇴화를 야기함을 보고하였다(Borgstrom et al ., 1999). 이것은 다양한 암들을 치료하는 데 현저한 임상적 결과를 달성하기 위한 VEGFR2-차단성 인간 항-VEGF 항체 및 기존의 세포독성 또는 화학치료 약제의 조합된 사용을 지지한다. 비조합된 독소루비신 및 독소루비신 프로드러그 조합 모두 고려된다.

페라라(Ferrara) 및 그 동료들은 또한 종양을 가지는 마우스에서의 마우스 유래 항-VEGF 단일클론 항체의 효과 및 농도 반응 및 인간 치료에 대한 외삽법(extrapolation)을 보고하였다(Mordenti et al ., 1999, 참조로서 본원에 특별히 통합되어 있음). 상기 연구들은 재조합 인간화된 형태의 항체의 효과적인 혈장 농도가 암 환자에게서 추정될 수 있기 하기 위하여, 마우스 유래의 항-VEGF 단일클론 항체의 농도 반응 곡선을 평가할 수 있도록 설계된다. 모르덴티 등은 누드 마우스에서의 만족스러운 종양 억제가 필요한 효과적인 범위로 인간에 사용하기 위한 치료 항체를 유지하는 데 효과적인 임상 투약 요법을 정의하기 위하여, 인간 시스템에 쉽게 적용될 수 있는 투약량의 마우스 유래의 항체를 사용하여 달성될 수 있다고 결론지었다(Mordenti et al ., 1999). 따라서, 현재 당업계에서 허용가능한 마우스 모델로부터 얻은 데이터는 모르덴티 등에 의해 보고된 분석 형태 뿐만 아니라 본원에 기재된 것과 같은 당업계에 공지된 기술들을 사용하여 적절한 인간 투약량으로 바꿀 수 있다(Mordenti et al ., 1999).

원숭이에서 재조합되고 인간화된 형태의 지넨테크사(Genentech's)의 항-VEGF 항체의 전임상 안정성 시험(preclinical safety evaluation)으로부터 얻은 결과들은 특정 후보 치료제들이 가지는 단점들의 예시를 제공한다. 비록 상기 항체들이 이 동물에서 약제학적 활성을 가진다 할지라도, 이 연구에서 원숭이들은 비대된 연골세포(hypertrophied chondrocytes), 연골하 골판 형성(subchondral bony plate formation)에서의 용량에 따른 증가 및 성장판(growth plate)의 맥관 침입의 억제를 특징으로 하는 성장판 형성이상(physeal dysplasia)을 나타낸다. 어떠한 이와 같은 단점들도 VEGFR1에 의해 매개되는 용골세포 및 연골파괴 세포에서의 VEGF 결합 및 신호전달을 억제하지 않는 VEGFR2-차단성 인간 항-VEGF 항체의 사용에서 명백하지 않을 것이다.

진테크사의 인간화된 단일클론 항-VEGF 항체의 전임상 약동학(pharmacokinetics), 종간 스케일링(interspecies scaling) 및 조직 분포에 대한 추가 연구로부터 얻은 데이터들은 린 등에 의하여 보고되었다(Lin et al ., 1999, 참조로서 본원에 특별히 통합되어 있음). 이 연구들은 최근의 125I 표지된 항체를 사용하여 마우스, 랫트, 원숭이 및 토끼에서 수행되었다. 마우스, 랫트 및 원숭이로부터 얻은 약동학 데이터들은 인간에서의 상대성장 스케일링(allometric scaling)을 사용하여 인간화된 대응 항체의 약동학을 예측하는 데 사용된다. 따라서, 적절한 투약 정보가 류마티스성 관절염, 안구 신생혈관형성 및 암과 같은 인간의 병리학적 증상의 치료를 위하여 개발될 수 있다.

항-VEGF 항체 A4.6.1의 인간화된 형태(아바스틴, bevacizumab)은 현재 임상 용도로 인가되었다(Hurwitz et al ., 2004, 참조로서 본원에 통합되어 있음). 따라서, 이와 같은 임상 데이터는 또한 현재의 VEGFR2-차단성 인간 항-VEGF 항체 치료를 위한 치료학적 투약량을 설계할 때 참조원(reference source)으로서 고려될 수 있다. 비록 단지 VEGF의 VEGRR2-매개성 작용을 억제하는 것에 대한 특이성만이 이점이라 할지라도, 본 발명은 새로운 인간 항체가 종양을 가지는 마우스에서의 연구에서 A4.6.1/아바스틴 만큼 효과적일 수 있음을 보여준다. 국제특허번호 제98/45331호는 또한 치료에 사용될 수 있는 인간화된 항-VEGF 항체의 투약량을 더 예시하기 위하여 참조로서 본원에 통합되어 있다.

종양 치료에서 접합된 VEGFR2-차단성 인간 항-VEGF 항체의 사용에 관하여, 유익한 효과를 달성하기 위하여 다양한 치료제를 종양의 맥관구조로 운반하는 것의 성공에 대한 과학 및 특허 문헌을 언급할 것이다. 예의 형태로, 각각의 미국 특허등록번호 제5,855,866호, 제5,877,289호, 제5,965,132호, 제6,051,230호, 제6,004,555호, 제5,776,427호, 제6,004,554호, 제6,036,955호 및 제6,093,399호는 이와 같은 치료제-표적화제 구조물의 사용을 더 설명하기 위한 목적으로 참조로서 본원에 통합되어 있다. 현재의 경우에 있어서, 상기 치료제-표적화제 구조물은 부착된 치료제의 항종양 활성을 증대하거나 그렇지 않다면 강화시킬 항신생혈관성 효과를 발휘하는 표적화제 부분을 포함한다.

당업계에 공지되어 있는 바와 같이, 임상 치료로 나아가기 전에 전임상 실험과 관련하여 가이드라인으로서 사용될 수 있는 현실적인 목표가 있다. 그러나, 임상, 본원에 나타낸 허용된 모델에서 증명된 항종양 효과 및 본원 방법의 강화된 안전성에서의 다른 항-VEGF 항체의 진보의 관점에서, 본 발명은 임상 치료에 대한 빠른 길과 함께 치료제를 제공한다. 따라서, 전임상 실험은 가장 유익한 항체, 투약량 또는 조합을 사용하기 위하여 사용될 수 있다.

임의의 변함없이 검출가능한 항신생혈관성 효과, 전이의 억제, 종양 맥관구조의 파괴, 종양 혈전증, 괴사 및/또는 일반적인 항종양 효과를 낳는 임의의 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체의 용량 또는 조합된 약제는 유용한 발명을 정의할 것이다. 본 발명은 또한 종양의 혈관 하류부분(downstream), 적어도 배수 혈관(draining vessels)의 서브셋(sub-set)을 표적화하는 데 효과적일 것이며, 특히 종양으로부터 방출된 사이토카인은 그것들의 항원 프로필을 바꾸는 이 혈관에 작용할 것이다.

이와 같은 상황에서도, VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체의 용량 또는 조합된 치료의 항신생혈관 및/또는 항종양 효과가 로우 엔드(low-end의 의도된 치료적 범위로 향하는 경우, 이 치료는 여전히 모든 다른 치료들보다 동등하거나 심지어 더욱 효과적일 것이라는 것 또한 알 수 있을 것이다. 유감스럽게도 어떤 종양 및 증상들은 중간의 또는 긴 시간 동안에 효과적으로 치료될 수 없다는 것은 임상의에게 있어 명백하지만, 특히 적어도 약 일반적으로 제안된 다른 방법들만큼 효과적인 경우 현재의 치료의 유용성을 부정하지는 않는다.

신생혈관이 형성된 종양의 치료를 위한 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체 구조물의 적절한 용량 또는 조합된 치료를 설계하는 것에 있어서, 그것은 임상적 투여를 위한 적절한 용량에 이르도록 하기 위하여 본원에 기재된 동물 연구 및 문헌에 있는 지식들로부터 쉽게 추정될 수 있다. 동물에서 인간 용량으로의 전환을 달성하기 위하여, 그것은 실험 동물의 단위 질량(unit mass) 당 투여된 약제의 질량을 설명할 것이며, 바람직하게는 실험 동물과 인간 환자 사이의 신체 표면적(body surface area; m2)에서의 차이를 설명할 것이다. 이와 같은 모든 계산은 잘 알려져 있으며, 당업자들에게 일반적이다.

예를 들면, 마우스 연구에서 성공적인 용량을 획득하고, 질량 및 표면적에 기초한 표준 계산을 적용함으로써 얻은 인간 환자에 사용하기에 효과적인 용량은 약 1mg/m2 및 약 1000mg/m2 사이, 바람직하게는 약 50mg/m2 및 약 500mg/m2 사이, 및 가장 바람직하게는 약 10mg/m2 및 약 100mg/m2 사이일 것이다. 비록 용량들이 항신생혈관제로서 사용하기 위한 나상의 또는 비접합된 항체와 관련하여 사용하기에 바람직할하다 할지라도, 이 용량들은 VEGFR2-차단성 인간 항-VEGF 나상 항체 및 VEGFR2-차단성 인간 항-VEGF 면역접합체에 적합하다.

따라서, 이 정보들을 사용하여, 본 발명자들은 인간 투여에 유용한 낮은 용량의 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체가 약 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 35, 40, 45 또는 약 50mg/m2 일 것이며; 인간 투여에 유용한 높은 용량의 이와 같은 항체 또는 면역접합체는 약 600, 650, 700, 750, 800, 850, 900, 925, 950, 975 또는 약 1000mg/m2 일 것이라고 생각한다. 인간 투여에 유용한 중간 용량의 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체는 약 55, 60, 70, 80, 90, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 525, 550 또는 약 575 mg/m2 정도와 같은 낮은 범위 및 높은 범위 사이의 임의의 용량이 될 것으로 생각된다.

특정하게 정해진 범위 사이의 임의의 앞서 언급한 인용된 예시 용량 또는 임의의 중간값을 사용하는 임의의 특정 범위가 고려된다. VEGFR2-차단성 인간 항-VEGF 면역접합체가 사용되는 경우, 응고 면역접합체는 일반적으로 독소 면역접합체보다 더욱 높은 용량으로 사용될 수 있다는 것 또한 알 수 있을 것이다.

일반적으로, 약 10-100mg/m2, 약 10-90mg/m2, 약 10-80mg/m2, 약 20-100mg/m2, 약 20-90mg/m2, 약 20-80mg/m2, 약 30-100mg/m2, 약 30-90mg/m2, 약 30-80mg/m2, 약 15-100mg/m2, 약 25-100mg/m2, 약 35-100mg/m2, 약 15-90mg/m2, 약 25-90mg/m2, 약 35-90mg/m2 정도의 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체의 투약 범위가 바람직할 것이다. 이러한 정해진 범위에도 불구하고, 활성 또는 최적 범위 내에서 더 변형된 본원에 주어진 파라미터 및 본원에 존재하는 상세한 가이드라인은 본 발명 내에 포함될 것이라는 것을 알 수 있을 것이다.

따라서, 더욱 낮은 용량은 다른 시약과의 조합에서 더욱 적절할 수 있으며, 높은 용량은 여전히 특히 VEGFR2-차단성 인간 항-VEGF 항체 및 면역접합체의 주어진 강화된 안전성에 내성이 있을 수 있다. 인간 항체(및 선택적으로 인간 응고제 또는 항신생혈관 단백질)의 사용은 본 발명이 임상 사용에 보다 안전하며, 건강한 조직에 대한 현저한 독성 또는 부작용의 기회를 더 감소시키도록 한다.

본 발명의 치료 요법의 목적은 일반적으로 받아들일 수 없는 독성과 관련된 레벨 이하로 용량을 여전히 유지시키면서 현저한 항종양 효과를 만들어내기 위한 것이다. 용량 그 자체를 변화시키는 것 뿐만 아리나, 상기 투여 요법 또한 치료 전략을 최적화시키도록 개조될 수 있다. 하나의 치료 프로토콜은 약 1mg/m2 및 약 1000mg/m2 사이, 바람직하게는 약 50mg/m2 및 500mg/m2 사이, 가장 바람직하게는 약 10mg/m2 및 약 100mg/m2 사이의 VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체, 또는 이와 같은 것들을 포함하는 치료적 칵테일을 약 1주에 1 내지 3번, 바람직하게는 정맥내 또는 근육내 투여, 가장 바람직하게는 정맥내로 투여하는 것이다.

특정 용량을 투여하는 것에 있어서, 전신적으로 환자에게 (멸균성, 발열성, 순도 및 일반적 안정성의 FDA 표준에 따른) 약제학적으로 허용가능한 조성물을 제공하는 것이 바람직할 것이다. 정맥내 주사가 일반적으로 바람직하다. 약 1 내지 2시간 정도의 시간에 걸친 지속적인 주입 또한 고려된다.

당연히, 광범위한 사용 이전에 임상 실험이 수행될 것이다. 환자의 치료 및 관찰을 포함하는 임상 실험 수행의 다양한 요소들은 본 발명의 명세서의 관점에서 당업자에게 잘 알려져 있을 것이다. 하기의 정보들은 이와 같은 실험을 달성하는 데 사용하기 위한 일반적인 가이드라인으로서 존재한다.

첫번째 VEGFR2-차단성 인간 항-VEGF 항체 치료 연구를 위하여 선택된 환자들은 적어도 한 과정의 기존의 치료에 반응하지 않을 것이며, 물리적 검사, 실험실 기술 및/또는 방사선 촬영 방법에 의하여 측정된 것으로서 객관적으로 특정가능한 질병을 가질 것이다. 임의의 화학치료는 연구에 들어가기 적어도 2주 전에 중단되어야 한다. 마우스 유래의 단일클론 항체 또는 항체 부분이 사용된 경우, 상기 환자들은 마우스 면역글로불린에 대한 알러지 병력을 가지고 있지 않아야 한다.

어떤 이점들은 삼중의 관 포트(triple lumen port)를 가지는 중심 정맥 유치 카테터(indwelling central venous catheter)의 사용에서 발견될 것이다. VEGFR2-차단성 인간 항-VEGF 항체는 예를 들어, 0.22μ 필터를 사용하여 여과되고, 식염수와 같은 것을 사용하여 적절하게 희석되어 총 부피 100ml이 되어야 한다. 사용하기 전, 시료는 또한 유사한 방법으로 여과되어야 하며, 그것의 농도는 A280을 측정함으로써 여과 전 및 후에 평가된다. 예상되는 회수는 87% 내지 99%의 범위 내여야 하며, 단백질 손실에 대한 조절은 그 후에 고려될 수 있다.

VEGFR2-차단성 인간 항-VEGF 항체 또는 면역접합체는 각각의 환자가 2-7일 간격으로 2-4 주입을 받음과 동시에 대략 4-24 시간 동안에 걸쳐 투여될 수 있다. 투여는 또한 7일간에 걸쳐 일정한 속도의 주입으로 수행될 수 있다. 임의의 용량 레벨로 주어진 상기 주입은 관찰된 임의의 독성에 따라야만 한다. 그러므로, 만일 임의의 단일 주입 후 또는 일정한 속도로 주입하는 특정 시간 동안에 등급 II 독성(Grade II toxicity)에 도달하면, 추가 용량은 보류되거나 독성이 향상될 때까지 일정한 속도의 주입은 멈춰져야만 한다. 대략 60%의 환자들이 임의의 카테고리에서 허용할 수 없는 등급 III 또는 IV 독성을 나타낼 때까지 증가된 용량의 VEGFR2-차단성 인간 항-VEGF 항체가 환자군에 투여되어야만 한다. 이 값의 2/3 용량이 안전한 용량으로서 정의된다.

물론 물리적 시험, 종양 측정 및 실험실 테스트가 치료 전과 한달 후의 간격으로 수행되어야 한다. 실험실 실험은 완전한 혈구 수치(blood count), 혈청 크레아티닌(serum creatinine), 크레아틴 키나아제(creatine kinase), 전해물(electrolyte), 요소(urea), 질소(nitrogen), SGOT, 빌리루빈(bilirubin), 알부민(albumin) 및 총혈청단백(total serum protein)을 포함하여야 한다. 치료 60일 후에 획득한 혈청 샘플은 투여된 치료제 및 임의의 그것들의 부분에 대한 항체의 존재에 대한 방사면역 검정(radioimmunoassay)에 의하여 평가되어야 한다. 예를 들어, ELISA 또는 RIA와 같은 임의의 표준 검정법을 사용한 혈청의 면역학적 분석은 VEGFR2-차단성 인간 항-VEGF 항체의 약동학 및 청소율이 평가될 수 있도록 할 것이다.

항종양 반응을 평가하기 위하여, 환자들을 1주에 대하여 48시간째 및 마지막 주입 후 30일째에 다시 검사하여야 한다. 촉진 가능한(palpable) 질병이 존재할 경우, 모든 덩어리들의 두개의 수직의 지름(prependicular diameter)이 치료하는 동안 매일, 치료 완료 후 1주 내 및 30일째에 측정되어야 한다. 비촉진성 질병을 측정하기 위하여, 연속 CT 스캔이 48시간 내지 1주 및 다시 30일째에 가슴, 배 및 골반을 통하여 1-cm 간격으로 수행될 수 있다. 조직 샘플들은 또한 적절하게는 질병 부위로부터 얻은 생검(biopsies) 또는 심지어 혈액 또는 유동성 샘플을 사용하여, 조직학적으로 및/또는 유세포 분석기에 의하여 평가되어야 한다.

임상 반응은 허용가능한 기준에 의하여 정의될 수 있다. 예를 들면, 완전한 반응은 치료 1개월 후에 모든 측정가능한 종양의 소멸에 의하여 정의될 수 있다. 그에 반하여, 부분적인 반응은 어떠한 종양 부위의 확장도 나타내지 않고, 치료 1개월 후 모든 평가가능한 종양 결절(nodules)의 생성물의 수직 지름의 합계의 50% 또는 그 보다 큰 감소로 정의될 수 있다. 유사하게는, 혼합된 반응은 하나 또는 그 이상의 부위에서의 진행과 함께, 치료 1개월 후 모든 측정가능한 병변의 생성물의 수직 지름의 50% 또는 그 보다 더 큰 감소로 정의될 수 있다.

상기에 기재된 것들과 같은 임상 실험으로부터의 결과에 비추어, 보다 더욱 정확한 치료 요법이 제형화될 수 있다. 그럼에도 불구하고, 투약에 있어서의 어떤 변경이 치료될 피험자의 조건에 따라 후에 필요할 수 있다. 본 발명의 명세서를 고려하여, 투여에 관련된 의사는 개개의 피험자들에 적절한 용량을 결정할 수 있을 것이다. 이와 같은 최적화 및 조정은 당업계에서 일반적으로 수행되며, 결코 과도한 실험을 요하지 않는다.

G. 조합 치료

관절염, 건선, 아테롬성 동맥경화증, 당뇨병성 망막증, 노화관련 황반변성, 그레이브스 병, 혈관 재협착, 혈관종 및 신생혈관성 녹내장(또는 상기에 기재된 다른 질병) 또는 고형 종양과 같은 신생혈관성 질병을 치료하기 위하여 사용되는지 여부에 관계없이, 본 발명은 다른 치료들과 조합될 수 있다.

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체 치료 방법은 환자가 나타내는 특정 종양, 질병 또는 질환의 치료에 일반적으로 사용되는 임의의 다른 방법과 조합될 수 있다. 특정한 치료 접근법이 환자의 증상 그 자체에 해롭다고 알려져 있지 않고, VEGFR2-차단성 인간 항-VEGF 항체 치료를 현저하게 방해하지 않는 한, 본 발명과 그것의 조합이 고려된다.

방사선 치료, 방사선치료제, 항신생혈관제, 아포토시스-유도제 및 항튜불린성 약물와 본 발명의 조합된 사용이 특히 바람직하다. 이와 같은 약제들의 많은 예들이 본 발명의 면역접합체와 관련하여 상기에 기재되어 있다. 치료적 접합체의 일 부분으로서 사용하기 위하여 처음으로 기재된 임의의 약제 또한 개별적으로 사용될 수 있으나, 여전히 본 발명과 조합하여 실시 가능하지 않다.

하나 또는 그 이상의 약제가 VEGFR2-차단성 인간 항-VEGF 항체 치료와 조합하여 사용되는 경우, 조합된 결과가 각각의 치료가 개별적으로 수행될 때 관찰된 효과의 합계일 필요는 없다. 비록 최소한의 부가적인 효과가 일반적으로 바람직하다 할지라도, 상기 단일 치료 중 하나의 임의의 증가된 항종양 효과는 이득일 것이다. 또한, 조합된 치료가 확실히 가능하고 유익하다 할지라도, 특히 시너지 효과를 나타낼 필요는 없다.

예를 들어, 안과 또는 다른 신생혈관성 질병 또는 질환을 치료하기 위한 조합된 항신생혈관 치료를 수행하기 위하여, 동물 내에서 그것들의 조합된 치료적 또는 항신생혈관적 작용을 야기하는 데 효과적인 방법으로, 다른 (제2의) 항신생혈관제를 포함하는 다른 치료제와 조합하여 VEGFR2-차단성 인간 항-VEGF 항체를 동물에게 간단히 투여할 것이다. 따라서, 상기 약제는 질병 부위 내에서의 그것들의 조합된 존재 및 눈과 같은 질병 환경에서 그것들의 조합된 작용을 야기하는 데 효과적인 시간 간격 동안 효과적인 양으로 제공될 것이다.

이 목적을 달성하기 위하여, VEGFR2-차단성 인간 항-VEGF 항체 및 다른 치료제 또는 항신생혈관제가 단일 조성물로 또는 서로 다른 투여 방법을 사용하는 두개의 별도의 조성물로서 동시에 동물에게 투여될 수 있다. 대안적으로, 상기 VEGFR2-차단성 인간 항-VEGF 항체 치료는 예를 들어, 분 내지 주(week)와 월(month)의 간격으로 다른 치료 또는 항신생혈관 치료에 우선하거나 뒤따를 수 있다. VEGFR2-차단성 인간 항-VEGF 항체 및 다른 치료제 또는 항신생혈관제가 유익하게 조합된 치료 효과를 발휘하도록 이와 같은 치료가 수행될 것이다.

종양 치료에 관해서는, 조합된 항종양 치료를 수행하기 위하여 동물 내에서 그것의 조합된 항종양 작용을 야기하는 데 효과적인 방법으로 다른 항암제와 조합한 VEGFR2-차단성 인간 항-VEGF 항체를 동물에게 똑같이 투여할 것이다. 이 약제들은 다시 종양의 맥관구조 내에 그것들의 조합이 존재하도록 하고 종양의 환경에 그것들의 조합된 작용을 야기하는 데 효과적인 시간 동안 효과적인 양으로 제공될 것이다.

VEGFR2-차단성 인간 항-VEGF 항체 및 항암제는 단일 조성물로, 또는 서로 다른 투여 방법을 사용하는 두개의 별도의 조성물로서 동시에 동물에게 투여될 수 있다. 대안적으로, VEGFR2-차단성 인간 항-VEGF 항체는 항암제 전 또는 후, 예를 들어 따로따로 분 내지 주(week)와 월(month)에 주어질 수 있다. 항암제 및 VEGFR2-차단성 인간 항-VEGF 항체는 종양에 유익한 조합된 효과를 발휘할 것이다. 많은 항암제들이 VEGFR2-차단성 인간 항-VEGF 항체 항신생혈관 치료 이전에 주어질 것이다. 그러나, 많은 다른 항암제들이 특히 VEGFR2-차단성 인간 항-VEGF 면역접합체가 사용된 후에, VEGFR2-차단성 인간 항-VEGF 항체와 동시에 또는 그 후에 거기에 투여될 것이다.

암 치료에서 물질의 조합의 일반적인 사용은 잘 알려져 있다. 예를 들면, 미국 특허등록번호 제5,710,134호(참조로서 본원에 통합되어 있음)는 비독성 물질 또는 "프로드러그(prodrugs)"와 조합하여 종양에서 괴사를 유도하는 성분을 기재하고 있다. 괴사 과정에 의해 자유롭게된 효소 세트는 비독성 "프로드러그"를 독성 "약물(drug)"로 절단하여 종양 세포의 죽음을 야기한다. 또한, 미국 특허등록번호 제5,747,469호(참조로서 본원에 통합되어 있음)는 p53을 암호화하는 바이러스 벡터와 DNA 파괴 시약(DNA damaging agent)의 조합된 사용을 기재하고 있다. 임의의 이와 같은 유사한 접근법들이 본 발명과 함께 사용될 수 있다.

어떤 상황에서, 각각의 투여 사이에 몇 일(2, 3, 4, 5, 6 또는 7), 몇 주(1, 2, 3, 4, 5, 6, 7 또는 8) 또는 심지어는 몇 달(1, 2, 3, 4, 5, 6, 7 또는 8)이 경과되는 경우, 치료를 위한 기간을 상당히 연장하는 것이 바람직할 것이다. 하나의 치료가 수술 또는 화학치료와 같은 종양을 실질적으로 파괴하고, 또 다른 치료는 항신생혈관제에 기초한 치료와 같은 미세전이 또는 종양의 재성장을 방지하기 위한 경우의 상황에 유리할 것이다. 항신생혈관제는 효과적으로 상처를 치유하도록 하기 위하여 수술 후 주의 깊은 시기에 투여되어야 한다.

VEGFR2-차단성 인간 항-VEGF 항체 또는 항암제 중 어느 한쪽의 많은 투여가 사용될 것이라는 것 또한 상상된다. 약제는 격일 또는 격주로 상호교환적으로 투여될 수 있거나; VEGFR2-차단성 인간 항-VEGF 항체의 서열 치료가 주어진 후 항암제 서열 치료가 주어진다. 임의의 사건에서, 조합된 치료를 사용하여 종양의 퇴화를 달성하기 위하여 필요한 모든 것은 투여 시기에 상관없이 항종양 효과를 발휘하는 데 효과적인 조합된 양으로 약제 모두를 운반하는 것이다.

수술에 관하여, 임의의 수술적 중재가 본 발명과 조합하여 수행될 수 있다. 방사선 치료와 관련하여, γ선 조사(γ-irradiation), X-레이(X-rays), UV 조사(UV-irradiation), 마이크로파(microwaves) 및 심지어는 전자 방출(electronic emission) 등과 같은 종양의 세포 내에서 국부적으로 DNA 데미지를 유도하기 위한 임의의 메카니즘이 고려된다. 종양 세포로의 방사성 동위원소의 직접적인 운반 또한 고려되며, 이것은 표적 항체 또는 다른 표적 수단, 및 바람직하게는 VEGFR2-차단성 인간 항-VEGF 항체와 함께 사용될 수 있다.

사이토카인 치료 또한 조합된 치료 요법을 위한 효과적인 파트너로 제공된다. 다양한 사이토카인들이 이와 같은 조합된 접근법에 사용될 수 있다. 대표적인 사이토카인은 IL-1α, IL-1β, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, TGF-β, GM-CSF, M-CSF, G-CSF, TNFα, TNFβ, LAF, TCGF, BCGF, TRF, BAF, BDG, MP, LIF, OSM, TMF, PDGF, IFN-α, IFN-β, IFN-γ를 포함한다. 사이토카인들은 환자의 증상 및 사이토카인의 상대적 독성과 같은 임상적 징조와 부합하는 표준 요법에 따라 투여된다. 우테로글로빈(uteroglobins) 또한 전이를 방지하거나 억제하는 데 사용될 수 있다(U.S. Patent No. 5,696,092; 참조로서 본원에 통합되어 있음).

G1 . 화학치료

어떤 구현에서, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 화학 치료제와 조합하여 투여될 수 있다. 다양한 화학 치료제들이 본원에 기재된 조합된 치료 방법에서 사용될 수 있다. 예로서 고려되는 화학 치료제들은 예를 들어, 아드리아마이신(adriamycin), 닥티노마이신(dactinomycin), 미토마이신(mitomycin), 카르미노마이신(carminomycin), 다우노마이신(daunomycin), 독소루비신(doxorubicin), 타목시펜(tamoxifen), 탁솔(taxol), 탁소티어(taxotere), 빈크리스틴(vincristine), 빈블라스틴(vinblastine), 비노렐빈(vinorelbine), 에토포시드(etoposide)(VP-16), 5-플루오로우라실(5-fluorouracil; 5FU), 사이토신 아라비노사이드(cytosine arabinoside), 시클로포스파미드(cyclophosphamide), 티오테파(thiotepa), 메토트렉세이트(methotrexate), 캄포테신(camptothecin), 악티노마이신-D(actinomycin-D), 미토마이신 C(mitomycin C), 시스플라틴(cisplain; CDDP), 아미노프테린(aminopterin), 콤브레타스타틴(combretastatin(s)) 및 유도체 및 그것들의 프로드러그를 포함한다.

당업자들에 의해 이해될 수 있는 것으로서, 화학 치료제의 적절한 용량은 일반적으로 임상 치료에 이미 사용된 것들일 수 있으며, 여기에서 상기 화학 치료제는 단독으로 또는 다른 화학 치료제와 조합하여 투여된다. 실시예만의 형태로, 시스플라틴과 같은 시약 및 다른 DNA 알킬화제가 사용될 수 있다. 시스플라틴은 총 세가지의 과정에 대한 3주간 매 5일 20mg/m2의 임상적 적용에 사용되는 효과적인 용량을 사용하여 암을 치료하는 데 널리 사용된다. 시스플라틴은 경구적으로 흡수되지 않으므로 정맥내, 피하내, 종양내 또는 복강내 주사를 통하여 운반되어야만 한다.

더욱 유용한 약제는 DNA 복제, 유사분열 및 염색체 분리(chromosomal segregation)를 방해하는 화합물을 포함한다. 이와 같은 화학치료 화합물은 또한 독소루비신, 에토포시드, 베라파밀(verapamil), 포도필로톡신(podophyllotoxin) 등으로 알려져 있는 아드리아마이신을 포함한다. 종양 형성의 치료를 위한 임상 셋팅에 널리 사용되는 이 화합물들은 정맥내 1회분 또는 경구적으로 정맥투여 용량의 두배에 대한 35-50mg/m2에 대하여, 아드리아마이신에 대하여 21일 간격으로 25-75mg/m2의 용량으로 정맥내 볼루스 주사(bolus injections)를 통하여 투여된다.

합성 및 폴리뉴클레오티드 전구체의 정확성(fidelity)을 파괴하는 약제 또한 사용될 수 있다. 충분한 시험을 거치고 쉽게 입수가능한 약제가 특히 유용하다. 이와 같은 것으로서, 5-플루오로우라실(5-FU)와 같은 약제는 이 약제가 종양 세포를 표적화하는 데 특히 유용하도록 만드는 종양 조직에 의해 선택적으로 사용된다. 비록 상당히 독성이 있다 할지라도, 5-FU는 국부적인 것을 포함하는 넓은 범위의 담체로 사용할 수 있지만, 3 내지 15mg/kg/일의 범위의 용량을 사용하는 정맥 투여가 일반적으로 사용된다.

조합된 치료를 위한 대표적 화학 치료제를 표 3에 열거하였다. 각각의 열거된 약제들은 대표적인 것이며 제한되지 않는다. 당업자들은 "레밍턴의 약학(Remington's Pharmaceutical Sciences; 15th Edition)" 챕터 33, 특히 624-652페이지를 참조하라. 투약에서의 변경은 치료될 증상에 따라 발생할 것이다. 치료를 관리하는 의사는 개개의 피험자에 대하여 적절한 용량을 결정할 수 있을 것이다.

[표 3]

종양형성 질병에 유용한 화학치료제

Figure 112013109092908-pat00002

Figure 112013109092908-pat00003

Figure 112013109092908-pat00004

Figure 112013118735889-pat00005

Figure 112013109092908-pat00006

Figure 112013109092908-pat00007

Figure 112013109092908-pat00008

Figure 112013109092908-pat00009

G2 . 항신생혈관제

정상의 생리학적 환경 하에서, 인간 또는 동물들은 매우 특이적인 한정된 상황에서만 신생혈관이 형성된다. 예를 들면, 신생혈관형성은 정상적으로 상처 치유, 태아 및 배아 발생 및 황체(corpus luteum), 자궁내막(endometrium) 및 태반(placenta)의 형성에서 관찰된다. 억제되지 않은(계속적이고/이거나 조절되지 않은) 신생혈관형성은 다양한 질병 상태에 관련되며, 종양의 전이 중에 발생한다.

조절된 및 조절되지 않은 신생혈관형성 모두 유사한 방법으로 발생한다고 여겨진다. 기저막(basement membrane)에 의해 둘러싸인 내피 세포 및 혈관주위 세포(pericyte)는 모세 혈관(capillary blood vessels)을 형성한다. 신생혈관형성은 내피 세포 및 백혈구에 의해 방출된 효소에 의한 기저막의 미란(erosion)으로부터 시작한다. 혈관 내강(lumen)에 자리잡고 있는 내피세포는 그 후 기저막을 통하여 튀어나온다. 신생혈관성 자극(stimulant)은 내피 세포가 미란된 기저막을 통하여 이동하도록 유도한다. 상기 이동하는 세포는 모혈관으로부터 "발아(sprout)"하고, 상기 내피 세포는 유사분열과 증식을 겪는다. 상기 발아된 내피는 새로운 혈관을 생성하는 모세 루프(capillary loops)를 형성하기 위하여 서로 융합된다.

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 임의의 하나 또는 그 이상의 다른 항신생혈관제와 조합하여 사용될 수 있다. VEGF를 억제하는 다른 약제와의 조합은 다른 중화 항체(Kim et al ., 1992; Presta et al ., 1997; Sioussat et al ., 1993; Kondo et al ., 1993; Asano et al ., 1995; Hurwitz et al ., 2004), 수용성 수용체 구조물(Kendall and Thomas, 1993; Aiello et al ., 1995; Lin et al ., 1998; Millauer et al ., 1996), 티로신 키나아제 억제제(Siemeister et al ., 1998), 역배열 전략(antisense strategies), VEGF 또는 VEGF 수용체에 대한 RNA 압타머 및 리보자임(Saleh et al., 1996; Cheng et al., 1996; 각각 참조로서 본원에 통합되어 있음)과 같은 것들이 포함된다. 참조로서 본원에 특별히 통합되어 있는 국제특허출원번호 제98/16551호에 기재된 것과 같은, 길항적 특성을 가지는 VEGF 변종 또한 사용될 수 있다.

항신생혈관 치료는 항신생혈관성 약제의 공급 또는 신생혈관성 약제의 억제를 기초로 할 수 있다. 중화 항체, 수용성 수용체 구조물, 소분자 억제제(small molecular inhibitors), 역배열, RNA 압타머 및 리보자임을 포함하는 VEGF를 억제하기 위하여 기재된 하나 또는 그 이상의 방법에 의해 달성될 수 있는 신생혈관성 약제의 억제가 모두 사용될 수 있다. 예를 들면, 참조로서 본원에 특별히 통합되어 있는 미국 특허등록번호 제5,520,914호에 기재된 것과 같은 안지오제닌(angiogenin)에 대한 항체가 사용될 수 있다. FGF는 신생혈관형성과 관련된다는 점에서 FGF 억제제 또한 사용될 수 있다. 어떤 예들은 아카란 설페이트(acharan sulfate)와 같은 글리코사미노글리칸(glycosaminoglycans)을 포함하는 그것들의 주요 반복 유닛으로서 2-O-황산화 우론산(2-O-sulfated uronic acid)를 가지는 서열에서 교차하는 N-아세틸글루코사민(N-acetylglucosamine)을 가지는 화합물이다. 이와 같은 화합물들은 참조로서 본원에 특별히 통합되어 있는 미국 특허등록번호 제6,028,061호에 기재되어 있으며, 본원의 것들과 조합하여 사용될 수 있다.

다양한 질병의 상태에서 나타나는 것과 같은 신생혈관형성의 치료에 유용한 다양한 티로신 키나아제 억제제가 현재 공지되어 있다. 이것들은 예를 들어, 본 발명과 조합하여 사용될 수 있는, 참조로서 본원에 특별히 통합되어 있는 미국 특허등록번호 제5,639,757호의 4-아미노피롤로[2,3-d]피리미딘(4-aminopyrrolo[2,3-d]pyrimidine)이다. VEGFR2 수용체를 통하여 티로신 키나아제 신호전달을 조정할 수 있는 유기 분자의 또 다른 예는 퀴나졸린 화합물(quinazoline compounds) 및 신생혈관형성의 치료에서 본 발명과 함께 사용하기 위한 또 다른 조합을 설명하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있는 미국 특허등록번호 제5,792,771호의 조성물이다.

다른 화학적 클래스의 화합물들 또한 신생혈관형성을 억제하는 것으로 나타났으며, 본 발명과 조합하여 사용될 수 있다. 예를 들면, 참조로서 본원에 특별히 통합되어 있는 미국 특허등록번호 제5,972,922호에 기재된 것과 같은, 안지오스타틱 4,9(11)-스테로이드(angiostatic 4,9(11)-steroids) 및 C21-산소화 스테로이드(C21-oxygenated steroids)와 같은 스테로이드가 조합된 치료에 사용될 수 있다. 각각 참조로서 본원에 특별히 통합되어 있는 미국 특허등록번호 제5,712,291호 및 제5,593,990호는 신생혈관형성을 억제하기 위하여 또한 본 발명과 조합하여 사용될 수 있는 탈리도미드(thalidomide) 및 관련 화합물, 전구체, 유사체, 대사물질 및 가수분해 생성물을 기재하고 있다. 미국 특허등록번호 제5,712,291호 및 제5,593,990호에서의 화합물은 경구적으로 투여될 수 있다. 조합된 치료와 관련하여 유용한 또 다른 대표적인 항신생혈관성 약제는 표 4에 열거되어 있다. 거기에 열거된 각각의 약제들은 대표적인 것이며 그것으로 제한되지 않는다.

신생혈관형성의 억제제 및 음성 조절제 물질 참고문헌 수용성 VEGFR1(soluble VEGFR1) Shibuya, 2006 수용성 뉴로필린-1(Soluble Neuropilin-1; NRP-1) Gagnon et al ., 2000 안지오스타틴(Angiostatin) O'Reilly et al ., 1994 엔도스타틴(Endostatin) O'Reilly et al ., 1997 안지오포이에틴 2(Angiopoietin 2) Maisonpierre et al ., 1997 칼레티쿨린(Calreticulin) Pike et al ., 1999 바소스타틴(Vasostatin) Pike et al ., 1998 바스큘로스타틴(Vasculostatin) Kaur et al ., 2005 칸스타틴(Canstatin) Kamphaus et al ., 2000 마스핀(Maspin) Zou et al ., 1994 16kDa 프로락틴 단편(prolactin fragment) Ferrara et al ., 1991; Clapp et al ., 1993; D'Angelo et al ., 1995; Lee et al., 1998 라미닌 펩티드(Laminin peptides) Kleinman et al ., 1993; Yamamura et al ., 1993; Iwamoto et al ., 1996; Tryggvason, 1993 피브로넥틴 펩티드(Fibronectin peptide) Grant et al ., 1998; Sheu et al ., 1997 조직 메탈로프로테이나아제 억제제(Tissue metalloproteinase inhibitors; TIMP 1,2,3,4) Sang, 1998 플라스미노겐 활성제 억제제(Plasminogen activator inhibitors; PAI-1, 2) Soff et al ., 1995 종양 괴사 인자 α(Tumor necrosis factor α)(고용량, 시험관 내) Frater-Schroder et al ., 1987 TGF-β1 RayChadhury and D'Amore, 1991; Tada et al., 1994 인터페론(Interferons;IFN-α, -β, -γ) Moore et al ., 1998; Lingen et al ., 1998 ELR-CXC 케모카인(Chemokines):
IK-12; IL-4; IL-18; SDF-1; MIG; 혈소판 인자(platelet factor) 4(PF4); IP-10; CXCL10
Moore et al ., 1998; Hiscox and Jiang, 1997; Coughlin et al ., 1998; Tanaka et al., 1997
트롬보스폰딘(Thrombospondin; TSP), TSP-1 및 TSP-2 Good et al ., 1990; Frazier, 1991; Bornstein, 1992; Tolsma et al ., 1993; Sheibani and Frazier, 1995; Volpert et al., 1998 SPARC Hasselaar and Sage, 1992; Lane et al ., 1992; Jendraschank and Sage, 1996 2-메톡시에스트라디올(2-Methoxyestradiol) Fotsis et al ., 1994 프롤리페린-관련 단백질(Proliferin-related protein) Jackson et al ., 1994 수라민(Suramin) Gagliardi et al ., 1992; Takano et al ., 1994; Waltenberger et al ., 1996; Gagliardi et al ., 1998; Manetti et al ., 1998 탈리도마이드(Thalidomide) D'Amato et al ., 1994; Kenyon et al ., 1997; Wells, 1998 카복시아미도트리아졸(Carboxyamidotriazole; CAI) Hussain et al ., 2003 코르티손(Cortisone) Thorpe et al ., 1993; Folkman et al ., 1983; Sakamoto et al ., 2003 리노마이드(Linomide) Vukanovic et al ., 1993; Ziche et al ., 1998; Nagler et al ., 1998 후마질린(Fumagillin; AGM-1470; TNP-470) Sipos et al ., 1994; Yoshida et al ., 1998 타목시펜(Tamoxifen) Gagliardi and Collins, 1993; Lindner and Borden, 1997; Haran et al ., 1994 한국 겨우살이 추출물(Korean mistletoe extract)(Viscum album coloratum) Yoon et al ., 1995 레티노이드(Retinoids) Oikawa et al ., 1989; Lingen et al ., 1996; Majewski et al ., 1996 CM101 Hellerqvist et al ., 1993; Quinn et al ., 1995; Wamil et al ., 1997; DeVore et al., 1997 덱사메타손(Dexamethasone) Hori et al ., 1996; Wolff et al ., 1997 백혈병 억제 인자(Leukemia inhibitory factor; LIF) Pepper et al ., 1995

신생혈관형성을 억제하는데 사용하기 위한 어떤 바람직한 성분은 안지오스타틴, 엔도스타틴, 바스큘로스타틴, 칸스타틴 및 마스핀이다. 이와 같은 약제는 본 발명의 면역접합체와 함께 상기에 기재되어 있으나, 조합하거나 비접합된 형태로 사용될 수 있다.

어떤 항신생혈관 치료는 이미 종양의 퇴화를 야기하는 것으로 나타났으며, 세균성 다당류 CM101 및 항체 LM609를 포함한다. CM101은 종양에서 신생혈관 염증을 유도하는 능력을 특징으로 하는 세균성 다당류이다. CM101은 보체 시스템의 활성화를 자극하는 미분화 내피(dedifferentiated endothelium) 상에 발현되는 수용체와 결합하고 가교결합한다. 그것은 또한 종양을 선택적으로 표적화하는 사이토카인-구동성(cytokine-driven) 염증 반응을 개시한다. 그것은 VEGF 및 그것의 수용체 발현을 하향조절하는 고유한 항병리신생혈관성 약제(antipathoangiogenic agent)이다. CM101은 현재 항암 약물로서 임상실험 중이며, 본 발명과 함께 조합하여 사용될 수 있다.

트롬보스폰딘(thrombospondin; TSP-1) 및 혈소판 인자 4(platelet factor 4; PF4) 또한 본 발명과 조합하여 사용될 수 있다. 이것들은 모두 헤파린과 관련된 신생혈관형성 억제제이며, 혈소판 α-과립(granules)에서 발견된다. TSP-1은 세포외 매트릭스 성분인 450kDa의 커다란 다중 도메인 글리코단백질(multi-domain glycoprotein)이다. TSP-1은 HSPGs, 피브로넥틴, 라미닌(laminin) 및 서로 다른 형태의 콜라겐을 포함하는 세포외 매트릭스에서 발견되는 많은 프로테오글리칸(proteoglycan)과 결합한다. TSP-1은 시험관 내에서 내피 세포의 이동 및 증식을 억제하며, 생체 내에서 신생혈관형성을 억제한다. TSP-1은 또한 변형된 내피 세포의 악성 표현형 및 종양 형성을 억제할 수 있다. 종양 억제 유전자 p53은 p53 활성의 손실이 TSP-1의 생성에서 극적인 감소를 유발하며 신생혈관형성이 개시된 종양에서 부수물의 증가를 야기하도록, TSP-1의 발현을 직접적으로 조절함을 보여준다.

PF4는 시험관 내에서의 내피 세포 증식 및 생체 내에서의 신생혈관형성을 강력하게 억제할 수 있는 케모카인의 CXC ELR- 패밀리의 구성원인 70aa의 단백질이다. PF4는 종양 내로 투여되거나 종양 성장의 억제를 야기할 수 있는 아데노바이러스성 벡터에 의해 운반된다.

인터페론과 메탈로프로테이나아제 억제제는 본 발명과 함께 조합될 수 있는 자연적으로 생성된 신생혈관형성 억제제의 두개의 다른 클래스이다. 인터페론의 항내피 활성(anti-endotheilial activity)은 1980년 초반부터 알려져 있었으나, 억제 메카니즘은 여전히 명확하지 않다. 그것들은 내피 세포 이동을 억제할 수 있고, 종양 세포에 의한 신생혈관성 프로모터의 생성을 억제하는 능력에 의해 매개될 가능성이 있는 생체 내의 어떤 항신생혈관 활성을 가진다고 알려져 있다. 특히 혈관 종양은 인터페론에 민감하며, 예를 들어 증식성 혈관종은 IFNα로 성공적으로 치료될 수 있다.

메탈로프로테이나아제의 조직 억제제(tissue inhibitors of metalloproteinases; TIMPs)는 또한 신생혈관형성을 억제하고 조합된 치료 프로토콜에 사용될 수 있는 매트릭스 메탈로프로테이나아제(matrix metalloproteases; MMPs)의 자연적으로 생성된 억제제 패밀리이다. MMPs는 그것들이 혈관 네트워크를 확장하거나 리모델링할 때 내피 세포 및 섬유아 세포(fibroblast)의 이동을 통하여 매트릭스를 퇴화시키기 때문에 신생혈관형성 과정에서 중요한 역할을 한다. 사실, MMPs 중 하나의 구성원인 MMP-2는 아마 이러한 목적을 위한 인테그린(integrin) ανβ3을 통하여 활성화된 내피와 관련이 있음을 보여준다. 만일 이 상호작용이 MMP-2의 단편에 의하여 파괴된다면, 그 후 신생혈관형성은 하향조절되고 종양의 성장은 억제된다.

임의의 하나 또는 그 이 상의 본 발명과 함께 사용될 수 있는, 신생혈관형성을 억제하는 다수의 약제(pharmacological agents)가 있다. 이것들은 AGM-1470/TNP-470, 탈리도마이드 및 카복시아미도트리아졸(carboxyamidotriazole; CAI)을 포함한다. 후마질린(fumagillin)은 1990년대에 신생혈관형성의 강력한 억제제로 발견되었으며, 그 후 후마질린의 합성 유사체인 AGM-1470 및 TNP-470이 개발되었다. 이 약물들 모두 시험관 내에서 내피 세포 증식을 억제하며, 생체 내에서 신생혈관형성을 억제한다. TNP-470은 장기간의 투여가 최적이라는 것을 암시하는 데이터와 함께 인간의 임상 실험에서 광범위하게 연구되었다.

탈리도마이드는 원래 진정제로서 사용되지만, 강력한 기형발생 물질(teratogen)이라는 것을 발견하여 사용이 중지되었다. 1994년에 탈리도마이드는 신생혈관형성 억제제라는 것이 발견되었다. 탈리도마이드는 현재 항암제 뿐만 아니라 혈관성 안질환의 치료로서 임상 실험되고 있다.

CAI는 콜라겐 IV 상에서의 액틴 재구성(actin reorganization), 내피 세포 이동 및 확장(spreading)을 예방하는 칼슘 채널 차단제(blocker)로서 작용하는 신생혈관형성의 소분자량 합성 억제제이다. CIA는 생리학적으로 도달할 수 있는 농도에서 신생혈관형성을 억제하며, 암 환자에 의하여 경구적으로 잘 적용된다. CAI를 사용한 임상 실험은 치료 전 진행성 질병을 가지는 암 환자의 49%에서 질병 안정화를 가져왔다.

헤파린 또는 헤파린 단편의 존재하에서 코르티손(cortisone)은 내피 세포 증식을 차단함으로써 마우스에서 종양의 성장을 억제함을 보여준다. 비록 헤파린이 내피 세포에 의해 스테로이드의 포획을 증가시킬 수 있다고 여겨진다 할지라도, 스테로이드 및 헤파린의 부가적인 저해 효과에 관련된 메카니즘은 명확하지 않다. 상기 혼합물은 새로 형성된 모세관 아래에 있는 기저막의 용해를 증가시키는 것으로 나타났고, 이것은 또한 부가적인 신생혈관 억제성 효과에 대한 설명을 가능하게 한다. 헤파린-코르티솔 접합체는 또한 생체 내에서 강력한 신생혈관 억제 및 항종양 효과 활성을 가진다.

또 다른 특정 신생혈관형성 억제제는 항침습 인자(Anti-Invasive Factor), 레티노산(retinoic acid) 및 파클리탁셀(paclitaxel)(U.S. Patent No. 5,716,981; 참조로서 본원에 통합되어 있음); AGM-1470(Ingber et al., 1990; 참조로서 본원에 통합되어 있음); 상어 연골 추출물(shark cartilage extract)(U.S. Patent No. 5,618,925; 참조로서 본원에 통합되어 있음); 음이온성 폴리아미드(anionic polyamide) 또는 폴리우레아 올리고머(U.S. Patent No. 5,593,664; 참조로서 본원에 통합되어 있음); 옥신돌(oxindole) 유도체(U.S. Patent No. 5,576,330; 참조로서 본원에 통합되어 있음); 에스트라디올(estradiol) 유도체(U.S. Patent No. 5,504,074; 참조로서 본원에 통합되어 있음); 및 티아졸로피리미딘(thiazolopyrimidine)(U.S. Patent No. 5,599,813; 참조로서 본원에 통합되어 있음) 또한 본 발명의 조합된 사용을 위한 항신생혈관 조성물로서 사용하기 위하여 고려된다.

αγβ3 인테그린의 길항제(antagonist)를 포함하는 조성물 또한 본 발명과 함께 조합하여 신생혈관형성을 저해하는 데 사용될 수 있다. 미국 특허등록번호 제5,766,591호(참조로서 본원에 통합되어 있음)에 기재된 것과 같이, 고리형 폴리펩티드들을 포함하는 RGD-함유 폴리펩티드(RGD-containing polypeptides) 및 그것들의 염이 αγβ3 인테그린 길항제의 적절한 예이다.

αγβ3 인테그린에 대한 항체 LM609 또한 종양의 퇴화를 유도한다. LM609와 같은 인테그린 αγβ3 길항제는 영향을 받지 않은 비활동적 혈관을 떠나는 신생혈관성 내피 세포의 아포토시스를 유도한다. LM609 또는 다른 αγβ3 길항제는 또한 αγβ3 및 MMP-2의 상호작용을 억제함으로써 작동할 수 있고, 단백질 가수분해성 효소는 내피세포 및 섬유아 세포의 이동에 중요한 역할을 한다고 생각되어 진다. 미국 특허등록번호 제5,753,230호는 신생혈관형성을 억제하기 위한 본 발명과 조합하기 위한 αγβ3(비트로넥틴(vitronectin αγβ3)에 대한 항체를 설명하기 위하여 참조로서 본원에 특별히 통합되어 있다.

이 경우에 있어서 신생혈관성 내피의 아포토시스는 혈관 네트워크의 안정에 캐스케이드(cascade) 효과를 가질 수 있다. 확장을 위한 종양의 신호에 완전하게 반응하는 것으로부터 종양의 혈관 네트워크를 억제하는 것은 사실 종양 세포의 죽음 또는 종양 부피의 손실을 야기하는 네트워크의 부분적 또는 전체적 붕괴를 개시할 수 있다. 엔도스타틴 및 안지오스타틴은 유사한 방식으로 기능할 수 있다. LM609는 비활성 혈관에 영향을 주지는 않지만, 항종양 효과를 얻기 위하여 종양 내의 모든 혈관이 치료를 위하여 표적화될 필요는 없다는 것을 강력하게 암시하는 종양의 퇴화를 야기할 수 있다.

Tie2 활성을 차단할 수 있는 수용성 Tie2 수용체를 사용하는 것과 같이, Tie2 수용체를 통하여 신호를 바꾸는 것에 기초한 치료적 중재의 다른 방법 또한 본 발명과 함께 조합하여 사용될 수 있다(Lin et al ., 1998). 재조합 아데노바이러스 유전자 치료를 사용하는 이와 같은 구조물의 운반은 암을 치료하고 전이를 감소시키는 데 효과적임을 보여주었다(Lin et al ., 1998).

G3 . 아포토시스 - 유도제

VEGFR2-차단성 인간 항-VEGF 항체 치료제는 또한 아포토시스를 유도하기 위한 방법과 유익하게 조합될 수 있다. 다양한 아포토시스-유도제들이 본 발명의 면역접합제와 함께 상기에 기재되어 있다. 임의의 이와 같은 아포토시스-유도제들이 본 발명의 항체에 연결되지 않고 본 발명과 함께 조합하여 사용될 수 있다.

면역접합체로서 상기에 기재된 아포토시스-유도제들은 제외하고, 다수의 종양 유전자들(oncogenes)이 아포토시스 또는 프로그램된 세포 죽음을 억제하는 것으로 확인되었다.

이 카테고리에서 대표적인 종양 유전자들은 bcr-abl, bcl-2(bcl-1과는 다름, 시클린 D1(cyclin D1); Gene Bank accession numbers M14745, X06487; U.S. Patent No. 5,650,491; 5,539,094; 각각 참조로서 본원에 통합되어 있음) 및 Bcl-xl, Mcl-1, Bak, A1, A20을 포함하는 패밀리 구성원을 포함하지만 이로 제한되지는 않는다. bcl-2의 과다발현은 T 세포 림프종(lymphomas)에서 처음으로 발견되었다. bcl-2는 아포토시스 경로에서 단백질인 Bax에 결합하고 불활성화시킴으로써 종양 유전자로서 기능한다. bcl-2 기능의 억제는 Bax의 불활성화를 예방하고 아포토시스 경로가 진행되도록 한다.

이러한 클래스의 종양 유전자의 억제, 예를 들어 역배열 뉴클레오티드 서열을 사용하는 것이 아포토시스의 강화를 제공하기 위한 본 발명에 사용하기 위하여 고려된다(U.S. Patent No. 5,650,491; 5,539,094 및 5,583,034, 각각 참조로서 본원에 통합되어 있음).

G4 . 면역독소 및 응고리간드

본 발명의 치료 방법은 종양 세포, 종양 맥관구조 또는 종양 기질의 상대적으로 특이적인 마커에 그것들의 표적 부분, 예를 들어 항체 또는 리간드가 유도되는 면역독소 및/또는 응고리간드와 함께 조합하여 사용될 수 있다. 상기에 논의된 화학 치료제 및 항신생혈관 약제와 마찬가지로, 표적화된 독소 또는 응고인자의 조합된 사용은 일반적으로 부가적이거나 심지어 상승적인 항종양 결과보다 부가적이고, 현저하게 더욱 큰 결과를 야기할 것이다.

일반적으로 말하자면, 본 발명의 이러한 부가적인 양상에서 사용하기 위한 항체 또는 리간드들은 바람직하게는 종양 부위에서 선택적으로 또는 특이적으로 발현되는 접근가능한(accessible) 종양 항원을 인식할 것이다. 상기 항체 또는 리간드들은 또한 바람직하게는 높은 친화력의 특성을 나타낼 것이며; 항체, 리간드 또는 그것들의 접합체들은 심장, 신장, 뇌, 간, 골수, 결장, 유방, 전립선, 갑상선, 쓸개, 폐, 부신, 근육, 신경 섬유, 이자, 피부 또는 다른 인간의 신체에서 생명을 유지하는 기관 또는 조직으로부터 선택된 하나 또는 그 이상의 조직들과 같은 생명을 유지하는 정상 조직에 대하여 생체 내에서 현저한 부작용을 나타내지 않을 것이다. 본원에 사용된 것으로서, 상기 용어 "현저한 부작용(significant side effects)"은 생체 내에 투여될 때 화학 치료중 일반적으로 나타나는 것들과 같은 단지 무시해도 좋거나 임상적으로 처리하기 쉬운 부작용만을 일으키는 항체, 리간드 또는 항체 접합체를 말한다.

본 발명과 조합하여 사용된 이러한 제2의 항암제의 적어도 하나의 결합 영역은 독소 또는 응고 이자를 종양 영역으로 운반할 수 있는, 즉 종양 부위 내로 위치시킬 수 있는 성분일 것이다. 이와 같은 표적화제는 종양 세포, 종양 맥관구조 또는 종양 기질의 성분에 대하여 유도될 수 있다. 상기 표적화제는 일반적으로 종양 세포, 종양 맥관구조 또는 종양 기질의 표면에서 발현된, 표면에 접근가능하거나 또는 표면에 위치된 성분에 결합할 것이다. 그러나, 일단 종양 맥관구조 및 종양 세포 파괴가 일어나면, 내부 성분들이 방출되어 사실상 임의의 종양 성분의 부가적인 표적화를 가능하게 할 것이다.

많은 종양 세포 항원들이 기재되어 있고, 그것들 중 임의의 하나는 본 발명의 조합된 양상과 관련하여 표적으로서 사용될 수 있다. 부가적인 면역독소 및 응고인자 표적화를 위한 적절한 종양 세포 항원들은 항체 B3에 의하여 인식되는 것들(U.S. Patent No. 5,242,813, 참조로서 본원에 통합되어 있음, ATCC HB 10573); KSI/4(U.S. Patent No. 4,975,369, 참조로서 본원에 통합되어 있음, 벡터 NRRL B-18356 및/또는 NRRL B-18357을 포함하는 세포로부터 얻어짐); 260F9(ATCC HB 8488) 및 D612(U.S. Patent No. 5,183,756, 참조로서 본원에 통합되어 있음, ATCC HB 9796)을 포함한다. 그것은 또한 항종양 세포 항체를 생산하는 다른 적절한 세포주를 확인하기 위하여 임의의 다음 해(year)의 ATCC 카탈로그를 참고할 수 있다.

종양 맥관구조의 표적화를 위하여, 표적화 항체 또는 리간드는 종종 신생혈관이 형성된 종양의 종양내부 혈관에 발현된, 부착된, 유도되거나 그렇지 않다면 위치된 마커에 결합할 것이다. 적절하게 발현된 표적 분자들은 예를 들어, 엔도글린(endoglin), E-셀렉틴(E-selectin), P-셀렉틴(P-selectin), VCAM-1, ICAM-1, PSMA(Liu et al., 1997), TIE, LAM-1과 반응하는 리간드, VEGF/VPF 수용체, FGF 수용체, αγβ3 인테그린, 플레이오트로핀(pleiotropin) 및 엔도시알린(endosialin)을 포함한다. 적절한 흡착된 표적은 VEGF, FGF, TGFβ, HGF, PF4, PDGF, TIMP, TIE와 결합하는 리간드 및 종양 관련 피브로넥틴 아형과 같은 것들이다. ELAM-1, VCAM-1, ICAM-1, LAM-1과 반응하는 리간드, 엔도글린 및 심지어 (예를 들어, IL-1, TNF-α, IFN-γ, IL-4 및/또는 TNF-β에 의하여 사이토카인-유도가능한) MHC 클래스 II; 및 (예를 들어, 트롬빈, 인자 IX/IXa, 인자 X/Xa 및 플라스민에 의하여 응고제-유도가능한) E-셀렉신, P-셀렉신, PDGF 및 ICAM-1과 같은, 사이토카인 및 응고제에 의하여 자연적이고 인공적으로 유도가능한 항원들 또한 표적화될 수 있다.

하기의 특허들은 종양의 맥관구조의 발현되고, 흡착되고, 유도되거나 위치된 마커에 대하여 유도되는 면역독소의 제조 및 사용에 관한 현재의 교시를 더욱 보충하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있다: 미국 특허등록번호 제6,093,399호, 제5,855,866호, 제5,965,132호, 제6,051,230호, 제6,004,555호, 제5,877,289호, 제6,004,554호, 제5,776,427호, 제5,863,538호, 제5,660,827호 및 제6,036,955호.

또 다른 종양 맥관구조 표적화 조성물 및 방법은 최근에 접근가능하다고 발견된 종양 혈관의 특이적 마커인 포스파티딜세린 및 포스파티딜에탄올아민과 같은 아미노포스포리피드를 표적화하는 것들을 포함한다. 항-아미노포스포리피드 항체의 단독 투여는 혈전증 및 종양의 퇴화를 유도하는 데 충분하다. 본 발명은 따라서 비접합된 항-포스파티딜세린 및/또는 포스파티딜에탄올아민 항체와 효과적으로 조합될 수 있거나, 이와 같은 항체의 면역접합체가 사용될 수 있다.

하기의 특허들은 항-아미노포스포리피드 항체 및 면역독소들의 제조 및 사용에 관한 현재의 교시를 더욱 보충하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있다: 미국 특허등록번호 제6,406,693호, 제6,312,694호, 제6,783,760호 및 제7,067,109호. 미국 특허등록번호 제6,312,694호, 제6,783,760호, 제6,818,213호 및 제7,067,109호는 독소 및 응고제를 종양 혈관으로 운반하는 데 사용하고 혈전증 및 종양의 퇴화를 유도하기 위한, 아넥신(annexin) 접합체와 같은 아미노포스포리피드 결합 단백질 접합체의 사용에 관한 현재의 교시를 더욱 보충하기 위한 목적으로 참조로서 본원에 더 통합되어 있다.

적절한 종양 기질 표적은 기저막 마커, 타입 IV 콜라겐, 라미닌, 헤파란 설페이트, 프로테오글리칸, 피브로넥틴, 활성화된 혈소판, LIBS 및 테나신을 포함하는, 종양 세포외 매트릭스 또는 기질의 성분, 또는 거기에 결합되는 성분들을 포함한다. 이와 같은 사용에 바람직한 표적은 RIBS이다.

하기의 특허들은 종양 기질 표적화제의 제조 및 용도에 관한 현재의 교시를 더욱 보충하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있다: 미국 특허출원번호 제6,093,399호, 제6,004,555호, 제5,877,289호, 및 제6,036,955호.

제2의 항암 치료제들은 VEGFR2-차단성 항-VEGF 항체 또는 VEGFR2-차단성 항-VEGF 항체 기재의 면역독소에 사용하기 위하여 본원에 기재된 임의의 세포독소 또는 그렇지 않다면 항암제에 작동가능하게 부착될 수 있다. 그러나, 적절한 항종양제 또한 방사성 동위원소를 포함한다. 리신 A 사슬 및 탈글리코실화된 A 사슬(dgA)와 같은 독소 부분이 바람직할 것이다.

본 발명과 함께 선택적으로 사용하기 위한 제2의 표적화제는 응고를 촉진할 수 있는 표적화된 성분, 즉 응고리간드를 포함할 수 있다. 여기에서, 표적 항체 또는 리간드는 VEGFR2-차단성 항-VEGF 항체 또는 VEGFR2-차단성 항-VEGF 항체 기재의 응고리간드에 사용하기 위하여 여기에 기재된 임의의 것들을 포함하는 직접 또는 간접적으로 응고를 자극하는 임의의 인자에 예를 들어, 다른 항체를 통하여 직접 또는 간접적으로 연결될 수 있다. 이와 같이 사용하기 위한 바람직한 응고 인자는 조직 인자(TF) 및, 절단된 TF(tTF), 이량체성 및 다량체성 TF 및 인자 VII를 활성화하기 위한 능력이 결여된 돌연변이 TF와 같은 TF 유도체들이다.

암 치료에서의 조합된 사용을 위한 면역독소 및 응고리간드의 유효량은 약 1주당 한번의 빈도로 IV 방법을 통하여 투여될 때, 약 0.1mg/kg 및 약 2mg/kg 사이, 바람직하게는 약 0.8mg/kg 및 약 1.2mg/kg 사이일 것이다. 투약에서의 어떤 변경은 치료될 피험자의 증상에 따라 필수적으로 발생할 것이다. 치료를 책임지는 의사가 개개의 피험자를 위하여 적절한 용량을 결정할 것이다.

G5 . TLR 작용제( agonist )

각각 TLR4를 활성화시키는 약화된 살모넬라 콜레라수이스(attenuated S. choleraesuis), BCG 및 탁솔을 포함하는 공지된 항암제의 효과에 공헌하는 톨-유사 수용체(Toll-Like Receptor; TLRs)를 통한 시그널링(signaling)이 현재 확립되어 있다. 실제로, TLR4 시그널링은 화학치료 및 방사선 치료의 함암 효과에 공헌한다(Apetoh et al., 2007). 어떤 공지의 항암제의 작용 메카니즘을 더욱 잘 이해하는 것 뿐만 아니라, TLR 시그널링의 중요성을 인식하는 것은 또한 TLRs를 활성화시킴으로써 기능하는 새로운 암치료제의 개발을 촉진한다.

따라서, 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 TLR을 통하여 시그널링을 자극하는 하나 또는 그 이상의 약제, 즉 하나 또는 그 이상의 TLR 작용제와 조합하여 암 치료에 사용될 수 있다. 적어도 제1의 TLR 작용제는 또한 면역접합체 부분(section)에서 본원에 기재된 것과 같은 치료적 접합체를 생성하기 위하여 본 발명의 인간 항체에 작동가능하게 부착될 수 있다. 임의의 하나 또는 그 이상의 하기의 또는 다른 TLR 작동제가 본 발명의 조합된 암 치료에 사용될 수 있다.

적절한 TLR 작동제는 임의의 하나 또는 그 이상의 TLR1 내지 TLR11, 바람직하게는 TLR1, TLR2, TLR4, TLR7, TLR8 또는 TLR9 및 가장 바람직하게는 TLR4, TLR7, TLR8 또는 TLR9 작동제를 포함한다. TLR1/TLR2 작동제는 리포단백질, 예를 들어 OspA, 및 트리아실화된 리포단백질을 포함하며, TLR2 작동제는 세균성 리포단백질, LAM, MALP-2, 글리코리피드 및 포린(porins)을 포함한다.

TLR4 작동제의 특정 예는 5D24.D4라 불리는 작동성(agonistic) 항-TLR4 항체(Cohen et al ., 2003), LPS, 지질 A 및 그것들의 유도체를 포함하며, 그것들 중 모노포스포릴 지질 A(monophosphoryl lipid A; MPL) 및 MPL 유사체가 현재 바람직하다. GAPs로서 알려져 있는 MPL 유사체는 본 발명과 조합하여 합성 TLR4 작동제로서 사용될 수 있다(Alderson et al ., 2006). TLR4 및 CD14를 통하여 시그널링을 자극하는 작동제는 또한 LPS, 지질 A, MPL 및 MPL 유사체 뿐만 아니라, 탁솔, 파클리탁셀, 플라보리핀(flavolipin) 및 GIPLs를 포함한다. TLR4 작동제 OK-432 및 OK-PSA는 자궁 경부암 및 비소세포 폐 암종(non-small-cell lung carcinoma)을 치료하는 데 사용되어 왔다.

TLR7 작동제는 이미퀴모드(imiquimod), 레시퀴모드(resiquimod) 및 이사토리빈(isatoribine)를 포함하며(Finberg et al ., 2005; Horsmans et al ., 2005), 이미퀴모드는 기저세포 암종(basal cell carcinoma)을 치료하는 데 사용하기 위하여 승인되었다. 다른 TLR7 작동제들은 가디퀴모드(gardiquimod), 록소리빈(loxoribine) 및 브로피리민(bropirimine)을 포함한다. 레시퀴모드는 또한 TLR8 작동제이다. CpG와 같은 TLR9 작동제는 비소세포 폐 암종, 비호지킨성 림프종(non-Hodgkin's lymphoma), 신세포암(renal cell carcinoma) 및 대장암(colorectal cancer)을 치료하는 데 사용되고 있다.

G6 . ADEPT 프로드러그 치료

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 프로드러그와 접합하여 사용될 수 있으며, 여기에서 상기 VEGFR2-차단성 인간 항-VEGF 항체는 단지 항체와 접촉해서만 프로드러그를 더욱 활성형으로 전환시키는 프로드러그 활성화 효소와 같은 프로드러그 활성화 성분과 작동가능하게 결합된다. 이 기술은 일반적으로 "ADEPT"라 불리며, 이것은 예를 들어, 각각 참조로서 본원에 특별히 통합되어 있는 국제특허출원번호 제95/13095호, 제97/26918호, 제97/24143호 및 미국 특허등록번호 제4,975,278호 및 제5,658,568호에 기재되어 있다.

본원에 사용된 것으로서, 상기 용어 "프로드러그(prodrug)"는 기초가 되는 모 약물과 비교하여 볼때, 종양 혈관 내피 세포를 포함하는 표적 세포에 감소된 세포독성 또는 그것이 아니라면 항암효과를 발휘하는 생물학적 또는 약제학적 활성 물질의 전구체 또는 유도체 형태를 말한다. 바람직하게는, 상기 프로드러그 또는 전구체 형태는 "천연(native)" 또는 모 형태(parent form)와 비교하여 현저하게 감소된 또는 더욱 바람직하게는 무시할 수 있을 정도의 세포독성 또는 항암 효과를 발휘한다. "프로드러그"는 더욱 활성적인 약물의 모 형태를 산출하기 위하여 활성화되거나 전환될 수 있다.

프로드러그를 만들고 사용하기 위한 기술 능력은 당업자들에게 존재한다. 윌만 등(Willman et al ., 1988) 및 스텔라와 힘멜슈타인(Stella and Himmelstein, 1985)은 다양한 프로드러그를 어떻게 만들고 사용하는지에 관련된 명세 및 교시를 더욱 보충하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있다. 본 발명의 측면에서 사용될 수 있는 대표적인 프로드러그 구조물은 포스페이트-함유 프로드러그(U.S. Patent No. 4,975,278), 티오포스페이트-함유 프로드러그, 설페이트-함유 프로드러그, 펩티드-기재의 프로드러그(U.S. Patent No. 5,660,829; 5,587,161; 5,405,990; WO 97/07118), D-아미노산이 변경된 프로드러그, 글리코실화된 프로드러그(U.S. Patent No. 5,561,119; 5,646,298; 4,904,768; 5,041,424), β-락탐-함유 프로드러그, 선택적으로 치환된 페닐아세트아미드-함유 프로드러그, 및 심지어는 5-플루오로시토신(5-fluorocytosine)(U.S. Patent No. 4,975,278) 및 5-플루오로우리딘(5-fluorouridine) 프로드러그 등을 포함하지만 이로 제한되지는 않으며, 여기에서 각각의 특허들은 참조로서 본원에 특별히 통합되어 있다.

프로드러그 형태로 사용될 수 있는 치료제 또는 세포독성 약물의 형태는 사실상 무한하다. 더 많은 세포독성 약제들이 프로드러그로서 사용하기에 덜 바람직한 이와 같은 형태의 운반, 예를 들어 응고제의 운반에 대하여 바람직할 것이다. 프로드러그를 만드는 데 필수적인 모든 것은 프로드러그가 실질적으로 불활성이 되도록 구조물을 설계하기 위한 것이며, "방출(released)"되거나 활성화된 약물은 실질적으로 또는 적어도 충분하게는 의도된 목적을 위한 활성을 가진다.

원래의 프로드러그 상에서의 다양한 향상들 또한 공지되어 있으며, 국제특허번호 제95/03830호, 유럽 특허번호 제751,144호(안트라시클린), 국제특허번호 제97/07097호(시클로프로필인돌) 및 국제특허번호 제96/20169호에 기재된 것과 같은 것들이 본 발명과 사용하기 위하여 고려된다. 예를 들면, 감소된 Km을 가지는 프로드러그는 본 발명의 측면에서 사용될 수 있는, 참조로서 본원에 특별히 통합되어 있는 미국 특허등록번호 제5,621,002호에 기재되어 있다. 참조로서 본원에 특별히 통합되어 있는 국제특허번호 제96/03151호에 예시되어 있고 본 발명과 함께 수행될 수 있는, 세포 내에서 수행될 수 있는 프로드러그 치료 또한 공지되어 있다.

ADEPT에서 사용하기 위하여, 프로드러그를 더욱 활성 약물로 활성화시키거나 전환시키는 약제는 VEGFR2-차단성 인간 항-VEGF 항체에 작동가능하게 부착될 수 있다. 따라서, 상기 VEGFR2-차단성 인간 항-VEGF 항체는 활성 약물이 종양의 맥관구조 및 기질과 같은 영역에서만 생성되고 순환 또는 건강한 조직에서는 생성되지 않도록 하기 위하여, 신생혈관성 부위 내, 바람직하게는 종양의 맥관구조 및 기질 내에 프로드러그를 전환시키는 능력을 위치시킨다.

프로드러그 활성화에 작용하도록 VEGFR2-차단성 인간 항-VEGF 항체에 부착될 수 있는 효소는 포스페이트-함유 프로드러그와 조합하여 사용하기 위한 알칼리성 포스파타아제(alkaline phosphatase)(U.S. Patent No. 4,975,278); 설페이트-함유 프로드러그와 조합하여 사용하기 위한 아릴설파타아제(arylsulfatase)(U.S. Patent No. 5,270,196); 세라티아 프로테아제(serratia protease), 써모리신(thermolysin), 서브틸리신(subtilisin), 카복시펩티다아제(carboxypeptidase)와 같은 펩티다아제 및 프로테아제(U.S. Patent No. 5,660,829; 5,587,161; 5,405,990) 및 펩티드 기재의 프로드러그와 조합하여 사용하기 위한 (카텝신 B 및 L을 포함하는) 카텝신(cathepsins); D-아미노산이 변경된 프로드러그와 조합하여 사용하기 위한 D-알라닐카복시펩티아다제(D-alanylcarboxypeptidases); 글리코실화된 프로드러그와 조합하여 사용하기 위한, β-갈락토시다아제(β-galactosidase) 및 뉴라미니다아제(neuraminidase)와 같은 탄수화물 절단 효소(carbohydrate-cleaving enzyme)(U.S. Patent NO. 5,561,119; 5,646,298); β-락탐 함유 프로드러그와 조합하여 사용하기 위한 β-락타마아제(β-lactamase); 페녹시아세트아미드(phenoxyacetamide) 기 또는 페닐아세트아미드(phenylacetamide) 기와 함께 그것들의 아미노 니트로겐(amino nitrogens)에서 유도체화된 약물과 조합하여 사용하기 위한 페니실린 V 아미다아제(penicillin V amidase; U.S. Patent No. 4,975,278) 또는 페니실린 G 아미다아제와 같은 페니실린 아미다아제; 및 5-플루오로시토신 기재의 프로드러그(U.S. Patent No. 4,975,278)와 조합하여 사용하기 위한 시토신 디아미나아제(cytosine deaminase; U.S. Patent No. 5,338,678; 5,545,548)을 포함하지만 이로 제한되는 것은 아니며, 여기에서 각각의 특허들은 참조로서 본원에 특별히 통합되어 있다.

촉매 항체(catalytic antibodies) 또는 "애브자임(abzymes)"으로 알려져 있는 효소적 활성을 가지는 항체들 또한 프로드러그를 활성 약물로 전환시키는 데 사용될 수 있다. 따라서, VEGFR2-차단성 인간 항-VEGF 항체에 기초한 애브자임은 본 발명의 다른 양상을 형성한다. 애브자임을 만들기 위한 기술적 능력은 또한 애브자임에 대한 교시를 보충하기 위한 목적으로 참조로서 본원에 특별히 통합되어 있는 매시 등(Massey, 1987)에 의해 예시되어 있는 것과 같이 당업자들에게 있다. 참조로서 본원에 특별히 통합되어 있는 유럽 특허출원번호 제745,673호에 기재되어 있는 것과 같이, 질소 머스터드 아릴 카바메이트(nitrogen mustard aryl carbamate)와 같은 카바메이트 위치에서 프로드러그의 붕괴를 촉진시킬 수 있는 촉매 항체가 더욱 고려된다.

G7 . 안구용 화합물( ocular combinations )

본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 당뇨병성 망막증, 황반변성, 노화 관련 황반변성, 신생혈관성 녹내장 및 상기에 기재된 다른 안질환을 포함하는 안질환 및 신생혈관성 안질환을 치료하기 위한 다른 치료제와 조합하여 사용될 수 있다. 상기 항체들은 수술을 포함하는 안질환의 치료에 일반적으로 사용되는 임의의 다른 방법과 조합될 수 있다.

다른 치료제와의 조합에 관해서는, VEGFR2-차단성 인간 항-VEGF 항체가 다른 치료제로서 전, 후 또는 실질적으로 동시에 투여될 수 있다. 실질적인 동시 투여는 단일 조성물 또는 두개의 개별 조성물로부터 달성될 수 있다.

황반변성, 노화관련 황반변성(AMD) 및 다른 안과적 징조와 관련된 것들과 같은 맥락막 신생혈관형성에 관해서는, 본 발명의 어떤 바람직한 조합은 SPARC(분비된 단백질, 산성 및 시스테인에 풍부; secreted protein, acidic and rich in cysteine)를 차단하고, 억제하고, 감소시키고, 하향조절 또는 중화시키는 제2의 약제를 사용하는 것들이다(Nozaki et al., 2006; U.S. Patent No. 2006/0135423). 본 발명의 항체들은 이미 VEGFR2 활성은 차단하지만 VEGFR1 활성은 차단하지 않기 때문에, SPARC를 차단하는 하나 또는 그 이상의 약제들과 그것들의 조합은 눈에서의 VEGF-유도성 신생혈관형성을 더 감소시키는데 특히 효과적인 방법을 형성할 것이다.

SPARC 억제제 또는 길항제는 예를 들어, VEGF 그 자체에 의지하여 성공적으로 개발된 것과 같은 동일한 분자 형태의 것들을 포함한다. 대표적인 SPARC 억제제들은 따라서 억제성 항-SPARC 항체 및 그것들의 항원-결합 단편(예를 들어, Sweetwyne et al ., 2004); RNA 압타머 및 RNA/DNA 압타머, SPARC 발현을 침묵시키거나 방해하는 스플라이싱 RNAs(siRNA 또는 RNAi)와 같은 와 같은 역배열 전략; 리보자임; 및 다른 단백질, 펩티드 및 소분자 억제제를 포함한다. 다클론성 및 단일클론성 항체 및 siRNAs를 포함하는 많은 이와 같은 SPARC 억제제들은 예를 들어, 시그마/알드리치사(Sigma/Aldrich), 산타 크루즈 바이오테크놀로지사(Santa Cruz Biotechnology, Inc., R&D Systems)로부터 상업적으로 이용가능하다. 따라서, 임의의 하나 또는 그 이상의 SPARc 억제제들이 DNA, RNA 및/또는 단백질 레벨 중 어느 하나에서 SPARC 레벨 또는 활성을 부가적으로 차단, 억제, 감소, 하향조절 또는 중화시키기 위하여 본 발명과 접합하여 사용될 수 있다.

H. 진단 및 이미지화

본 발명은 시험관 내 및 생체 내 진단 및 이미지화 방법을 더 제공한다. 이와 같은 방법들은 관절염, 건선 및 고형 종양으로 예시되지만 본원에 기재된 모든 신생혈관성 질병을 포함하지는 않는 임의의 신생혈관성 질병에 대한 진단, 예측(prognostic) 또는 이미지화 정보를 생성하는 데 사용할 수 있다. 종양의 진단 및 이미지화 분야에 관계없이, 본 발명의 이러한 양상들은 시험관 내 진단 테스트, 바람직하게는 샘플이 비침습적으로 얻어질 수 있고, 높은 효율의 검정에서 테스트될 수 있는 경우 및/또는 애매한 임상 진단에서 확인이 필요할 경우 사용하기에 가장 바람직하다.

H1 . 면역검출 방법 및 키트

여전히 다른 구현에서, 본 발명은 VEGF를 결합시키고, 정제하고, 제거하고, 정량하거나 그렇지 않으면 일반적으로 검출하고, 신생혈관성 질병을 진단하기 위한 면역검출 방법과 관계가 있다. 본 발명의 VEGFR2-차단성 인간 항-VEGF 항체는 분리된 조직 샘플, 생검 또는 스왑(swabs)에서 및/또는 균질화된 조직 샘플에서, 생체 내에서 VEGF를 검출하는 데 사용될 수 있다(하기를 참조). 이와 같은 면역검출 방법은 명확한 진단 유용성을 가지지만, 또한 항원 샘플의 역가측정(titering) 등에서와 같은 비임상적 샘플에 대한 응용성도 가진다.

다양한 단계의 유용한 면역검출 방법이 예를 들어, 나카무라 등과 같은 과학 논문에 기재되어 있다(Nakamura et al ., 1986; 참조로서 본원에 통합되어 있음). 일반적으로, 면역결합 방법은 VEGF를 함유하는 것으로 의심되는 샘플을 얻고, 면역복합체를 형성하는 데 효과적인 조건 하에서 VEGFR2-차단성 인간 항-VEGF 항체와 샘플을 접촉시키는 것을 포함한다. 이와 같은 방법에서, 상기 항체는 컬럼 매트릭스(column matrix)의 형태와 같은 고체 지지체에 연결될 수 있고, VEGF를 함유하는 것으로 의심되는 샘플은 고정화된 항체에 적용될 것이다.

더욱 바람직하게는, 상기 면역결합 방법은 결합 과정 동안에 형성된 임의의 면역 복합체들의 검출 또는 정량화를 필요로 하는, 샘플에서 VEGF의 양을 검출하거나 정량하는 방법을 포함한다. 여기에서, VEGF를 함유하는 것으로 의심되는 샘플을 얻고, 이것에 따라서 항체와 샘플을 접촉시킨 후, 특정 조건하에서 형성된 면역 복합체의 양을 검출 또는 정량할 수 있다.

분석되는 생물학적 샘플은 VEGF를 함유하는 것으로 의심되며, 일반적으로 신생혈관성 질병을 가지는 것으로 의심되는 동물 또는 환자로부터 얻어지는 임의의 샘플일 수 있다. 상기 샘플들은 조직 절편 또는 표본(specimen), 생검, 스왑 또는 도포 테스트 샘플(smear test sample), 균질화된 조직 추출물 또는 분리되거나 정제된 형태의 이와 같은 샘플일 수 있다.

면역 복합체(1차 면역 복합체)를 형성하는 데 충분한 시간 동안 효과적인 조건 하에서 항체와 선별된 생물학적 샘플을 접촉하는 것은 일반적으로 대충 간단하게 샘플에 항체 조성물을 첨가하고, 임의의 존재하는 VEGF와 면역 복합체를 형성, 즉 임의의 존재하는 VEGF에 결합하기 위한 항체에 대한 충분한 시간 동안 혼합물을 배양하는 것이다. 이후에, 조직 절편, ELISA 플레이트, 점 블롯(dot blot) 또는 웨스턴 블롯과 같은 샘플-항체 조성물은 일반적으로 이 항체들만이 검출될 1차 면역 복합체 내에 특이적으로 결합되도록, 임의의 비특이적으로 결합한 항체 종들을 제거하기 위하여 세척될 것이다.

면역복합체 형성의 검출은 당업계에 잘 알려져 있으며, 다양한 접근법의 적용을 통하여 달성될 수 있다. 이러한 방법들은 일반적으로 당업계에 공지되어 있는 임의의 방사성, 형광성, 생물학적 또는 효소적 태그 또는 표지와 같은 표지 또는 마커의 검출에 기반을 두고 있다. 이와 같은 표지의 사용에 관계있는 미국 특허들은 각각 참조로서 본원에 통합되어 있는 제3,817,837호, 제3,850,752호, 제3,939,350호, 제3,996,345호, 제4,277,437호, 제4,275,149호 및 제4,366,241호를 포함한다. 발색 기질(chromogenic substrate)과 접촉하여 착색 생성물을 생성하는 효소의 사용이 일반적으로 바람직하다. 제2의 항체 또는 비오틴/아비딘 리간드 결합 배열과 같은 2차 결합 리간드 또한 당업계에 공지된 것으로서 사용될 수 있다.

검출에 사용되는 VEGFR2-차단성 인간 항-VEGF 항체는 그것들 자체가 검출 표지에 연결될 수 있고, 여기에서 그 후 이 표지는 간단하게 검출되며, 그것에 의하여 검출될 조성물에서의 1차 면역 복합체의 양이 검출된다.

바람직하게는, 상기 1차 면역 복합체는 본 발명의 항체에 결합 친화력을 가지는 제2 결합 리간드에 의하여 검출된다. 이와 같은 경우에 있어서, 상기 제2 결합 리간드는 검출가능한 표지에 연결될 수 있다. 상기 제2 결합 리간드는 그것 자체가 종종 항체이므로, "2차(secondary)" 항체라고 불릴 수 있다. 상기 1차 면역 복합체는 2차 면역 복합체를 형성하는 데 충분한 시간 동안 효과적인 조건 하에서 표지된 2차 결합 리간드 또는 항체와 접촉된다. 상기 2차 면역 복합체는 그 후 일반적으로 임의의 비특이적으로 결합된 표지된 2차 항체 또는 리간드를 제거하기 위하여 세척되고, 2차 면역 복합체에 남아있는 표지들이 그 후 검출된다.

다른 방법들은 두 단계 접근법에 의한 1차 면역 복합체의 검출을 포함한다. 1차 항체에 대한 결합 친화력을 가지는 항체와 같은 2차 결합 리간드가 상기에 기재된 것과 같은 2차 면역 복합체를 형성하는 데 사용된다. 세척 후, 상기 2차 면역 복합체는 면역 복합체(3차 면역 복합체)를 형성하는 데 충분한 시간 동안 효과적인 조건 하에서 다시 2차 항체에 대한 결합 친화력을 가지는 3차 결합 리간드 또는 항체와 접촉된다. 상기 제3차 리간드 또는 항체는 이와 같이 형성된 3차 면역 복합체의 검출을 위한 검출가능한 표지에 연결된다. 이 시스템은 원한다면 시그널 증폭을 위하여 제공될 수 있다.

신생혈관성 질병을 가지는 환자의 임상적 진단 또는 관찰에서, 정상 피험자로부터의 대응하는 생물학적 샘플에서의 농도와 비교하여, VEGF의 검출 또는 VEGF 농도에서의 증가는 신생혈관성 질병을 가지는 환자를 나타낸다.

그러나, 당업자들에게 공지되어 있는 바와 같이, 그러한 임상 진단은 분리에서 이 방법에 기초하여 만들어질 수 없을 것이다. 당업자들은 양성 확인을 나타내는 바이오마커의 현저한 발현과 바이오마커의 낮은 농도 또는 백그라운드 발현을 구별하는 데 매우 익숙하다. 사실상, 백그라운드 발현 레벨은 종종 현저하거나 양성으로서 점수매겨지게 될 염색이 증가된 상기 "컷오프(cut-off)"를 형성하는 데 사용된다.

H2 . 이미지화

본 발명의 이 양상들은 종양 이미지화 방법 및 조합된 종양 치료 및 이미지화 방법에 사용하는 데 바람직하다. 하나 또는 그 이상의 검출가능한 약제에 연결된 VEGFR2-차단성 인간 항-VEGF 항체는 그 자체를 이미지화에 사용하거나 치료 이전에 믿을 수 있는 이미지를 형성하기 위하여 종양을 미리 이미지화하기 위하여 구상된다. 이와 같은 조성물 및 방법들은 또한 내부 이미지(internal image)가 진단 또는 예측 목적 또는 치료를 설계하는 데 바람직한, 임의의 다른 신생혈관성 질병 또는 질환, 특히 비악성 종양, 아테롬성 동맥경화증 증상의 이미지화 및 진단에 적용될 수 있다.

VEGFR2-차단성 인간 항-VEGF 항체 이미지화 항체들은 일반적으로 검출가능한 표지에 작동가능하게 부착되거나 접합된 VEGFR2-차단성 인간 항-VEGF 항체를 포함할 것이다. "검출가능한 표지(detectable labels)"는 그것들의 특이적 기능 특성 또는 화학적 특성 때문에 검출될 수 있는 화합물 또는 요소이며, 그것들의 사용은 성분들이 검출되도록 부착되고 원한다면 더 정량화되는 성분이 될 수 있게 한다. 생체 내 진단 프로토콜 또는 "이미지화 방법(imaging methods)"을 위한 항체 접합체에서, 표지는 비침습적 방법을 사용하여 검출될 필요가 있다.

항체 및 결합 리간드에 대한 그것들의 부착을 위한 방법만큼 많은 적절한 조영제(imaging agents)가 당업계에 공지되어 있다(예를 들어, 모두 참조로서 본원에 통합되어 있는 미국 특허공개번호 제5,021,236호 및 제4,472,509호를 참조). 어떤 부착 방법은 예를 들어, 항체에 부착된 DTPA와 같은 유기 킬레이트화제(organic chelating agent)를 사용하는 금속 킬레이트 복합체의 사용을 포함한다(U.S. Patent No. 4,472,509). 단일클론 항체 또한 글루타르알데히드(glutaraldehyde) 또는 산화제(periodate)와 같은 결합제(coupling agent)의 존재하에서 효소와 반응시킬 수 있다. 형광 마커를 가지는 접합체는 이 결합제의 존재하에서 또는 이소티오시아네이트(isothiocyanate)와의 반응에 의하여 제조된다.

검출가능한 표지의 예는 상자성 이온(paramagnetic ions)이다. 이 경우에 있어서, 적절한 이온은 크로뮴(III), 망간(II), 철(II), 철(II), 코발트(II), 니켈(II), 구리(II), 네오디뮴(III), 사마륨(III), 이테르븀(III), 가돌리늄(III), 바나듐(II), 테르븀(III), 디스프로슘(III), 홀뮴(III) 및 에르븀(III)을 포함하며, 가돌리늄을 사용하는 것이 특히 바람직하다.

X-레이 이미지화와 같은 다른 측면에 유용한 이온은 란타늄(III), 금(III), 납(II) 및 특히 비스무스(III)를 포함하지만 이로 제한되지는 않는다. 형광 표지는 로다민(rhodamine), 플루오르세인(fluorescein) 및 레노그라핀(renographin)을 포함한다. 로다민과 플루오르세인이 종종 이소티오시아네이트 중간체를 통하여 연결된다.

진단 적용을 위한 방사성 동위원소의 경우에 있어서, 적절한 예는 14탄소(14carbon), 51크로뮴(51chromium), 36염소(36chlorine), 57코발트(57cobalt), 구리67(copper67), 152Eu, 갈륨67(gallium67), 3수소(3hydrogen), 요오드123(iodine123), 요오드125(iodine125), 인듐111(indium111), 59철(59iron), 32인(32phosphorus), 레늄186(rhenium186), 레늄188(rhenium188), 75셀레늄(75selenium), 35황(35sulphur), 테크네튬99 m(technetium99m) 및 이트륨90(yttrium99)을 포함한다. 125I가 종종 어떤 구현에서 사용하기에 바람직하며, 테크늄99 m 및 인듐111 또한 그것들의 낮은 에너지 및 장거리 검출에 대한 적합성 때문에 바람직하다.

본 발명에 사용하기 위한 방사성 표지된 VEGFR2-차단성 인간 항-VEGF 항체는 당업계에 잘 알려져 있는 방법에 따라 생산될 수 있다. 예를 들면, 항체에 방사성 동위원소 금속성 이온이 결합하는 데 종종 사용되는 매개성 작용기(intermediary functional groups)는 디에틸렌트리아민펜타아세트산(diethylenetriaminepentaacetic acid; DTPA) 및 에티렌디아민테트라아세트산(ethylenediaminetetraacetic acid; EDTA)이다.

단일클론 항체 또한 소디움 또는 포타슘 요오드화물 및 소디움 하이포클로라이트(sodium hypochlorite)와 같은 화학적 산화제, 또는 락토퍼록시다아제(lactoperoxidase)와 같은 효소적 산화제와의 접촉에 의하여 요오드화될 수 있다. 본 발명에 따른 항체들은 리간드 교환 공정(ligand exchange process)에 의하여, 예를 들어 제일주석 용액(stannous solution)을 사용하여 퍼테크네이트(pertechnate)를 환원시키고, 세파덱스 컬럼 상에서 환원된 퍼테크네이트를 킬레이트화시키고 이 컬럼에 항체를 적용함으로써, 또는 직접 표지 기술(direct labeling techniques), 예를 들어 퍼테크네이트, SNCl2와 같은 환원제, 소디움-포타슘 프탈레이트 용액(sodium-potassium phthalate solution) 및 항체를 배양함으로써 테크네튬-99(technetium-99)로 표지될 수 있다.

임의의 앞서 언급한 형태의 검출가능하게 표지된 VEGFR2-차단성 인간 항-VEGF 항체는 본 발명의 이미지화 또는 조합된 이미지화 및 치료의 양상에 사용될 수 있다. 그것들은 시험관 내 진단에서 사용하는 데 동등하게 적절하다. 생체 내 이미지화 구현을 위한 투약은 일반적으로 치료를 위한 것보다는 적지만, 또한 환자의 나이 및 체중에 의존한다. 1회 용량만으로도 충분하다.

생체 내 진단 또는 이미지화 방법은 일반적으로 환자에게 비침습적 방법에 의해 검출가능한 마커에 접합된 진단적 유효량의 VEGFR2-차단성 인간 항-VEGF 항체를 투여하는 것을 포함한다. 항체-마커 접합체는 종양 내에서 VEGF에 위치되고 결합하기 위하여 충분한 시간동안 둔다. 환자는 그 후 검출가능한 마커를 확인하기 위한 검출 기구(detection device)에 노출되어 종양의 이미지를 형성한다.

H3 . 진단 키트

여전히 다른 구현에서, 본 발명은 상기에 기재된 면역검출 및 이미지화 방법과 함께 사용하기 위한 면역검출 및 이미지화 키트를 모두 포함하는 진단 키트를 제공한다. 따라서, 키트 내에 제공된 VEGFR2-차단성 인간 항-VEGF 항체들은 일반적으로 적절한 용기 내에 포함된다.

면역검출에 대하여, 비록 재구성을 위한 항체 용액 또는 파우더가 바람직하다 할지라도, 항체들은 미세역가 플레이트(microtitre plate)의 웰과 같은 고체 지지체에 결합될 수 있다. 면역검출 키트는 바람직하게는 적어도 제1의 면역검출 시약을 포함한다. 키트의 면역검출 시약은 주어진 항체에 결합되거나 연결된 검출가능한 표지를 포함하는 다양한 형태들 중 임의의 하나를 취할 수 있다. 2차 결합 리간드에 결합되거나 부착된 검출가능한 표지 또한 고려된다. 대표적인 2차 리간드는 1차 항체에 대한 결합 친화력을 가지는 2차 항체이다.

본 발명의 키트에 사용하기 위한 더욱 적절한 면역검출 시약은 1차 항체에 대한 결합 친화력을 가지는 2차 항체에 덧붙여, 상기 2차 항체에 대한 결합 친화력을 가지는 3차 항체를 포함하는 2성분 시약을 포함하며, 상기 3차 항체는 검출가능한 표지에 연결된다. 상기에서 알 수 있는 바와 같이, 다수의 대표적인 표지들이 당업계에 공지되어 있으며, 이와 같은 모드느 표지들이 본 발명과 함께 사용될 수 있다. 이러한 키트들은 완전히 접합된 형태로, 중간체의 형태로, 또는 키트의 사용자에 의해 접합될 분리된 부분으로서 항체-표지 접합체를 포함할 수 있다.

이미지화 키트는 바람직하게는 생체 내에서 검출가능한 표지에 이미 부착된 VEGFR2-차단성 인간 항-VEGF 항체를 포함할 것이다. 그러나, 상기 표지 및 부착 기구는 개별적으로 공급될 수 있다.

어느 한 쪽의 키트는 검출 검정을 위한 표준곡선을 만드는 데 사용될 수 있으므로, 표지되었는지의 여부에 관계없이 적절하게 엘리컷된 VEGF 조성물과 같은 조절제를 더 포함할 수 있다. 키트의 성분들은 수성 매질 또는 감압하에 동결건조시킨 형태로 패키지될 수 있다.

키트의 용기 수단은 일반적으로 바람직하게는 적절하게 엘리컷된 항체 또는 항원이 담길 수 있는 적어도 하나의 바이알, 시험관, 플라스크, 병, 주사기 또는 다른 용기 수단을 포함할 것이다. 2차 또는 3차 결합 리간드 또는 부가적인 성분이 제공될 경우, 상기 키트는 또한 일반적으로 이 리간드 또는 성분이 담길 수 있는 2차, 3차 또는 다른 부가적인 용기를 포함할 것이다. 상기 키트는 또한 임의의 하나 또는 그 이상의 신생혈관성 질병의 진단에 사용하기 위한 다른 진단 시약을 포함할 수 있다. 바람직하게는, VEGF 결합에 기반을 두지 않는 2차 진단제가 사용될 것이다.

본 발명의 키트는 또한 전형적으로 항체 및 상업용을 위하여 밀폐된 다른 시약 용기를 포함할 것이다. 이와 같은 용기들은 원하는 바이알들이 계속 유지되는 사출성형(injection molded) 또는 중공성형(blow molded) 플라스틱 용기를 포함할 수 있다.

SEQ ID NO: 기술 서열 Clone EJ173-112-Cl1 (r84 scFv) 1 VH domain (nt)
CAGGTGCAGCTGGTGCAATCTGGGGCTGAGGT
GAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCT
GCAAGGCTTCTGGAGGCACCTTCAGCAGCTAT
GCTATCAGCTGGGTGCGACAGGCCCCTGGACA
AGGGCTTGAGTGGATGGGAGGTTTTGATCCTG
AAGATGGTGAAACAATCTACGCACAGAAGTTC
CAGGGCAGAGTCACCATGACCGAGGACACATC
TACAGACACAGCCTACATGGAGCTGAGCAGCC
TGAGATCTGAGGACACGGCCGTGTATTACTGT
GCAACAGGACGTTCTATGGTTCGGGGAGTCAT
TATACCTTTTAACGGTATGGACGTCTGGGGCC
AAGGGACCACGGTCACCGTCTCCTCA
도 1 참조
2 VL domain (nt)
GACATCCGGATGACCCAGTCTCCATCCTCCCTG
TCTGCATCTGTAGGAGACAGAGTCACCATCACT
TGCCGGGCAAGTCAGAGCATTAGCAGCTATTTA
AATTGGTATCAGCAGAAACCAGGGAAAGCCCC
TAAGCTCCTGATCTATGCTGCATCCAGTTTGCAA
AGTGGGGTCCCATCAAGGTTCAGTGGCAGTGGA
TCTGGGACAGATTTCACTCTCACCATCAGCAGTC
TGCAACCTGAAGATTTTGCAACTTACTACTGTCA
ACAGAGTTACAGTACCCCGCTCACTTTCGGCGG
AGGGACCAAGGTGGAGATCAAA
도 1 참조
3 VH domain (aa)
QVQLVQSGAEVKKPGASVKVSCKASGGTFSSYAIS
WVRQAPGQGLEWMGGFDPEDGETIYAQKFQGRVT
MTEDTSTDTAYMELSSLRSEDTAVYYCATGRSMVR
GVIIPFNGMDVWGQGTTVTVSS
도 1 참조
4 VL domain (aa)
DIRMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQ
QKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLT
ISSLQPEDFATYYCQQSYSTPLTFGGGTKVEIK
도 1 참조
5 Heavy CDR1 SYAIS 6 Heavy CDR2 GFDPEDGETIYAQKFQG 7 Heavy CDR3 GRSMVRGVIIPFNGMDV 8 Light CDR1 RASQSISSYLN 9 Light CDR2 AASSLQS 10 Light CDR3 QQSYSTPLT 11 Heavy FR1 QVQLVQSGAEVKKPGASVKVSCKASGGTFS 12 Heavy FR2 WVRQAPGQGLEWMG 13 Heavy FR3 RVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT 14 Heavy FR4 WGQGTTVTVSS 15 Light FR1 DIRMTQSPSSLSASVGDRVTITC 16 Light FR2 WYQQKPGKAPKLLIY 17 Light FR3 GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC 18 Light FR4 FGGGTKVEIK 19 링커 KLSGSASAPKLEEGEFSEARV 20 Whole scFv clone (nt) 도 1 참조 21 Whole scFv clone (aa) 도 1 참조 r84 Full length IgG 22 IgG heavy chain (nt) 실시예 6 참조 23 IgG light chain (nt) 실시예 6 참조 24 IgG heavy chain (aa) 실시예 6 참조 25 IgG light chain (aa) 실시예 6 참조 26 IgG VH domain (nt) 실시예 6 참조 27 IgG VL domain (nt) 실시예 6 참조

하기의 예들은 본 발명의 바람직한 구현을 설명하기 위하여 포함된다. 당업자들은 하기의 실시예에 기재된 기술들이 본 발명의 실행에서 잘 기능하도록 발명자들에 의해 발견된 기술들을 나타내며, 따라서 그것의 실행을 위한 바람직한 방법을 구성하기 위하여 고려될 수 있음을 알 수 있어야 한다. 그러나, 당업자들은 본 발명의 명세서를 고려하여 많은 변경들이 기재된 특정 구현에서 만들어질 수 있고, 본 발명의 의도와 범위를 벗어나지 않는 한 동일하거나 유사한 결과를 여전히 얻을 수 있다는 것을 알 수 있어야 한다.

실시예

실시예 1 : 항체 선별

VEGF는 배발생(embryogenesis), 골격성장(skeletal growth) 및 생식기능(reproductive functions) 동안 생리학적 신생혈관형성의 주요 조절자이다. 티로신 키나아제 수용체 VEGFR2와의 상호작용을 통한 VEGF 시그널링 또한 종양의 성장 관련을 포함하는 병리학적 신생혈관형성에 중요하다. 신생혈관형성을 차단하는 치료 특이적 인간 항체에 대한 필요성이 주어져, VEGFR2(KDR/Flk-1)와 그것의 상호작용을 특이적으로 또는 실질적으로 차단하지만, VEGFR1(Flt-1)과 그것의 상호작용은 실질적으로 차단하지 않는 VEGF 상의 에피토프에 대하여 반응하는 인간 항체를 확인하였다.

단일 사슬 형태의 항체들을 c-myc 및 6xHis 태그 에피토프를 포함하는 pHOG21 플라스미드(Kipriyanov et al ., 1996; 1997)(도 9A 및 도 9B) 내로 클로닝하였다(NcoI 및 Not I 제한 부위에서). 대장균 세포 XL-1 블루(XL-1 blue)를 형질전환시키고, 암피실린 플레이트 상에서 선별하였으며, scFv가 IPTG 유도 상에서 발현되었다. 정제된 scFv를 VEGF에 대한 선택적 생물학적 활성을 위하여 ELISA로 테스트하였다. VEGF와 VEGFR2의 상호작용은 특이적으로 차단하지만 VEGF와 VEGFR1의 상호작용은 차단하지 않는 마우스 유래의 항체 2C3를 사용하는 경쟁적 ELISA 검정에 의하여 선택적 생물학적 활성을 더 확인하였다(Brekken et al., 1998; 2000). 또한, 비아코어(Biacore)는 고정화된 VEGF-A에 대한 scFv 항체의 결합을 나타낸다. 마우스 유래의 VEGF에 대한 결합 뿐만 아니라 인간 VEGF에 대한 결합 또한 평가하였다.

A. 서열( sequencing )

하나의 바람직한 항체-생산 클론의 중쇄 및 경쇄의 뉴클레오티드 서열을 나타내었다. 상기 항체는 EJ173/112-Cl1(r84/PGN311)로 나타내며, scFv 형태(실시예 1 및 도 1) 및 전장 IgG 형태(실시예 6) 모두로 생산되었다. EJ173/112-Cl1(r84/PGN311)의 단일 사슬 형태의 경쇄 및 중쇄의 뉴클레오티드 서열 및 아미노산 서열을 도 1 및 표 5에 나타내었다. r84/PGN311의 전장 IgG 형태의 경쇄 및 중쇄의 뉴클레오티드 서열 및 아미노산 서열을 실시예 6에 나타내었다. EJ173/112-Cl1(r84/PGN311)의 경쇄 및 중쇄의 CDR 및 골격 영역을 표 5에 나타내었다.

실시예 2 : 높은 친화력으로 VEGF 에 결합하는 EJ173 /112-Cl1( r84 / PGN311 )

항체에 대한 특이성을 확인하기 위하여, 코팅된 인간 VEGF-A(Dr. Rolf A. Brekken, UT Southwestern Medical Center, Dallas, TExas로부터 얻음)에 대한 EJ173/112-Cl1(r84/PGN311)의 scFv 형태의 결합을 ELISA에 의해 테스트하였다. 간단하게는, 2μg/ml의 VEGF-A를 폴리스티렌 플레이트 상에 코팅하였다. 다음으로, 20μg/ml의 정제된 EJ173/112-Cl1(r84/PGN311) scFv를 첫번째 웰에 첨가하고, 3배 희석을 사용하여 적정하였다. 결합된 scFv를 항-c-myc 태그 마우스 단일클론 항체(Invitrogen) 및 HRP-접합된 2차 토끼 항-마우스 항체를 사용하여 검출하였다.

ELISA 결과는 그것의 모 클론과 비교하여 EJ173/112-Cl1(r84/PGN311) scFv(도 2)가 VEGF에 결합하며, 중요하게는 증가된 결합 시그널을 가지므로 증가된 친화력을 가짐을 보여준다. 마우스 유래의 B9 항체는 양성 대조군으로서 사용되며, 상기 마우스 유래의 B9 항체는 인간 VEGF-A에 대한 마우스 유래의 scFv 항체이다(Dr. Phillip E. Thrope, UT Southwestern Medical Center, Dallas, Texas로부터 얻음).

EJ173/112-Cl1(r84/PGN311)는 모 클론에 비하여 더욱 유익한 특성을 보여준다. EJ173/112-Cl1(r84/PGN311)는 모 클론과 비교하여 혈청에서 더 높은 안정성을 가지며, scFv 형태로 응집을 형성하는 데 감소된 경향을 가진다(데이터 없음).

다른 항- VEGF 항체로부터의 7개의 서로 다른 중쇄를 가지는 EJ173 /112-Cl1(r84/PGN311)의 가변영역 중쇄 셔플링

VEGF 결합 특성을 유지하는 데 있어서 r84/PGN311의 경쇄 가변 영역의 중요성을 확인하기 위하여, r84/PGN311과 구별되는 다른 항-VEGF 항체 클론으로부터 유래된 7개의 다른 가변 영역 중쇄와 EJ173/112-Cl1(r84/PGN311)의 가변 영역 경쇄를 결합하였다. 그 결과 생성된 클론을 NiNTA 컬럼 상에서 그것들의 His 태그를 통하여 발현시키고 정제하였다. 정제 후 농도를 측정하고, 코팅된 인간 VEGF-A에대한 ELISA를 수행하였다. 20μg/ml의 정제된 scFv를 첨가하고, 결합된 scFv를 항-c-myc 태그 마우스 단일클론 항체(Invitrogen) 및 HRP-접합된 2차 토끼 항-마우스 항체를 사용하여 검출하였다.

다른 항-VEGF 항체 클론으로부터 유래된 가변 영역 중쇄를 가지는 EJ173/112-Cl1(r84/PGN311)의 가변 영역 경쇄의 7개의 조합 중에서 3개가 이 ELISA에서 VEGF에 대한 현저한 결합을 나타냄을 보여주었다. 이것은 매우 적당한 비율이며, r84/PGN311의 경쇄 가변 영역이 VEGF에 대한 결합을 유지하는 데 중요하며, 또한 VEGF에 결합하는 항체가 생기도록 이 경쇄 가변 영역과 결합될 수 있는 다른 경쇄 가변 영역이 쉽게 확인될 수 있다.

실시예 3 : 마우스 유래의 2 C3 EJ173 /112- Cl1 ( r84 / PGN311 )의 경쟁

항체의 특이성을 더 증명하기 위하여, 두개의 2C3 농도의 존재하에서 EJ173/112-Cl1(r84/PGN311) scFv의 결합을 코팅된 VEGF-A에 대하여 ELSIA에서 테스트하였다. 간단하게는, 2μg/ml VEGF-A를 폴리스티렌 플레이트 상에 코팅하였다. 다음으로, 1μg/ml의 정제된 EJ173/112-Cl1(r84/PGN311) scFv, 모 클론 또는 마우스 유래의 B9 scFv를 6개의 평행한 웰에 첨가하였고, 그 중 두개는 0.1μg이 포함되고, 두개는 1μg의 마우스 유래의 2C3 IgG가 포함되고, 각각 2C3 IgG의 최종농도 1 및 10μg/ml이 되도록 하였다. 남아있는 결합된 scFv를 HRP-접합된 항-c-myc 태그 마우스 단일클론 항체(Invitrogen)을 사용하여 검출하였다.

VEGF에 대한 EJ173/112-Cl1(r84/PGN311) scFv의 결합은 증가하는 농도의 2C3 IgG와의 경쟁에 의하여 감소된다. 이 결과들은 따라서 EJ173/112-Cl1(r84/PGN311)가 VEGF에 대한 결합을 위하여 2C3 항체와 효과적으로 경쟁하며, EJ173/112-Cl1(r84/PGN311)는 2C3와 같은 실질적으로 동일한 에피토프에 결합함을 보여준다.

실시예 4 : 인간 및 마우스 VEGF 에 결합하는 EJ173 /112- Cl1 ( r84 / PGN311 )

인간 및 마우스 유래의 VEGF에 대한 EJ173/112-Cl1(r84/PGN311)의 결합을 측정하였다. 1μg/ml의 마우스 유래 VEGF(R&D Systems 493-MV-005/CF, 담체를 포함하지 않는 마우스 유래 VEGF164) 및 인간 VEGF를 폴리스티렌 면역플레이트에 코팅하였다. 10μg/ml의 정제된 scFv를 첨가하고, 항-c-myc 태그 마우스 단일클론 항체(Invitrogen) 및 HRP-접합된 2차 토끼 항-마우스 항체를 사용하여 검출하였다.

그 결과는 EJ173/112-Cl1(r84/PGN311) scFv가 마우스 유래 VEGF 및 인간 VEGF 모두에 결합함을 보여준다(도 4).

게다가, r84의 scFv 형태 및 마우스 VEGF에 대한 그것의 모 클론의 결합 친화력을 평가하기 위하여 비아코어 T100을 사용하였다. 이것을 위하여, 1000RU의 재조합 마우스 VEGF164(493-MV/CF, R&D Systems)을 CM5 칩(Biacore) 상에 고정화시키고, 단량체성 scFv의 희석 시리즈(100nM 및 2배 희석물)를 50μl/분의 유속으로 흘려보냈다. KD로 나타내는 결합 친화력을 비아코어 T100 머신에 속하는 소프트웨어를 사용하는 1:1 피팅 모델(Fitting model)에 의해 계산하였다. 상기 KD 값은 EJ173/112-Cl1(r84/PGN311)에 대해서는 1.0x10-8M로 계산되고, 모 클론에 대해서는 4.0x10-8M로 계산되었다. 따라서, r84/PGN311은 마우스 유래의 VEGF에 대하여 모 클론보다 더 높은 결합 친화력을 보여준다.

이 결과들은 이 선택된 항체(r84/PGN311)가 마우스에서의 전임상 연구 및 인간에서 사용하기 위한 것 모두에 사용하기에 적합함을 나타낸다.

하기의 실시예 6에 상세히 설명하는 바와 같이, 전장 인간 및 마우스 유래 키메라 IgG 형태의 r84 항체를 만들었다. ELISA 결합 연구들은 각각의 이 IgG 형태의 r84 항체들 또한 마우스 유래 VEGF 및 인간 VEGF 모두에 결합한다는 것을 확인하였다(도 19). 이 결과들은 2C3 항체에 대하여 선택된 전장 인간 r84 항체의 다른 이점을 보여주며, 2C3는 마우스 유래의 VEGF에 대한 의미있는 결합을 나타내지 않는다.

마우스 유래의 VEGF에 대한 2C3의 의미있는 결합의 부재는 간접 ELISA 검정에서 증명되었다. 이 검정법에서, 인간 및 마우스 VEGF 뿐만 아니라 다른 VEGF 패밀리 구성원들과의 2C3의 상호작용을 평가하였다.

브레켄 등(Brekken et al., Cancer Research 1998 및 2000)에 기재된 것과 같이 간접 ELISA 검정을 필수적으로 수행하였다. 간단하게는, 다양한 성장 인자, 즉 인간 VEGF-A(VEGF), 마우스 VEGF, PIGF, VEGF-B, VEGF-C 및 VEGF-D를 R&D Systems로부터 구입하여, ELISA 플레이트의 웰 상에 코팅하였다(4℃에서 하룻밤동안, 민감화 버퍼(sensitizing buffer)에서 0.5g/ml로 50μg/웰). 상기 웰을 37℃에서 1시간 동안 5% CAH(카제인산 가수분해물, Sigma, PBS에서 만들어짐)로 차단시키고, 상온에서 2시간 동안 10μg/ml에서 2C3 항-VEGF 항체와 함께 3번 배양하였다. 퍼록시다아제-접합된 2차 항체(항인간 또는 항마우스 IgG 중 어느 하나, 1:5000으로 희석)를 사용하여 결합을 측정하였다. 상기 웰들을 TMB(HRP를 위한 비색 기질)을 사용하여 발색시키고, 흡광도를 450nM에서 읽었다. 평균 흡광도 값은 하기와 같다: 평균 흡광도 값은 하기와 같다: 인간 VEGF-A(3.07), 마우스 VEGF(0.09)는 배경 시그널, PIGF(0.1), VEGF-B(0.09) 및 VEGF-D(0.12)와 같다.

상기 결과는 2C3가 인간 VEGF에는 결합하지만 마우스 VEGF-A, PIGF, VEGF-B, VEGF-C 또는 VEGF-D와는 반응하지 않는다는 것을 증명한다. 이 검정은 여러번 반복되었으며 유사한 결과를 가진다.

r84/PGN3l1 항체의 IgG 형태가 마우스 VEGF에 결합하는 반면, 2C3와 아바스틴은 마우스 VEGF에 결합하지 않는다는 또 다른 증거가 r84, 2C3 및 아바스틴으로 처리된 동물에서 평가된 혈청에서의 마우스 VEGF 농도에 대한 실험에서 얻어졌다.

대조군 IgG(Synagis), 아바스틴, 2C3 또는 r84로 처리된 종양을 가지는 동물로부터 얻은 혈청을 수집하고, R&D 시스템사의 키트를 사용하여 마우스 VEGF의 농도를 위한 ELISA로 평가하였다. 게다가, r84 처리된 마우스로부터의 몇몇의 혈청 샘플들은 단백질 G 비드와 함께 배양함으로써 모든 항체들을 면역적으로 제거하였다.

상기 결과를 도 24에 나타내었다. 마우스 VEGF의 혈청 농도는 대조군, 아바스틴 및 2C3 처리된 동물들 사이에서 매우 유사하였다. 그러나, r84 처리된 동물에서의 마우스 VEGF의 혈청 농도는 극적으로 매우 높았다. 대조군, 아바스팀 및 2C3 처리된 동물에서 관찰된 것 및 r84 처리된 동물들에서 관찰된 것 사이의 마우스 VEGF 농도에서의 차이는 대조군, 아바스틴 및 2C3 항체들이 마우스의 VEGF에는 결합하지 않는 반면 r84 IgG 항체들은 마우스의 VEGF에 결합한다는 증거이다.

도 24에서의 "r84" 컬럼은 혈청에서의 VEGF의 총량을 나타낸다(즉, 유리(생물학적으로 활성인) VEGF 및 r84와 복합체화된 VEGF). 유리 (생물학적으로 활성인) VEGF의 양은 항-VEGF 항체들이 치료적으로 사용될 때, 특히 VEGF에 대한 결합에서 항체의 유효성을 평가하기 위하여 측정되는 중요한 파라미터이다(Loupakis et al., 2007). "r84 supe" 컬럼은 마우스 유래의 VEGF에 결합된 r84 면역글루불린 및 r84가 단백질 G와 함께 배양됨으로써 제거된 후, 혈청에서의 유리 VEGF의 양을 나타낸다. 도 24는 따라서 r84 처리된 동물의 혈청에서의 유리 마우스 VEGF 농도가 기준 농도에 있음을 나타낸다. 따라서, 도 24에서의 결과들은 r84가 마우스 VEGF에 잘 결합할 뿐만 아니라, r84가 치료에 사용하는데 중요한 특성인 혈청에서의 유리 (생물학적으로 활성인) VEGF의 제거 농도에 매우 효과적임을 증명한다.

상기 결과들은 동계 마우스 유방암 모델을 사용하는 하기 실시예 11E에서 논의되며, 마우스 키메라 r84의 생존이 현저하게 향상된 종양을 가지는 마우스는 생체 내에서 r84가 VEGF에 결합하며 마우스 VEGF 활성을 차단함을 더 입증한다.

상기에 기재된 결과들은 전장 인간 r84/PGN3l1 항체가 마우스 유래 및 인간 VEGF 모두에 결합하는 반면, 2C3 및 아바스틴 항체는 마우스 유래의 VEGF에 결합하지 않음을 보여준다. 이것은 마우스 동계 모델 모두에서, 즉 마우스 종양 세포가 마우스 및 이종 모델에 투여, 즉 인간 종양 세포가 마우스에 투여될 경우에, 예를 들면 항종양 활성을 평가하기 위하여 r84를 사용할 수 있다는 측면에서 중요한 이점이다.

게다가, r84/PGN3l1에 의해 나타나지만 2C3 및 아바스틴과 같은 항체들에 의해서는 나타나지 않는 마우스 및 인간 VEGF 모두에 결합하는 능력은 이종 마우스 모델에서 r84에 의해 나타난 결과들이 인간 피험자에서의 r84의 대표적 활성이라는 것을 보여주며, 즉 전임상 마우스 모델에서 r84를 이용한 결과들은 항체가 환자에게 적용될 때 보여질 수 있는 우수한 모델일 것이라는 것을 보여준다. 이에 대한 이유는 인간 VEGF에만 결합할 수 있는 항체(예를 들어, 아바스틴 및 2C3)는 인간 종양 세포에 의해 생성된 VEGF에 결합할 것이지만, 내생적 마우스 유래의 VEGf에 결합할 수는 없을 것이다. 이것은 물론 종양에 의해 생성된 VEGF와 내생적 VEGF가 존재할 인간 환자에서의 상황과 같지 않다.

이와 같은 상황이 가지는 잠재적인 단점은 인간의 VEGF에는 결합하지만 마우스의 VEGF에는 결합하지 않는 항체가 마우스 이종 모델에서는 잘 성능할 수 있지만, 이것은 더욱 많은 VEGF가 존재하는 인간 시스템에서의 유사한 성능을 반영하지 않는다. 즉, 인간 VEGF에만 결합할 수 있는 항체를 사용하는 마우스 이종 시스템에서 보여지는 항종양 효과는 임상 실제보다 더 나아보일 수 있다. 대조적으로, 만일 인간 및 마우스 VEGF 모두에 결합할 수 있는 항체를 사용하여 작업한다면, 그 후 이것은 마우스 모델 시스템에 존재하는 모든 형태의 VEGF에 결합할 것이며, 이것은 항체가 인간에게 적용될 경우의 더욱 더 대표적인 상황일 것이다. 이것은 중요한 이점이며, 본 발명의 항체에 의해 나타나는 것이다.

실시예 5 : EJ173 /112- Cl1 ( r84 / PGN3l1 )의 결합 친화력

다양한 항체의 결합 친화력을 평가하기 위하여 비아코어를 사용하였다. 1M(micromolar) 농도로 서로 다른 scFv 항체들을 고정화된 VEGF(아민 결합)를 사용하는 CM5 칩에 흘려보냈다. 결합 곡선을 도 5에 나타내었으며, scFv 형태의 r84/PGN3l1이 단일 사슬 형태의 모 클론(m)보다 주목할만큼 더욱 높은 결합 친화력을 가짐을 볼 수 있다.

게다가, VEGF에 대한 r84 IgG의 결합 친화력을 계산하기 위하여 초기 연구들을 수행하였으며, 다양한 농도의 r84 IgG를 고정화된 VEGF-A위로 흘려보냈다. 이것에 관하여, Kd로 나타내는 결합 친화력은 비아코어 3000 평가 소프트웨어에서 1:1 결합 모델을 사용하여 계산하였다. 이 초기 연구에서 r84 IgG에 대하여 얻어진 Kd 값은 6.7 x 10-9M으로 계산되었다.

비아코어를 사용한 후속 결합 연구들은 표 6에 나타낸 친화력 데이터를 산출하였다. 이들 실험에 대하여, IgG 형식의 EJ173/112-Cl1(r84/PGN3l1) 및 2C3의 친화력을 CM5 칩(Biacore) 상에서 100RU의 인간 VEGF-A를 고정화시킴으로써 측정하였다. 각각의 IgG의 희석 시리즈(100nM 및 2배 희석물)을 유속 50l/분으로 VEGF 코팅된 플로우 셀 위로 흘려보냈다. BSA로 코팅된 플로우 셀로부터의 백그라운드 시그널을 결합 곡선으로부터 제거하였다. KD로 나타나는 결합 친화력을 비아코어 T100 머신에 속하는 소프트웨어를 사용하여 1:1 피팅 모델에 의해 계산하였다.

KD(M) 코팅된 VEGF
(100RU), 25℃
코팅된 VEGF
(100RU), 37℃
2C3 1.24 x 10-8 3.13 x 10-7 r84 3.21 x 10-9 5.22 x 10-9

상기 데이터는 r84가 25℃ 및 37℃ 모두에서 2C3보다 더욱 우수한 친화력으로 VEGF에 결합함을 보여준다. 이러한 차이점은 암을 포함하는 신생혈관성 질병의 치료에 관련된 많은 임상 셋팅에서 2C3와 비교하였을 때 r84의 더욱 우수한 특성을 이끌어낼 것임을 기대하는 것은 합리적이다. 37℃에서의 결과는 특히 이것이 생체 내에서 사용될 때 겪게 될 항체의 온도이기 때문에 특히 흥미롭다. 이 실험에 있어서, 아바스틴은 25℃ 및 37℃에서의 결합을 비교하였을 때 친화력에서 약 10배 적의 손실을 보여준 반면, r84는 온도에 덜 민감하였다(KD의 감소가 심지어 2배가 아님).

실시예 6 : scFv 형의 r84 / PGN3l1 IgG 형으로 전환

전장 인간 IgG 형태의 r84를 하기와 같이 처음으로 만들었다. 도 1에 나타낸 것과 같은 scFv 형 r84/PGN3l1 항체의 VH 및 VL 사슬의 서열을 획득하고, Lonza pCon IgG1a 및 카파 발현 벡터 안으로 삽입한 후 전체 r84 항체 유전자를 포함하는 하나의 벡터를 제조하기 위하여 결합시켰다. 전장 IgG 항체를 만들기 위하여, 그 후 벡터를 CHO K1SV 세포 안으로 감염시켰다.

일단 성장 조건이 최적화되면, 세포주의 생산율은 세포 배양 1리터 당 대략 5밀리그램의 항체였다. 비록 이 발현 방법이 효과적이라 할지라도, 모든 정제된 항체가 안정한 것은 아니다. 버퍼 최적화 후, 항체의 응집이 감소하였으며, 89.5%의 단량체 및 10.5%의 응집 이루었다.

사용된 최적화된 성장 조건은 40μM MSX, pH 6.8-7.0, 5% CO2, 37℃와 함께 인비트로젠사의 CD-CHO이다. 사용된 최적화된 버퍼는 ph 5.5에서 10mM 소디움 포스페이트, 25mM 소디움 아세테이트, 50mM 글리신이다.

r84/PGN3l1의 안정성을 더 증가시키기 위하여, 아미노산 서열을 분석하였다. 전형적인 인간 항체 서열에 대한 r84 서열의 비교는 r84의 VL 사슬의 마지막 아미노산이 사용될 구조물로부터 빠져있다는 것을 보여주었다(즉, 마지막 라이신 잔기, K가 빠져있음). 이 잔기를 재도입하였다. DNA 서열 또한 CHO 세포에 더욱 "친화적(compatible)"이 되도록 (번역된 아미노산 서열을 변경하지 않고) 변경되었다. 그 결과는 VL 사슬이 라이신으로 끝나는 새로운 DNA 서열 및 아미노산이었다. IgG 항체의 새로운 완전한 중쇄 및 경쇄의 뉴클레오티드 및 아미노산 서열을 하기에 나타내었다:

r84/PGN3l1 IgG 중쇄(핵산 서열)

CCTCCCAGATTCCAGTAACTCCCAATCTTCTCTCTGCAGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAGGTAAGCCAGCCCAGGCCTCGCCCTCCAGCTCAAGGCGGGACAGGTGCCCTAGAGTAGCCTGCATCCAGGGACAGGCCCCAGCCGGGTGCTGACACGTCCACCTCCATCTCTTCCTCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGTGGGACCCGTGGGGTGCGAGGGCCACATGGACAGAGGCCGGCTCGGCCCACCCTCTGCCCTGAGAGTGACCGCTGTACCAACCTCTGTCCCTACAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATAG

(SEQ ID NO:22)

r84/PGN3l1 IgG 중쇄(아미노산 서열)

QVQLVQSGAEVKKPGASVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCATGRSMVRGVIIPFNGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

(SEQ ID NO:24)

r84/PGN3l1 IgG 경쇄(핵산 서열)

GACATTCGGATGACTCAGTCTCCCTCCTCTTTGAGCGCTTCTGTGGGCGATAGGGTTACTATCACTTGTCGAGCCTCTCAATCCATCAGCTCCTACTTGAACTGGTACCAGCAGAAACCCGGGAAAGCACCCAAGCTGCTTATTTACGCCGCCTCCTCCCTGCAATCCGGAGTGCCCTCCCGGTTCAGCGGCTCCGGCTCTGGAACAGACTTTACCCTGACCATTTCTTCTTTGCAGCCTGAGGATTTTGCTACTTACTACTGTCAGCAGAGTTACTCCACCCCTTTGACATTCGGTGGTGGAACGAAAGTAGAAATTAAGCGTACGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG

(SEQ ID NO:23)

r84/PGN3l1 IgG 경쇄(아미노산 서열)

DIRMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

(SEQ ID NO:25)

상기에 나타낸 새로운 r84/PGN3l1 DNA 서열을 Lonza pCon IgG1a 및 카파 발현 벡터 안으로 삽입한 후, 전체 r84/PGN3l1 항체 서열을 포함하는 하나의 벡터를 만들기 위하여 결합시켰다. 상기 벡터를 그 후 CHO K1SV 세포 안으로 감염시켰다. 항체 생산은 세포 배양 최적화 거의 없이 1리터 당 350 밀리그램 이상으로 증가하였다. 심지어 더욱 중요하게는, 상기 항체는 단량체 99% 이상으로 더욱 더 안정하였다.

IgG 형태의 r84/PGN3l1의 가변 중쇄 및 가변 경쇄의 핵산 서열을 또한 하기에 나타내었다:

r84/PGN3l1 IgG VH 사슬(핵산 서열)

CAGGTACAGCTTGTGCAGTCCGGAGCCGAGGTGAAGAAACCCGGAGCATCAGTGAAGGTTAGCTGCAAGGCATCTGGTGGGACATTTTCCTCCTATGCCATCTCCTGGGTTCGGCAGGCTCCCGGACAGGGCCTGGAGTGGATGGGGGGGTTCGATCCCGAAGACGGAGAGACCATTTACGCACAGAAGTTTCAGGGTCGCGTGACCATGACCGAGGATACTTCTACCGACACAGCATATATGGAGCTCAGTAGCTTGCGCTCCGAGGACACGGCTGTATATTACTGTGCCACTGGACGGAGCATGGTGCGCGGGGTAATCATCCCTTTCAACGGGATGGATGTATGGGGCCAAGGGACCACCGTGACAGTCAGCTCT

(SEQ ID NO: 26)

r84/PGN3l1 IgG VL 사슬(핵산 서열)

GACATTCGGATGACTCAGTCTCCCTCCTCTTTGAGCGCTTCTGTGGGCGATAGGGTTACTATCACTTGTCGAGCCTCTCAATCCATCAGCTCCTACTTGAACTGGTACCAGCAGAAACCCGGGAAAGCACCCAAGCTGCTTATTTACGCCGCCTCCTCCCTGCAATCCGGAGTGCCCTCCCGGTTCAGCGGCTCCGGCTCTGGAACAGACTTTACCCTGACCATTTCTTCTTTGCAGCCTGAGGATTTTGCTACTTACTACTGTCAGCAGAGTTACTCCACCCCTTTGACATTCGGTGGTGGAACGAAAGTAGAAATTAAG

(SEQ ID NO:27)

마우스 유래 키메라 형태의 r84 항체를 또한 제작하였다. 이것은 마우스에서의 어떤 전임상 연구를 위한 마우스 항체를 제공하기 위하여 전장 인간 가변 영역을 마우스 불변 영역에 부착하기 위하여 수행하였다. 마우스 키메라 항체의 생성은 전장 인간 IgG에 대하여 상기에 기재된 것과 같이 수행하였으나, 전장 인간 가변 영역을 암호화하는 핵산 서열을 마우스 불변 영역을 암호화하는 핵산 서열에 부착하였다.

마우스 유래의 키메라 IgG 항체의 새로운 완전한 중쇄 및 경쇄의 뉴클레오티드 및 아미노산 서열을 하기에 나타내었다:

r84/PGN3l1 키메라 중쇄(핵산 서열)

aaccatctcaaaacccaaagggtcagtaagagctccacaggtatatgtcttgcctccaccagaagaagagatgactaagaaacaggtcactctgacctgcatggtcacagacttcatgcctgaagacatttacgtggagtggaccaacaacgggaaaacagagctaaactacaagaacactgaaccagtcctggactctgatggttcttacttcatgtacagcaagctgagagtggaaaagaagaactgggtggaaagaaatagctactcctgttcagtggtccacgagggtctgcacaatcaccacacgactaagagcttctcccggactccgggtaaatga

(SEQ ID NO:31)

r84/PGN3l1 키메라 중쇄(아미노산 서열)

QVQLVQSGAEVKKPGASVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCATGRSMVRGVIIPFNGMDVWGQGTTVTVSSRADAAPTVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK

(SEQ ID NO:32)

r84/PGN3l1 키메라 경쇄(핵산 서열)

GATATCAGGATGACGCAGAGTCCAAGCTCTCTGTCTGCCTCTGTGGGGGACAGGGTGACTATTACTTGTCGGGCATCACAGAGTATCTCCAGCTACCTTAATTGGTACCAGCAAAAGCCCGGCAAAGCCCCCAAATTGCTGATTTACGCAGCCAGCTCCCTTCAGTCTGGCGTCCCTAGCCGCTTCTCCGGGAGCGGATCAGGCACAGACTTTACGTTGACAATCAGTTCTCTGCAGCCGGAGGATTTTGCCACTTACTACTGTCAACAGAGCTACAGTACGCCTCTCACGTTTGGCGGTGGGACAAAGGTGGAAATCAAACGGGCTGATGCTGCACCGACTGTGTCCATCTTCCCACCATCCAGTGAGCAGTTAACATCTGGAGGTGCCTCAGTCGTGTGCTTCTTGAACAACTTCTACCCCAAAGACATCAATGTCAAGTGGAAGATTGATGGCAGTGAACGACAAAATGGCGTCCTGAACAGTTGGACTGATCAGGACAGCAAAGACAGCACCTACAGCATGAGCAGCACCCTCACGTTGACCAAGGACGAGTATGAACGACATAACAGCTATACCTGTGAGGCCACTCACAAGACATCAACTTCACCCATTGTCAAGAGCTTCAACAGGAATGAGTGT

(SEQ ID NO:33)

r84/PGN3l1 키메라 경쇄(아미노산 서열)

DIRMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPLTFGGGTKVEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

(SEQ ID NO:34)

실시예 7 : VEGFR2 - 매개성 사건을 저해하는 EJ173 /112-Cl1( r84 / PGN3l1 )

A. VEGFR2 를 통한 세포 시그널링을 저해하는 r84 / PGN3l1

선별된 항체의 세포적 성능을 확인하기 위하여 세포 검정을 사용하였다. VEGF는 MAPK 키나아제 경로를 통한 세포내 시그널링을 자극하며, 또한 각각 44 및 42 킬로달톤에서 MAPK1 및 MAPK2라 불리는 두개의 단백질의 (인산화를 통한) 활성화에 관여한다. 이들 단백질의 다른 명칭은 Erk1 및 Erk2이다. VEGF와 VEGFR2의 상호작용을 억제하는 항체들은 Erk1/2 활성화 또한 잘 억제할 수 있다.

bEnd.3 또는 PAE/KDR 세포주(각각 UT-Southwestern Medical Center, Dallas, TX and Dr. Johannes Waltenberger, Ulm University Medical Center, Ulm, Germany에서 Dr. Philip Thrope로부터 얻음)는 그것들이 VEGF로 자극받을 수 있도록 그것들의 표면 상에 VEGFR2를 발현한다. 상기 세포주에 혈청과 성장인자를 48시간 동안 결여시키고, 다음으로 4μg/ml에서 IgG 형식으로 후보물질의 존재 또는 부재하에서 10(V10) 및 50(V50)ng/ml의 VEGF165의 첨가를 통하여 자극하였다. 자극되지 않은 세포들은 음성 대조군(negative control; NS)이다. 이 자극 후에, 상기 tpv들을 용해시키기 전에 서로 다른 포스파타아제 억제제를 포함하는 얼음으로 냉각시킨 PBS로 세척하였다. 원심분리된 세포 추출물을 폴리아크릴아미드 겔에 걸고, 분리된 단백질들을 그 후에 니트로셀룰로오스 막에 블롯팅하였다. Erk1/2 인산화의 억제를 관찰하기 위하여 항-포스포 Erk1/2 항체를 사용하여 상기 블롯을 조사하였다(도 6). 총 Erk1/2 또한 세포 농도의 내부 대조군으로서 검출하였다. r84/PGN3l1 클론은 Erk1/2의 인산화를 억제하였다.

VEGF는 또한 155 킬로달톤에서 단백질의 (인산화를 통한) 활성화에 관여하는 포스포리파아제 Cγ(PLC-γ) 경로를 통한 세포내 시그널링을 자극한다. VEGF와 VEGFR2의 상호작용을 억제하는 항체들은 PLC-γ의 활성화 또한 잘 억제할 수 있다.

인간 피부 포세혈관 내피 세포주(Human dermal microvascular endothelial cell lines; HDMEC, Lonza, catalog #CC2810)는 그것들이 VEGF로 자극될 수 있도록 그것들의 표면상에 VEGFR2를 발현한다. HDMECs를 6-웰 플레이트를 사용하여 웰 당 250,000 세포를 깔았다. 세포들은 5% FBS ECM(내피 세포 배지)에서 밤새 부착하도록 하였다. 상기 세포들을 그 후 24시간 동안 혈청을 결핍시키고, 항체 아바스틴(bevacizumab, Presta et al ., 1997), r84/PGN3l1, 2C3(모두 IgG 형식) 또는 대조군 IgG 항체(Synagis(palivizumab), 인간 항-RSV, MedImmune)의 존재하에서 50ng/ml의 VEGF165(+VEGF)의 첨가를 통하여 자극하였다. 상기 IgGs는 90μg/ml로 사용하였다. 자극되지 않은 세포들은 음성 대조군(NT)이다. 아바스틴 및 r84/PGN3l1 또한 VEGF의 부재하에서 세포에 첨가되었다.

이 자극 후에, 상기 세포들을 용해하기 전에 서로 다른 포스파타아제 억제제를 포함하는 얼음에 냉각시킨 PBS로 세척하였다. 원심분리된 세포 추출물을 폴리아크릴아미드 겔에 걸고, 분리된 단백질을 그 후 니트로셀룰로오스 막으로 옮겼다. 인산화의 억제를 관찰하기 위하여 항-포스포 Erk1/2 항체(도 16A, pERK1/2) 및 항-포스포 PLC-γ 항체(도 16A, pPLC-γ)를 사용하여 블롯을 조사하였다. 총 Erk1/2(도 16A, ERK1/2) 및 PLC-γ(도 16A, PLC-γ) 또한 세포 농도의 내부 대조군으로서 검출하였다. HDMECs 상에서의 VEGFR2의 발현은 VEGFR2에 대한 항체를 사용하여 검출하였다(도 16A). 도 16A는 r84/PGN3l1 IgG 항체가 Erk1/2 및 PLC-γ 모두의 인산화를 억제함을 보여준다.

상기에 기재된 것과 동일한 방법을 사용하여 VEGFR1을 발현하는 PAE Flt1 세포는 처리되고, 처리되지 않고 남겨지거나 항체 아바스틴 또는 r84/PGN3l1(IgG의 형식으로)의 존재 또는 부재하에서 50ng/ml의 VEGF165의 첨가를 통하여 자극되기 전에 동일한 방법으로 결핍되었다. 블롯을 제조하고, 항-포스포 VEGFR1 항체를 사용하여 조사하였다(도 16B, 포스포 VEGFR1). 총 VEGFR1(도 16B, 총 VEGFR1) 또한 세포 농도의 내부 대조군으로서 검출하였다. 도 16B에서의 데이터는 r84/PGN3l1이VEGFR1의 인산화는 억제하지 않는 반면, 양성 대조군인 아바스틴은 VEGFR1의 인산화를 억제함을 보여준다. 동시에, 도 16A 및 도 16B는 r84/PGN3l1이 VEGFR2 경로를 선택적으로 차단함을 확인하였다.

B. VEGFR2 - 발현성 세포의 VEGF -유도성 이동을 차단하는 r84 / PGN3l1

예상했던 바와 같이, r84/PGN3l1 또한 VEGF2-발현성 내피 세포의 VEGF-유도성 이동을 강력하게 억제할 수 있음을 확인하였다. 이 활성의 예는 HDMEC에 대한 도 20A 그리고 PAE KDR-발현 세포에 대한 도 20B에 나타내었다. 각각의 이들 검정에서, r84는 VEGFR2-발현성 세포의 VEGF-유도성 이동을 현저하게 억제하며, 적어도 아바스틴 만큼 잘 성능함에 주목하여야 할 것이다.

VEGFR1-발현성 PAE Flt1 세포를 사용한 비교 연구는 r84가 VEGFR1-발현성 세포의 VEGF-유도성 이동은 억제하지 않음을 보여주었다(도 21). 대조적으로, 아바스틴은 VEGFR1-발현성 세포의 VEGF-유도성 이동을 현저하게 억제하였다(도 21).

실시예 8 : VEGF121 에 결합하는 EJ173 /112- Cl1 ( r84 / PGN3l1 )

생물학적 활성형 아형의 VEGF-A, VEGF121에 대한 EJ173/112-Cl1(r84/PGN3l1) scFv의 결합을 측정하였다(R&D Systems HuVEGF121 298-VS-005/CF). 2μg/ml의 담체를 포함하지 않는 VEGF121을 폴리스티렌 면역플레이트상에 깔았다. 10μg/ml의 정제된 scFv를 첨가하고, 항-c-myc 태그 마우스 단일클론 항체(Invitrogen) 및 HRP-접합된 2차 토끼 항-마우스 항체를 사용하여 검출하였다.

상기 결과는 EJ173/112-Cl1(r84/PGN3l1)(도 7)가 VEGF121에 양성임을 보여준다. B9 마우스 유래의 scFv 대조군은 VEGF121을 인식하지만, 인간 변종 보다는 낮은 농도에서이다.

실시예 9 : VEGFR2 에 결합하는 VEGF 는 차단하지만 VEGFR1 에 결합하는 VEGF 는 차단하지 않는 EJ173 /112-Cl1( r84 / PGN3l1 )

96-웰 ELISA 플레이트(BD Falcon, cat # 353279)를 50μl의 민감화 버퍼/웰에서 1.0μg/ml의 농도로 수용성 HuVEGFR1/Fc(R&D Systems, cat # 321-FL-050, CF) 또는 HuVEGFR2(R&D Systems 357-KD-050/CF)를 사용하여 4℃에서 밤새 코팅하였다. 상기 웰을 세척 버퍼(wash buffer; WB)(TBSt(Tris buffer Saline, 0.1% Tween 20))로 세척하고, 세척 버퍼에서 20% 아쿠아블록(East Coast Biologics, Inc)으로 37℃에서 1시간 동안 차단하였다. 적절한 농도로 50μl의 IgG 또는 세척 버퍼를 웰에 첨가한 후 즉시 100ng/ml의 최종농도로 VEGF-비오틴을 첨가하였다. 상기 플레이트를 상온에서 2시간 동안 배양하고, 3번 세척한 후 세척 버퍼에 1:7500 희석으로 웰당 100μl의 퍼록시다아제-접합된 아비딘(JacksonImmuno Research)을 사용하여 상온에서 1시간 동안 배양하였다. 상기 플레이트를 4번 세척한 후, TMB를 사용하여 시그널을 발생시키고, 산으로 정지시키고 450nM에서 판독하였다.

이들 검정의 결과를 도 8A 및 도 8B에 나타내었다. VEGF 단독(VEGF) 또는 지시 항체의 존재하에서의 VEGF의 시그널을 VEGF 단독(100%)에 대하여 표준화시켰다. 평균 +/- SEM을 나타내었다. N=12(각각 3중으로 처리가 수행된 4개의 동일한 플레이트) 50%를 넘지 않는 시그널은 결합의 현저한 억제로 간주된다.

도 8A 및 도 8B에 나타낸 것과 같이, 이 조절된 연구로부터의 결과는 r84/PGN3l1이 실질적으로는 VEGF와 VEGFR2의 상호작용은 차단하지만, VEGF와 VEGFR1의 상호작용은 실질적으로 차단하지 않음을 보여준다. r84/PGN3l1 및 아바스틴(bevacizumab)를 사용한 병행 연구(Presta et al ., 1997)는 VEGFR2와 VEGFR1 모두와 VEGF와의 상호작용을 실질적으로 차단하는 것과 같은 아바스틴의 공지된 특성을 확인하였다. 게다가, r84/PGN3l1 및 원래 마우스 유래의 2C3 항체를 사용하는 병행 연구는 VEGFR2에 결합하는 VEGF는 실질적으로 차단하지만 VEGFR1에 결합하는 VEGF는 실질적으로 차단하지 않는다는 차이가 2C3에 대한 것 보다 r84에 대한 것이 심지어 더욱 크다는 것을 보여주었다. 이것은 2C3 항체 이상의 r84의 다른 놀라운 이점을 보여준다.

실시예 10 : VEGFR2 를 발현하는 종양관련 대식세포

A. 모델

흉선이 없는 누드 마우스(thymic nude mice)(7-9주)에 췌장의 꼬리 안으로 1x106의 MiaPaCa-2 세포를 주입함으로써 동위종양(orthotopic tumors)을 확립하였다. 종양은 치료를 개시하기 1주 전에 발생시켰다.

B. 치료

동물들은 3주간 2번 복강 주사를 통하여 대조군 항체(C44) 또는 마우스 유래의 2C3 항체로 처리되었다. 희생시킨 후, 종양을 절제하고, 남아있는 췌장과 함께 무게를 잰 후, 조직화학 및 면역조직화학적 분석을 위하여 스냅 동결건조 또는 메틸 카르노이(methyl carnoys)에 고정시켰다.

C. IHC

대식세포 마커를 위하여 사용된 항체들은 CD86, CD14 및 F4/80을 포함한다. VEGFR2 항체 T014 및 RAFL-2를 사용하였다.

D. 복강 대식세포 분리

종양을 가지는(tumor-bearing; TB) 또는 종양을 가지지 않는(non-tumor bearing; NTB) 동물들로부터 멸균 복강 세척(sterile peritoneal lavage)을 통하여 대식세포를 분리하였다.

E. 결과

놀랍게도, 종양관련 대식세포(tumor associated marcrophages; TAM)가 VEGFR2를 발현한다는 것을 발견하였다. 이것은 2C3가 생체 내에서 VEGFR2-양성 TAM의 칩윤을 감소시킨다는 결과를 설명한다. 이 결과들을 도 10A, B 및 C에 나타내었다.

이와 관련하여, 도 10A는 대조군 처리된 또는 2C3 처리된 동물들로부터 얻은 종양 절편 상에 염색되는 T104(VEGFR2 항체) 및 F4/80(대식세포 마커)의 동일부위 발생(co-localization)을 도시하였다. 2C3는 대식 세포의 침윤을 감소시킨다. 그러나, 두 그룹 모두 VEGFR2 및 대식세포 마커의 동일부위 발생을 증명한다. 3개의 서로 다른 대식세포 마커 및 VEGFR2 중 하나에 대한 이중 양성 세포의 수를 도 10B에 도시하였다. 도 10C에서, 종양을 가지는 동물로부터 얻은 복강 대식세포는 두개의 서로 다른 항체를 사용하는 VEGFR2를 증명한다.

실시예 11 : 동물에서의 종양 크기를 감소시키는 r84 / PGN3l1

r84/PGN3l1 항체의 투여가 종양 크기에 현저한 감소를 야기함을 보여주기 위하여 동물 모델을 사용하였다.

A. MDA - MB -231 유방암 세포 종양 모델

5 밀리온(million)의 MDA-MB-231 세포를 SCID 마우스의 유방의 지방 패드(fat pad) 안으로 주입하였다. 종양을 치료 시작 26일 전에 발생시켰다. 이 시점에서, 동물들을 랜덤하게 치료군으로 배정하였다. 100μl의 식염수(대조군, n=5) 또는 100μl의 버퍼에 250μg의 아바스틴 IgG(n=8) 또는 r84/PGN3l1(n=9)를 1주당 2번 피하 주사로 주었다. 상기 결과를 도 11에 나타내었으며, 평균 종양 크기 +/- SEM으로 표시하였다. 아바스틴 및 r84 처리된 마우스들은 대조군 치료된 동물들보다 현저하게 작아진 종양 크기를 가진다. 도 12는 각 군에서 개개의 동물들에 대한 종양 무게/체중을 나타낸다. 아바스틴 및 r84 처리된 마우스들은 대조군 치료된 동물들보다 현적하게 작은 종양/신체 비율을 가진다. 도 11 및 도 12에서의 이 결과들은 r84가 본질적으로 아바스틴 만큼 효과적으로 성능함을 보여준다.

B. A673 횡문근육종 ( rhabdomyosarcoma ) 종양 모델

1.0x106의 A-673 세포(인간 횡문근육종 세포주-ATCC CRL-1598)을 22nu/nu(NCI) 마우스의 피하내로 주입하였다. 상기 마우스들을 3개의 군으로 나누고(각 2C3 및 r84/PGN3l1 n=8, n=6/대조군), 치료는 종양 세포 주입(tumor cell injection; TCI) 5일 후에 개시하였다. 치료는 1주당 2번 복강으로 50μg의 지시 IgG를 주사하는 것으로 구성된다. 동물의 체중 및 종양 크기를 관찰하였다. 대조군 항체들은 시나지스(Synagis; 인간 항-RSV)였다.

마우스들은 종양 세포 주입 후 5일째 및 29일째 사이에 8번의 주사 치료를 받았다. 도 13은 종양 세포 주입 후 30일 째의 각 군의 종양 크기를 나타낸다. 원웨이 ANOVA는 상기 그룹이 통계적으로 다름을 나타내며; 또한 2C3 및 r84/PGN3l1은 "던넷 다중 비교(Dunnett's multiple comparison test)"에 의하여 대조군과 다름을 나타낸다(p<0.05). 2C3 및 r84가 1주당 2번의 50μg의 중간 용량(moderate dose)의 주사에서 종양의 성장을 감소시킨다는 것은 이 결과로부터 명백하다. r84는 본질적으로 2C3와 동일한 활성을 나타내었다. 이 동물 실험으로부터의 총체적인 결론은 2C3 및 r84는 A673 종양의 성장을 조절하는 데 효과적이라는 것이다.

C. 인간 비소세포 폐암( NSCLC ) 모델

r84/PGN3l1 항체의 투여가 종양의 성장에 현저한 감소를 야기한다는 것을 보여주기 위하여 생체 내 동물 모델을 더 사용하였다.

생체 내에서 종양의 성장을 억제하기 위한 r84/PGN3l1의 능력을 4개의 서로 다른 인간 소세포 폐암(non-small cell lung cancers; NSCLC), H1299(ATCC CRL-5803), H460(ATCC HTB-177), H358(ATCC CRL-5807) 및 A549(ATCC CCL-185)에서 테스트하였다. SCID 마우스(세포주 당 n=25)에 2.5x106 세포를 피하내로 주사하였고, 치료는 종양 세포 주입 하루 후에 개시하였다. 250μg의 시나지스 또는 XTL(음성 대조군), 아바스틴 IgG(양성 대조군) 또는 500μg의 r84/PGN3l1 IgG으로 구성되는 치료는 각 주에 2번 복강 내로 운반되었다. H460 마우스는 40일 후에 희생시키고, H1299 마우스는 48일 후에 희생시키고, A549 마우스는 55일 후에 희생시키고, H358 마우스는 83일 후에 희생시켰다. 종양의 무게를 측정하였으며, 그 결과를 도 17A(H460에 대한 것), 도 17B(H1299에 대한 것), 도 17C(H358에 대한 것) 및 도 17D(A549에 대한 것)에 평균 종양 무게 +/- SEM으로 나타내었다. 대조군의 종양 무게에 대한 치료된 종양 무게의 비를 또한 도 17A, 도 17B, 도 17C 및 도 17D에 나타내었다("T/C").

도 17A, 도 17B, 도 17C 및 도 17D는 아바스틴 및 r84/PGN3l1 처리된 동물들이 대조군 치료된 동물들보다 현저하게 작은 종양 무게를 가짐을 보여준다. r84/PGN3l1은 H460(도 17A), H1299(도 17B) 및 A549(도 17D) 모델에서 아바스틴보다 더욱 나은 성능을 보인다. r84/PGN3l1은 H358 검정(17C)에서 적어도 아바스틴 만큼 효과적으로 성능한다.

D. Panc1 췌장암 세포 종양 모델

췌장 선암 세포(pancreatic adenocarcinoma cells) Panc1을 가지는 마우스에 r84/PGN3l1 IgG 또는 음성 대조군으로서 시나지스를 주었다. 치료는 마우스를 희생시킬 때까지 하였다. 종양의 크기를 측정하고, 그 결과를 도 22에 나타내었다. r84/PGN3l1은 대조군과 비교하여 Panc1 종양의 성장을 현저하게 감소시킴을 볼 수 있다(도 22).

E. 4 T1 유방암 모델

마우스 키메라 형태의 r84/PGN3l1을 사용하는 제어된 연구는 r84 항체가 동계 4T1 유방암을 가지는 마우스의 생존을 연장시킬 수 있음을 보여주었다. 도 23에 나타낸 것과 같이, 마우스 키메라 r84/PGN3l1을 이용한 치료는 대조군 치료된 군에서의 동물보다 마우스에 더욱 긴 생존을 가져다주었다.

실시예 12 : 종양 관련 대식세포의 미세혈관 밀도 및 침윤을 감소시키는 r84 / PGN3l1

실시예 11에 기재된 MDA-MB-231 동물 모델 연구에서 사용된 마우스 및 또한 100μl 버퍼에 250μg의 2C3 IgG을 사용한 동일한 요법에 따른 병행으로 치료된 마우스로부터 종양을 얻었다. 이들 종양을 절단하고, 마우스 내피 세포(MECA-32) 및 대식세포 마커(Mac-3)에 대한 항체로 염색하였다. 대조군 동물로부터 얻은 3개의 종양 및 각각 r84/PGN3l1 및 2C3 처리된 동물로부터 얻은 3개의 종양을 분석하였으며, 각각의 종양으로부터 얻은 5개의 이미지를 연구하였다. 그 결과를 도 14 및 도 15에 나타내었으며, r84 및 2C3 처리된 동물로부터 얻은 종양들은 현저하게 감소된 수의 혈관/현미경 시야(high power field)(MECA-32, p<0.0001, 도 15) 및 대식세포 마커의 현저하게 감소된 발현(Mac-3, r84에 대하여 p<0.01, 도 14)을 보여주었다. 이것은 r84가 종양 관련 대식세포의 미세혈관 밀도 및 침윤을 현저하게 감소시키며, r84가 종양 관련 대식세포의 침윤을 감소시키는 것에서 2C3 더욱 명백한 효과를 가진다는 증거이다(도 14).

실시예 13 : 세포 침윤 종양 상에서의 r84 / PGN3l1 의 효과

A. 다형핵 백혈구( polymorphonuclear leukocyte )

실시예 11에 기재된 MDA-MB-231 동물 모델 연구에 사용된 마우스에서 종양을 취하고, 또한 100μl 버퍼에 250μg의 2C3 IgG을 사용한 동일한 요법에 따른 병행으로 치료된 마우스로부터 종양을 취하였다. 상기 연구는 r84 및 2C3 치료된 동물로부터 얻은 종양이 대조군과 비교하여 현저하게 증가된 다핵형 백혈구(PMN) 침윤을 가짐을 보여주었다. 이 효과는 r84 및 2C3 항체에 대하여 통계적으로 유의하였다. 비록 아바스틴(bevacizumab) 또한 대조군과 비교하여 MDA-MB-231 종양 내로의 PMN 침윤이 증가되었고, r84 및 2C3와는 대조적으로, 이러한 증가는 아바스틴에 대하여 통계적으로 유의하지 않다.

B. CD11b +/ Gr1 + 세포

MDA-MB-231 종양을 가지는 마우스에서의 추가 연구는 대조군과는 대조적으로 현저하게 적은 CD11/Gr1 이중 양성 세포가 r84-치료된 동물에서 종양을 침윤한다는 것을 보여주었다. 비교 연구에 있어서, 비록 어떠한 감소가 아바스틴-처리된 동물에서 측정되었다 할 지라도, 2C3 항체 뿐만 아니라 아바스틴도 CD11+/Gr1+ 침윤에 통계적으로 유의한 감소를 보이지 않았다.

실시예 11에 기재된 MDA-MB-231 동물 모델 연구에 사용된 마우스에서 종양을 취하고, 또한 100μl 버퍼에 250μg의 2C3 IgG을 사용한 동일한 요법에 따른 병행으로 치료된 마우스로부터 종양을 취하였다. 상기 연구는 대조군과는 대조적으로 현저하게 적은 CD11b+/Gr1+ 이중 양성 세포가 r84-치료된 동물에서 종양을 침윤한다는 것을 보여주었다(ANOVA에 의하여 평가됨, p<0.01, 도 25에서 **으로 나타냄). 이중 양성 세포 수에서의 감소는 39%였다. 비교 연구에 있어서, 2C3는 CD11b+/Gr1+ 침윤에 통계적으로 유의한 감소를 보이지 않았다(도 25).

골수 유래의 억제 세포 CD11b+/Gr1+의 감소된 침윤은 최근에 항-VEGF 치료에 대한 종양 무반응성의 중재와 관련을 가지는 마커 모두를 발현하는 세포와 같이 특히 관심있는 것이다(Shojaei et al., 2007). 골수 유래의 억제세포(CD11b+Gr1+) 또한 종양의 진행에 중요한 공헌자이다. 종양의 미세환경에서, 이들 세포는 면역억제성 매개물질을 분비하며, T 림프구 기능이상(dysfunction)을 유도한다(Gabrilovich et al ., 2001; Serafini et al ., 2004).

CD11b+/Gr1+ 세포의 종양 침윤은 r84-처리된 동물에서 적어도 명백하고/현저하게 낮기 때문에, r84를 이용한 치료는 VEGF를 표적화하는 다른 약물을 사용한 치료보다 항-VEGF 치료에 대한 약물 내성 또는 무반응성이 덜 발생하는 경향이 있다.

따라서, 종양 세포 내로의 CD11b+/Gr1+ 세포의 침윤을 감소시키기 위한 이 능력은 r84/PGN3l1에 의해 나타난 더욱 유리한 특성이며, r84/PGN3l1의 치료적 적용을 위한 잠재적인 중요성을 가지는 특성이다. 더욱이, 이 특성은 2C3 항체에 의해서는 나타나지 않으며, 아바스틴에 의해 더욱 감소된 레벨에서만 나타난다.

실시예 14 : 종양에서 림프계 밀도를 감소시키는 r84 / PGN3l1

MDA-MB-231 종양을 가지는 마우스를 r84/PGN3l1 또는 대조군 항체로 치료하고, 종양 내 림프관을 보기 위하여 종양 절편을 분석하였다. 그 결과를 도 18A, 도 18B 및 도 18C에 나타내었으며, r84-처리된 종양에서의 림프관 밀도는 대조군 조양에서 보다 현저하게 낮았다.

특히, 림프구성 마커인 포도플라닌(podoplanin) 및 프록스1(Prox1)을 통한 림프관의 확인을 위하여 동결건조된 MDA-MB-231 종양 절편의 면역형광염색을 처음으로 수행하였다. 이 결과들을 포도플라닌(녹색), 프록스1(적색) 및 겹쳐진 이미지를 나타내는 도 18A에 설명하였으며, 대조군(윗쪽 패널) 및 r-84 처리된 종양(아래쪽 패널)에서 림프관을 확인하였다. 연이은 MDA-MB-231 종양 절편에서 LYVE-1 염색 또한 수행하였다. 도 18B에 나타난 것과 같이, 이 결과들은 LYVE-1에 대하여 염색된 MDA-MB-231 종양 절편에서의 림프관의 패턴이 포도플라닌 및 프록스1에 대하여 관찰된 것과 유사하다는 것을 나타낸다(도 18A).

대조군 및 r84-처리된 종양에서의 림프관 밀도가 서로 다른지에 대한 여부를 측정하기 위하여, 각각의 LYVE-1 염색된 종양 절편의 전체 영역을 낮은 현미경 배율에서 검사하였고, LYVE-1 양성 영역의 백분율을 NIS-요소 이미징 소프트웨어(NIS-Element imaging software)를 사용하여 각 필드에 대하여 측정하였다. 각 종양 및 그룹 평균에 대한 최종 스코어를 내기 위하여 가장 높은 LYVE-1 양성 퍼센트 영역을 가지는 10개의 필드를 함께 평균내었고, 독립된 스튜던트 t-test(unpair student's t-test)에 의하여 유의성에 대한 테스트를 하였다. 도 18C에 도시한 바와 같이, 대조군 종양의 LYVE-1 양성 영역의 백분율(7.03±1.013, n=6)은 r84 처리된 종양(2.23±0.986; n=5)보다 현저하게 더욱 컸으며, p=0.0042였다. 이 결과들은 r84/PGN3l1을 이용한 치료가 종양의 림프관 밀도를 현저하게 낮추므로 림프관 형성을 억제하기 위한 본 발명의 인간 항체의 사용을 지지함을 보여준다.

실시예 15 : 마우스에서 독성을 유도하지 않는 r84 / PGN3l1 의 장기 투여

종양을 가지지 않은 마우스 및 종양을 가지는 마우스를 이 연구에 사용하였다.

5x106의 Panc-1 세포(human pancreatic cancer cell line; ATCC CRL-1469)를 10마리의 SCID 마우스에 주입하였다. 종양 세포 주입 후 1일 째, 5마리의 종양을 가지는 마우스 및 5마리의 종양을 가지지 않은 마우스에 500μg의 시나지스 또는 r84/PGN3l1 IgG를 복강으로 주사하였다. 1주에 2번 주사하고, 12주간 치료를 지속한 후 마우스들을 희생시켰다. 희생 당시에 혈액을 수집하고, 표준 혈액 화학에 대한 분석을 행하였다. 간, 콩팥 및 갑상선 또한 조직학적 평가를 위하여 수집하였다.

이 분석들은 H&E 염색(이 검사는 마우스 조직 조직학을 전문으로 하는 병리학자에 의하여 맹검방식(blinded fashion)으로 수행되었다) 에 의해 검사된 임의의 조직의 조직구조에 명백한 변화가 없음을 보여주었다. 게다가, 혈액 화학은 22개의 서로 다른 분석체에 대하여 분석하였고, 대조군, 정상적인 마우스 또는 r84 처리된 마우스 간에 현저한 변화는 없다는 것을 발견하였다.

본 발명의 조성물 및 방법이 바람직한 구현의 측면에서 기재된다 할지라도, 본 발명의 컨셉, 의도 및 범위를 벗어나지 않게 조성물, 방법 및 본원에 기재된 방법의 단계 또는 단계의 순서에 변경이 적용될 수 있다는 것은 당업자들에게 명백할 것이다. 더욱 상세하게는, 화학적 및 생리학적으로 모두 관련된 어떤 약제는 동일하거나 유사한 결과가 달성되는 한 본원에 기재된 약제로 치환될 수 있음은 명백할 것이다. 당업자들에게 명백한 모든 이와 같은 유사한 치환 및 변경들은 첨부된 청구항에 의해 정의된 것과 같은 본 발명의 의도, 범위 및 컨셉 내에 있는 것으로 간주된다.

참고문헌

본원에서 상기에 언급된 것들에 대한 예시적 절차 또는 다른 상세한 보충을 제공하기 위하여 하기의 참고문헌들은 참조로서 본원에 특별히 통합되어 있다.

Abrams and Oldham, "In:Monoclonal Antibody Theraphy of Human Cancer", Foon and Morgan ( Eds .). Martinus Nijhoff publishing , Boston, 103-120, 1985.

Aiello, Prerce, Foley, Takagi, Chen, Riddle, Ferrara, King, Smith, "Suppression of retinal neovascularization in vivo by inhibition of vascular endothelial growth factor(VEGF) using soluble VEGF-receptor chimeric proteins," Proc , Natl . Acad . Sci ., USA, 92:10457-10461, 1995.

Alderson, McGowan, Baldridge, Probst, "TLR4 Agonists as Immunomodulatory Agents", J. Endoxin Res ., 12(5):313-319, 2006. Alon, Hemo, Itin, Pe'er, Stone, Keshet, Vascular endothelial growth facctor acts as a survival factor for newly formed retinal vessels and has implications for retinopathy of permaturity," Nature Med., 1:1024-1028, 1995.

Altschul, Madden, Schaffer, Zhang, Zhang, Miller, Lipman, "Gapped BLAST and PSI-BLAST:a new generation of protein database search programs", Nucleic Acids Res ., 25:3389-3402, 1997.

Anthony, Wheeler, Elcock, Pickett, Thomas, "Short report:identification of a specific pattern of vascular endothelial growth factor mRNA expression in human placenta and cultured placental fibroblasts", Placenta , 15:557-61, 1994.

Apetoh, Ghiringhelli, Tesniere, Obeid, Ortiz, Criollo, Mignot, Maiuri, Ullrich, Saulnier, Yang, Amigorena, Ryffel, Barrat, Saftig, Levi, Lidereau, Nogues, Mira, Chompret, Joulin, Clavel-Chapelon, Bourhis, Andre, Delaloge, Tursz, Kroemer, Zitvogel, "Toll-Like Receptor 4-Dependent Contribution of the Immune System to Anticancer Chemotherapy and Radiotherapy", Nat . Med ., 13:1050-1059, 2007.

Arbabi-Ghahroudi Desmyter, Wyns, Hamers, Muyldermans, "Selection and identification of single domain antibody fragments from camel heavy-chain antibodies", FEBS Lett., 414:521-526, 1997.

Asahara, Murohara, Sullivan, Silver, van der Zee, Li, Witzenbichler, Schatteman, Isner, "Isolation of putative progenitor endothelial cells for angiogenesis," Science , 275(5302):964-967, 1997.

Asano, Yukita, Matsumono, Kondo, Suzuki, "Inhibition of tumor growth and metastasis by an immunoneutralizing monoclonal antibody to human vascular endothelial growth factor/vascular permeability factor," Cancer Res ., 55:5296-5301, 1995.

Asano, Yukita, Matsumono, Hanatani, Suzuki, "An anti-human VEGF monoclonal antibody, MV833, that exhibits potent anti-tumor activity in vivo," Hybridoma, 17:185-90, 1998.

Baca, Presta, O'Connor, Wells, "Antibody humanization using monovalent phage display," J. Biol . Chem ., 272(16):10678-84, 1997.

Baldari, Murray, Ghiara, Cesareni, Galeotti, "A Novel Leader Peptide Which Allows Efficient Secretion of a Fragment of Human Interleukin 1 Beta in Saccharomyces Cerevisiae", EMBO J., 6:229-234, 1987.

Barbas, Kang, Lerner and Benkovic, "Assembly of combinatorial antibody libraries on phage surfaces: the gene III site," Proc . Natl . Acad ., Sci. USA , 88(18):7978-7982, 1991.

Baxter and Jain, "Transport of fluid and macromolecules in tumors," Micro. Res., 41:5-23, 1991.

Beckman, Weiner and Davis, "Antibody Consructs in Cancer Therapy", Cancer, 109(2):170-179, 2006.

Benjamin, Golijanin, Itin, Pode and Keshet, "Selective ablation of immature blood vessels in established human tumors follows vascular endothelial growth factor withdrawal," J. Clin . Invest ., 103(2):159-165, 1999.

Berman, Mellis, Pollock, Smith, Suh, Heinke, Kowal, Surti, Chess, Cantor, et al ., "Content and organization of the human Ig VH locus: definition of three new VH families and linkage to the Ig CH locus," EMBO J., 7(3):727-738, 1988.

Borgstrom, Hillan, Sriramarao, Ferrara, "Complete inhibition of angiogenesis and growth of microtumors by anti-vascular endothelial growth factor neutralizing antibody: novel concepts of angiostatic therapy from intravital videomicroscopy," Cancer Res., 56(17):4032-1439, 1996.

Borgstrom Bourdon, Hillan, Sriramarao, Ferrara, "Neutralizaing anti-vascular endothelial growth factor antibody completely inhibits angiogenesis and growth of human prostate carcinoma micro tumors in vivo," Prostate , 35(1):1-10, 1998.

Borgstrom, Gold, Hillan, Ferrara, "Importance of VEGF for breast cancer angiogenesis in vivo: implications from intravital microscopy of combination treatment with an anti-VEGF neutralizing monoclonal antibody and doxorubicin," Anticancer Research, 19(5B):4203-11, 1999.

Bornstein, "Thrombospondins: structure and regulation of expression," FASEB J, 6(14):3209-3299, 1992.

Brekken, Huang, King, Thorpe, "Vascular endothelial growth factor as a marker of tumor endothelium," Cancer Res ., 58(9):1952-1959, 1998.

Brekken, Overholser, Stasny, Waltenberger, Minna, Thorpe, "Selective inhibition of VEGFR2 activity by a monoclonal anti-VEGF antibody blocks tumor growth in mice", Cancer Res ., 60:5117-24, 2000.

Brem, "Angiogenesis antagonists: current clinical trials," Angiogenesis, 2:9-20, 1998.

Brinster, Chen, Trumbauer, Yagle, Palmiter, "Factors Affecting the Efficiency of Introducing Foreign DNA into Mice by Microinjecting Eggs," Proc. Natl . Acad . Sci . USA , 82(13):4438-4442, 1985.

Burke, Carle, Olson, "Cloning of large segments of exogenous DNA into yeast by means of artificial chromosome vectors", Science, 236, 806-812, 1987.

Burke, Lehmann-Bruinsma, Powell, "Vascular endothelial growth factor causes endothelial proliferation after vascular injury," Biochem . Biophys . Res. Comm ., 207:348-354, 1995.

Burrows and Thorpe, "Vascular targeting-a new approach to the therapy of solid tumors," Pharmacol . Ther ., 64:155-174, 1994.

Burrows and Thorpe, "Eradication of large solid tumors in mice with an immunotoxin directed against tumor vasculature," Proc . Natl . Acad . Sci . USA , 90:8996-9000, 1993.

Burrows, Watanabe, Thorpe, "A murine model for antibody-directed targeting of vascular endothelial cells in solid tumors," Cancer Res ., 52:5954-5962, 1992.

Carmeliet, Ferreira, Breier, Pollefeyt, Kieckens, Gertsenstein, Fahrig, Vandenhoeck, Harpal, Eberhardt, Declercq, Pawling, Moons, Collen, Risau, Nagy, "Abnormal blood vessel development and lethality in embryos lacking a single VEGF allele," Nature, 380(6573):435-439, 1996.

Carillo and Lipton, "The Multiple Sequence Alignment Problem in Biology", SIAM J. Applied Math., 48:1073, 1988.

Cheng, Huang, Nagane, Ji, Wang, Shih, Arap, Huang, Cavenee, "Suppression of glioblastoma angiogenicity and tumorigenicity by inhibition of endogenous expression of vascular endothelial growth factor," Proc . Natl . Acad. Sci . USA, 93:8052-8057, 1996.

Claffey, Brown, del Aguila, Tognazzi, Y대 Manseau, Dvorak, "Expression of vascular permeability factor/vascular endothelial growth factor by melanoma cells increases tumor growth, angiogenesis, and experimental metastasis," Cancer Res ., 56:172-181, 1996.

Clapp, Martial, Guzman, Fentier-Delure, Weiner, "The 16-kilodaltono N-terminal fragment of human prolactin is a potent inhibitor of angiogenesis," Endocrinology, 133(3):1292-1299, 1993.

Clauss, Weich, Breier, Knies, Rockl, Waltenberger, Risau, "The vascualr endothelial cell growth factor receptor Flt-1 mediates biological activities," J. Biol . Chem ., 271(30):17629-17634, 1996.

Cohen, Gaskins, Nasoff, "Generation of a Monoclonal Antibody Agonist to Toll-Like Receptor 4", Hybridoma , 24(1):27-35, 2005.

Condeelis and Pollard, "Macrophages: Obligate Partners for Tumor Cell Migration, Invasion, and Metastasis", Cell, 124:263-266, 2006.

Connolly, Heuvelman, Nelson, Olander, eppley, Delfino, Siegel, Leimgruber, Feder, "Tumor vascular permeability factor stimulates endothelial cell growth and angiogenesis," J. Clin . Invest ., 84:1470-1478, 1989.

Coughlin, Salhany, Wysocka, Aruga, Kuzawa, Chang, Hunter, Fox, Trinchieri, Lee, "Interleukin-12 and interleukin-18 synergistically induce murine tumor regression which involves inhibition of angiogenesis," J. Clin . Invest., 101(6):1441-1452, 1998.

Cullen, Gray, Wilson, Hayenga, Lamsa, Rey, Norton, Berka, "Controlled Expression and Secretion of Bovine Chymosin in Aspergillus Nidulans," BioTechnology, 5:369, 1987.

D'Amato, Loughnan, Flynn, Folkman, "Thalidomide is an inhibitor of angiogenesis," Proc . Natl . Acad . Sci . USA, 91(9):4082-4085, 1994.

D'Angelo, Struman, Martial, Weiner, "Activation of mitogen-activated protien kinases by vascular endothelial growth factor and basic fibroblast growth factor in capillary endothelial cells is inhibited by the antiangiogenic factor 16-kDa N-terminal fragment of prolactin," Proc . Natl . Acad. Sci . USA, 92(14):6374-6378, 1995.

Davies and Cohen, "Interactions of protein antigens with antibodies," Proc Natl . Acad . Sci . U.S.A. 93:7-12, 1996.

Davies, Paddlan, Sheriff, "Antibody-antigen complexes," Annu . Rev . Biochem. 59:439-473, 1990.

Davies and Riechmann, "Antibody VH domains as small recognition units", Biotechnology(NY), 13:475-479, 1995.

Davis and Yancopoulos, "The angiopoietins: Yin and Yang in angiogenesis", Curr . Top . Microbiol . Immunol ., 237:173-85, 1999.

Detmar, Brown, Claffey, Yeo, Kocher, Jackman, Berse, Dvorak, "Overexpression of vascular permeability factor/vascular endothelial growth factor and its receptors in psoriasis," J. Exp . Med ., 180:1141-1146, 1994.

Devereux, Haeberli, Smithies, "A Comprehensive Set of Sequence Analysis Programs for the VAX", Nucleic Acids Res ., 12:387, 1984.

DeVore, Hellerqvist, Wakefield, Wamil, Thurman, Minton, Sundell, Yan, Carter, Wang, York, Zhang, Johnson, "Phase I Study of the Antineovascularization Drug CM101," Clin . Cancer Res ., 3(3):365-372, 1997.

deVries, Escobedo, Ueno, Houck, Ferrara, Williams, "The fms-like tyrosine kinase, a receptor for vascular endothelial growth factor," Science , 255(5047):989-991, 1992.

Dvorak, Nagy, Dvorak, "Structure of solid tumors and their vascularture: implications for therapy with monoclonal antibodies," Cancer Cells, 3:77-85, 1991a.

Dvorak, Sioussat, Brown, Verse, Nagy, Sotrel, Manseau, Vandewater, Senger, "Distribution of vascular permeability factor(vascular endothelial growth factor) in tumors-concentration in tumor blood vessels," J. Exp . Med ., 174:1275-1278, 1991b.

Ferrara, "The role of vascular endothelial growth factor in pathological angiogenesis," Breast Cancer Res . Treat ., 36:127-137, 1995.

Ferrara, Clapp, Weiner, "The 16K fragment of prolactin specifically inhibits basal or fibroblast growth factor stimulated growth of capillary endothelial cells," Endocrinology , 129(2):896-900, 1991.

Ferrara, Houck, Jakeman, Winer, Leung, "The vascular endothelial growth factor family of polypeptides," J. Cell . Biochem ., 47:211-218, 1991.

Ferra, Carver-Moore, Chen, Dowd, Lu, O'Shea, Powell-Braxton, Hillan, Moore, "Heteozygous embryonic lethality induced by targeted inactivation of the VEGF gene," Nature , 380(6573):439-442, 1996.

Fidler and Ellis, "The implications of angiogenesis for the biology and therapy of cancer metastasis [comment]," Cell , 79(2):185-188, 1994.

Fidler, Kumar, Bielenberg, Ellis, "Molecular determinants of angiogenesis in cancer metastasis," Cancer J. Sci . Am ., 4 Suppl 1:S58-66, 1998.

Finberg, Knipe, Kurt-Jones, "Herpes Simplex Virus and Toll-Like Receptors", Viral Immunol ., 18(3):457-465, 2005.

Folkman and Shing, "Angiogenesis," J. Biol . Chem ., 267:10931-10934, 1992.

Folkman, Langer, Linhardt, Haudenschild, Taylor, "Angiogenesis inhibition and tumor regression caused by heparin or a heparin fragment in the presence of cortisone," Science, 221:719-725, 1983.

Fong, Rossant, Gertsenstein, Breitman, "Role of the Flt-1 receptor tyrosine kinase in regulating the assembly of vascular endothelium," Nature , 376:66-70, 1995.

Forsythe, Jiang, Iyer, Agani, Leung, Koos, Semenza, "Activation of vascular endothelial growth factor gene transcription by hypoxia-inducible factor 1," Mol . Cell . Biol ., 16:4604-4613, 1996.

Fotsis, Zhang, Pepper, Adlercreutz, Montesano, Nawroth, Schweigerer, "The endogenous oestrogen metabolite 2-methoxyoestradiol inhibits angiogenesis and suppresses tumour growth," Nature , 368(6468):237-239, 1994.

Frank, Hubner, Breier, Longaker, Greenhalgh, Werner, "Regulation of vascular endothelial growth factor expression in cultured growth factor expression in cultured keratinocytes. Implications for normal and impaired wound healing," J. Biol . Chem., 270:12607-12613, 1995.

Frankel, "Genetically Engineered Toxins," Editor Arthur E. Frankel, Marcel Dekker Inc., New York, NY, 1992.

Frater-Schroder, Risau, Hallmann, Gautschi, Bohlen, "Tumor necrosis factor type alpha, a potent inhibitor of endothelial cell growth in vitro, is angiogenic in vivo," Proc . Natl . Acad . Sci . USA , 84(15):5277-5281, 1987.

Frazier, "Thrombospondins," Curr . Opin , Cell Biol ., 3(5):792-799, 1991.

Frische, Meldal, Werdelin, Mouritsen, Jensen, Galli-Stampino, Bock, "Multiple Column Synthesis of a Library of T-Cell Stimulating Tn-Antigenic Glycopeptide Analogues for the Molecular Characterization of T-Cell-Glycan Specificity", J. Pept . Sci ., 2(4):212-22, 1996.

Gabrilovich, D.I., Velders, M.P., Sotomayor, E.M. & Kast, W.M.(2001), Mechanism of immune dysfunction in cancer mediated by immature Gr-1+myeloid cells. J Immunol , 166, 5398-406.

Gagliardi, Hadd, Collins, "Inhibition of angiogenesis by suramin," Cancer Res ., 52(18):5073-5075, 1992.

Gagliardi and Collins, "Inhibition of angiogenesis by antiestrogens," Cancer Res ., 53(3):533-535, 1993.

Gagliardi, Kassack, Kreimeyer, Muller, "Antiangiogenic and antiproliferative activity of suramin analogues," Cancer Chemother . Pharmacol., 41(2):117-124, 1998.

Gagnon, Bielengerg, Gechtman, Miao, Takashima, Soker, Klagsbrun, "Identification of a natural soluble neuropilin-1 that binds vascular endothelial growth factor: In vivo expression and antitumor activity", Proc . Natl. Acad . Sci . USA , 97(6):2573-2578, 2000.

Gerber, Condorelli, Park, Ferrara, "Differential transcriptional regulation of the two vascular endothelial growth factor receptor genes," J. Biol. Chem ., 272:23659-23667, 1997.

Gerber, Vu, Ryan, Kowalski, Werb, Ferrara, "VEGF couples hypertrophic cartilage remodeling, ossification and angiogenesis during endochondral bone formation," Nature Medicine, 5(6):623-8, 1999.

Giovarelli, Cappello, Forni, Salcedo, Moore, LeFleur, Nardelli, Di Carlo, Lollini, Ruben, Ullrich, Garotta, Musiam, "Tumor rejection and immune memory elicited by locally released LEC chemokine are associated with an impressive recruitment of APCs, lymphocytes, and granulocytes", J. Immunol ., 164, 3200-3206, 2000.

Glennie, McBride, Worth, Stevenson, "Preparation and performance of bispecific F(ab'gamma)2 antibody containing thioether-linked Fab' gamma fragments," J. Immunol ., 139:2367-2375, 1987.

Goeddel, "Gene Expression Technology: Methods in Enzymology 185, Academic Press , San Diego , CA , 1990.

Good, Polverini, Rastinejad, Beau, Lemons, Frazier, Bouck, "A tumor suppressor-dependent inhibitor of angiogenesis is immunologically and functionally indistinguishable from a fragment of thrombospondin," Proc . Natl. Acad . Sci . USA, 87(17):6624-6628, 1990.

Goswami, Sahai, Wyckoff, Cammer, Cox, Pizley, Stanley, Segall and Condeelis, "Macrophages Promote the Invasion of Breast Carcinoma Cells via a Colony-Stimulating Facor-1/Epidermal Growth Factor Paracrine Loop", Cancer Res., 65(12):5278-5283, 2005.

Grant, Caballero, Bush, Spoerri, "Fibronectin fragments modulate human retinal capillary cell proliferation and migration," Diabetes, 47(8):1335-1340, 1998.

Guo, Jia, Song, Warren, Donner, "Vascular endothelial cell growth factor promotes tyrosine phosphorylation of mediators of signal transduction that contain SH2 domains," J. Biol . Chem ., 270:6729-6733, 1995.

Hamers-Casterman and Atarhouch, "Naturally Occurring antibodies Devoid of Light Chains", Nature, 363(6428):446-448, 1993.

Hammer, Pursel, Rexroad, Wall, Bolt, Ebert, Palmiter, Brinster, "Production of Transgenic Rabbits, Sheep and Pigs by Microinjection", Nature, 315:680-683, 1985.

Hanahan and Folkman, "Patterns and emerging mechanisms of the angiogenic switch during tumorigenesis," Cell, 86(3):353-364, 1996.

Harada, Mitsuyama, Yoshida, Sakisaka, Taniguchi, Kawaguchi, Ariyoshi, Saiki, Sakamoto, Nagata, Sata, Matsuo, Tanikawa, "Vascular endothelial growth factor in patients with rheumatoid arthrits", Scandinavian J. Rheumatol ., 27(5):377-80, 1998.

Haran, Maretzek, Glodberg, Horowitz, Degani, "Tamoxifen enhances cell death in implanted MCF7 breast cancer by inhibiting endothelium growth," Cancer Res ., 54(21):5511-5514, 1994.

Hasselaar and Sage, "SPARC antagonizes the effect of basic fibroblast growth factor on the migraion of bovine aortic endothelial cells," J. Cell biochem, 49(3):272-283, 1992.

Harlow and Lane, "Antibodies: a Laboratory Manual", Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory, ISBN 978-087969314-5:1-726, 1998.

Hellerqvist, Thurman, Page, Wang, Russell, Montgomery, Sundell, "Antitumor effects of GBS toxin: a polysaccharie exotoxin from group B beta-hemolytic streptococcus," J. Cancer Res . Clin . Oncol ., 120(1-2):63-70, 1993.

Henikoff and Henikoff, "Amino acid Substitution Matrices from Protein Blocks", Proc . Natl . Acad . Sci . USA , 89:10915-10919, 1992.

Hinnen, Hicks, Fink, "Transformation of Yeast", Proc . Natl . Acad , Sci . USA, 75:1929, 1978.

Hiratsuka, Minowa, Kuno, Noda, Shibuya, "Flt-1 lacking the tyrosine kinase domain is sufficient for normal development and angiogenesis in mice," Proc. Natl . Acad . Sci . USA , 95(16):9349-9354, 1998.

Hiscox and Jiang, "Interleukin-12, an emerging anti-tumour cytokine," In Vivo , 11(2):125-132, 1997.

Holash, Maisonpierre, Compton, Boland, Alexander, Zagzag, Yancopoulos, Wiegand, "Vessel Cooption, Regression and Growth in Tumors Mediated by Angiopoietins and VEGF", Science, 284:1994-1998, 1999.

Holliger and Hudson, "Engineered Antibody Fragments and the Rise of Single Domains", Nature Biotechnology , 23(9):1126-1136, 2005.

Holm, "Dali: a Network Tool for Protein Structure Comparison", Trend in Biochemical Sciences, 20:478-480, 1995.

Holm, "Protein Structure Comparison by Alignment of Distance Matrices", J. Mol . Biol ., 233:123-38, 1993.

Holm, "Touring Protein Fold Space With Dali/FSSP", Nucleic Acid Res ., 26:316-9, 1998.

Hood and Granger, "Protein kinase G mediates vascular endothelial growth factor-induced Raf-1 activation and proliferation in human endothelial cells," J. Biol . Chem ., 273(36):23504-23508, 1998.

Hood, Meininger, Ziche, Granger, "VEGF upregulates ecNOS message, protein, and NO production in human endothelial cells," Am . J. Physiol ., 274(3 pt 2):H1054-1058, 1998.

Hori, Hu, Yasui, Smither, Gresham, Fan, "Differential effects of angiostatic steroids and dexamethasone on angiogenesis and cytokine levels in rat sponge implants," Br . J. Pharmacol ., 118(7):1584-1591, 1996.

Horsmans, Berg, Desager, Mueller, Schott, Fletcher, Steffy, Bauman, Kerr, Averett, "Isatoribine, an agonist of TLR7, reduces plasma virus concentration in chronic hepatitis C infectioin." Hepatology, 42(3):724-31, 2005. Houben-weyl, Methods of Organic Chemistry, ed. E. Wansch, Vol. 15 I and II, Thieme, Stuttgart, 1987.

Houck, Ferrara, Winer, Cachianes, Li, Leung, "The vascular endothelial growth factor family: Identification of a fourth molecular species and characterization of alternative splicing of RNA," Mol . Endocrinol ., 5(12):1806-1814, 1991.

Huang, Molema, King, Wakins, Edgington, Thorpe, "Tumor infarction in mice by antibody-directed targeting of tissue factor to tumor vasculature," Science, 275:547-550, 1997.

Hurwitz, Fehrenbacher, Novotny, Cartwright, Hainsworth, Heim, Berlin, Baron, Griffing, Holmgren, Ferrara, Fyfe, Rogers, Ross, Kabbinavar, "Bevacizumab plus Irinotecan, Fluorouracil, and Leucovorin for Metastatic Colorectal Cancer", N. Engl . J. Med ., 350:2335-2342, 2004.

Huse, Sastry, Lverson, Kang, Alting-Mees, Burton, Benkovic and Lerner, "Generation of a Large Combinatorial Library of the Immunoglobulin Repertoire in Phage Lambda," Science , 246(4935):1275-1281, 1989.

Hussain, Kotz, Minasian, Premkumar, Sarosy, Reed, Zhai, Steinberg, Raggio, Oliver, Figg, Kohn, "Phase II Trial of Carboxyamidotriazole in Patients With Relapsed Epithelial Ovarian Cancer", J. Clin . Oncol ., 21(23);4356-4363, 2003.

Ingber, Fujita, Kishimoto, Sudo, Kanamaru, Brem, Folkman, "Angioinhibins: Synthetic analogues of fumagillin which inhibit angiogenesis and suppress tumor growth," Nature, 48:555-557, 1990.

Inoue, Itoh, Ueda, Naruko, Kojima, Komatsu, Doi, Ogawa, Tamura, Takaya, Igaki, Yamashita, Chun, Masatsugu, Becker, Nakao, "Vascular endothelial growth factor(VEGF) expression in human coronary atherosclerotic lesions: possible pathophysiological significance of VEGF in progression of atherosclerosis", Circulation, 98(20):2108-16, 1998.

Ito, Fukuda, Murata, Kimura, "Transformation of Intact Yeast Cells Treated with Alkali Cations", J. Bacteriol ., 153:163-168, 1983.

Iwamoto, Nomizu, Yamada, Ito, Tanaka, Sugioka, "Inhibition of angiogenesis, tumour growth and experimental metastasis of human fibrosarcoma cells HT1080 by a multimeric form of the laminin sequence Tyr-Ile-Gly-Ser-Arg(YIGSR)," Br . J. Cancer , 73(5):589-595, 1996.

Jackson, Volpert, Bouck, Linzer, "Stimulation and inhibition of angiogenesis by placental proliferin and proliferin-related protein," Science, 266(5190):1581-1584, 1994.

Jendraschak and Sage, "Regulation of angiogenesis by SPARC and angiostatin: implications for tumor cell biology," Semin . Cancer Biol., 7(3):139-146, 1996.

Kabat, Wu, Perry, Gottesman, Foeller, "Sequences of Proteins of Immunological Interest" 5 th Ed . Public Health Service , National Institutes of Health, Bethesda , Md , 647-669, 1991.

Kamphaus, Colorado, Panka, Hopfer, Ramchandran, Torre, Maeshima, Mier, Sukhatme, and Kalluri, "Canstatin, a Novel Matrix-derived Inhibitor of Angiogenesis and Tumor Growth", J. Biol . Chem ., 275(2):1209-1215, 2000.

Kang, Barbas, Janda, Benkovic and Lerner, "Linkage of Recognition and Replication Functions by Assembling Combinatorial Antibody Fab Libraries Along Phage Surfaces", Proc . Natl . Acad . Sci ., U.S.A., 88(10):4363-4366, 1991.

Kaufman, Murtha, Davies, "Thranslational Efficiency of Polycistronic Mrnas and Their Utilization to Express Heterologous Genes in Mannalian Cells", EMBO J., 6:187-195, 1987.

Kaur, Brat, Devi and Van Meir, "Vasculostatin, a proteolytic fragment of Brain Angiogenesis Inhibitor 1, is an antiangiogenic and antitumorigenic factor", Oncogene, 24:3632-3642, 2005.

Keck, Hauser, Krivi, Sanzo, Warren, Feder, Connolly, "Vascular permeability factor, an endothelial cell mitogen related to PDGF," Science , 246:1309-1312, 1989.

Kendall and Thomas, "Inhibition of vascular endothelial cell growth factor activity by an endogenously encoded soluble receptor," Proc . Natl . Acad. Sci . USA , 90:10705-10709, 1993.

Kenyon, Browne, D'Amato, "Effects of thalidomide and related metabolites in a mouse corneal model of neovascularization," Exp . Eye Res ., 64(6):971-978, 1997.

Kerbel, Viloria-Petit, Okada, Rak, "Establishing a link between oncogenes and tumor angiogenesis," Mol . Med ., 4(5):286-295, 1998.

Keyt, Nguyen, Berleau, Duarte, Park, Chen, Ferrara, "Identification of vascular endothelial growth factor determinants for binding KDR and FLT-1 receptors. Generation of receptor-selective VEGF variants by site-directed mutagenesis," J. Biol . Chem., 271(10):5638-46, 1996.

Kim, Li, Houck, Winer, Ferrara, "The vascular endothelial growth factor proteins: identification of biologically relevant regions by neutralizing monoclonal antibodies," Growth Factors , 7:53-64, 1992.

Kim, Li, Winer, Armanini, Gillett, Phillips, "Inhibition of vascular endothelial growth factor-induced angiogenesis suppresses tumour growth in vivo," Nature , 362:841-844, 1993.

Kim, Kwak, Ahn, So, Liu, Koh, Koh, "Molecular cloning and characterizaiton of a novel angiopoietin family protein, angiopoietin-3", FEBS Lett ., 443(3):353-6, 1999.

Kipriyanov, Kupriyanova, Little, Moldenhauer, "Rapid detection of recombinant antibody fragments directed against cell-surface antigens by flow cytometry", J. Immunol ., Meth ., 196:51-62, 1996.

Kipriyanov, Moldenhauer, Little, "High level production of soluble single chain antibodies in small-scale Escherichia coli cultures", J. Immunol. Meth ., 200:69-77, 1997.

Kiss, Fisher, Pesavento, Dai, Valero, Ovecka, Nolan, Phipps, Velappan, Chasteen, Martinez, Waldo, Pavilk, Bradbury, "Antibody binding loop insertions as diversity elements", Nucleic Acids Research, 34(19):e132, 2006.

Kleinman, Weeks, Schnaper, Kibbey, Yamamura, Grant, "The laminins: a family of basement membrane glycoproteins important in cell differentiation and tumor metastases," Vitam . Horm ., 47:161-186, 1993.

Kondo, asano, Suzuki, "Significance of Vascular endothelial growth factor/vascular permeability factor for solid tumor growth, and its inhibition by the antibody," Biochem . Biophys . Res . Commun, 194(3):1234-1241, 1993.

Korpelainen and Alitalo, "Signaling angiogenesis and lymphangiogenesis," Curr . Opin . Cell Biol ., 10(2):159-164, 1998.

Kremer, Breier, Risau, Plate, "Up-regulation of flk-1/vascular endothelial growth factor receptor 2 by its ligand in a cerebral slice culture system," Cancer Res ., 57:3852-3859, 1997.

Kroll and Waltenberger, "The vascular endothelial growth factor receptor KDR activates multiple signal transduction pathways in procine aortic endothelial cells", J. Biol . Chem., 272:32521-7, 1997.

Kurjan and Herskowitz, "Structure of a Yeast Pheromone Gene(MFα): a Putative α-Factor Precursor Contains Four Tandem Copies of mature α-Factor", Cell, 30:933-943, 1982.

Kyte and Doolittle, "A simple method for displaying the hydropathic character of a protein," J. Mol . Biol ., 157(1):105-132, 1982.

Lane, Iruela-Arispe, Sage, "Regulation of gene expression by SPARC during angiogenesis in vitro . Changes in fibronectin, thrombospondin-1, and plasminogen activator inhibitor-1," J. Biol . Chem ., 267(23):16736-16745, 1992.

Le Gall, Reusch, Little and Kipriyanov, "Effect of Linker Sequences Between the Antibody Variable Domains on the Formation, Stability and Biological Activity of a Bispecific Tandem Diabody", Protein Engineering . Design & Selection, 17(4):357-366, 2004.

Lee, Clapp, Martial, Weiner, "Inhibition of urokinase activity by the antiangiogenic factor 16K prolacin: activation of plasminogen activator inhibitor 1 expression," Endocrinology , 139(9):3696-3703, 1998.

Lewis and Pollard, "Distinct Role of Macrophages in Different Tumor Microenvironments", Cancer Res ., 66(2):605-612, 2006.

Lin, Sankar, Shan, Dewhirst, Polverini, Quinn, Peters, "Inhibition of tumor growth by targeting tumor endothelium using a soluble vascular endothelial growth factor receptor," Cell Growth Differ ., 9:49-58, 1998.

Lin, Buxton, Acheson, Radziejewski, Maisonpierre, Yancopoulos, Channon, Hale, Dewhirst, George, Peters, "Anti-angiogenic gene therapy targeting the endothelium-specific receptor tyrosine kinase Tie2", Proc . Natl . Acad . Sci., USA, 95(15):8829-34, 1998.

Lin, Nguyen, Mendoza, Escandon, Fei, Meng, Modi, "Preclinical pharmacokinetics, interspecies scaling, and tissue distribution of a humanized monoclonal antibody against vascular endothelial growth factor", J. Pharmacol. Exp . Therap ., 288(1):371-8, 1999.

Lin, Li, Gnatovskiy, Deng, Zhu, Grzesik, Qian, Xue and Pollard, "Macrophages Refulate the Angiogenic Switch in a Mouse Model of Breast Cancer", Cancer Res ., 66(23):11238-11246, 2006.

Lindner and Borden, "Effects of tamoxifen and interferon-beta or the combination on tumor-induced angiogenesis," Int . J. Cancer , 71(3):456-461, 1997.

Lingen, Polverini, Bouck, "Retinoic acid and interferon alpha act synergistically as antiangiogenic and antitumor agents against human head and neck squamous cell carcinoma," Cancer Res ., 58(23):5551-5558, 1998.

Lingen, Polverini, Bouck, "Inhibition of squamous cell carcinoma angiogenesis by direct interaction of retinoic acid with endothelial cells," Lab. Invest ., 74(2):476-483, 1996.

Lin-ke, Hong-Qu, Nagy, Eckelhoefer, Masse, Dvorak, Dvorak, "Vascular targeting of solid and ascites tumours with antibodies to vascular endothelial growth factor," Eur . J. Cancer , 32A(14):2467-2473, 1996.

Loupakis, Falcone, Masi, Fioravanti, Kerbel, Del Tacca, Bocci "Vascular Endothelial Growth Factor Levels in Immunodepleted plasma of Cancer Patients As a Possible Pharmacodynamic Marker for Bevacizumab Activity," J. Clin . Onc, 1816-1818, 2007.

Luckow and Summers, "High Level Expression of Nonfused Foreign Genes with Autographa Californica Nuclear Polyhedrosis Virus Expression Vectors," Virology, 170:31-39, 1989.

Luo, Toyoda, Shibuya, "Differential inhibition of fluid accumulation and tumor growth in two mouse ascites tumors by an antivascular endothelial growth factor/permeability factor neutralizing antibody," Cancer Res ., 58(12):2594-2600, 1998a.

Luo, Yamaguchi, Shinkai, Shitara, Shibuya, "Significant expression of vascular endothelial growth factor/vascular permeability factor in mouse ascites tumors," Cancer Res ., 58(12):2652-2660, 1998b.

Majewske, Skopinska, Marczak, Szmurlo, Bollag, Jablonska, "Vitamin D3 is a potent inhibitor of tumor cell-induced angiogenesis," J. Investig . Dermatol. Symp . Proc ., 1(1):97-101, 1996.

Malecaze, Clamens, Simorre-Pinatel, Mathis, Chollet, Favard, Bayard, Plouet, "Detection of vascular endothelial growth factor messenger RNA and vascular endothelial growth factor-like activity in proliferative diabetic retinopathy," Arch . Ophthalmol ., 112:1476-1482, 1994.

Maisonpierre, Suri, Jones, Bartunkova, Wiegand, Radziejewski, Compton, McClain, Aldrich, Papadopoulos, Daly, Davis, Sato, Yancopoulos, "Angiopoietin-2, a natural antagonist for Tie2 that disrupts in vivo angiogenesis," Science , 277(5322):55-60, 1997.

Manetti, Cappello, Botta, Corelli, Mongelli, Biasoli, Borgia, Ciomei, "Synthesis and binding mode of heterocyclic analogues of suramin inhibiting the human basic fibroblast growth factor," Bioorg . Med . Chem ., 6(7):947-958, 1998.

Massey, "Catalytic Antibodies Catching On", Nature , 328:457-458, 1987.

Mazure, Chen, Yeh, Laderoute, Giaccia, "Oncogenic transformation and hypoxia synergistically act to modulate vascular endothelial growth factor expression," Cancer Res ., 56:3436-3440, 1996.

McNamara, Harmey, Walsh, Redmond, Bouchier-Hayes, "Significance of angiogenesis in cancer therapy [published erratum appears in Br J surg ., Oct:85(10):1449, 1998," Br . J. Surg ., 85(8):1044-1055, 1998.

Merrifield, "Solid Phase Peptide Synthesis 1. Synthesis of Tetrapeptide", J. Am . Chem . Assoc ., 85:2149-2154, 1964.

Mesiano, Ferrara, Jaffe, "Role of vascular endothelial growth factor in ovarian cancer: inhibition of ascites of formation by immunoneutralization," Am. J. Pathol ., 153(4):1249-1256, 1998.

Millauer, Longhi, Plate, Shawver, Risau, Ullrich, Strawn, "Dominant-negative inhibition of Flk-1 suppresses the growth of many tumor types in vivo," Cancer Res ., 56:1615-1620, 1996.

Mills, Brooker and Camerini-Otero, "Sequences of human immunoglobulin siwtch regions: implications for recombination and transcription," Nucl . Acids Res ., 18:7305-7316, 1990.

Moore, Arenberg, Addison, Keane, Streiter, "Tumor angiogenesis is regulated by CXC chemokines," J. Lab . Clin . Med ., 132(2):97-103, 1998.

Mordenti, Thomsen, Licko, Chen, Meng, Ferrara, "Efficacy and concentration-response of murine anti-VEGF monoclonal antibody in tumor-bearing mice and extrapolation to humans", Toxicologic Pathology , 27(1):14-21, 1999.

Morrison, Wims, Kobrin and Oi, "Production of novel immunoglobulin molecules by gene transfection," Mt . Sinai J. Med., 53(3):175, 1986.

Muller, Li, Christinger, Wells, Cunningham, De Vos, "Vascular Endothelial growth factor: Crystal structure and functional mapping of the kinase domain receptor binding site", Proc . Natl . Acad . Sci . USA ., 94:7192-7197, 1997.

Muller, Chen, Christinger, Li, Cunningham, Lowman, de Vos, "VEGF and the Fab fragment of a humanized neutralizing antibody: crystal structure of the complex at 2.4 A resolution and mutational analysis of the interface," Structure, 6(9):1153-67, 1998.

Mustonen and Alitalo, "Endothelial receptor tyrosine kinases involved in angiogenesis," J. Cell Biol., 129:895-898, 1995.

Myers and Miller, "Optical Alignments in Linear Spaces", CABIOS, 4:11-17, 1988.

Nagashima, Yoshino, Aono, Takai, Sasano, "Inhibitory effects of anti-rheumatic drugs on vascular endothelial growth factor in cultured rheumatoid synovial cells", clin . Exp . Immunol ., 116(2):360-5, 1999.

Nagler, Feferman, Shoshan, "Reduction in basic fibroblast growth factor mediated angiogenesis in vivo by linomide," connect Tissue Res ., 37(1-2):61-68, 1998.

Nakamura Voller and Bidwell, "Enzyme Immunoassays: Heteogeneous and Homogeneous Systems", In: Handbook of Experimental Immunology, Vol. 1: Immunochemistry, D.M. Wier(Ed.), Blackwell Scientific Publications, Oxford 1986, Chapter 27.

Needleman and Wunsch, "A General Method Applicable to the Search For Similarities in the Amino Acid Sequence of Two Proteins", J. Mol . Biol ., 48:443, 1970.

Neuberger and Milstein, "Somatic hypermutation," Curr . Opin . Immunol ., 7:248-254, 1995.

Neufeld, Cohen, Gengrinovitch, Poltorak, "Vascular endothelial by CDR grafting on a nonimmunoglobulin scaffold", Protein Sci ., 13:1882-1891, 2004.

Niida, Kaku, Amano, Yoshida, Kataoka, Nishikawa, Tanne, Maeda, Nishikawa, Kodama, "Vascular endothelial growth factor can substitute for macrophage colony-stimulating factor in the support of osteoclastic bone resorption", J. Exp . Med ., 190(2):293-8, 1999.

Nozaki, Sakurai, Raisler, Baffi, Witta, Ogura, Brekken, Sage, Ambati, Ambati, "Loss of SPARC-mediated VEGRR-1 suppression after injury revelas a novel antiangiogenic activity of VEGF-A", J. Clin . Invest ., 116(2):422-9, 2006.

Oikawa, Hirotani, Nakamura, Shudo, Hiragun, Iwaguchi, "A highly potent antiangitogenic activity of retinoids," Cancer Lett ., 48(2):157-162, 1989.

Olander, Connolly, DeLarco, "Specific binding of vascular permeability factor to endothelial cells," Biochem . Biophys . Res . Comm ., 175:68-76, 1991.

O'Reilly, Boehm, Shing, Fukai, Vasios, Lane, Flynn, Birkhead, Olsen, Folkman, "Endostatin: an endogenous inhibitor of angiogenesis and tumor growth," Cell ., 88(2):277-285, 1997.

Plamiter and Brinster, "Transgenic Mice", Cell , 41:343-345, 1985.

Palmiter, Norstedt, Gelinas, Hammer, Brinster, "Metallothionein-Human GH Fusion Genes Stimulate Growth of Mice", Science , 222:809-814, 1983.

Parmley and Smith, "Antibody-selectable filamentous fd phage vectors: affinity purification of target genes," Gene, 73(2):305-318, 1988.

Pearson and Lipman, "Improved tools for biological sequence analysis", Proc. Natl . Acad . Sci . USA , 85:2444-2448, 1998.

Pearson, "Rapid and sensitive sequence comparison with FASTP and FASTA", Methods in Enzymology, 183:63-93, 1990.

Pepper, Ferrara, Orci, Montesano, "Leukemia inhibitory factor(LIF) inhibits angiogenesis in vitro," J. Cell Sci ., 108(1):73-83, 1995.

Petersen, Wang, Yalcin-Chin, Li-Peyton, Minna, Harran, Wang, "Autocrine TNFα Signaling Renders Human Cancer Cells Susceptible to Smac-Mimetic-Induced Apoptosis", Cancer Cell, 12(5):445-456, 2007.

Petrova, Nykanen, Norrmen, Ivanov, Andersson, Haglund, Puolakkainen, Wempe, von Melchner, Gradwohl, Vanharanta, Aaltonen, Saharinen, Gentile, Clarke, Taipale, Oliver, Alitalo, "Transcription factor PROX1 induces colon cancer progression by promoting the transition from benign to highly dysplastic phenotype", Cancer Cell , 13(5):407-19, 2008.

Pike, Yao, Jones, Cherney, Appella, Sakaguchi, Nakhasi, Teruya-Feldstein, Wirth, Gupta and Tosato, "Vasostatin, a Calreticulin Fragment, Inhibits Angiogenesis and Suppresses Tumor Growth", J. Exp . Med ., 188(12):2349-2356, 1998.

Pike, Yao, Setsuda, Jones, Cherney, Appella, Sakaguchi, Nakhasi, Atreya, Teruya-feldstei, Wirth, Gupta and Tosato, "Calreticulin and Calreticulin Fragments Are Endothelial Cell Inhibitors That Suppress Tumor Growth", Blood, 94(7):2461-2468, 1999.

Plate, Breier, Weich, Mennel, Risau, "Vasclar endothelial growth factor and glioma angiogenesis: coordinate induction of VEGF receptors, distribution of VEGF protein and possible in vivo regulatory mechanisms," Int . J. Cancer , 59:520-529, 1994.

Potgenes, Westphal, DeWaal, Ruiter, "The role of vascular permeability factor and basic fibroblast growth factor in tumor angiogenesis," In : Growth Factors in Tumor Angiogenesis, Berlin: Walter de Gruyer & Co. pp. 57-70, 1995.

Presta, Chen, O'Connor, Chisholm, Meng, Krummen, Winkler, Ferrara, "Humanization of an anti-vascular endothelial growth factor monoclonal antibody for the therapy of solid tumors and other disorders," Cancer Res ., 57:4593-4599, 1997.

Qiu, Wang, Cai, Wang, Yue, "Small antibody mimetics comprising two complementarity-determining regions and a framework region for tumor targeting," Nature Biotechnology , 25(8):921-929, 2007.

Quinn, Thurman, Sundell, Zhang, Hellerqvist, "CM101, a polysaccharide antitumor agent, does not inhibit wound healing in murine models," J. Cancer Res. Clin . Oncol ., 121(4):253-256, 1995.

Raychaudhury and D'Amore, "Endothelial cell regulation by transforming growth factor-beta," J. Cell Biochem ., 47(3):224-229, 1991.

Reff and Heard, "A Review of Modifications to Recombinant Antibodies: Attempt to Increase Efficacy in Oncology Aplications", Critical Reviews in Oncology Hematology, 40:25-35, 2001.

Reiter, Ulrich Brinkmann, Lee and Pastan, "Engineering Antibody Fv Fragments for Cancer Detection and Therapy: Disulfide-Stabilized Fv Fragments", Nature Biotechnoloty , 14:1239-1245, 1996.

Richer and Lo, "Introduction of human DNA into mouse eggs by injenction of dissected human dhromosome fragments", Science , 245:175-177, 1989.

Ryan, Eppler, Hagler, Bruner, Thomford, Hall, Shopp, O'Neill, "Preclinical safety evaluation of rhuMAbVEGF, an antiangiogenic humanized monoclonal antibody", Toxiocologic Pathology , 27(1):78-86, 1999.

Sakamoto, Tanaka, Togho, Ogawa, "Heparin plus cortisone acetate inhibit tumor growth by blocking endothelial cell proliferation," Canc . J., 1:55-58, 1986.

Saleh, Stacker, Wilks, "Inhibition of growth of C6 glioma cells in vivo by expression of antisense vascular endothelial growth factor sequence," Cancer Res., 56:393-401, 1996.

Sambrook, Fritsch and Maniatis, Molecular Cloning : A Laboratory Manual, 2nd Ed., Cold Spring Harbor Press, Cold Spring Harbor, NY, 1989.

Sang, "Complex role of matrix metalloproteinases in angiogenesis," Cell Res., 8(3):171-177, 1998.

Schultz, Tanner, Hofmann, Emini, Condra, Jones, Kieff, Ellis, "Expression and Secretion in Yeast of a 400-Kda Envelope Glycoprotein Derived from Epstein-Barr Virus", Gene, 54:113-123, 1987.

Seed, "an LFA-3 Cdna Encodes a Phospholipid-Linked Membrane Protein Homologous to its Receptor CD2", Nature , 329:840, 1987.

Senger, Galli, Dvorak, Perruzzi, Harvey, Dvorak, "Tumor cells secrete a vascualr permeability factor that promotes accumulation of ascites fluid," Science, 219:983-985, 1983.

Senger, Perruzzi, Feder, Dvorak, "A highly conserved vascular permeability factor secreted by a variety human and rodent tumor cell lines," Cancer Res ., 46:5629-5632, 1986.

Senger, Connolly, Vandewater, Feder, Dvorak, "Purification and NH2-terminal amino acid sequence of guinea pig tumor secreted vascular permeability factor," Cancer Res ., 50:1774-1778, 1990.

Serafini, P., De santo, C., Marigo, I., Cingarlini, S., Dolcetti, L., Gallina, G., Zanovello, P. & Bronte, V(2004). "Derangement of immune responses by myeloid suppressor cells", Cancer Immunol Immunother, 53, 64-72.

Shalaby, Rossant, Yamaguchi, Gertsenstein, Wu, Breitman, Schuh, "Failure of blood-island formation and vasculogenesis in Flk-1-deficient mice," Nature, 376:62-66, 1995.

Sheibani and Frazier, "Thrombospondin 1 expression in transformed endothelial cells restores a normal phenotype and suppresses their tumorigenesis," Proc . Natl . Acad . Sci . USA, 92(15):6788-6792, 1995.

Sheu, Yen, Kan, "Inhibition of angiogenesis in vitro and in vito: comparison of the relative activities of triflavin, an Arg-Gly-Asp-containing peptide and anti-alpha(v)beta3 integrin monoclonal antibody," Biochem . Biophys, Acta, 1336(3):445-454, 1997.

Shibuya, "Vascular endothelial growth factor receptor-1(VEGFR-1/Flt-1): a dual regulator for angiogenesis", Angiogenesis, 9(4):225-30, 2007.

Shojaei, Wu, Malik, Zhong, Baldwin, Schanz, Fuh, Gerber, Ferrara, "Tumor refractoriness to anti-VEGF treatment is mediated by CD11b+Gr1+ myeloid cells", Nature Biotechnology, 25:911-920, 2007.

Sideras, Mizuta, Kanamori, Suzuki, Okamoto, Kuze, Ohno, Doi, Fukuhara, Hassan, et al., "Production of sterile transcripts of C gamma genes in an IgM-producing human neoplastic B cell line that switches to IgG-producing cells," Intl . Immunol ., 1(6):631-642,1989.

Siemeister, Martiny-Baron, Marme, "The pivotal role of VEGF in tumor angiogenesis: molecular facts and therapeutic opportunities," Cancer Metastasis Rev ., 17(2):241-248., 1998.

Sinker, White, Gordon, "Molecular Biology of Ri-Plasmid a Review", J. Biosci(Bangalore), 11:47-58, 1987.

Sioussat, Dvorak, Brock, Senger, "Inhibition of vascular permeability factor(vascular endothelial growth factor) with antipeptide antibodies," Arch. Biochem . Biophys ., 301:15-20, 1993.

Sipos, Tamargo, Weingart, Berm, "Inhibition of tumor angiogenesis," Ann. NY Acad . Sci ., 732:263-272, 1994.

Smith and Waterman, "Comparison of Biosequences", Adv . Appl . Math ., 2:482, 1981.

Smith, Summers, Fraser, "Production of Human Beta interferon in Insect Cells Infected With Baculovirus Expression Vector", Mol . Cell Biol ., 3:2156-2165, 1983.

Soff, Sanderowitz, Gately, Verrusio, Weiss, Berm, Kwaan, "Expression of plasminogen activator inhibitor type 1 by human prostate carcinoma cells inhibits primary tumor growth, tumor-associated angiogenesis, and metastasis to lung and liver in an athymic mouse model," J. Clin . Invest ., 96(6):2593-2600, 1995.

Soker, Takashima, Miao, Neufeld, Klagsbrun, "Neuropilin-1 is expressed by endothelial and tumor cells as an isoform-specific receptor for vascular endothelial growth factor." Cell , 92(6):735-745, 1998.

Springer, Chen, Kraft, Bednarski, Blau, "VEGF gene delivery to muscle: potential role for vasculogenesis in adults," Mol , Cell , 2(5):549-558, 1998.

Stella and Himmelstein, "Prodrugs: A chemical approach to targeted drug delivery", Directed Drug Delivery, Borchardt et al., Eds. Human Press, 1985, pp 247-267.

Sweetwyne, Brekken, Workman, Bradshaw, Carbon, Siadak, Murri and Sage, "Functional Analysis of the Matricellular Protein SPARC with Novel Monoclonal Antibodies", J. Histochem . Cytochem ., 52(6):723-733, 2004.

Tada, Fukunaga, Wakabayashi, Masumi, Sato, Izumi, Kohno, Kuwano, "Inhibition of tubular morphogenesis in human microvascular endothelial cells by co-culture with chondrocytes and involvement of transforming growth factor beta: a model for avascularity in human cartilage." Biochim . Biophys . Acta , 1201(2):135-142, 1994.

Takano, Gately, Neville, Herblin, Gross, Engelhard, Perricone, Eidsvoog, Berm, "Suramin, an anticancer and angiosuppressive agent, inhibits endothelial cell binding of basic fibroblast growth factor, migration, proliferation, and induction of urokinase-type plasminogen activator," Cancer Res., 54(10):2654-2660, 1994.

Tanaka, Manome, Wen, Kufe, Fine, "Viral vector-mediated transduction of a modified platelet factor 4 cDNA inhibits angiogenesis and tumor growth," Nat. Med ., 3(4):437-442, 1997.

Terman, Dougher-Vermazen, Carrion, Dimitrov, Armellino, Gospodarowicz, Bohlen, "Identification of the KDR tyrosine kinase as a receptor for vascular endothelial cell growth factor," Biochem . Biophys . Res . Comm ., 187:1579-1586, 1992.

Terman, Khandke Dougher-Vermazan, Maglione, Lassam, Gospodarowicz, Persico, Bohlen, eisinger, "VEGF receptor subtypes KDR and FLT1 show different sensitivities to heparin and placenta growth facotr," Growth Factors, 11(3):187-195, 1994.

Thomas, "Vascular endothelial growth facotr, a potent and selective angiogenesis agent," J. Biol , Chem ., 271:603-606, 1996.

Thompson, Higgins, Gibson, "CLUSTAL W: Improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalities and weight matrix choice", Nucleic Acids Res ., 22:4673-4680, 1994.

Thorpe, Derbyshire, Andrade, Press, Knowles, King, Watson, Yang, Rao-Bette, "Heparin-Steroid Conjugates: New Angiogenesis Inhibitors with Antitumor Activity in Mice," Cancer Res ., 53:3000-3007, 1993.

Tischer, Mitchell, Hartman, Silva, Gospodarowicz, Fiddes, Abraham, "The human gene for vascular endothelial growth factor," J. Biol . Chem ., 266:11947-11954, 1991.

Tolsma, Volpert, Good, Frazier, Polverini, Bouck, "Peptides derived from two separate domains of the matrix protein thrombospondin-1 have anti-angiogenic activity," J. Cell Biol ., 122(2):497-511, 1993.

Tryggvason, "The laminin family," Curr . Opin . Cell Biol ., 5(5):877-882, 1993.

Valenzuela, Griffiths, Rojas, Aldrich, Jones, Zhou, McClain, Copeland, Gilbert, Jenkins, Huang, Papadopoulos, Maisonpierre, Davis, Yancopoulos, "Angiopoietins 3 and 4: diverging gene counterparts in mice and humans", Proc. Natl . Acad . Sci ., USA , 96(5):1904-9, 1999.

van den Beucken, Neer, Sablon, Desmet, Celis, Hoogenboom, Hufton, "Building novel binding ligands to B7.1 and B7.2 based on human antibody single variable light chain domains", J. Mol . Biol., 310:591-601,2001.

van dijk, Warnaar, van Eendenburg, Thienpont, Braakman, Boot, Fleuren and Bolhuis, "Induction of tumor-cell lysis by bi-specific monoclonal antibodies recognizing renal-cell carcinoma and CD3 anatigen." Int . J. Cancer, 43:344-349, 1989.

Varfolomeev, Blankenshio, Wayson, fedorova, Kayagaki, Garg, Zobel, Dynek, Elliott, Wallweber, Flygare, Fairbrother, Deshayes, Dixit, Vucic, "IAP Antagonists Induce Autoubiquitination of c-IAPs, NF-κB Activiation, and TNF-α-Dependent Apoptosis", Cell , 131(4):669-681, 2007.

Vince, Wong, Khan, Feltham, Chau, Ahmed, Benetatos, Chunduru, Condon, McKinlay, Brink, Leverkus, Tergaonkar, Schneider, Callus, Koentgen, Vaux, Silke, "IAP Antagonists Target cIAP1 to Induce TNFα-Dependent Apoptosis", Cell, 131(4):682-693, 2007.

Volpert, Lawler, Bouck, "A human fibrosarcoma inhibits systemic angiogenesis and the growth of experimental metastases via thrombospondin-1," Proc. Natl . Acad . Sci . USA , 95(11):6343-6348, 1998.

Vukanovic, Passaniti, Hirata, Traystman, Hartley-Asp, Isaacs, "Antiangiogenic effects of the quinoline-3-carboxamide linomide," Cancer Res., 53(8):183301837, 1993.

Waltenberger, Claesson-Welsh, Siegbahn, Shibuya, Heldin, "Different signal transduction properties of KDR and Flt1, two receptors for vascular endothelial growth facotr," J. Biol . Chem ., 269(43):26988-26995, 1994.

Waltenberger, Mayr, Pentz, Hombach, "Functional upregulation of the vascular endothelial growth factor receptor KDR by hopoxia." Circulation , 94:1647-1654, 1996.

Waltenberger, Mayr, Frank, Hombach, "Suramin is a potent inhibitor of vascular endothelial growth factor. A contribution to the molecular basis of its antiangiogenic action," J. Mol . Cell Cardiol ., 28(7):1523-1529, 1996.

Wamil, Thurman, Sundell, DeVore, Wakefield, Johnson, Wang, Hellerqvist, "Soluble E-selectin in cancer patients as a marker of the therapeutic efficacy of CM101, a tumor-inhibiting anti-neovascularization agent, evaluated in phase I clinical trail," J. Cancer Res . Clin . Oncol ., 123(3):173-179, 1997.

Ward, Gussow, Griffiths, Jones, Winter, "Binding Activities of a Repertoire of Single Immunoglobulin Variable Domains Secreted from Escherichia Coli", Nature , 341(6242):544-546, 1989.

Wells, "Starving cancer into submission", Chem . Biol ., 5(4):R87-88, 1998.

Whitehurst, Flister, Bagaitkar, Volk, Bivens, Pickett, Castro-Rivera, Brekken, Gerard, Ran, "Anti-VEGF-A therapy reduces lymphatic vessel density and expression of VEGFR-3 in an orthotopic breast tumor model", Int . J. Cancer, 121(10):2181-91, 2007.

Wiesmann, Fuh, Christinger, Eigenbrot, Wells, de Vos, "Crystal structure at 1.7A resolution of VEGF in complex with domain 2 of the Flt-1 receptor," Cell , 91(5):695-704, 1997.

Willman et al ., "Prodrugs in cancer therapy", Biochem . Soc . Trans ., 14:375-382, 1998.

Winter and Milstein, "Man-made antibodies," Nature , 349:293-299, 1991.

Wolff, Guerin, Laterra, Bressler, Indurti, Brem, Goldstein, "Dexamethasone inhibits glioma-induced formation of capillary like structure in vitro and angiogenesis in vivo," Klin , Padiatr ., 209(4):275-277, 1997.

Wyckoff, Wang, Lin, Wang, Pixley, Stanley, Graf, Pollard, Segall and Condeelis, "A Paracrine Loop Between Tumor Cells and Macrophages is Required for Tumor Cell Migration in Mammary Tumors", Cancer Res., 64:7022-7029, 2004.

Xie, Chen, Fu, Harter, Young, Sunkara, Vovak, Villanueva-Siles, Ratech, "Podoplanin(d2-40): a new immunohistochemical marker for reactive follicular dendritic cells and follicular dendritic cell sarcomas", Int . J. Clin , Exp . Pathol., 1(3):276-84, 2008.

Yoon, Yoo, Choi, Do, Kang, Lee, Azuma, Kim, "Inhibitory effect of Korean mistletoe(Viscum album coloratum) extract on tumour angiogenesis and metastasis of haematogenous and non-haematogenous tumour cells in mice," Cancer Lett , 97(1):83-91, 1995.

Yoshida, Kaneko, Tsukamoto, Han, Ichinose, Kimura, "Suppression of hepatoma growth and angiogenesis by a fumagillin derivative TNP470: possible involvement of nitric oxide synthase," Cancer Res ., 58(16):3751-3756, 1998.

Young, Mackenzie, Narang, Oomen and Baenziger, "Thermal Stabilization of a Single-Chain Fv Antibody Fragment by Introduction of a Disulphide Bond", FEBS Letters , 16396(377):135-139, 1995.

Yamamura, Kibbey, Jun, Kleinman, "Effect of Matrigel and laminin peptide YIGSR on tumor growth and metastasis," Semin , Cancer Biol ., 4(4):259-265:1993.

Zachary, "Vascular endothelial growth factor: how it transmits its signal," Exp . Nephrol ., 6(6):480-487, 1998.

Zambryski, Herrera-Estreila, DeBlock, Van Montagu, Schell "Genetic Engineering, Principles and Methods", Hollaender and Setlow ( eds .), Vol. VI, pp.253-278. Plenum Press, New York, 1984.

Zapata, Ridgway, Mordenti, Osaka, Wong, Bennett, Carter, "Engineering Linear F(Ab')2 Fragments For Efficient Production in Escherichia Coli and Enhanced Antiproliferative Activity", Protein Eng ., 8(10):1057-1062, 1995.

Zhang, Gildersleeve, Yang, Xu, Loo, Uryu, Wong, Schultz, "A New Strategy for the Synthesis of Glycoproteins", Science, 303(5656):371-373, 2004.

Ziche, Donnini, Morbidelli, Parenti, Gasparini, Ledda, "Linomide blocks angiogenesis by breast carcinoma vascular endothelial growth factor transfectants," Br . J. Cancer , 77(7):1123-1129, 1998.

Zou, Anisowicz, Hendrix, Thor, Neveu, Sheng, Rafidi, Seftor, Sanger, "Maspin, a serpin with tunor-suppressing activity in human mammary epithelial cells", Science , 28:263(5146):526-9, 1994.

<110> Affitech AS Peregrine Pharmaceuticals, Inc. <120> Anti-VEGF Antibody Compositions and Methods <130> PI13-0121 <150> US 60/987,015 <151> 2007-11-09 <150> US 61/106,047 <151> 2008-10-16 <150> US 61/108,023 <151> 2008-10-24 <160> 34 <170> KopatentIn 1.71 <210> 1 <211> 378 <212> DNA <213> Artificial Sequence <220> <223> antibody VH domain <400> 1 caggtgcagc tggtgcaatc tggggctgag gtgaagaagc ctggggcctc agtgaaggtc 60 tcctgcaagg cttctggagg caccttcagc agctatgcta tcagctgggt gcgacaggcc 120 cctggacaag ggcttgagtg gatgggaggt tttgatcctg aagatggtga aacaatctac 180 gcacagaagt tccagggcag agtcaccatg accgaggaca catctacaga cacagcctac 240 atggagctga gcagcctgag atctgaggac acggccgtgt attactgtgc aacaggacgt 300 tctatggttc ggggagtcat tatacctttt aacggtatgg acgtctgggg ccaagggacc 360 acggtcaccg tctcctca 378 <210> 2 <211> 321 <212> DNA <213> Artificial Sequence <220> <223> antibody VL domain <400> 2 gacatccgga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagagtcacc 60 atcacttgcc gggcaagtca gagcattagc agctatttaa attggtatca gcagaaacca 120 gggaaagccc ctaagctcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatca 180 aggttcagtg gcagtggatc tgggacagat ttcactctca ccatcagcag tctgcaacct 240 gaagattttg caacttacta ctgtcaacag agttacagta ccccgctcac tttcggcgga 300 gggaccaagg tggagatcaa a 321 <210> 3 <211> 126 <212> PRT <213> Artificial Sequence <220> <223> antibody VH domain <400> 3 Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Gly Thr Phe Ser Ser Tyr 20 25 30 Ala Ile Ser Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly Gly Phe Asp Pro Glu Asp Gly Glu Thr Ile Tyr Ala Gln Lys Phe 50 55 60 Gln Gly Arg Val Thr Met Thr Glu Asp Thr Ser Thr Asp Thr Ala Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Thr Gly Arg Ser Met Val Arg Gly Val Ile Ile Pro Phe Asn Gly 100 105 110 Met Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser 115 120 125 <210> 4 <211> 107 <212> PRT <213> Artificial Sequence <220> <223> antibody VL domain <400> 4 Asp Ile Arg Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Tyr 20 25 30 Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro 65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Tyr Ser Thr Pro Leu 85 90 95 Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 105 <210> 5 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> antibody VH CDR1 <400> 5 Ser Tyr Ala Ile Ser 1 5 <210> 6 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> antibody VH CDR2 <400> 6 Gly Phe Asp Pro Glu Asp Gly Glu Thr Ile Tyr Ala Gln Lys Phe Gln 1 5 10 15 Gly <210> 7 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> antibody VH CDR3 <400> 7 Gly Arg Ser Met Val Arg Gly Val Ile Ile Pro Phe Asn Gly Met Asp 1 5 10 15 Val <210> 8 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> antibody VL CDR1 <400> 8 Arg Ala Ser Gln Ser Ile Ser Ser Tyr Leu Asn 1 5 10 <210> 9 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> antibody VL CDR2 <400> 9 Ala Ala Ser Ser Leu Gln Ser 1 5 <210> 10 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> antibody VL CDR3 <400> 10 Gln Gln Ser Tyr Ser Thr Pro Leu Thr 1 5 <210> 11 <211> 30 <212> PRT <213> Artificial Sequence <220> <223> antibody VH FR1 <400> 11 Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Gly Thr Phe Ser 20 25 30 <210> 12 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> antibody VH FR2 <400> 12 Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met Gly 1 5 10 <210> 13 <211> 32 <212> PRT <213> Artificial Sequence <220> <223> antibody VH FR3 <400> 13 Arg Val Thr Met Thr Glu Asp Thr Ser Thr Asp Thr Ala Tyr Met Glu 1 5 10 15 Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Thr 20 25 30 <210> 14 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> antibody VH FR4 <400> 14 Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser 1 5 10 <210> 15 <211> 23 <212> PRT <213> Artificial Sequence <220> <223> antibody VL FR1 <400> 15 Asp Ile Arg Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys 20 <210> 16 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> antibody VL FR2 <400> 16 Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr 1 5 10 15 <210> 17 <211> 32 <212> PRT <213> Artificial Sequence <220> <223> antibody VL FR3 <400> 17 Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr 1 5 10 15 Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys 20 25 30 <210> 18 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> antibody VL FR4 <400> 18 Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 1 5 10 <210> 19 <211> 21 <212> PRT <213> Artificial Sequence <220> <223> linker <400> 19 Lys Leu Ser Gly Ser Ala Ser Ala Pro Lys Leu Glu Glu Gly Glu Phe 1 5 10 15 Ser Glu Ala Arg Val 20 <210> 20 <211> 762 <212> DNA <213> Artificial Sequence <220> <223> Whole scFv clone <400> 20 caggtgcagc tggtgcaatc tggggctgag gtgaagaagc ctggggcctc agtgaaggtc 60 tcctgcaagg cttctggagg caccttcagc agctatgcta tcagctgggt gcgacaggcc 120 cctggacaag ggcttgagtg gatgggaggt tttgatcctg aagatggtga aacaatctac 180 gcacagaagt tccagggcag agtcaccatg accgaggaca catctacaga cacagcctac 240 atggagctga gcagcctgag atctgaggac acggccgtgt attactgtgc aacaggacgt 300 tctatggttc ggggagtcat tatacctttt aacggtatgg acgtctgggg ccaagggacc 360 acggtcaccg tctcctcaaa gctttcaggg agtgcatccg ccccaaaact tgaagaaggt 420 gaattttcag aagcacgcgt agacatccgg atgacccagt ctccatcctc cctgtctgca 480 tctgtaggag acagagtcac catcacttgc cgggcaagtc agagcattag cagctattta 540 aattggtatc agcagaaacc agggaaagcc cctaagctcc tgatctatgc tgcatccagt 600 ttgcaaagtg gggtcccatc aaggttcagt ggcagtggat ctgggacaga tttcactctc 660 accatcagca gtctgcaacc tgaagatttt gcaacttact actgtcaaca gagttacagt 720 accccgctca ctttcggcgg agggaccaag gtggagatca aa 762 <210> 21 <211> 254 <212> PRT <213> Artificial Sequence <220> <223> whole scFv clone <400> 21 Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Gly Thr Phe Ser Ser Tyr 20 25 30 Ala Ile Ser Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly Gly Phe Asp Pro Glu Asp Gly Glu Thr Ile Tyr Ala Gln Lys Phe 50 55 60 Gln Gly Arg Val Thr Met Thr Glu Asp Thr Ser Thr Asp Thr Ala Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Thr Gly Arg Ser Met Val Arg Gly Val Ile Ile Pro Phe Asn Gly 100 105 110 Met Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser Lys Leu 115 120 125 Ser Gly Ser Ala Ser Ala Pro Lys Leu Glu Glu Gly Glu Phe Ser Glu 130 135 140 Ala Arg Val Asp Ile Arg Met Thr Gln Ser Pro Ser Ser Leu Ser Ala 145 150 155 160 Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile 165 170 175 Ser Ser Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys 180 185 190 Leu Leu Ile Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg 195 200 205 Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser 210 215 220 Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Tyr Ser 225 230 235 240 Thr Pro Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 245 250 <210> 22 <211> 1977 <212> DNA <213> Artificial Sequence <220> <223> IgG heavy chain <400> 22 caggtacagc ttgtgcagtc cggagccgag gtgaagaaac ccggagcatc agtgaaggtt 60 agctgcaagg catctggtgg gacattttcc tcctatgcca tctcctgggt tcggcaggct 120 cccggacagg gcctggagtg gatggggggg ttcgatcccg aagacggaga gaccatttac 180 gcacagaagt ttcagggtcg cgtgaccatg accgaggata cttctaccga cacagcatat 240 atggagctca gtagcttgcg ctccgaggac acggctgtat attactgtgc cactggacgg 300 agcatggtgc gcggggtaat catccctttc aacgggatgg atgtatgggg ccaagggacc 360 accgtgacag tcagctctgc ctccaccaag ggcccatcgg tcttccccct ggcaccctcc 420 tccaagagca cctctggggg cacagcggcc ctgggctgcc tggtcaagga ctacttcccc 480 gaaccggtga cggtgtcgtg gaactcaggc gccctgacca gcggcgtgca caccttcccg 540 gctgtcctac agtcctcagg actctactcc ctcagcagcg tggtgaccgt gccctccagc 600 agcttgggca cccagaccta catctgcaac gtgaatcaca agcccagcaa caccaaggtg 660 gacaagaaag ttggtgagag gccagcacag ggagggaggg tgtctgctgg aagccaggct 720 cagcgctcct gcctggacgc atcccggcta tgcagcccca gtccagggca gcaaggcagg 780 ccccgtctgc ctcttcaccc ggaggcctct gcccgcccca ctcatgctca gggagagggt 840 cttctggctt tttccccagg ctctgggcag gcacaggcta ggtgccccta acccaggccc 900 tgcacacaaa ggggcaggtg ctgggctcag acctgccaag agccatatcc gggaggaccc 960 tgcccctgac ctaagcccac cccaaaggcc aaactctcca ctccctcagc tcggacacct 1020 tctctcctcc cagattccag taactcccaa tcttctctct gcagagccca aatcttgtga 1080 caaaactcac acatgcccac cgtgcccagg taagccagcc caggcctcgc cctccagctc 1140 aaggcgggac aggtgcccta gagtagcctg catccaggga caggccccag ccgggtgctg 1200 acacgtccac ctccatctct tcctcagcac ctgaactcct ggggggaccg tcagtcttcc 1260 tcttcccccc aaaacccaag gacaccctca tgatctcccg gacccctgag gtcacatgcg 1320 tggtggtgga cgtgagccac gaagaccctg aggtcaagtt caactggtac gtggacggcg 1380 tggaggtgca taatgccaag acaaagccgc gggaggagca gtacaacagc acgtaccgtg 1440 tggtcagcgt cctcaccgtc ctgcaccagg actggctgaa tggcaaggag tacaagtgca 1500 aggtctccaa caaagccctc ccagccccca tcgagaaaac catctccaaa gccaaaggtg 1560 ggacccgtgg ggtgcgaggg ccacatggac agaggccggc tcggcccacc ctctgccctg 1620 agagtgaccg ctgtaccaac ctctgtccct acagggcagc cccgagaacc acaggtgtac 1680 accctgcccc catcccggga tgagctgacc aagaaccagg tcagcctgac ctgcctggtc 1740 aaaggcttct atcccagcga catcgccgtg gagtgggaga gcaatgggca gccggagaac 1800 aactacaaga ccacgcctcc cgtgctggac tccgacggct ccttcttcct ctacagcaag 1860 ctcaccgtgg acaagagcag gtggcagcag gggaacgtct tctcatgctc cgtgatgcat 1920 gaggctctgc acaaccacta cacgcagaag agcctctccc tgtctccggg taaatag 1977 <210> 23 <211> 645 <212> DNA <213> Artificial Sequence <220> <223> IgG light chain <400> 23 gacattcgga tgactcagtc tccctcctct ttgagcgctt ctgtgggcga tagggttact 60 atcacttgtc gagcctctca atccatcagc tcctacttga actggtacca gcagaaaccc 120 gggaaagcac ccaagctgct tatttacgcc gcctcctccc tgcaatccgg agtgccctcc 180 cggttcagcg gctccggctc tggaacagac tttaccctga ccatttcttc tttgcagcct 240 gaggattttg ctacttacta ctgtcagcag agttactcca cccctttgac attcggtggt 300 ggaacgaaag tagaaattaa gcgtacggtg gctgcaccat ctgtcttcat cttcccgcca 360 tctgatgagc agttgaaatc tggaactgcc tctgttgtgt gcctgctgaa taacttctat 420 cccagagagg ccaaagtaca gtggaaggtg gataacgccc tccaatcggg taactcccag 480 gagagtgtca cagagcagga cagcaaggac agcacctaca gcctcagcag caccctgacg 540 ctgagcaaag cagactacga gaaacacaaa gtctacgcct gcgaagtcac ccatcagggc 600 ctgagctcgc ccgtcacaaa gagcttcaac aggggagagt gttag 645 <210> 24 <211> 456 <212> PRT <213> Artificial Sequence <220> <223> IgG heavy chain <400> 24 Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Gly Thr Phe Ser Ser Tyr 20 25 30 Ala Ile Ser Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly Gly Phe Asp Pro Glu Asp Gly Glu Thr Ile Tyr Ala Gln Lys Phe 50 55 60 Gln Gly Arg Val Thr Met Thr Glu Asp Thr Ser Thr Asp Thr Ala Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Thr Gly Arg Ser Met Val Arg Gly Val Ile Ile Pro Phe Asn Gly 100 105 110 Met Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser Ala Ser 115 120 125 Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr 130 135 140 Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro 145 150 155 160 Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val 165 170 175 His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser 180 185 190 Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile 195 200 205 Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val 210 215 220 Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala 225 230 235 240 Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro 245 250 255 Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val 260 265 270 Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 275 280 285 Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln 290 295 300 Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln 305 310 315 320 Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 325 330 335 Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro 340 345 350 Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr 355 360 365 Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser 370 375 380 Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr 385 390 395 400 Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr 405 410 415 Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe 420 425 430 Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 435 440 445 Ser Leu Ser Leu Ser Pro Gly Lys 450 455 <210> 25 <211> 214 <212> PRT <213> Artificial Sequence <220> <223> IgG light chain <400> 25 Asp Ile Arg Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Tyr 20 25 30 Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro 65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Tyr Ser Thr Pro Leu 85 90 95 Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala 100 105 110 Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125 Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140 Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln 145 150 155 160 Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170 175 Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185 190 Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser 195 200 205 Phe Asn Arg Gly Glu Cys 210 <210> 26 <211> 378 <212> DNA <213> Artificial Sequence <220> <223> IgG VH domain <400> 26 caggtacagc ttgtgcagtc cggagccgag gtgaagaaac ccggagcatc agtgaaggtt 60 agctgcaagg catctggtgg gacattttcc tcctatgcca tctcctgggt tcggcaggct 120 cccggacagg gcctggagtg gatggggggg ttcgatcccg aagacggaga gaccatttac 180 gcacagaagt ttcagggtcg cgtgaccatg accgaggata cttctaccga cacagcatat 240 atggagctca gtagcttgcg ctccgaggac acggctgtat attactgtgc cactggacgg 300 agcatggtgc gcggggtaat catccctttc aacgggatgg atgtatgggg ccaagggacc 360 accgtgacag tcagctct 378 <210> 27 <211> 321 <212> DNA <213> Artificial Sequence <220> <223> IgG VL domain <400> 27 gacattcgga tgactcagtc tccctcctct ttgagcgctt ctgtgggcga tagggttact 60 atcacttgtc gagcctctca atccatcagc tcctacttga actggtacca gcagaaaccc 120 gggaaagcac ccaagctgct tatttacgcc gcctcctccc tgcaatccgg agtgccctcc 180 cggttcagcg gctccggctc tggaacagac tttaccctga ccatttcttc tttgcagcct 240 gaggattttg ctacttacta ctgtcagcag agttactcca cccctttgac attcggtggt 300 ggaacgaaag tagaaattaa g 321 <210> 28 <211> 78 <212> DNA <213> Artificial Sequence <220> <223> c-myc and His tag <400> 28 gcggccgctg gatccgaaca aaagctgatc tcagaagaag acctaaactc acatcaccat 60 caccatcact aatctaga 78 <210> 29 <211> 23 <212> PRT <213> Artificial Sequence <220> <223> c-myc and His tag <220> <221> SITE <222> (6)..(15) <223> c-myc epitope tag <220> <221> SITE <222> (18)..(23) <223> His epitope tag <400> 29 Ala Ala Ala Gly Ser Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu Asn 1 5 10 15 Ser His His His His His His 20 <210> 30 <211> 778 <212> DNA <213> Artificial Sequence <220> <223> whole scFv clone inclusive NcoI and NotI restriction sites <400> 30 ccatggccca ggtgcagctg gtgcaatctg gggctgaggt gaagaagcct ggggcctcag 60 tgaaggtctc ctgcaaggct tctggaggca ccttcagcag ctatgctatc agctgggtgc 120 gacaggcccc tggacaaggg cttgagtgga tgggaggttt tgatcctgaa gatggtgaaa 180 caatctacgc acagaagttc cagggcagag tcaccatgac cgaggacaca tctacagaca 240 cagcctacat ggagctgagc agcctgagat ctgaggacac ggccgtgtat tactgtgcaa 300 caggacgttc tatggttcgg ggagtcatta taccttttaa cggtatggac gtctggggcc 360 aagggaccac ggtcaccgtc tcctcaaagc tttcagggag tgcatccgcc ccaaaacttg 420 aagaaggtga attttcagaa gcacgcgtag acatccggat gacccagtct ccatcctccc 480 tgtctgcatc tgtaggagac agagtcacca tcacttgccg ggcaagtcag agcattagca 540 gctatttaaa ttggtatcag cagaaaccag ggaaagcccc taagctcctg atctatgctg 600 catccagttt gcaaagtggg gtcccatcaa ggttcagtgg cagtggatct gggacagatt 660 tcactctcac catcagcagt ctgcaacctg aagattttgc aacttactac tgtcaacaga 720 gttacagtac cccgctcact ttcggcggag ggaccaaggt ggagatcaaa gcggccgc 778 <210> 31 <211> 1368 <212> DNA <213> Artificial Sequence <220> <223> chimeric heavy chain <400> 31 caggtgcagc tggtgcaatc tggggctgag gtgaagaagc ctggggcctc agtgaaggtc 60 tcctgcaagg cttctggagg caccttcagc agctatgcta tcagctgggt gcgacaggcc 120 cctggacaag ggcttgagtg gatgggaggt tttgatcctg aagatggtga aacaatctac 180 gcacagaagt tccagggcag agtcaccatg accgaggaca catctacaga cacagcctac 240 atggagctga gcagcctgag atctgaggac acggccgtgt attactgtgc aacaggacgt 300 tctatggttc ggggagtcat tatacctttt aacggtatgg acgtctgggg ccaagggacc 360 acggtcaccg tctcctcacg cgccgatgct gcaccgactg tctatccact ggcccctgtg 420 tgtggagata caactggctc ctcggtgact ctaggatgcc tggtcaaggg ttatttccct 480 gagccagtga ccttgacctg gaactctgga tccctgtcca gtggtgtgca caccttccca 540 gctgtcctgc agtctgacct ctacaccctc agcagctcag tgactgtaac ctcgagcacc 600 tggcccagcc agtccatcac ctgcaatgtg gcccacccgg caagcagcac caaggtggac 660 aagaaagagc ccagagggcc cacaatcaag ccctgtcctc catgcaaatg cccagcacct 720 aacctcttgg gtggaccatc cgtcttcatc ttccctccaa agatcaagga tgtactcatg 780 atctccctga gccccatagt cacatgtgtg gtggtggatg tgagcgagga tgacccagat 840 gtccagatca gctggtttgt gaacaacgtg gaagtacaca cagctcagac acaaacccat 900 agagaggatt acaacagtac tctccgggtg gtcagtgccc tccccatcca gcaccaggac 960 tggatgagtg gcaaggagtt caaatgcaag gtcaacaaca aagacctccc agcgcccatc 1020 gagagaacca tctcaaaacc caaagggtca gtaagagctc cacaggtata tgtcttgcct 1080 ccaccagaag aagagatgac taagaaacag gtcactctga cctgcatggt cacagacttc 1140 atgcctgaag acatttacgt ggagtggacc aacaacggga aaacagagct aaactacaag 1200 aacactgaac cagtcctgga ctctgatggt tcttacttca tgtacagcaa gctgagagtg 1260 gaaaagaaga actgggtgga aagaaatagc tactcctgtt cagtggtcca cgagggtctg 1320 cacaatcacc acacgactaa gagcttctcc cggactccgg gtaaatga 1368 <210> 32 <211> 455 <212> PRT <213> Artificial Sequence <220> <223> chimeric heavy chain <400> 32 Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Gly Thr Phe Ser Ser Tyr 20 25 30 Ala Ile Ser Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly Gly Phe Asp Pro Glu Asp Gly Glu Thr Ile Tyr Ala Gln Lys Phe 50 55 60 Gln Gly Arg Val Thr Met Thr Glu Asp Thr Ser Thr Asp Thr Ala Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Thr Gly Arg Ser Met Val Arg Gly Val Ile Ile Pro Phe Asn Gly 100 105 110 Met Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser Arg Ala 115 120 125 Asp Ala Ala Pro Thr Val Tyr Pro Leu Ala Pro Val Cys Gly Asp Thr 130 135 140 Thr Gly Ser Ser Val Thr Leu Gly Cys Leu Val Lys Gly Tyr Phe Pro 145 150 155 160 Glu Pro Val Thr Leu Thr Trp Asn Ser Gly Ser Leu Ser Ser Gly Val 165 170 175 His Thr Phe Pro Ala Val Leu Gln Ser Asp Leu Tyr Thr Leu Ser Ser 180 185 190 Ser Val Thr Val Thr Ser Ser Thr Trp Pro Ser Gln Ser Ile Thr Cys 195 200 205 Asn Val Ala His Pro Ala Ser Ser Thr Lys Val Asp Lys Lys Glu Pro 210 215 220 Arg Gly Pro Thr Ile Lys Pro Cys Pro Pro Cys Lys Cys Pro Ala Pro 225 230 235 240 Asn Leu Leu Gly Gly Pro Ser Val Phe Ile Phe Pro Pro Lys Ile Lys 245 250 255 Asp Val Leu Met Ile Ser Leu Ser Pro Ile Val Thr Cys Val Val Val 260 265 270 Asp Val Ser Glu Asp Asp Pro Asp Val Gln Ile Ser Trp Phe Val Asn 275 280 285 Asn Val Glu Val His Thr Ala Gln Thr Gln Thr His Arg Glu Asp Tyr 290 295 300 Asn Ser Thr Leu Arg Val Val Ser Ala Leu Pro Ile Gln His Gln Asp 305 310 315 320 Trp Met Ser Gly Lys Glu Phe Lys Cys Lys Val Asn Asn Lys Asp Leu 325 330 335 Pro Ala Pro Ile Glu Arg Thr Ile Ser Lys Pro Lys Gly Ser Val Arg 340 345 350 Ala Pro Gln Val Tyr Val Leu Pro Pro Pro Glu Glu Glu Met Thr Lys 355 360 365 Lys Gln Val Thr Leu Thr Cys Met Val Thr Asp Phe Met Pro Glu Asp 370 375 380 Ile Tyr Val Glu Trp Thr Asn Asn Gly Lys Thr Glu Leu Asn Tyr Lys 385 390 395 400 Asn Thr Glu Pro Val Leu Asp Ser Asp Gly Ser Tyr Phe Met Tyr Ser 405 410 415 Lys Leu Arg Val Glu Lys Lys Asn Trp Val Glu Arg Asn Ser Tyr Ser 420 425 430 Cys Ser Val Val His Glu Gly Leu His Asn His His Thr Thr Lys Ser 435 440 445 Phe Ser Arg Thr Pro Gly Lys 450 455 <210> 33 <211> 642 <212> DNA <213> Artificial Sequence <220> <223> chimeric light chain <400> 33 gatatcagga tgacgcagag tccaagctct ctgtctgcct ctgtggggga cagggtgact 60 attacttgtc gggcatcaca gagtatctcc agctacctta attggtacca gcaaaagccc 120 ggcaaagccc ccaaattgct gatttacgca gccagctccc ttcagtctgg cgtccctagc 180 cgcttctccg ggagcggatc aggcacagac tttacgttga caatcagttc tctgcagccg 240 gaggattttg ccacttacta ctgtcaacag agctacagta cgcctctcac gtttggcggt 300 gggacaaagg tggaaatcaa acgggctgat gctgcaccga ctgtgtccat cttcccacca 360 tccagtgagc agttaacatc tggaggtgcc tcagtcgtgt gcttcttgaa caacttctac 420 cccaaagaca tcaatgtcaa gtggaagatt gatggcagtg aacgacaaaa tggcgtcctg 480 aacagttgga ctgatcagga cagcaaagac agcacctaca gcatgagcag caccctcacg 540 ttgaccaagg acgagtatga acgacataac agctatacct gtgaggccac tcacaagaca 600 tcaacttcac ccattgtcaa gagcttcaac aggaatgagt gt 642 <210> 34 <211> 214 <212> PRT <213> Artificial Sequence <220> <223> chimeric light chain <400> 34 Asp Ile Arg Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Tyr 20 25 30 Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro 65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Tyr Ser Thr Pro Leu 85 90 95 Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Ala Asp Ala Ala 100 105 110 Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly 115 120 125 Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile 130 135 140 Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu 145 150 155 160 Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser 165 170 175 Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr 180 185 190 Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser 195 200 205 Phe Asn Arg Asn Glu Cys 210

Claims (60)

  1. VEGF에 결합하며, 세개의 CDRs를 포함하는 적어도 하나의 중쇄 가변 영역(heavy chain variable region) 및 세개의 CDRs를 포함하는 적어도 하나의 경쇄 가변 영역(light chain varilable region)을 포함하는 분리된 항체에 있어서,
    상기 경쇄 가변 영역은
    (a) SEQ ID NO:8의 아미노산 서열을 가지는 가변성 경쇄 CDR1;
    (b) SEQ ID NO:9의 아미노산 서열을 가지는 가변성 경쇄 CDR2; 및
    (c) SEQ ID NO:10의 아미노산 서열을 가지는 가변성 경쇄 CDR3을 포함하며,
    상기 중쇄 가변 영역은
    (a) SEQ ID NO:5의 아미노산 서열을 가지는 가변성 중쇄 CDR1,
    (b) SEQ ID NO:6의 아미노산 서열을 가지는 가변성 중쇄 CDR2, 및
    (c) SEQ ID NO:7의 아미노산 서열을 가지는 가변성 중쇄 CDR3을 포함하는 분리된 항체.
  2. 제1항에 있어서,
    상기 경쇄 가변 영역은 SEQ ID NO:4의 아미노산 서열을 가지는 것을 특징으로 하는 분리된 항체.
  3. 제1항에 있어서,
    상기 중쇄 가변 영역은 SEQ ID NO:3의 아미노산 서열을 가지는 것을 특징으로 하는 분리된 항체.
  4. 제1항에 있어서,
    상기 경쇄 가변 영역은 SEQ ID NO:4의 아미노산 서열을 가지고,
    상기 중쇄 가변 영역은 SEQ ID NO:3의 아미노산 서열을 가지는 것을 특징으로 하는 분리된 항체.
  5. 제1항에 있어서,
    상기 항체는 SEQ ID NO:21의 아미노산 서열을 포함하는 것을 특징으로 하는 분리된 항체.
  6. 제1항에 있어서,
    상기 항체는 전 인간 항체(fully human antibody)인 것을 특징으로 하는 분리된 항체.
  7. 제1항에 있어서,
    상기 항체는 항체 불변 영역(antibody constant region)을 포함하는 완전 항체(whole antibody)인 것을 특징으로 하는 분리된 항체.
  8. 제7항에 있어서,
    상기 항체는 IgG 항체인 것을 특징으로 하는 분리된 항체.
  9. 제7항에 있어서,
    상기 항체는 SEQ ID NO:24의 아미노산 서열을 가지는 중쇄 및 SEQ ID NO:25의 아미노산 서열을 가지는 경쇄를 포함하는 것을 특징으로 하는 분리된 항체.
  10. 제1항에 있어서,
    상기 항체는 항체의 항원 결합 단편(antigen binding fragment)인 것을 특징으로 하는 분리된 항체.
  11. 제10항에 있어서,
    상기 항체의 항원 결합 단편은 Fab, Fab', F(ab')2, scFv, Fv, dsFv, ds-scFv, Fd, DAB, TandAb 이량체(TandAb dimer), 선형 항체(linear antibody), 미니항체(minibody), 2가 항체(dibody) 또는 이중 특이성 항체 단편(bispecific antibody fragment)인 것을 특징으로 하는 분리된 항체.
  12. 제1항에 있어서,
    상기 항체는 10nM 보다 적은 Kd와 일치하는 VEGF에 대한 결합 친화력을 가지는 IgG 항체인 것을 특징으로 하는 분리된 항체.
  13. 삭제
  14. 삭제
  15. 삭제
  16. 제1항에 있어서,
    상기 항체는 VEGF에 결합하며, VEGF 수용체 VEGFR1(Flt-1)에 결합하는 VEGF를 현저하게 억제하는 일 없이 VEGF 수용체 VEGFR2(KDR/Flk-1)에 결합하는 VEGF를 현저하게 억제하는 것을 특징으로 하는 분리된 항체.
  17. 제1항에 있어서,
    상기 항체는 적어도 인간 VEGF 및 마우스 VEGF에 결합하는 것을 특징으로 하는 분리된 항체.
  18. VEGF에 결합하는 분리된 항체에 있어서,
    항체가 IgG 형식일 경우 10nM 보다 적은 Kd와 일치하는 VEGF에 대한 결합 친화력을 가지고,
    상기 항체는 세개의 CDRs를 포함하는 적어도 하나의 중쇄 가변 영역 및 세개의 CDRs를 포함하는 적어도 하나의 경쇄 가변 영역을 포함하며,
    상기 경쇄 가변 영역은
    (a) SEQ ID NO:8의 아미노산 서열을 가지는 가변성 경쇄 CDR1,
    (b) SEQ ID NO:9의 아미노산 서열을 가지는 가변성 경쇄 CDR2, 및
    (c) SEQ ID NO:10의 아미노산 서열을 가지는 가변성 경쇄 CDR3을 포함하고,
    상기 중쇄 가변 영역은
    (a) SEQ ID NO:5의 아미노산 서열을 가지는 가변성 중쇄 CDR1,
    (b) SEQ ID NO:6의 아미노산 서열을 가지는 가변성 중쇄 CDR2, 및
    (c) SEQ ID NO:7의 아미노산 서열을 가지는 가변성 중쇄 CDR3을 포함하는 분리된 항체.
  19. 적어도 제1의 치료제 또는 진단제에 부착된 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체를 포함하는 면역접합체.
  20. 적어도 제1의 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항에 따른 항체 또는 그것의 면역접합체를 포함하는 조성물.
  21. 적어도 제1의 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항에 따른 항체 또는 그것의 면역접합체를 포함하는, 신생혈관형성 또는 림프관형성을 억제하기 위한 약제학적 조성물.
  22. 제21항에 있어서,
    상기 조성물은 적어도 제2의 치료제를 더 포함하는 것을 특징으로 하는 약제학적 조성물.
  23. 제22항에 있어서,
    상기 제2의 치료제는 화학 치료제(chemotherapeutic agent)인 것을 특징으로 하는 약제학적 조성물.
  24. 제23항에 있어서,
    상기 적어도 제2의 치료제는 피리미딘 유사체(pyrimidine analogs), 백금 배위 착물(platinum coordination complexes), 캄토테신(camptothecins), 티로신 키나아제 억제제(tyrosine kinase inhibitors) 및 티로신 키나아제 수용체의 억제제로 이루어지는 군으로부터 선택되는 것을 특징으로 하는 약제학적 조성물.
  25. 제24항에 있어서,
    상기 적어도 제2의 치료제는 5-플루오로우라실(5-fluorouracil), 카페시타빈(capecitabine), 옥살리플라틴(oxaliplatin), 시스플라틴(cisplatin), 카르보플라틴(carboplatin), 이리노테칸(irinotecan), 악시티닙(axitinib), 수니티닙(sunitinib) 또는 파클리탁셀(paclitaxel)인 것을 특징으로 하는 약제학적 조성물.
  26. 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체를 암호화하는 뉴클레오티드 서열 영역을 포함하는 핵산 분자.
  27. 제26항에 있어서,
    상기 뉴클레오티드 서열 영역은 SEQ ID NO:21의 아미노산 서열을 가지는 항체를 암호화하는 것을 특징으로 하는 핵산 분자.
  28. 제27항에 있어서,
    상기 뉴클레오티드 서열 영역은 SEQ ID NO:20의 뉴클레오티드 서열을 가지는 것을 특징으로 하는 핵산 분자.
  29. 제26항에 있어서,
    상기 뉴클레오티드 서열 영역은 SEQ ID NO:24의 아미노산 서열을 가지는 중쇄 및 SEQ ID NO:25의 아미노산 서열을 가지는 경쇄를 포함하는 항체를 암호화하는 것을 특징으로 하는 핵산 분자.
  30. 제29항에 있어서,
    상기 SEQ ID NO:24를 암호화하는 뉴콜레오티드 서열 영역은 SEQ ID NO:22의 뉴클레오티드 서열을 가지고, 상기 SEQ ID NO:25를 암호화하는 뉴클레오티드 서열 영역은 SEQ ID NO:23의 뉴클레오티드 서열을 가지는 것을 특징으로 하는 핵산 분자.
  31. 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체를 암호화하는 뉴클레오티드 서열 영역을 포함하는 핵산 분자를 포함하는 발현 벡터.
  32. 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체를 암호화하는 뉴클레오티드 서열 영역을 포함하는 핵산 분자 또는 이 핵산분자를 포함하는 발현 벡터를 포함하는 숙주 세포.
  33. 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체를 암호화하는 뉴클레오티드 서열 영역을 포함하는 핵산 분자 또는 이 핵산분자를 포함하는 발현 벡터를 포함하는 바이러스.
  34. 적어도 제1의 용기에
    제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체,
    적어도 제1의 치료제 또는 진단제에 부착된 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체를 포함하는 면역접합체,
    적어도 제1의 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항에 따른 항체 또는 그것의 면역접합체를 포함하는 조성물,
    제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체를 암호화하는 뉴클레오티드 서열 영역을 포함하는 핵산 분자,
    제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체를 암호화하는 뉴클레오티드 서열 영역을 포함하는 핵산 분자를 포함하는 발현 벡터,
    제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체를 암호화하는 뉴클레오티드 서열 영역을 포함하는 핵산 분자 또는 이 핵산 분자를 포함하는 발현 벡터를, 포함하는 숙주 세포, 또는
    제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체를 암호화하는 뉴클레오티드 서열 영역을 포함하는 핵산 분자 또는 이 핵산 분자를 가지는 발현 벡터를 포함하는, 바이러스;를 포함하는 키트.
  35. (a) 암호화된 항체를 발현하는데 효과적인 조건 하에서, 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체를 암호화하는 뉴클레오티드 서열 영역을 포함하는 핵산 분자를 포함하는 발현 벡터를 포함하는 숙주 세포를 배양하고,
    (b) 상기 숙주 세포로부터 발현된 항체를 얻는 것
    을 포함하는, 항체를 생산하는 방법.
  36. 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체 또는 그것의 면역접합체와 VEGF를 포함하는 검체를 접촉시키는 것을 포함하는 VEGF 결합 방법.
  37. VEGF/항체 복합체를 형성하는데 효과적인 조건하에서 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체 또는 그것의 면역접합체와 VEGF를 포함하는 것으로 의심되는 검체를 접촉시키고, 그렇게 형성된 복합체를 검출하는 것을 포함하는, VEGF 검출 방법.
  38. 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체 또는 그것의 면역접합체를 포함하는 신생혈관형성 또는 림프관형성을 억제하여 질병의 치료에 사용하기 위한 약제.
  39. 제38항에 있어서,
    상기 질병은 암(cancer), 안구 혈관신생성 질병(ocular neovascular disease), 황반변성(macular degeneration), 노화관련 황반변성(age-related macular degeneration), 관절염(arthritis), 류마티스성 관절염(rheumatoid arthritis), 아테롬성 동맥경화증(atherosclerosis), 당뇨병성 망막증(diabetic retinopathy), 갑상선 과증식(thyroid hyperplasia), 그레이브스 병(Grave's disease), 혈관종(hemangioma), 신생혈관성 녹내장(neovascular glaucoma) 및 건선(psoriasis)로 이루어진 군으로부터 선택되는 것을 특징으로 하는 약제.
  40. 제38항에 있어서,
    상기 치료는 제2치료제의 사용을 더 포함하는 것을 특징으로 하는 약제.
  41. 제38항에 있어서,
    상기 치료는 인간 피험자에게 수행되는 것을 특징으로 하는 약제.
  42. 제40항에 있어서,
    상기 제2치료제는 화학 치료제(chemotherapeutic agent)인 것을 특징으로 하는 약제.
  43. 제1항 내지 제12항 또는 제16항 내지 제18항 중 어느 한 항의 항체 또는 그것의 면역접합체를 포함하는 신생혈관형성 또는 림프관형성과 관련된 질병의 진단에 사용하기 위한 약제학적 조성물.
  44. 제43항에 있어서,
    상기 질병은 암(cancer), 안구 혈관신생성 질병(ocular neovascular disease), 황반변성(macular degeneration), 노화관련 황반변성(age-related macular degeneration), 관절염(arthritis), 류마티스성 관절염(rheumatoid arthritis), 아테롬성 동맥경화증(atherosclerosis), 당뇨병성 망막증(diabetic retinopathy), 갑상선 과증식(thyroid hyperplasia), 그레이브스 병(Grave's disease), 혈관종(hemangioma), 신생혈관성 녹내장(neovascular glaucoma) 및 건선(psoriasis)로 이루어진 군으로부터 선택되는 것을 특징으로 하는 약제학적 조성물.
  45. 제43항에 있어서,
    상기 진단은 인간 피험자에게 수행되는 것을 특징으로 하는 약제학적 조성물.
  46. 제19항에 있어서,
    상기 항체는 적어도 제1의 방사선 치료제(radiotherapeutic agent), 화학 치료제(chemotherapeutic agent), 항신생혈관제(anti-angiogenic agent), 아폽토시스-유도제(apoptosis-inducing agent), 항튜불린성 약물(anti-tubulin drug), 항종양(anti-cellular) 또는 세포독성(cytotoxic) 약제, 스테로이드(steroid), 사이토카인(cytokine), 케모카인(chemokine) 또는 응고제(coagulant)에 부착되는 것을 특징으로 하는 면역접합체.
  47. 제19항에 있어서,
    상기 항체는
    (a) 비소 방사성동위원소(arsenic radioisotope);
    (b) 탁솔(taxol), 도세탁셀(decetaxel), 파클리탁셀(paclitaxel), 시스플라틴(cisplatin), 겜시타빈(gemcitabine), 콤브레타스타틴(combretastatin), 독소루비신(doxorubicin) 또는 아드리아마이신(adriamycin);
    (c) 리신(ricin), 겔로닌(gelonin), 아브린(abrin), 디프테리아(diphtheria), 슈도모나스(pseudomonas) 또는 백일해(pertussis) 독소;
    (d) V-타입 ATPase 억제제(V-type ATPase inhibitor);
    (e) IL-2, IL-12, TNF-α, 인터페론(interferon) 또는 LEC; 또는
    (f) 절단된 조직 인자(truncated Tissue Factor)
    에 부착되는 것을 특징으로 하는 면역접합체.
  48. 제42항에 있어서,
    상기 적어도 제2의 치료제는 피리미딘 유사체(pyrimidine analogs), 백금 배위 착물(platinum coordination complexes), 캄토테신(camptothecins), 티로신 키나아제 억제제(tyrosine kinase inhibitors) 및 티로신 키나아제 수용체의 억제제로 이루어지는 군으로부터 선택되는 것을 특징으로 하는 약제.
  49. 제48항에 있어서,
    상기 적어도 제2의 치료제는 5-플루오로우라실(5-fluorouracil), 카페시타빈(capecitabine), 옥살리플라틴(oxaliplatin), 시스플라틴(cisplatin), 카르보플라틴(carboplatin), 이리노테칸(irinotecan), 악시티닙(axitinib), 수니티닙(sunitinib) 또는 파클리탁셀(paclitaxel)인 것을 특징으로 하는 약제.
  50. 삭제
  51. 삭제
  52. 삭제
  53. 삭제
  54. 삭제
  55. 삭제
  56. 삭제
  57. 삭제
  58. 삭제
  59. 삭제
  60. 삭제
KR1020137031727A 2007-11-09 2008-11-07 항-vegf 항체 조성물 및 방법 KR101502267B1 (ko)

Priority Applications (7)

Application Number Priority Date Filing Date Title
US98701507P true 2007-11-09 2007-11-09
US60/987,015 2007-11-09
US10604708P true 2008-10-16 2008-10-16
US61/106,047 2008-10-16
US10802308P true 2008-10-24 2008-10-24
US61/108,023 2008-10-24
PCT/GB2008/003745 WO2009060198A1 (en) 2007-11-09 2008-11-07 Anti-vegf antibody compositions and methods

Publications (2)

Publication Number Publication Date
KR20130136014A KR20130136014A (ko) 2013-12-11
KR101502267B1 true KR101502267B1 (ko) 2015-03-18

Family

ID=40428119

Family Applications (2)

Application Number Title Priority Date Filing Date
KR1020107012713A KR20100102110A (ko) 2007-11-09 2008-11-07 항-vegf 항체 조성물 및 방법
KR1020137031727A KR101502267B1 (ko) 2007-11-09 2008-11-07 항-vegf 항체 조성물 및 방법

Family Applications Before (1)

Application Number Title Priority Date Filing Date
KR1020107012713A KR20100102110A (ko) 2007-11-09 2008-11-07 항-vegf 항체 조성물 및 방법

Country Status (18)

Country Link
US (3) US8034905B2 (ko)
EP (2) EP2219672B1 (ko)
JP (2) JP5809415B2 (ko)
KR (2) KR20100102110A (ko)
CN (1) CN101918030B (ko)
AU (1) AU2008324045B2 (ko)
BR (1) BRPI0820298A8 (ko)
CA (1) CA2705152C (ko)
CO (1) CO6280498A2 (ko)
DK (1) DK2219672T3 (ko)
EA (1) EA201070585A1 (ko)
ES (1) ES2572356T3 (ko)
HK (1) HK1147445A1 (ko)
IL (1) IL205547A (ko)
MX (1) MX2010005104A (ko)
NZ (1) NZ586053A (ko)
WO (1) WO2009060198A1 (ko)
ZA (2) ZA201003812B (ko)

Families Citing this family (41)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008153997A1 (en) * 2007-06-07 2008-12-18 Brookwood Pharmaceuticals, Inc. Reduced-mass, long-acting dosage forms
US8216571B2 (en) * 2007-10-22 2012-07-10 Schering Corporation Fully human anti-VEGF antibodies and methods of using
EP2229951A1 (en) * 2009-03-08 2010-09-22 Stichting Katholieke Universiteit Methods for the treatment or prevention of systemic sclerosis
US20130309173A2 (en) * 2009-10-09 2013-11-21 SingaporeHealth Services Pte. Ltd. Methods and compositions for maintenance of a functional wound
WO2011056644A2 (en) * 2009-10-28 2011-05-12 Centocor Ortho Biotech Inc. Anti-glp-1r antibodies and their uses
EP2497498A4 (en) * 2009-11-05 2013-04-17 Univ Osaka Therapeutic agent for autoimmune diseases or allergy, and method for screening for the therapeutic agent
CN102167740B (zh) * 2010-02-25 2014-06-04 上海百迈博制药有限公司 一种全人源抗vegf单克隆抗体、其制备方法及用途
EP2538965B1 (en) 2010-02-25 2017-04-12 Schepens Eye Research Institute Therapeutic compositions for the treatment of dry eye disease
WO2011137441A2 (en) * 2010-04-30 2011-11-03 Abraxis Bioscience, Llc Sparc binding aptamers and uses thereof
IL205774D0 (en) * 2010-05-13 2010-12-30 Muhammad Abdulrazik Novel compounds for the treatment of glaucoma and ocular hypertension
JP6178241B2 (ja) 2011-02-11 2017-08-09 ザ ロックフェラー ユニヴァーシティ 血管新生障害の処置
FR2975600B1 (fr) * 2011-05-24 2013-07-05 Assist Publ Hopitaux De Paris Agents pour le traitement de tumeurs
CN102399868B (zh) * 2011-10-10 2013-01-30 江苏省农业科学院 一种猪tlr4基因t611a碱基突变的检测方法
US20150056190A1 (en) * 2012-03-30 2015-02-26 Genentech, Inc. Diagnostic methods and compositions for treatment of cancer
CN104411332B (zh) * 2012-03-30 2018-11-23 索伦托治疗有限公司 与vegfr2结合的全人抗体
CN103417965B (zh) * 2012-05-17 2018-04-13 江苏先声药业有限公司 一种含有抗vegf抗体的药物组合物
AU2013296455A1 (en) * 2012-08-01 2015-02-26 Tetralogic Pharmaceuticals Corporation Combination therapy
JP6320382B2 (ja) 2012-08-13 2018-05-09 ザ ロックフェラー ユニヴァーシティ メラノーマの処置および診断
WO2014055415A1 (en) 2012-10-01 2014-04-10 Mayo Foundation For Medical Education And Research Cancer treatments
CN102863529A (zh) * 2012-10-09 2013-01-09 李彬 一种vegf单抗及包含该单抗的骨折愈合评价抗体芯片
CN104968216A (zh) 2012-12-10 2015-10-07 N·V·努特里奇亚 含有非消化性寡糖的营养组合物
US9682154B2 (en) 2013-02-04 2017-06-20 Vascular Biogenics Ltd. Methods of inducing responsiveness to anti-angiogenic agent
EP2956476A4 (en) 2013-02-18 2016-10-05 Vegenics Pty Ltd Ligand binding molecules and uses thereof
KR20140119317A (ko) 2013-03-28 2014-10-10 삼성전자주식회사 c-Met 항체 및 VEGF 결합 단편이 연결된 융합 단백질
KR101541478B1 (ko) * 2013-05-31 2015-08-05 동아쏘시오홀딩스 주식회사 항-vegf 항체 및 이를 포함하는 암 또는 신생혈관형성관련 질환의 예방, 진단 또는 치료용 약학 조성물
US9879081B2 (en) 2013-06-25 2018-01-30 Samsung Electronics Co., Ltd. Protein complex, bispecific antibody including the protein complex, and method of preparation thereof
WO2015070197A1 (en) * 2013-11-11 2015-05-14 Wake Forest University Health Sciences Detection of malignancy in brain cancer
US10294295B2 (en) 2013-11-27 2019-05-21 Inis Biotech Llc Methods for modulating angiogenesis of cancers refractory to anti-VEGF treatment
US9388239B2 (en) 2014-05-01 2016-07-12 Consejo Nacional De Investigation Cientifica Anti-human VEGF antibodies with unusually strong binding affinity to human VEGF-A and cross reactivity to human VEGF-B
EA201692502A1 (ru) 2014-06-16 2017-09-29 Мэйо Фаундейшн Фор Медикал Эдьюкейшн Энд Рисерч Лечение миелом
US9446148B2 (en) 2014-10-06 2016-09-20 Mayo Foundation For Medical Education And Research Carrier-antibody compositions and methods of making and using the same
TW201713360A (en) * 2015-10-06 2017-04-16 Mayo Foundation Methods of treating cancer using compositions of antibodies and carrier proteins
CN104530234B (zh) * 2014-12-30 2017-02-22 安源医药科技(上海)有限公司 检测人vegf的组合试剂、试剂盒及其使用方法
CN104558175B (zh) * 2014-12-30 2017-02-22 安源医药科技(上海)有限公司 抗人vegf的重组嵌合抗体及其制备方法和用途
WO2016191751A1 (en) 2015-05-28 2016-12-01 Bristol-Myers Squibb Company Treatment of pd-l1 positive lung cancer using an anti-pd-1 antibody
US20180162942A1 (en) 2015-05-29 2018-06-14 Bristol-Myers Squibb Company Treatment of renal cell carcinoma
US20170037132A1 (en) 2015-07-14 2017-02-09 Bristol-Myers Squibb Company Method of treating cancer using immune checkpoint inhibitor
WO2017141185A1 (en) * 2016-02-16 2017-08-24 The Regents Of The University Of California Methods and compositions for treating atherosclerosis
AU2017334698A1 (en) 2016-09-27 2019-03-21 Oncologie, Inc. Methods for treating cancer with bavituximab based on levels of β2-glycoprotein 1, and assays therefor
WO2019077593A1 (en) 2017-10-20 2019-04-25 Vascular Biogenics Ltd. Diagnostic methods for anti-angiogenic agent therapy
WO2019129679A1 (en) 2017-12-29 2019-07-04 F. Hoffmann-La Roche Ag Method for improving vegf-receptor blocking selectivity of an anti-vegf antibody

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6524583B1 (en) 1999-04-28 2003-02-25 Board Of Regents, The University Of Texas System Antibody methods for selectively inhibiting VEGF
WO2003102157A2 (en) * 2002-06-03 2003-12-11 Genentech, Inc. Synthetic antibody phage libraries
US20060280747A1 (en) 2003-08-01 2006-12-14 Genentech, Inc. Anti-VEGF antibodies

Family Cites Families (134)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
YU33730B (en) 1967-04-18 1978-02-28 Farmaceutici Italia Process for preparing a novel antibiotic substance and salts thereof
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
FR2182943B1 (ko) 1972-04-10 1976-12-31 Rustenburg Platinum Mines Ltd
CH605550A5 (ko) 1972-06-08 1978-09-29 Research Corp
US4366246A (en) 1977-11-08 1982-12-28 Genentech, Inc. Method for microbial polypeptide expression
US5221619A (en) 1977-11-08 1993-06-22 Genentech, Inc. Method and means for microbial polypeptide expression
US4704362A (en) 1977-11-08 1987-11-03 Genentech, Inc. Recombinant cloning vehicle microbial polypeptide expression
US5583013A (en) 1977-11-08 1996-12-10 Genentech, Inc. Method and means for microbial polypeptide expression
FR2437213B1 (ko) 1978-09-28 1983-05-06 Cm Ind
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US4957939A (en) 1981-07-24 1990-09-18 Schering Aktiengesellschaft Sterile pharmaceutical compositions of gadolinium chelates useful enhancing NMR imaging
US4472509A (en) 1982-06-07 1984-09-18 Gansow Otto A Metal chelate conjugated monoclonal antibodies
US5001116A (en) 1982-12-20 1991-03-19 The Children's Medical Center Corporation Inhibition of angiogenesis
US4526988A (en) 1983-03-10 1985-07-02 Eli Lilly And Company Difluoro antivirals and intermediate therefor
US4736866B1 (en) 1984-06-22 1988-04-12 Transgenic non-human mammals
US5139941A (en) 1985-10-31 1992-08-18 University Of Florida Research Foundation, Inc. AAV transduction vectors
US4785420A (en) 1986-04-09 1988-11-15 Joyce Communications Systems, Inc. Audio/telephone communication system for verbally handicapped
FR2601675B1 (fr) 1986-07-17 1988-09-23 Rhone Poulenc Sante Derives du taxol, leur preparation et les compositions pharmaceutiques qui les contiennent
US4861581A (en) 1986-12-05 1989-08-29 Cancer Biologics, Inc. Detection of necrotic malignant tissue and associated therapy
US4996237A (en) 1987-01-06 1991-02-26 Arizona Board Of Regents Combretastatin A-4
CA1338645C (en) 1987-01-06 1996-10-15 George R. Pettit Isolation, structural elucidation and synthesis of novel antineoplastic substances denominated "combretastatins"
US4904768A (en) 1987-08-04 1990-02-27 Bristol-Myers Company Epipodophyllotoxin glucoside 4'-phosphate derivatives
US5520914A (en) 1987-08-06 1996-05-28 President And Fellows Of Harvard College Antibodies to angiogenin: immunotherapeutic agents
US4975278A (en) 1988-02-26 1990-12-04 Bristol-Myers Company Antibody-enzyme conjugates in combination with prodrugs for the delivery of cytotoxic agents to tumor cells
US4975369A (en) 1988-04-21 1990-12-04 Eli Lilly And Company Recombinant and chimeric KS1/4 antibodies directed against a human adenocarcinoma antigen
US5183756A (en) 1988-08-19 1993-02-02 The United States Of America As Represented By The Department Of Health And Human Services Monoclonal antibody (D612) having selective reactivity for gastrointestinal caricinomas and method for employing the same
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US5019368A (en) 1989-02-23 1991-05-28 Cancer Biologics, Inc. Detection of necrotic malignant tissue and associated therapy
WO1990010457A1 (en) 1989-03-14 1990-09-20 New York University Method of treating hiv infections using immunotoxins
US4940726A (en) 1989-04-26 1990-07-10 Arizona Board Of Regents Cell growth inhibitory macrocyclic lactones denominated Combretastatin D-1 and Combretastatin D-2
US5338678A (en) 1989-06-09 1994-08-16 Oncogen, A Limited Partnership Expression of DNA sequences encoding a thermally stable cytosine deaminase from saccharomyces
CA2018273C (en) 1989-06-09 1999-04-06 Peter D. Senter Thermally stable cytosine deaminase
DE3920358A1 (de) 1989-06-22 1991-01-17 Behringwerke Ag Bispezifische und oligospezifische, mono- und oligovalente antikoerperkonstrukte, ihre herstellung und verwendung
US5270196A (en) 1989-10-20 1993-12-14 Bristol-Myers Squibb Company Arylsulfatase from streptomyces
US5427908A (en) 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
US5972922A (en) 1990-06-11 1999-10-26 Alcon Laboratories, Inc. Steroids which inhibit angiogenesis
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
DE69127627D1 (de) 1990-08-29 1997-10-16 Genpharm Int Produktion und Nützung nicht-menschliche transgentiere zur Produktion heterologe Antikörper
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5698426A (en) 1990-09-28 1997-12-16 Ixsys, Incorporated Surface expression libraries of heteromeric receptors
US5242813A (en) 1990-10-12 1993-09-07 The United States Of America As Represented By The Department Of Health And Human Services Mouse monoclonal antibodies specific for normal primate tissue, malignant human cultural cell lines human tumors
US5747469A (en) 1991-03-06 1998-05-05 Board Of Regents, The University Of Texas System Methods and compositions comprising DNA damaging agents and p53
DE69233750D1 (de) 1991-04-10 2009-01-02 Scripps Research Inst Bibliotheken heterodimerer Rezeptoren mittels Phagemiden
FR2676058B1 (fr) 1991-04-30 1994-02-25 Hoechst Lab Prodrogues glycosylees, leur procede de preparation et leur utilisation dans le traitement des cancers.
WO1993000902A1 (fr) 1991-07-03 1993-01-21 Otsuka Pharmaceutical Co., Ltd. Regulateur d'apoptose
EP1136556B1 (en) 1991-11-25 2005-06-08 Enzon, Inc. Method of producing multivalent antigen-binding proteins
GB9200417D0 (en) 1992-01-09 1992-02-26 Bagshawe Kenneth D Cytotoxic drug therapy
US5667988A (en) 1992-01-27 1997-09-16 The Scripps Research Institute Methods for producing antibody libraries using universal or randomized immunoglobulin light chains
US5877289A (en) 1992-03-05 1999-03-02 The Scripps Research Institute Tissue factor compositions and ligands for the specific coagulation of vasculature
US6093399A (en) 1992-03-05 2000-07-25 Board Of Regents, The University Of Texas System Methods and compositions for the specific coagulation of vasculature
US5660827A (en) 1992-03-05 1997-08-26 Board Of Regents, The University Of Texas System Antibodies that bind to endoglin
US6004555A (en) 1992-03-05 1999-12-21 Board Of Regents, The University Of Texas System Methods for the specific coagulation of vasculature
US5965132A (en) 1992-03-05 1999-10-12 Board Of Regents, The University Of Texas System Methods and compositions for targeting the vasculature of solid tumors
US6036955A (en) 1992-03-05 2000-03-14 The Scripps Research Institute Kits and methods for the specific coagulation of vasculature
WO1993017715A1 (en) 1992-03-05 1993-09-16 Board Of Regents, The University Of Texas System Diagnostic and/or therapeutic agents, targeted to neovascular endothelial cells
US5474765A (en) 1992-03-23 1995-12-12 Ut Sw Medical Ctr At Dallas Preparation and use of steroid-polyanionic polymer-based conjugates targeted to vascular endothelial cells
US5411860A (en) 1992-04-07 1995-05-02 The Johns Hopkins University Amplification of human MDM2 gene in human tumors
US5374617A (en) 1992-05-13 1994-12-20 Oklahoma Medical Research Foundation Treatment of bleeding with modified tissue factor in combination with FVIIa
US5430062A (en) 1992-05-21 1995-07-04 Research Corporation Technologies, Inc. Stilbene derivatives as anticancer agents
GB9314960D0 (en) 1992-07-23 1993-09-01 Zeneca Ltd Chemical compounds
US5464833A (en) 1992-08-19 1995-11-07 Otsuka Pharmaceutical Co., Ltd. Apoptosis regulating composition
EP0655923A1 (en) 1992-08-19 1995-06-07 Merrell Pharmaceuticals Inc. Antiangiogenic oligomers
WO1994007515A1 (en) 1992-10-06 1994-04-14 The Scripps Research Institute Mutant tissue factor lacking factor vii activation activity
US5792771A (en) 1992-11-13 1998-08-11 Sugen, Inc. Quinazoline compounds and compositions thereof for the treatment of disease
US5846945A (en) 1993-02-16 1998-12-08 Onyx Pharmaceuticals, Inc. Cytopathic viruses for therapy and prophylaxis of neoplasia
US5629327A (en) 1993-03-01 1997-05-13 Childrens Hospital Medical Center Corp. Methods and compositions for inhibition of angiogenesis
US5399586A (en) 1993-03-11 1995-03-21 Allergan, Inc. Treatment of mammals afflicted with tumors with compounds having RXR retinoid receptor agonist activity
NO941135L (no) 1993-04-01 1994-10-03 Daiichi Seiyaku Co Tiazolpyrimidin derivater
AU7050994A (en) 1993-06-01 1994-12-20 Scripps Research Institute, The Human mutant tissue factor compositions useful as tissue factor antagonists
US5716981A (en) 1993-07-19 1998-02-10 Angiogenesis Technologies, Inc. Anti-angiogenic compositions and methods of use
GB9315494D0 (en) 1993-07-27 1993-09-08 Springer Caroline Improvements relating to prodrugs
US5504074A (en) 1993-08-06 1996-04-02 Children's Medical Center Corporation Estrogenic compounds as anti-angiogenic agents
EP0647450A1 (en) 1993-09-09 1995-04-12 BEHRINGWERKE Aktiengesellschaft Improved prodrugs for enzyme mediated activation
GB9323429D0 (en) 1993-11-12 1994-01-05 Wellcome Found Therapy
US5539094A (en) 1993-11-12 1996-07-23 La Jolla Cancer Research Foundation DNA encoding Bcl-2-associated proteins
US5622829A (en) 1993-12-08 1997-04-22 The Regents Of The University Of California Genetic markers for breast, ovarian, and prostatic cancer
GB9326136D0 (en) 1993-12-22 1994-02-23 Erba Carlo Spa Biologically active 3-substituted oxindole derivatives useful as anti-angiogenic agents
US5565491A (en) 1994-01-31 1996-10-15 Bristol-Myers Squibb Company Use of phosphotyrosine phospatase inhibitors for controlling cellular proliferation
US5840301A (en) 1994-02-10 1998-11-24 Imclone Systems Incorporated Methods of use of chimerized, humanized, and single chain antibodies specific to VEGF receptors
US5583034A (en) 1994-02-22 1996-12-10 La Jolla Institute For Allergy And Immunology Enhancement of adoptosis using antisense oligonucleotides
US5753230A (en) 1994-03-18 1998-05-19 The Scripps Research Institute Methods and compositions useful for inhibition of angiogenesis
US5591717A (en) 1994-04-06 1997-01-07 Rojko; Jennifer L. Branched apogenic peptide for inducing apoptosis
US5639725A (en) 1994-04-26 1997-06-17 Children's Hospital Medical Center Corp. Angiostatin protein
US5618925A (en) 1994-04-28 1997-04-08 Les Laboratories Aeterna Inc. Extracts of shark cartilage having an anti-angiogenic activity and an effect on tumor regression; process of making thereof
DE4417865A1 (de) 1994-05-20 1995-11-23 Behringwerke Ag Kombination von Tumornekrose-induzierenden Substanzen mit Substanzen, die durch Nekrosen aktiviert werden, zur selektiven Tumortherapie
US5605826A (en) 1994-06-10 1997-02-25 Panorama Research, Inc. 24 kilodalton cytoplasmic protease activating DNA fragmentation in apoptosis
AU702250B2 (en) 1994-07-11 1999-02-18 Board Of Regents, The University Of Texas System Methods and compositions for the specific coagulation of vasculature
GB9415167D0 (en) 1994-07-27 1994-09-14 Springer Caroline J Improvements relating to cancer therapy
US5693473A (en) 1994-08-12 1997-12-02 Myriad Genetics, Inc. Linked breast and ovarian cancer susceptibility gene
US5753441A (en) 1994-08-12 1998-05-19 Myriad Genetics, Inc. 170-linked breast and ovarian cancer susceptibility gene
US5747282A (en) 1994-08-12 1998-05-05 Myraid Genetics, Inc. 17Q-linked breast and ovarian cancer susceptibility gene
US5709999A (en) 1994-08-12 1998-01-20 Myriad Genetics Inc. Linked breast and ovarian cancer susceptibility gene
US5710001A (en) 1994-08-12 1998-01-20 Myriad Genetics, Inc. 17q-linked breast and ovarian cancer susceptibility gene
US5587459A (en) 1994-08-19 1996-12-24 Regents Of The University Of Minnesota Immunoconjugates comprising tyrosine kinase inhibitors
US5776743A (en) 1994-09-06 1998-07-07 La Jolla Cancer Research Foundation Method of sensitizing tumor cells with adenovirus E1A
US5561122A (en) 1994-12-22 1996-10-01 Arizona Board Of Regents Acting On Behalf Of Arizona State University Combretastatin A-4 prodrug
GB9426133D0 (en) 1994-12-23 1995-02-22 Zeneca Ltd Chemical compounds
US5696092A (en) 1995-03-07 1997-12-09 George Washington University Methods and compositions for inhibiting metastasis of epithelial cell-derived cancers
US5571523A (en) 1995-03-09 1996-11-05 President And Fellows Of Harvard College Antioxidant-induced apoptosis in vascular smooth muscle cells
US6096871A (en) 1995-04-14 2000-08-01 Genentech, Inc. Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life
US5702892A (en) 1995-05-09 1997-12-30 The United States Of America As Represented By The Department Of Health And Human Services Phage-display of immunoglobulin heavy chain libraries
US5639757A (en) 1995-05-23 1997-06-17 Pfizer Inc. 4-aminopyrrolo[2,3-d]pyrimidines as tyrosine kinase inhibitors
GB9510830D0 (en) 1995-05-27 1995-07-19 Zeneca Ltd Proteins
US5871723A (en) 1995-06-06