EP4724490A2 - Lymphotoxin beta receptor agonist binding proteins - Google Patents

Lymphotoxin beta receptor agonist binding proteins

Info

Publication number
EP4724490A2
EP4724490A2 EP24741027.7A EP24741027A EP4724490A2 EP 4724490 A2 EP4724490 A2 EP 4724490A2 EP 24741027 A EP24741027 A EP 24741027A EP 4724490 A2 EP4724490 A2 EP 4724490A2
Authority
EP
European Patent Office
Prior art keywords
ltβr
seq
amino acid
binding
binding protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP24741027.7A
Other languages
German (de)
French (fr)
Inventor
Rajkumar NOUBADE
Ian Nevin FOLTZ
Hong Yu Wang
Danyang GONG
Ryan Benjamin CASE
Jun Zhang
Chin-Wen Lai
Fernando Garces
Christine Elaine Tinberg
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Amgen Inc
Original Assignee
Amgen Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Amgen Inc filed Critical Amgen Inc
Publication of EP4724490A2 publication Critical patent/EP4724490A2/en
Pending legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3076Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
    • C07K16/3092Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)

Description

LYMPHOTOXIN BETA RECEPTOR AGONIST BINDING PROTEINS [0001] The benefit under 35 U.S.C. §119(e) of U.S. Provisional Application No.63/472,565, filed June 12, 2023, is hereby claimed, and the disclosure thereof is hereby incorporated by reference herein. FIELD [0002] The field of this invention relates to compositions and methods related to lymphotoxin beta receptor (“LTβR” or “LTBR”) binding proteins. BACKGROUND OF VARIOUS EMBODIMENTS [0003] Cancer immunotherapy enhances cancer patient survival by inducing or boosting an effective anti-tumor immune response in the patient. Immune checkpoint inhibition is one form of immunotherapy that has changed the treatment landscape for many tumors. This therapy works by blocking the immunosuppressive signals of immune checkpoint proteins, such as cytotoxic T lymphocyte antigen 4 (CTLA-4), programmed cell death protein 1 (PD-1), and programmed cell death ligand 1 (PD-L1), that mediate tumor immune evasion. Blockade of this immunosuppressive signaling restores and/or enhances the body’s natural anti-tumor response to facilitate tumor eradication. While this form of immunotherapy has generated durable responses in many patients, it fails to generate therapeutic response in many others. In particular, patients with “cold tumors”, i.e., tumors characterized by a lack of infiltrating T cells and the presence of other immunosuppressive cells, are typically resistant to immune checkpoint inhibitor therapy. Accordingly, there is a need in the art for an anti-cancer therapy that can induce T cell infiltration into the tumor microenvironment to inflame such cold tumors and overcome this resistance thereby rendering the tumor amenable to immunotherapy. SUMMARY OF VARIOUS EMBODIMENTS [0004] A first aspect of the present disclosure is directed to an agonist lymphotoxin β receptor (LTβR) binding protein. The agonist LTβR binding protein of the disclosure binds one or more amino acid residues of human LTβR cysteine-rich domain 4 (CRD4) comprising amino acid residues 169-211 of SEQ ID NO: 1 and (a) does not inhibit LIGHT binding to LTβR or (b) does not inhibit LTα1β2 binding to LTβR. [0005] Another aspect of the present disclosure is directed to a bispecific agonist LTβR binding protein. This bispecific binding protein comprises a LTβR binding domain, where the LTβR binding domain binds one or more amino acid residues of human LTβR CRD4 comprising amino acid residues 169- 211 of SEQ ID NO: 1; and a tumor-associated antigen binding domain. This bispecific binding protein agonizes LTβR activity, and (a) does not inhibit LIGHT binding to LTβR or (b) does not inhibit LTα1β2 binding to LTβR. [0006] Other aspects of the present disclosure are directed to polynucleotides encoding the agonist LTβR binding proteins and bispecific LTβR binding proteins of the disclosure; vectors comprising these polynucleotides; and host cells comprising these vectors. [0007] Additional aspects of the present disclosure are directed to pharmaceutical compositions comprising an agonist LTβR binding protein, a bispecific agonist LTβR binding protein, or a polynucleotide or vector encoding the same as described herein. [0008] Another aspect of the disclosure is directed to methods of treating cancer in a subject that involve administering, to the subject having cancer, an agonist LTβR binding protein. The agonist LTβR binding protein used in these methods binds one or more amino acid residues of human LTβR cysteine-rich domain 4 (CRD4) comprising amino acid residues 169-211 of SEQ ID NO: 1 and (a) does not inhibit LIGHT binding to LTβR or (b) does not inhibit LTα1β2 binding to LTβR [0009] Another aspect of the disclosure is directed to methods of treating cancer in a subject that involve administering, to the subject having cancer, a bispecific agonist LTβR binding protein. This bispecific agonist LTβR binding protein comprises a LTβR binding domain and a tumor-associated antigen binding domain. This LTβR binding domain binds one or more amino acid residues of human LTβR cysteine-rich domain (CRD4) comprising amino acid residues 169-211 of SEQ ID NO: 1. The bispecific LTβR binding protein further comprises a tumor-associated antigen binding domain. The bispecific LTβR binding protein agonizes LTβR activity and (a) does not inhibit LIGHT binding to LTβR or (b) does not inhibit LT1α2β binding to LTβR. [0010] The potential utility of LTβR agonism as an anti-tumor therapy was suggested more than 20 years ago (see e.g., Browning et al., “Signaling through the Lymphotoxin β Receptor Induces the Death of Some Adenocarcinoma Tumor Lines,” J. Exp. Med. 183:867 (1996)). Despite this, only one LTβR antibody has progressed to a Phase I clinical trial, and that trial ended prematurely. LTβR is ubiquitously expressed on various cells throughout the body and plays a critical role in the formation and maintenance of lymphoid organs and various immune cell populations. Thus, for an LTβR antibody to be therapeutically effective and safe, it must selectively activate LTβR signaling in the tumor microenvironment without disrupting normal LTβR signaling outside of the tumor microenvironment. While targeting agonism to the tumor environment can be achieved using a bispecific modality that provides cross-linking specific LTβR activation; if not properly designed, the cross-linking dependent agonist will act as an antagonist when bound to LTβR in a target-independent manner. Given the importance of LTβR in the maintenance of immune functions, antagonizing its activity presents serious safety concerns. [0011] The agonist LTβR binding proteins disclosed herein overcome this problem by exerting agonist activity in a cross-linking target-dependent manner without antagonizing normal LTβR signaling activity. This was achieved by specifically selecting for and engineering LTβR binding proteins that agonize LTβR in a cross-linking specific manner when bound to the cysteine rich domain 4 (CRD4) of LTβR without blocking endogenous LTβR ligand (i.e., LIGHT or LTα1β2) binding and signaling activity. BRIEF DESCRIPTION OF THE FIGURES [0012] FIGs. 1A–1B show tumor associated antigen (TAA)-targeted LTβR agonism increases lymphocyte infiltration in the human EpCAM-expressing B16F10 melanoma tumor model. As shown in the graph of FIG.1A, the total number of T cells (CD3+ T cells) infiltrating the tumor tissue increased at the 3 mg/kg dose of the human EpCAM x murine LTβR bispecific antibody relative to administration of an isotype control antibody. As shown in the graph of FIG.1B, the total number of B cells (CD19+ B cells) infiltrating the tumor tissue increased with increasing doses (0.3, 3, and 30 mg/kg) of the huEpCAM x muLTβR BsAb relative to administration of an isotype control antibody. [0013] FIG. 2 shows tumor associated antigen (TAA)-targeted LTβR agonism induces HEV formation in the human EpCAM-expressing B16F10 melanoma tumor model. FIG. 2 shows the immunohistochemical analysis of HEV formation in tumor tissue following isotype control treatment (top image) and 3mg/kg of huEpCAM-muLTβR bispecific antibody treatment (bottom image) as described in Example 1 herein. [0014] FIG. 3 shows tumor associated antigen (TAA)-targeted LTβR agonism increased T cell infiltration in a human KPC pancreatic tumor model. The graph of FIG.3 shows T cells counts per gram of tumor tissue increased following administration of two different tool huLRRC15 x muLTβR BsAb to mice bearing a KPC M5 tumor. The huLRRC15 x muLTβR BsAb was administered twice a week for 3 doses before tumors were assessed with flow cytometry. One-way ANOVA with Dunnett’s multiple comparison test showed no significant difference against isotype, but treatments do show an upwards trend of T cell infiltration. Mean and SEM are represented in the graph. [0015] FIG. 4 shows tumor associated antigen (TAA)-targeted LTβR agonism inhibited tumor growth in a human KPC pancreatic tumor model. The graph of FIG.4 shows mean tumor volume of KPC M5 pancreatic tumor model treated with PD-1 antibody, huLRRC15 x muLTβR BsAb, or the combination of these antibodies. huLRRC15 x muLTβR BsAb monotherapy (▼) produced a greater effect than PD-1 monotherapy (■). The combination of huLRRC15 x muLTβR BsAb and PD-1 Ab did show greater TGI, but the difference between the two treatment groups was not statistically significant. Two-way ANOVA with Tukey’s multiple comparison test demonstrated significance against isotype for huLRRC15 x muLTbR BsAb and huLRRC15 x muLTbR BsAb + PD-1 Ab (p<0.0001). N=10, Mean and SEM are represented in the graph. [0016] FIG.5 contains Tables A and B summarizing characterization data of the LTβR antibodies identified in the first round of hybridoma screening. Table A contains functional potency values (EC50) and binding data, i.e., LTβR antibody binding to TNRFSF1 and TNRFSF2, mouse LTβR, and cynomolgus LTβR. Data is presented as GeoMean fold over mock transfected cells. Table A also shows the percent inhibition of human LIGHT or human LTα1β2 ligand binding to human LTβR in the presence of the indicated LTβR antibody as assessed using the single-point FACS bead-based receptor-ligand assay as described in Example 4.6. Table B shows LTβR antibody binding affinity measurements (ka, kd, and KD) to human and cynomolgus LTβR. [0017] FIG. 6 identifies the regions of the LTβR extracellular domain (ECD) (SEQ ID NO: 4) involved in the binding interaction with LTβR antibody, LIBC No.218990 (Bio. Reg. No.19320 / Well ID 30H1), as determined by hydrogen-deuterium exchange (HDX) mass spectrometry (MS) (see Example 6.1.1). Shown are deuterium uptake graphs of peptides corresponding to residues 56-64 and 81-101 of the LTβR extracellular domain (ECD) alone or in complex with the antibody. Protection from deuterium exchange in the complex derived peptides relative to non-complexed peptides indicates that one or more residues within these regions, i.e., residues 57-64 and 82-101, of the LTβR ECD are involved in the binding interaction (note that the N-terminal residues of a peptide does not have an amide hydrogen for measure and is therefore excluded in reporting epitope regions). [0018] FIG. 7 identifies the regions of the LTβR ECD (SEQ ID NO: 4) involved in the binding interaction with LTβR antibody, LIBC No.218944 (Bio. Reg No.19321 / Well ID 31A3), as determined by HDX MS (see Example 6.1.1). Shown are deuterium uptake graphs of peptides corresponding to residues 3–9, 20–29, and 38–47 of the LTβR ECD alone or in complex with the antibody. Protection from deuterium exchange in the complex derived peptides relative to non-complexed peptides indicates that one or more residues within these regions, i.e., residues 4-9, 21-29, and 39-47, of the LTβR ECD are involved in the binding interaction (note that the N-terminal residues of a peptide does not have an amide hydrogen for measure and is therefore excluded in reporting epitope regions). [0019] FIG. 8 identifies the regions of the LTβR ECD (SEQ ID NO: 4) involved in the binding interaction with LTβR antibody, LIBC No.219058 (Bio. Reg. No.19324 / Well ID 36G2), as determined by HDX MS (see Example 6.1.1). Shown are deuterium uptake graphs of peptides corresponding to residues 56-64 and 81-101 of the LTβR ECD alone or in complex with the antibody. Protection from deuterium exchange in the complex derived peptides relative to non-complexed peptides indicates that one or more residues within these regions, i.e., residues 57-64 and 82-101, of the LTβR ECD are involved in the binding interaction (note that the N-terminal residues of a peptide does not have an amide hydrogen for measure and is therefore excluded in reporting epitope regions). [0020] FIG. 9 identifies the regions of the LTβR ECD (SEQ ID NO: 4) involved in the binding interaction with LTβR antibody, LIBC No. 219081 (Bio Reg. No. 19325 / Well ID 41B2), as determined by HDX MS (see Example 6.1.1). Shown are deuterium uptake graphs of peptides corresponding to residues 167–179 of the LTβR ECD alone or in complex with the antibody. Protection from deuterium exchange in the complex derived peptides relative to non-complexed peptides indicates that one or more residues within these regions, i.e., residue 168-179, of the LTβR ECD are involved in the binding interaction (note that the N-terminal residues of a peptide does not have an amide hydrogen for measure and is therefore excluded in reporting epitope regions). [0021] FIG.10 identifies the regions of the LTβR ECD (SEQ ID NO: 4) involved in the binding interaction with LTβR antibody, LIBC No.219097 (Bio. Reg. No.19326 / Well ID 43D9), as determined by HDX MS (see Example 6.1.1). Shown are deuterium uptake graphs of peptides corresponding to residues 38–42, 37–47, 56–64, and 65–70 of the LTβR ECD alone or in complex with the antibody. Protection from deuterium exchange in the complex derived peptides relative to non-complexed peptides indicates that one or more residues within these regions, i.e., residues 39–42 and 57–70, of the LTβR ECD are involved in the binding interaction (note that the N-terminal residues of a peptide does not have an amide hydrogen for measure and is therefore excluded in reporting epitope regions). [0022] FIG. 11 identifies the regions of the LTβR ECD (SEQ ID NO: 4) involved in the binding interaction with LTβR antibody, LIBC No.218979 (Bio. Reg. No.19319 / Well ID 23E9), as determined by HDX MS (see Example 6.1.2). Shown are deuterium uptake graphs of peptides corresponding to residues 154–166, 167–177, 167–181, and 178–193 of the LTβR ECD alone or in complex with the antibody. Protection from deuterium exchange in the complex derived peptides relative to non-complexed peptides indicates that one or more residues within these regions, i.e., residues 168-178, of the LTβR ECD are involved in the binding interaction (note that the N-terminal residues of a peptide does not have an amide hydrogen for measure and is therefore excluded in reporting epitope regions). [0023] FIG.12 identifies the regions of the LTβR ECD (SEQ ID NO: 4) involved in the binding interaction with LTβR antibody, LIBC No.219051 (Bio. Reg. No.19323 / Well ID 35F5), as determined by HDX MS (see Example 6.1.2). Shown are deuterium uptake graphs of peptides corresponding to residues 1–9, 1–20 (unglycosylated and glycosylated), 10–20, and 19–28 of the LTβR ECD alone or in complex with the antibody. Protection from deuterium exchange in the complex derived peptides relative to non-complexed peptides indicates that one or more residues within regions 1–19 of the LTβR ECD are involved in the binding interaction (note that Q1 has been converted to pyro-Q, which contains a measurable amide hydrogen). [0024] FIG.13 identifies the variable heavy (VH) and variable light (VL) domain regions of LIBC No. 218990 (19320/30H1) involved in the binding interaction with LTβR. Shown are deuterium uptake graphs of VH and VL domain peptides alone or when bound to LTβR. Protection from deuterium exchange in the complexed peptides relative to non-complexed peptides indicates that one or more CDR residues within these regions of the antibody are involved in the binding interaction. The regions including these one or more residues are boxed in the shown VH and VL sequences and the three CDR regions of each variable domain are underlined. [0025] FIGs.14A–14B identify the variable heavy (VH) and variable light (VL) domain regions of LIBC No. 218944 (19321/31A3) involved in the binding interaction with LTβR. Shown are deuterium uptake graphs of VH (FIG. 14A) and VL (FIG. 14B) domain peptides alone or when bound to LTβR. Protection from deuterium exchange in the complexed peptides relative to non-complexed peptides indicates that one or more CDR residues within these regions of the antibody are involved in the binding interaction. The regions including these one or more residues are boxed in the shown VH (FIG.14A) and VL (FIG.14B) sequences and the three CDR regions of each variable domain are underlined. [0026] FIG.15 identifies the variable heavy (VH) and variable light (VL) domain regions of LIBC No. 219058 (19324/36G2) involved in the binding interaction with LTβR. Shown are deuterium uptake graphs of VH and VL domain peptides alone or when bound to LTβR. Protection from deuterium exchange in the complexed peptides relative to non-complexed peptides indicates that one or more CDR residues within these regions of the antibody are involved in the binding interaction. The regions including these one or more residues are boxed in the shown VH and VL sequences and the three CDR regions of each variable domain are underlined. [0027] FIGs.16A–16B identify the variable heavy (VH) and variable light (VL) domain regions of LIBC No. 219081 (19325/41B2) involved in the binding interaction with LTβR. Shown are deuterium uptake graphs of VH (FIG. 16A) and VL (FIG. 16B) domain peptides alone or when bound to LTβR. Protection from deuterium exchange in the complexed peptides relative to non-complexed peptides indicates that one or more CDR residues within these regions of the antibody are involved in the binding interaction. The regions including these one or more residues are boxed in the shown VH (FIG.16A) and VL (FIG.16B) sequences and the three CDR regions of each variable domain are underlined. [0028] FIGs.17A–17B identify the variable heavy (VH) and variable light (VL) domain regions of LIBC No. 219097 (19326/43D9) involved in the binding interaction with LTβR. Shown are deuterium uptake graphs of VH (FIG. 17A) and VL (FIG. 17B) domain peptides alone or when bound to LTβR. Protection from deuterium exchange in the complexed peptides relative to non-complexed peptides indicates that one or more CDR residues within these regions of the antibody are involved in the binding interaction. The regions including these one or more residues are boxed in the shown VH (FIG.17A) and VL (FIG.17B) sequences and the three CDR regions of each variable domain are underlined. [0029] FIGs.18A–18B identify the variable heavy (VH) and variable light (VL) domain regions of LIBC No.218979 (Bio. Reg. No.19319 / Well ID 23E9) involved in the binding interaction with LTβR. Shown are deuterium uptake graphs of VH (FIG.18A) and VL (FIG.18B) domain peptides alone or when bound to LTβR. Protection from deuterium exchange in the complexed peptides relative to non-complexed peptides indicates that one or more CDR residues within these regions of the antibody are involved in the binding interaction. The regions including these one or more residues are boxed in the shown VH (FIG. 18A) and VL (FIG.18B) sequences and the three CDR regions of each variable domain are underlined. [0030] FIGs.19A–19B identify the variable heavy (VH) and variable light (VL) domain regions of LIBC No.219051 (Bio. Reg. No.19323 / Well ID 35F5) involved in the binding interaction with LTβR. Shown are deuterium uptake graphs of VH (FIG.19A) and VL (FIG.19B) domain peptides alone or when bound to LTβR. Protection from deuterium exchange in the complexed peptides relative to non-complexed peptides indicates that one or more CDR residues within these regions of the antibody are involved in the binding interaction. The regions including these one or more residues are boxed in the shown VH (FIG. 19A) and VL (FIG.19B) sequences and the three CDR regions of each variable domain are underlined. [0031] FIG. 20 is a graph showing potency of huLTβR x huCLDN6 bispecific antibodies (PUR149204-4, PUR149205-4, PUR149212-5, and PUR149213-4). Potency was measured by IL-8 release from LTβR expressing human melanoma cells co-cultured with CLDN6 expressing hamster ovarian cells (CHOs) in the presence of an increasing concentration of the indicated huLTβR x huCLDN6 bispecific antibody. The “signal” of the y-axis represents relative IL-8 release calculated by the ratio of signal at 665 nm to signal at 615 nm. [0032] FIG. 21 is a graph showing potency of huLTβR x huCLDN18.2 bispecific antibodies (PUR149206-4, PUR149214-4, and PUR149215-4). Potency was measured by IL-8 release from LTβR expressing human melanoma cells co-cultured with CLDN18.2 expressing CHO cells in the presence of an increasing concentration of the indicated huLTβR x huCLDN18.2 bispecific antibody. The “signal” of the y-axis represents relative IL-8 release calculated by the ratio of signal at 665 nm to signal at 615 nm. [0033] FIG. 22 is a graph showing potency of huLTβR x huMUC17 bispecific antibodies (PUR149211-4, PUR149218-4, and PUR149219-4). Potency was as measured by IL-8 release from LTβR expressing human melanoma cells co-cultured with MUC17 expressing CHO cells in the presence of an increasing concentration of the indicated huLTβR x huMUC17 bispecific antibody. The “signal” of the y- axis represents relative IL-8 release calculated by the ratio of signal at 665 nm to signal at 615 nm. [0034] FIG.23 is a graph showing potency of huLTβR x huLRRC15 bispecific antibodies (44245- 5, 45147-3, and 52208-3). Potency was as measured by IL-8 release from LTβR expressing human melanoma cells co-cultured with LRRC15 expressing Saos-2 cells in the presence of an increasing concentration of the huLTβR x huLRRC15 bispecific antibody. The “signal” of the y-axis represents relative IL-8 release calculated by the ratio of signal at 665 nm to signal at 615 nm. [0035] FIGs.24A-24C are graphs showing LIGHT (FIG.24A) and LTα1β2 (FIG.24B) inhibition in the presence of increasing concentrations of various LTβR antibodies described herein. FIG. 24C is a graph showing anti-LTβR antibody binding to LTβR expressed by HEK293 cells to confirm that non-ligand blocking activity was not due to non-receptor binding by the tested antibody. [0036] FIGs.25A-25C are graphs showing LIGHT (FIG.25A) and LTα1β2 (FIG.25B) inhibition in the presence of increasing concentrations of various LTβR-LRRC15 bispecific as described herein. FIG. 25C is a graph showing LTβR-LRRC15 bispecific antibody binding to LTβR expressed by HEK293 cells to confirm that non-ligand blocking activity was not due to non-receptor binding by the tested bispecific antibody. [0037] FIGs.26A-26C are graphs showing LTα1β2 (FIG.26A) and LIGHT (FIG.26B) inhibition in the presence of increasing concentrations of the indicated LTβR-LRRC15 bispecific antibody (52208) as described herein. FIG. 26C is a graph showing LTβR-LRRC15 bispecific antibody binding to LTβR expressed by HEK293 cells to confirm that non-ligand blocking activity was not due to non-receptor binding by the tested bispecific antibody. [0038] FIG. 27 provides a table summarizing the additional agonist LTβR CRD4 binding, non- ligand blocking antibodies identified in the rescreening of XenoMouse® hybridoma pools. Non-ligand blocking activity of the antibodies was assessed using the cell-based assay described in Example 9.3 and Caterra assay as described in Example 9.4. DETAILED DESCRIPTION OF THE VARIOUS EMBODIMENTS [0039] The present disclosure is directed to protein molecules that bind to and agonize the lymphotoxin-beta receptor (LTβR). The present disclosure provides agonist LTβR binding proteins that bind one or more amino acid residues of human LTβR cysteine-rich domain 4 (CRD4) comprising amino acid residues 169-211 of SEQ ID NO: 1 and (a) do not inhibit LIGHT binding to LTβR or (b) do not inhibit LTα1β2 binding to LTβR. The present disclosure also provides bispecific agonist LTβR binding proteins comprising an LTβR binding domain that binds one or more amino acid residues of human LTβR CRD4 and (a) does not inhibit LIGHT binding to LTβR or (b) does not inhibit LT1α2β binding to LTβR, and a tumor-associated antigen binding domain. [0040] The present disclosure is further directed to methods of treating cancer is a human subject. These methods comprise administering an agonist LTβR binding protein, e.g., and agonist LTβR antibody or a bispecific agonist LTβR binding protein as described herein, to a subject having cancer to induce or enhance an anti-tumor immune response in the subject. As demonstrated herein, LTβR agonism within the tumor microenvironment induces high endothelial venule formation to enhance immune cell infiltration into the tumor microenvironment. This LTβR-mediated anti-tumor immune response is sufficient to reduce tumor growth. [0041] The present disclosure further provides compositions, kits, and methods relating to agonist LTβR binding proteins that bind to human LTβR. Also provided are nucleic acid molecules comprising a sequence of polynucleotides that encode all or a portion of the agonist LTβR binding proteins disclosed herein. The present disclosure further provides vectors and plasmids comprising such nucleic acids, and cells or cell lines comprising such nucleic acids and/or vectors and plasmids. The provided methods further include, for example, methods of making, identifying, and isolating agonist LTβR binding proteins, and methods for administering, to a human subject, an agonist LTβR binding protein of the disclosure. [0042] It is to be understood that both the foregoing general description and the following detailed description are exemplary and explanatory only and are not restrictive of the invention as disclosed. [0043] Unless otherwise defined herein, scientific and technical terms used in connection with the present disclosure shall have the meanings that are commonly understood by those of ordinary skill in the art. Generally, nomenclatures used in connection with, and techniques of, cell and tissue culture, molecular biology, immunology, microbiology, genetics and protein and nucleic acid chemistry and hybridization described herein are those well-known and commonly used in the art. The methods and techniques of the present disclosure are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification unless otherwise indicated. See, e.g., Sambrook et al. Molecular Cloning: A Laboratory Manual, 2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989) and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates (1992), and Harlow and Lane Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1990), which are incorporated herein by reference. Enzymatic reactions and purification techniques are performed according to manufacturer’s specifications, as commonly accomplished in the art or as described herein. The terminology used in connection with, and the laboratory procedures and techniques of, analytical chemistry, synthetic organic chemistry, and medicinal and pharmaceutical chemistry described herein are those well-known and commonly used in the art. [0044] In this disclosure, the use of the singular terms include pluralities and plural terms shall include the singular unless specifically stated otherwise. As used herein, the singular forms “a”, “an”, and “the”' include both singular and plural referents unless the context clearly dictates otherwise. [0045] In this disclosure, the use of the term “including”, as well as other forms, such as “includes” and “included”, is not limiting. Also, terms such as “element” or “component” encompass both elements and components comprising one unit and elements and components that comprise more than one subunit unless specifically stated otherwise. Also, the use of the term “portion” can include part of a moiety or the entire moiety. [0046] The recitation of numerical ranges by endpoints includes all numbers and fractions subsumed within the respective ranges, as well as the recited endpoints. [0047] The term “about” as used herein when referring to a measurable value such as a parameter, an amount, a temporal duration, and the like, is meant to encompass variations of ±10% or less, preferably ±1–5% or less from the specified value, insofar such variations are appropriate to perform in the disclosed embodiment. It is to be understood that the value to which the modifier “about” refers is itself also specifically, and preferably, disclosed. [0048] Polynucleotide and polypeptide sequences are indicated using standard one- or three-letter abbreviations. Unless otherwise indicated, polypeptide sequences have their amino termini at the left and their carboxy termini at the right. Single-stranded nucleic acid sequences and the top strand of double- stranded nucleic acid sequences, have their 5’ termini at the left and their 3’ termini at the right. A particular section of a polypeptide can be designated by amino acid residue number such as amino acids 1 to 50, or by the actual residue at that site such as, e.g., asparagine to proline. A particular polypeptide or polynucleotide sequence also can be described by explaining how it differs from a reference sequence. [0049] The following terms, unless otherwise indicated, shall be understood to have the following meanings: [0050] “Sequence identity” refers to the relationship between two or more amino acid (polypeptide or protein) sequences or two or more nucleic acid (polynucleotide) sequences, as determined by comparing the sequences. The identity between two sequences is preferably defined by assessing their identity across the whole length of the sequence as identified herein. [0051] When comparing the identity of two or more nucleotide or amino acid sequences, the percentage of sequence identity between a first sequence and a second sequence may be calculated using methods known by a person skilled in the art, e.g., by dividing the number of residues in the first sequence that are identical to the residues at the corresponding positions in the second sequence by the total number of residues in the first sequence and multiplying by 100% or by using a known computer algorithm for sequence alignment such as NCBI Blast, e.g., BLASTN and BLASTP (Altschul, S. F. et al, J. Mol. Biol. 215:403-410 (1990), the GCG program package (Devereux, J., et al, Nucleic Acids Research 12 (1): 387 (1984)), BestFit, FASTA, and EMBOSS Needle (Madeira, F., et al, Nucleic Acids Research 47(W1): W636- W641 (2019)). [0052] “Binding affinity” generally refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., a LTβR binding protein as describe herein) and its binding partner (e.g., human LTβR). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., LTβR binding protein and LTβR). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD). Affinity can be measured and/or expressed in a number of ways known in the art, including, but not limited to, equilibrium dissociation constant (KD) and equilibrium association constant (KA). The KD is calculated from the quotient of koff/kon, whereas KA is calculated from the quotient of kon/koff. kon refers to the association rate constant of, e.g., an antibody to an antigen, and koff refers to the dissociation of, e.g., an antibody from an antigen. Binding affinity can be determined using a variety of techniques as described herein and as known in the art, for example but not limited to, equilibrium methods, e.g., enzyme-linked immunosorbent assay (ELISA), KinExA (see, e.g., Rathanaswami et al. Analytical Biochemistry, 373:52-60 (2008), which is hereby incorporated by reference in its entirety), and radioimmunoassay (RIA); a surface plasmon resonance assay; or other kinetics-based assay (e.g., BIACORE® analysis or Octet® analysis (forteBIO)). Affinity can also be determined using other methods such as indirect binding assays, competitive binding assays, fluorescence resonance energy transfer (FRET), gel electrophoresis, and chromatography (e.g., gel filtration). These and other methods may utilize a label on one or more of the components being examined and/or employ a variety of detection methods including but not limited to chromogenic, fluorescent, luminescent, or isotopic labels. A detailed description of binding affinities and kinetics can be found in Paul, W. E., ed., Fundamental Immunology, 4th Ed., Lippincott-Raven, Philadelphia (1999), which focuses on antibody-immunogen interactions. [0053] The term “binding protein” as used herein refers to any one of many forms of binding proteins known in the art. In exemplary aspects, binding proteins of the present disclosure encompass (i) full-length immunoglobulin molecules, i.e., antibodies, (ii) epitope binding fragments of antibodies, and (iii) antibody derivatives, e.g. multi-specific antibodies. [0054] As used herein, the term “antibody” refers to a protein having a conventional immunoglobulin format, comprising heavy and light chains, and comprising variable and constant regions. For example, an antibody may be an IgG which is a “Y-shaped” structure of two identical pairs of polypeptide chains, each pair having one “light” (typically having a molecular weight of about 25 kDa) and one “heavy” chain (typically having a molecular weight of about 50-70 kDa). An antibody has a variable region and a constant region. In IgG formats, the variable region is generally about 100-110 or more amino acids, comprises three complementarity determining regions (CDRs) and is primarily responsible for antigen recognition. [0055] The general structure and properties of CDRs of antibodies have been described in the art. Briefly, in an antibody scaffold, the CDRs are embedded within a framework in the heavy and light chain variable region where they constitute the regions largely responsible for antigen binding and recognition. A variable region typically comprises at least three heavy or light chain CDRs (Kabat et al., 1991, Sequences of Proteins of Immunological Interest, Public Health Service N.I.H., Bethesda, Md.; see also Chothia and Lesk, 1987, J. Mol. Biol. 196:901-917; Chothia et al., 1989, Nature 342: 877-883), within a framework region (designated framework regions 1-4, FR1, FR2, FR3, and FR4, by Kabat et al., 1991; see also Chothia and Lesk, 1987, supra). [0056] Antibodies can comprise any constant region known in the art. Human light chains are classified as kappa and lambda light chains. Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. In the present invention, antibodies are of the IgG isotype. IgG has several subclasses, including, but not limited to IgG1, IgG2, IgG3, and IgG4. The light chain constant region can be, for example, a kappa- or lambda-type light chain constant region, e.g., a human kappa- or lambda-type light chain constant region [0057] An “epitope binding fragment” of an antibody encompasses any polypeptide fragment, region, portion, or domain of a full-length antibody that exhibits the same or substantially similar binding properties of the full-length antibody and can be obtained, for example, by protease cleavage of an intact parental antibody. [0058] An “antibody derivative” is a protein or polypeptide that contains at least one epitope binding domain of an antibody and is typically formed using recombinant techniques or via chemical modification of a parent antibody or portion thereof. An antibody derivative comprises an amino acid sequence that is substantially similar to the amino acid sequence of one or more parental antibodies or relevant portions thereof. Exemplary antibody derivatives of the present disclosure include multispecific binding proteins, e.g., a bispecific binding protein. [0059] The term “epitope” as used herein refers to the site or portion of a protein to which an antibody binds. An epitope can be composed of either or both contiguous amino acid residues or discontiguous amino acid residues that form a conformational spatial unit. For a discontiguous epitope, amino acids from differing portions of the linear sequence of the antigen come in close proximity in 3- dimensional space through the folding of the protein molecule. The epitope to which a LTβR binding protein binds can be determined by hydrogen/deuterium exchange coupled with mass spectrometry as described herein. [0060] The term “paratope” as used herein refers to the portion of a binding protein, e.g., an antibody, that binds to the epitope of a protein target. A paratope can be linear in nature or can be discontinuous, formed by a spatial relationship between non-contiguous amino acid residues of an antibody rather than a linear series of amino acids. As referred to herein, “light chain paratope amino acid residues”, “heavy chain paratope amino acid residues”, or “paratope interface residues” refer to antibody light chain and/or heavy chain residues involved in the binding interaction with the protein target. The paratope may comprise amino acid residues of a single heavy chain CDR, e.g., heavy chain CDR3, or a combination of amino acid residues from the heavy chain CDRs (HCDR1, CDR2, HCDR3) and light chain CDRs (LCDR1, LCDR2, and LCDR3). As demonstrated herein, a paratope does not require all amino acid residues of a CDR and does not require amino acid residues from all six CDRs. LTβR Binding Proteins [0061] The disclosure herein encompasses agonist lymphotoxin beta receptor (LTβR) binding proteins. LTβR, also known as tumor necrosis factor (TNF) receptor superfamily member 3 and tumor necrosis factor receptor type III (TNFR-III), is a member of the TNF family that is expressed on most cell types, including fibroblasts, epithelial cells, monocytes, dendritic cells, and cells of the myeloid lineage. LTβR is not expressed by T or B lymphocytes. LTβR is a receptor for two TNF family cytokine ligands. The first of these LTβR ligands is a heterotrimer of lymphotoxin α and lymphotoxin β subunits known as LTα1β2. The second ligand of LTβR is a homotrimer of LIGHT (Tumor necrosis factor ligand superfamily member 14 (TNFSF14)). LTα1β2 and LIGHT binding to LTβR initiates a signal transduction pathway that involves primarily the NFκB pathway. LTβR signaling is involved in lymph node (LN) organogenesis during development and the maintenance of lymphoid organs and various immune cells, including neutrophils, natural killer (NK) cells and invariant natural killer T (iNKT) cells in adulthood. LTβR also plays a critical role in the formation of LN-like cell clusters known as tertiary lymphoid structures (TLS) in non-lymph organs and the induction of genes critical for T cell migration across the endothelium, both of which are key to facilitating an effective anti-tumor response. [0062] Human LTβR is a 61 kDa transmembrane protein having an amino acid sequence of SEQ ID NO: 1 (isoform 1) or SEQ ID NO: 2 (isoform 2) as shown below. The LTβR binding proteins as described herein bind to human LTβR. In one embodiment, the LTβR binding proteins of the present disclosure bind to one or more epitopes within the extracellular domain of human LTβR (comprising amino acid residues 31-227 of SEQ ID NO: 1), which contains four cysteine-rich domains (i.e., CRD1–CRD4). [0063] In one embodiment, the LTβR binding proteins described herein also bind to cynomolgus (cyno) LTβR. The amino acid sequence of cyno LTβR is provided below (SEQ ID NO: 3). In one embodiment, the LTβR binding proteins described herein do not bind to murine LTβR. In one embodiment, the LTβR binding proteins described herein bind to human LTβR and cynomolgus LTβR but do not bind to murine LTβR. [0064] In accordance with the present disclosure, the LTβR binding proteins are agonist LTβR binding proteins, for example, an agonist LTβR antibody, an agonist LTβR epitope binding fragment of an antibody, or an agonist LTβR antibody derivative (e.g., an agonist LTβR bispecific binding protein). An “agonist LTβR binding protein” as used herein is an LTβR binding molecule that induces LTβR-mediated signaling either directly, by binding to the receptor, or indirectly, via binding to the receptor and inducing its higher order clustering at the cell surface, e.g., by use of cross-linking antibodies. Binding of a LTβR binding protein of the disclosure to LTβR induces NFκB signaling, gene expression associated with T cell migration across the endothelium, and/or TLS cluster formation. Assays for measuring LTβR activation and/or the induction of LTβR signaling by a binding protein of the present disclosure are known in the art and are described herein. [0065] In one embodiment, LTβR agonism is measured by assaying interleukin-8 (IL8) release from LTβR expressing cells following incubation with an agonist LTβR binding protein as described in Example 7 herein. An increase in the level of cellular IL8 release in the presence of an LTβR binding protein of the present disclosure as compared to its absence is an indication that the LTβR binding protein functions as an agonist LTβR binding protein. In another embodiment, LTβR agonism is measured by assaying transactivation of endothelial cells. LTβR-mediated endothelial cell transactivation can be measured by assaying the endothelial cell expression of adhesion molecules, such as vascular cell adhesion protein 1 (VCAM1; also known as CD106) and/or intracellular adhesion molecule 1 (ICAM; also known as CD54), and/or the expression or secretion of inflammatory chemokines, such as, e.g., CCL5, CCL2, and CXCL10. An increase in endothelial cell VCAM or ICAM expression in the presence of an agonist LTβR binding protein as compared to in its absence is an indication that the LTβR binding protein functions as an agonist LTβR binding protein. Similarly, an increase in endothelial cell expression or secretion of CCL5, CCL2, and/or CXCL10 in the presence of an LTβR binding protein as compared to in its absence is an indication that the LTβR binding protein functions as an agonist LTβR binding protein. [0066] In one embodiment, the agonist activity of an LTβR binding protein described herein induces at least a 10% increase in LTβR signaling activity, as measured by, e.g., IL8 release or endothelial cell transactivation, relative to LTβR signaling activity in the absence of the agonist LTβR binding protein. In one embodiment, the LTβR binding protein described herein increases LTβR signaling activity by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% relative to the level of LTβR signaling in the absence of the agonist LTβR binding protein. In one embodiment, the LTβR binding protein described herein increases LTβR signaling activity by at least 100% relative to the level of LTβR signaling in the absence of the agonist LTβR binding protein. [0067] In one embodiment, the agonist activity of the LTβR binding proteins described herein is measured using one or more of the in vitro functional endpoints as described above and the activity is expressed as a half maximal effective concentration (EC50). In one embodiment, the EC50 of the LTβR binding proteins described herein is within about 1 pM to about 500 pM, about 1 pM to about 250 pM, about 1 pM to about 200 pM, about 1 pM to about 150 pM, about 1 pM to about 125 pM, about 1 to about 100 pM, about 1 pM to about 90 pM about 1 to about 80 pM about 1 pM to about 70 pM, about 1 pM to about 60 pM, about 1 pM to about 50 pM, about 1 pM to about 40 pM, about 1 to about 30 pM, about 1 to 200 pM, about 10 to about 200 pM, about 20 pM to about 200 pM, about 30 pM to about 200, about 40 pM to about 200 pM, about 50 pM to about 200 pM, about 60 pM to about 200 pM. In one embodiment, the EC50 of agonist LTβR binding protein mediated IL-8 release as described herein is about 10 pM to about 200 pM, about 20 pM to about 150 pM, or about 30 pM to about 140 pM. [0068] In one embodiment, the LTβR binding proteins as described herein bind to and agonize human LTβR while allowing endogenous LTβR ligand binding to the receptor and resulting activity to occur. As described supra, LTβR binds at least two different endogenous ligands, i.e., LIGHT and LTα1β2. When an LTβR binding protein of the present disclosure is bound to its corresponding epitope of LTβR, at least one of LIGHT or LTα1β2 can also bind to LTβR to initiate endogenous ligand-mediated signaling activity. Thus, in one embodiment, binding of an LTβR binding protein described herein does not inhibit, prevent, or preclude LTα1β2 binding to LTβR. In one embodiment, binding of an LTβR binding protein described herein does not inhibit, prevent, or preclude LIGHT binding to LTβR. In a preferred embodiment, binding of an LTβR binding protein described herein does not inhibit, prevent, or preclude either LIGHT binding to LTβR or LTα1β2 binding to LTβR. [0069] This functional feature of the agonist LTβR binding protein, referred to herein as “non- ligand blocking activity”, is a beneficial feature of the agonist LTβR binding proteins of the present disclosure because it maximizes safety upon administration of the binding protein to, e.g., a patient. Additionally, the LTβR binding proteins described herein preferentially agonize LTβR in a cross-linking dependent manner, i.e., the binding molecule must bind to LTβR and another protein (e.g., an Fc receptor or a targeting protein) to induce LTβR activation. These two features provide a superior molecule from a safety perspective. If the binding molecule binds LTβR in a non-crosslinking dependent manner, e.g., it only binds to LTβR, its binding will not agonize the receptor. In addition, because the LTβR binding protein binds LTβR in a manner that does not block endogenous ligand binding, its binding will also not unintentionally antagonize or block endogenous ligand mediated activity. [0070] In one embodiment, non-ligand blocking activity of an agonist LTβR binding protein as described herein is characterized by the percent inhibition that its binding has on LIGHT and LTα1β2 binding to LTβR. In one embodiment, LTβR binding by a binding protein of the present disclosure results in negligible inhibition or blocking of LIGHT binding (≤20% inhibition) to LTβR or LTα1β2 binding (≤20% inhibition) to LTβR as measured by the cell based receptor-ligand assay described infra (see also Example 8). For example, LTβR binding by a binding protein as described herein inhibits ≤20% of LIGHT binding to LTβR, ≤20% LTα1β2 binding to LTβR, or ≤20% of LIGHT and LTα1β2 binding to LTβR as measured by the cell-based receptor-ligand assay described herein. In one embodiment, the LTβR binding protein as described herein inhibits <20%, <15%, <10%, <9%, <8%, <7%, <6%, <5%, <4%, <3%, <2%, or <1% of LIGHT binding to LTβR or LTα1β2 binding to LTβR. In one embodiment, LTβR binding by a binding protein as described herein inhibits <15% of LIGHT binding to LTβR or inhibits <15% of LTα1β2 binding to LTβR as measured by the cell-based receptor ligand assay described herein and exemplified in Example 8.2. In one embodiment, LTβR binding by a binding protein as described herein inhibits <15% of LIGHT binding to LTβR and inhibits <15% of LTα1β2 binding to LTβR as measured by the cell-based receptor ligand assay described herein and exemplified in Example 8.2. In one embodiment, LTβR binding by a binding protein described herein inhibits < 10% of LIGHT binding to LTβR or inhibits <10% LTα1β2 binding to LTβR as measured by the cell-based receptor ligand assay described herein. In one embodiment, LTβR binding by a binding protein described herein inhibits < 10% of LIGHT binding to LTβR and inhibits <10% LTα1β2 binding to LTβR as measured by the cell-based receptor ligand assay described herein. In one embodiment, LTβR binding by a binding protein described herein inhibits < 5% of LIGHT binding to LTβR or inhibits <5% LTα1β2 binding to LTβR as measured by the cell-based receptor ligand assay described herein. In one embodiment, LTβR binding by a binding protein described herein inhibits < 5% of LIGHT binding to LTβR and inhibits <5% LTα1β2 binding to LTβR as measured by the cell-based receptor ligand assay described herein. Preferably, LTβR binding by a binding protein described herein inhibits 0% of LIGHT binding to LTβR or inhibits 0% of LTα1β2 binding to LTβR as measured by the cell- based receptor ligand assay described herein. More preferably, LTβR binding by a binding protein described herein inhibits 0% of LIGHT binding to LTβR and inhibits 0% of LTα1β2 binding to LTβR as measured by the cell-based receptor ligand assay described herein. Exemplary LTβR binding proteins described herein that do not inhibit LIGHT binding to LTβR and do not inhibit LTα1β2 binding to LTβR (i.e., exhibit 0% inhibition of LIGHT and 0% inhibition of LTα1β2 binding to LTβR) include, without limitation, the agonist LTβR binding proteins that bind to the CRD4 domain of LTβR. [0071] Alternatively, non-ligand blocking activity of an agonist LTβR binding protein as described herein is characterized by the percentage of endogenous LTβR ligand binding that occurs in the presence of bound agonist LTβR binding protein. In one embodiment, LTβR binding by a binding protein as described herein allows at least 80% of endogenous LTβR ligand (i.e., LIGHT or LTα1β2) binding to occur as measured by the cell-based receptor-ligand assay described herein (see Example 8.2). In one embodiment, LTβR binding by a binding protein as described herein allows at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% of LIGHT binding to LTβR or LTα1β2 binding to LTβR to occur. In one embodiment, LTβR binding by a binding protein as described herein allows at least 90% of LIGHT binding to LTβR to occur or at least 90% of LTα1β2 ligand binding to LTβR to occur as measured by the cell based receptor-ligand assay described herein and exemplified in Example 8. In one embodiment, LTβR binding by a binding protein as described herein allows at least 90% of LIGHT binding to LTβR to occur and at least 90% of LTα1β2 ligand binding to LTβR to occur as measured by the cell based receptor-ligand assay described herein and exemplified in Example 8. In one embodiment, LTβR binding by a binding protein as described herein allows at least 95% of LIGHT binding to LTβR to occur or at least 95% of LTα1β2 ligand binding to LTβR to occur as measured by the cell based receptor-ligand assay described herein and exemplified in Example 8. In one embodiment, LTβR binding by a binding protein as described herein allows at least 95% of LIGHT binding to LTβR to occur and at least 95% of LTα1β2 ligand binding to LTβR to occur as measured by the cell based receptor-ligand assay described herein and exemplified in Example 8. Preferably, LTβR binding by a binding protein as described herein allows 100% of LIGHT binding to LTβR occur or 100% of LTα1β2 ligand binding to LTβR to occur as measured by the cell based receptor-ligand based assay described in Example 8. More preferably, LTβR binding by a binding protein as described herein allows 100% of LIGHT binding to LTβR occur and 100% of LTα1β2 ligand binding to LTβR to occur as measured by the cell based receptor-ligand based assay described in Example 8. Exemplary agonist LTβR binding proteins described herein that allow 100% of LIGHT binding to LTβR and 100% LTα1β2 binding to LTβR are the agonist LTβR binding proteins that bind to the CRD4 domain of LTβR. [0072] Non-ligand blocking activity of the agonist LTβR binding proteins described herein is measured and quantified using a cell-based receptor-ligand binding assay. This assay measures the percent inhibition of LIGHT and/or LTα1β2 binding to LTβR in the presence of the agonist LTβR binding protein of the disclosure (see Example 8). This cell-based receptor-ligand binding assay involves incubating LTβR expressing cells with cell culture media containing the agonist LTβR binding protein for 1 hour at 4°C to allow the agonist LTβR binding protein to bind LTβR expressed on the cells. Suitable LTβR expressing cells include any cell type that naturally expresses LTβR, e.g., endothelial cells, macrophages, natural killer cells, etc., as well as cells engineered to express LTβR, e.g., a cell line (such as CHO cells, HEK 293 cells, melanoma cells, etc.) transfected with a LTβR expression vector. The concentration of agonist LTβR binding protein in the cell culture media is at a concentration effective to saturate binding of all LTβR expressed by the LTβR expressing cells. For example, the concentration of agonist LTβR binding protein in the cell culture media is at a concentration of 5-30nM to saturate binding of all LTβR expressed by the LTβR expressing cells. The assay further involves interacting the LTβR expressing cells, after incubating with the agonist LTβR binding protein, with a detectable LIGHT ligand, a detectable LTα1β2 ligand, or both (i.e., detectable LIGHT and LTα1β2 ligands) under conditions effective for the ligands to bind to LTβR. LIGHT and LTα1β2 ligands are rendered detectable by directly coupling them to a detectable label, e.g., a fluorescent label or tag. Binding of the detectable LIGHT and/or LTα1β2 ligands to the LTβR expressing cells in the presence of the agonist LTβR binding protein is detected using suitable means (e.g., Fluorescence-activated cell sorting). A quantitative assessment of ligand binding inhibition is determined by comparing the level of LIGHT and/or LTα1β binding to LTβR in the presence of an agonist LTβR binding protein to the corresponding level of LIGHT and/or LTα1β binding to LTβR in the absence of the agonist LTβR binding protein. Agonist LTβR binding proteins that minimally inhibit (≤20% inhibition) or do not inhibit (0% inhibition) LIGHT or LTα1β2 ligand binding to LTβR are identified as suitable for use in the methods described herein. The binding of the detectable LIGHT and/or LTα1β2 ligands to LTβR expressing cells in the presence or absence of the LTβR binding protein is detected via FACs on a flow cytometry machine. [0073] Exemplary agonist LTβR binding proteins described herein exhibit the desired functional properties (e.g., cyno and human LTβR binding and non-ligand blocking activity) as a result, in part, of the epitope of LTβR bound by the agonist LTβR binding protein. In one embodiment, the LTβR binding proteins as disclosed herein bind to an epitope of LTβR comprising one or more segments of a cysteine rich domain (CRD) of the extracellular domain, i.e., one or more residues of CRD1, CRD2, CRD3, or CRD4. The human LTβR extracellular domain is provided below as SEQ ID NO: 4. In one embodiment, the agonist LTβR binding protein of the present disclosure binds to an epitope comprising residues of CRD1 of LTβR. CRD1 of LTβR comprises residues 12–51 of SEQ ID NO: 4, which corresponds to residues 42-81 of the full-length LTβR of SEQ ID NO: 1. In one embodiment, the LTβR binding protein of the present disclosure binds to an epitope comprising residues of LTβR CRD2. LTβR CRD2 comprises residues 52–94 of SEQ ID NO: 4, which corresponds to residues 82-124 of the full-length LTβR of SEQ ID NO: 1. In one embodiment, the LTβR binding protein of the present disclosure binds to an epitope comprising residues of LTβR CRD3. LTβR CRD3 comprises residues 95–138 of SEQ ID NO: 4, which corresponds to residues 125-168 of the full-length LTβR of SEQ ID NO: 1. In one embodiment, the LTβR binding protein of the present disclosure binds to an epitope comprising residues of LTβR CRD4. LTβR CRD4 comprises residues 139–181 of SEQ ID NO: 4, which corresponds to residues 168–211 of the full-length LTβR amino acid sequence of SEQ ID NO: 1. [0074] In one embodiment, an agonist LTβR binding protein of the present disclosure binds to an epitope that comprises residues of the extracellular CRD2 and CRD3 of human LTβR. In one embodiment, the agonist LTβR binding protein binds to an epitope within CRD2 comprising one or more residues at positions 56–64 of SEQ ID NO: 4 and binds to an epitope spanning CRD2 and CRD3 comprising one or more residues at positions 81–101 of SEQ ID NO: 4 as determined by hydrogen/deuterium exchange (HDX) mass spectrometry (MS). In one embodiment, the agonist LTβR binding protein binds to the aforementioned regions of CRD2 and CRD3 and does not bind to a region of LTβR outside of CRD2 and CRD3. In other words, in one embodiment, the agonist LTβR binding protein binds to regions of LTβR consisting of one or more residues within CRD2 and CRD3. Binding of an LTβR binding protein to the identified regions of LTβR agonizes receptor signaling while allowing endogenous LTβR ligand binding. Agonist LTβR binding proteins that bind this epitope also bind cyno LTβR. Exemplary agonist LTβR binding proteins having these properties are identified herein as LIBC219058 (19324) and LIBC218990 (19320). [0075] In another embodiment, an agonist LTβR binding protein of the present disclosure binds to an epitope that comprises residues of the extracellular CRD1 of human LTβR. In one embodiment, the agonist LTβR binding protein described herein binds to an epitope within CRD1 comprising one or more residues at positions 3–9, 20–29, and/or 38–47 of SEQ ID NO: 4 as determined by HDX MS. In one embodiment, the agonist LTβR binding protein binds to the aforementioned regions of CRD1 and does not bind to a region of LTβR outside of CRD1. In other words, in one embodiment, the agonist LTβR binding protein binds to a region of LTβR consisting of residues within CRD1. Binding of an LTβR binding protein to this epitope of LTβR agonizes receptor signaling while allowing endogenous LIGHT ligand binding to LTβR and minimally inhibiting LTα1β2 ligand binding (≤20%). Agonist LTβR binding proteins that bind this epitope also bind cyno LTβR. An exemplary agonist LTβR binding protein having these properties is identified herein as LIBC218994 (19321). [0076] In another embodiment, an agonist LTβR binding protein of the present disclosure binds to an epitope that comprises residues of the extracellular CRD1 of human LTβR. In one embodiment, the agonist LTβR binding protein described herein binds to an epitope within CRD1 comprising one or more residues at positions 1–19 of SEQ ID NO: 4 as determined by HDX MS. In one embodiment, the agonist LTβR binding protein binds to the aforementioned regions of CRD1 and does not bind to a region of LTβR outside of CRD1. In other words, in one embodiment, the agonist LTβR binding protein binds to a region of LTβR consisting of residues within CRD1. Binding of an LTβR binding protein to this epitope of LTβR agonizes receptor signaling and does not inhibit endogenous LIGHT binding to LTβR and does not inhibit endogenous LTα1β2 binding to LTβR. Agonist LTβR binding proteins that bind this epitope also bind cyno LTβR. An exemplary agonist LTβR binding protein having these properties is identified herein as LIBC219051 (19323). [0077] In another embodiment, an agonist LTβR binding protein of the present disclosure binds to an epitope that comprises residues of the extracellular CRD4 of human LTβR. In one embodiment, the agonist LTβR binding protein described herein binds to an epitope within CRD4 comprising one or more residues at positions 168–179 of the extracellular domain of LTβR (SEQ ID NO: 4) (residues 197-209 of SEQ ID NO: 1) as determined by HDX MS. In one embodiment, the agonist LTβR binding protein binds to the aforementioned region of CRD4 and does not bind to a region of LTβR outside of CRD4. In other words, in one embodiment, the agonist LTβR binding protein binds to a region of LTβR consisting of residues within CRD4. Binding of an agonist LTβR binding protein to this epitope of LTβR agonizes receptor signaling and does not inhibit endogenous LIGHT binding to LTβR and does not inhibit endogenous LTα1β2 binding to LTβR. Agonist LTβR binding proteins that bind this epitope also bind cyno LTβR. Exemplary agonist LTβR binding protein having these properties are identified herein as LIBC219081 (19325) and LIBC218979 (19319). [0078] LTβR binding proteins that have an identical or overlapping epitope with the exemplary agonist LTβR binding proteins disclosed herein will compete with each other for binding to LTβR. Thus, in one embodiment, an exemplary agonist LTβR binding protein of the disclosure competes for binding to CRD4 with LIBC219081 (19325) and/or LIBC218979 (19319). To “compete” or “be in competition with” means the LTβR binding protein competes for the same epitope or binding site on a target. Such competition can be determined by an assay in which a reference agonist LTβR binding protein, such as agonist LTβR binding proteins LIBC219081 (19325) and LIBC218979 (19319), prevents or inhibits specific binding of a test LTβR binding protein. An exemplary competitive binding assay that can be utilized to identify agonist LTβR binding proteins encompassed by the present disclosure that compete for binding to CRD4 of LTβR is described herein in Example 9.2. Usually, when a competing LTβR binding protein is present in excess, it will inhibit binding of a reference agonist LTβR binding protein to a common epitope by at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, or at least 75%. In some instances, binding of a reference agonist LTβR binding protein to LTβR is inhibited by at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more. Exemplary agonist LTβR binding proteins of the present disclosure that compete for binding to the CRD4 domain of LTβR with the binding proteins identified herein as LIBC219081 (19325) and LIBC218979 (19319) are described herein (see Tables 2–4 and 6–8). [0079] An agonist LTβR binding protein of the present disclosure is a protein that binds to and agonizes LTβR without blocking or inhibiting one or both endogenous LTβR ligands from binding LTβR. The LTβR binding proteins described herein comprise one or more amino acid binding domains that alone, or in combination, bind a region of LTβR and activate signaling activity of the receptor. Optionally, the agonist LTβR binding proteins further comprise a scaffold or framework portion that allows the one or more binding domains to adopt a conformation that promotes a binding interaction between the binding domain(s) and LTβR. Exemplary LTβR binding proteins include, without limitation, LTβR antibodies (i.e., immunoglobulins), epitope binding fragments of an LTβR antibody, and LTβR antibody derivatives, each of which is described in more detail herein. [0080] An agonist LTβR binding protein as disclosed herein binds to its corresponding epitope within the extracellular domain of LTβR. In one embodiment, an agonist LTβR binding protein of the present disclosure binds epitope residues within CRD4 of the extracellular domain of LTβR (i.e., residues 139–181 of SEQ ID NO: 4 (ECD); residues 169–211 of SEQ ID NO: 1 (full-length LTβR)) more frequently, more rapidly, with greater duration and/or with greater affinity or avidity than an alternative epitope. In one embodiment, the agonist LTβR binding proteins described herein bind to any 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acid residues of the extracellular CRD4 domain of LTβR, in particular one or more residues of 168-179 of SEQ ID NO: 4 or one or more residues of 168–178 of SEQ ID NO: 4. [0081] In accordance with the present disclosure, an agonist LTβR binding protein binds to LTβR with a tight binding affinity as determined by an equilibrium dissociation constant (KD) value of 10-7 M or less. In one embodiment, an agonist LTβR binding protein of the present disclosure (e.g., an LTβR antibody, epitope-binding fragment, or antibody derivative) binds human LTβR with an equilibrium dissociation constant or KD (koff/kon) of less than 10-7 M, less than 10-8 M, less than 10-9 M, less than 10-10 M, or less than 10-11 M less than 10-12 M, or less than 10-13 M (lower values indicating tighter binding affinity). [0082] In one embodiment, agonist LTβR binding proteins of the disclosure (e.g., antibodies, epitope-binding fragments, and antibody derivatives) bind human LTβR with an equilibrium dissociation constant or KD (koff/kon) of between about 10-7 M and about 10-11 M, between about 10-7 M and about 10-10 M, between about 10-7 M and about 10-9 M, between about 10-7 M and about 10-8 M, between about 10-8 M and about 10-9 M, between about 10-9 M and about 10-10 M, between about 10-10 M and about 10-11 M, between about 10-11 M and about 10-12 M, between about 10-12 M and about 10-13 M. In any embodiment, agonist LTβR binding proteins of the disclosure specifically bind human LTβR with a KD of between about 10-8 M and about 10-11 M or between about 10-9 M and about 10-10 M. [0083] In one embodiment, agonist LTβR binding proteins of the disclosure (e.g., antibodies, epitope-binding fragments, and antibody derivatives) specifically bind human LTβR with an equilibrium dissociation constant or KD (koff/kon) of between about 0.01 mM and about 10 nM, between about 0.01 nM and about 9 nM, between about 0.01 nM and about 8 nM, between about 0.01 nM and about 7 nM, between about 0.01 nM and about 6 nM, between about 0.01 nM and about 5 nM, between about 0.01 nM and about 4 nM, between about 0.01 nM and about 3 nM, between about 0.01 nM and about 2 nM, between about 0.01 nM and about 1 nM, between about 0.1 nM and about 10 nM, between about 0.1 nM and about 9 nM, between about 0.1 nM and about 8 nM, between about 0.1 nM and about 7 nM, between about 0.1 nM and about 6 nM, between about 0.1 nM and about 5 nM, between about 0.1 nM and about 4 nM, between about 0.1 nM and about 3 nM, between about 0.1 nM and about 2 nM, between about 0.1 nM and about 1 nM, or between about 0.01 nM and about 0.1 nM. [0084] The agonist LTβR binding proteins of the disclosure that bind to human LTβR also bind to cynomolgus monkey (cyno) LTβR with the same or similar affinities. The amino acid sequence of cyno LTβR is provided herein as SEQ ID NO: 3. In exemplary aspects, the agonist LTβR binding proteins described herein bind to cynomolgus monkey LTβR with a KD of between about 10-7 M and about 10-8 M, between about 10-8 M and about 10-9 M, between about 10-9 M and about 10-10 M, between about 10-10 M and about 10-11 M, between about 10-11 M and about 10-12 M. In any embodiment, LTβR binding proteins of the disclosure specifically bind cyno LTβR with a KD of between about 10-8 M and about 10-10 M. [0085] In one embodiment, agonist LTβR binding proteins of the disclosure (e.g., antibodies, epitope-binding fragments, and antibody derivatives) bind cynomolgus monkey (cyno) LTβR with an equilibrium dissociation constant or KD (koff/kon) of between about 0.1 nM and about 30 nM, between about 0.1 nM and about 20 nM, between about 0.1 nM and about 10 nM, between about 0.1 nM and about 9 nM, between about 0.1 nM and about 8 nM, between about 0.1 nM and about 7 nM, between about 0.1 nM and about 6 nM, between about 0.1 nM and about 5 nM, between about 0.1 nM and about 4 nM, between about 0.1 nM and about 3 nM, between about 0.1 nM and about 2 nM, or between about 0.1 nM and about 1 nM. [0086] The agonist LTβR binding proteins of the present disclosure bind with high affinity to both human LTβR and cyno LTβR. For example, the KD of the agonist LTβR binding protein for human LTβR is within about 100-fold, about 50-fold, about 25-fold, about 10-fold, about 5-fold, or about 2-fold or less of the KD of the agonist LTβR binding protein for cyno LTβR. In one embodiment, the KD of the agonist LTβR binding protein for human LTβR is about 10-fold or less of the KD of the agonist LTβR binding protein for cyno LTβR. [0087] The agonist LTβR binding proteins as disclosed herein bind to the LTβR extracellular domain with an affinity corresponding to a KD that is at least ten-fold lower, such as at least 100-fold lower, for instance at least 1,000-fold lower, such as at least 10,000-fold lower, for instance at least 100,000-fold lower than its affinity for binding to a non-specific antigen (e.g., TNFR-I or TNFR-II, etc.). The amount with which the affinity is lower is dependent on the KD of the binding protein to LTβR, so that when the KD of the agonist LTβR binding protein is very low (that is, the binding protein is highly specific), then the amount with which the affinity for LTβR is lower than the affinity for a non-specific antigen may be at least 10,000-fold. [0088] In one embodiment, the agonist LTβR binding protein of the present disclosure is an LTβR antibody , an epitope-binding fragment of an LTβR antibody (e.g., an LTβR binding Fab, Fab′, F(ab′)2), or an LTβR antibody derivative (e.g., LTβR scFv, minibody, diabody, or multi-specific binding protein) as described herein. [0089] In one embodiment, an agonist LTβR binding protein of the present disclosure is an antibody as defined herein. The term “antibody” also includes antibodies comprising 1, 2, 3, 4, or 5 amino acid residue insertions or deletions at the N-terminus and/or C-terminus of the heavy and/or light chain that retain the same or similar binding and/or function as the antibodies comprising two heavy chains and two light chains not comprising these amino acid residue substitutions, insertions, or deletions. [0090] The heavy and light chain variable regions (VH and VL, respectively) of an antibody and other binding molecules described herein (i.e., epitope-binding fragments of an antibody and antibody derivatives) are responsible for LTβR recognition and binding, while the heavy and light chain constant regions mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system. Within light and heavy chains, the variable (V) and constant regions (C) are joined by a “J” region of about 12 or more amino acids, with the heavy chain also including a “D” region of about 10 more amino acids (see generally, Fundamental Immunology Ch.7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989), which is hereby incorporated by reference in its entirety). The variable regions of each light/heavy chain pair form the antibody binding site such that an intact immunoglobulin has two binding sites. [0091] The VH and VL regions of an LTβR antibody and other LTβR binding proteins as described herein are further subdivided into regions of hypervariability, termed “complementarity determining regions,” or “CDRs,” that are interspersed within regions of more conserved sequence, termed “framework regions” (FR). One or more residues within one or more variable region CDRs of the heavy and light chains form a binding domain that interacts with an antigen, e.g., LTβR. Exemplary VH and VL domain sequences and VH and VL CDR sequences of LTβR antibodies and binding proteins of the present disclosure are described in more detail infra. [0092] In one embodiment, an agonist LTβR binding protein of the present disclosure is an epitope- binding fragment of a LTβR antibody. As used herein, the terms “fragment”, “region”, “portion”, and “domain” are generally intended to be synonymous, unless the context of their use indicates otherwise. Fragments of antibodies (e.g., Fab and (Fab′)2 fragments) that exhibit LTβR binding ability can be obtained, for example, by protease cleavage of an intact parental antibody. Alternatively, the epitope binding fragment of the LTβR antibody is an amino acid sequence that comprises a portion of the amino acid sequence of such parental antibody. Exemplary LTβR-binding fragments encompassed by the present disclosure include, without limitation, (i) Fab' or Fab fragments, which are monovalent fragments containing the VL, VH, CL and CH1 domains as described supra; (ii) F(ab')2 fragments, which are bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) Fd fragments consisting essentially of the VH and CH1 domains; (iv) Fv fragments consisting essentially of a VL and VH domain; (v) single domain antibodies or dAb fragments (Ward et al. “Binding Activities Of A Repertoire Of Single Immunoglobulin Variable Domains Secreted From Escherichia coli ,” Nature 341 :544-546 (1989), which is hereby incorporated by reference in its entirety), which consist essentially of a VH or VL domain (or an epitope binding portion of the VH or VL) and are also called domain antibodies or nanobodies (Holt et al. “Domain Antibodies: Proteins For Therapy,” Trends Biotechnol. 21(11):484-490 (2003); Revets et al. “Nanobodies As Novel Agents For Cancer Therapy,” Expert Opin. Biol. Ther.5(1):111-124 (2005), which are hereby incorporated by reference in their entirety); and (vi) isolated complementarity determining regions (CDR). [0093] An agonist LTβR epitope-binding fragment of the present disclosure may contain 1, 2, 3, 4, 5 or all 6 of the CDR domains of an LTβR antibody as disclosed herein. In one embodiment, an epitope- binding fragment of an LTβR antibody comprises, essentially consists of, or consists of 30 to 100 amino acid residues, or 50 to 150 amino acid residues, or 70 to 200 amino acid residues of the parental LTβR antibody. In one embodiment, the length of an epitope-binding fragment of an LTβR antibody is at least 40%, 50%, 60%, 70%, 80%, 90% or 95% of the length of the LTβR antibody. In one embodiment, an LTβR epitope-binding fragment of the present disclosure elicits the same or similar activity of the LTβR antibody from which the fragment is derived from. In one embodiment, agonist LTβR epitope-binding fragments and LTβR antibodies as described herein elicit detectable LTβR binding activity and induce LTβR signaling as disclosed herein. [0094] Epitope-binding fragments of an LTβR antibody may be obtained using conventional techniques known to those of skill in the art. For example, agonist LTβR F(ab')2 fragments may be generated by treating an agonist LTβR antibody with pepsin. The resulting LTβR F(ab')2 fragment may be treated to reduce disulfide bridges to produce LTβR Fab' fragments. Agonist LTβR Fab fragments may be obtained by treating an agonist LTβR antibody with papain, and LTβR Fab' fragments may be obtained with pepsin digestion of an agonist LTβR antibody. An agonist LTβR Fab' fragment may be obtained by treating an agonist LTβR F(ab')2 fragment with a reducing agent, such as dithiothreitol. LTβR-binding fragments may also be generated by expression of nucleic acids encoding such fragments in recombinant cells (see e.g., Evans et al. “Rapid Expression Of An Anti-Human C5 Chimeric Fab Utilizing A Vector That Replicates In COS And 293 Cells,” J. Immunol. Meth.184:123-38 (1995), which is hereby incorporated by reference in its entirety). For example, a chimeric gene encoding a portion of a LTβR F(ab')2 fragment could include DNA sequences encoding the CH1 domain and hinge region of the heavy chain, followed by a translational stop codon to yield such a truncated antibody fragment molecule. Suitable fragments capable of binding to a desired epitope of LTβR may be readily screened for utility in the same manner as an antibody. LTβR antibodies and their epitope-binding fragments of the present disclosure are “isolated” so as to exist in a physical milieu distinct from that in which it was produced or would be naturally occurring. [0095] In one embodiment, the agonist LTβR binding protein of the present disclosure is an antibody derivative. Agonist LTβR antibody derivatives include proteins or polypeptides that contain at least one epitope binding domain of an agonist LTβR antibody and are typically formed using recombinant techniques. Agonist LTβR antibody derivatives can also or alternatively be obtained through chemical modification of a parent LTβR antibody or portion thereof. An agonist LTβR antibody derivative comprises an amino acid sequence that is substantially similar to the amino acid sequence of such parental antibody or relevant portion of the parental antibody, for example, differing by less than 30%, less than 20%, less than 10%, or less than 5% from such parental LTβR antibody or relevant portion thereof, or by 10 amino acid residues, or by fewer than 10, 9, 8, 7, 6, 5, 4, 3 or 2 amino acid residues from such parental molecule or relevant portion thereof. [0096] An exemplary agonist LTβR antibody derivative of the present disclosure is a single chain Fv (scFv). An agonist LTβR scFv is formed from the two domains of the Fv fragment, i.e., the VL region and the VH region, which may be encoded by separate genes. Such gene sequences or their encoding cDNA are joined, using recombinant methods, by a flexible linker (typically of about 10, 12, 15 or more amino acid residues) that enables them to be made as a single protein chain in which the VL and VH regions associate to form monovalent epitope-binding proteins (see e.g., Bird et al. “Single-Chain Antigen-Binding Proteins,” Science 242:423-426 (1988); and Huston et al. “Protein Engineering Of Antibody Binding Sites: Recovery Of Specific Activity In An Anti-Digoxin Single-Chain Fv Analogue Produced In Escherichia coli,” Proc. Natl. Acad. Sci. (U.S.A.) 85:5879-5883 (1988), which are hereby incorporated by reference in their entirety). [0097] Another exemplary agonist LTβR antibody derivative of the present disclosure is a bispecific scFv. A bispecific LTβR scFv can be formed by employing a flexible linker that enables the VL and VH regions of different single polypeptide chains (each having different epitope binding specificities) to associate together. [0098] In another embodiment, the agonist LTβR antibody derivative of the present disclosure is a divalent or bivalent single chain variable fragment, engineered by linking two scFvs together either in tandem (i.e., tandem scFv), or such that they dimerize to form a diabody (Holliger et al. “‘Diabodies’ : Small Bivalent And Bispecific Antibody Fragments,” Proc. Natl. Acad. Sci. (U.S.A.) 90(14), 6444-8 (1993); which is hereby incorporated by reference in its entirety). In accordance with this embodiment, each scFv in the bivalent tandem scFv or diabody can be the same, i.e., recognize the same target epitope of LTβR or can be different, i.e., recognize and bind different target epitopes. In yet another embodiment, the agonist LTβR antibody derivative is a triabody, i.e., a trivalent single chain variable fragment, engineered by linking three scFvs together, either in tandem or in a trimer formation to form a triabody. In accordance with this embodiment, each scFv of the triabody can be the same, i.e., recognize the same target epitope, or can be different, i.e., recognize and bind different target epitopes. In another embodiment, the agonist LTβR antibody derivative is a tetrabody of four single chain variable fragments, where each of the scFv recognize the same or different target epitopes. In another embodiment, the agonist LTβR antibody derivative is a “linear antibody” which is an antibody comprising a pair of tandem Fd segments (VH-CH1- VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (see Zapata et al. Protein Eng.8(10): 1057-1062 (1995), which is hereby incorporated by reference in its entirety). In another embodiment, the agonist LTβR antibody derivative is a minibody, comprising single-chain Fv regions coupled to the CH3 region (i.e., scFv-CH3). In another embodiment, the agonist LTβR antibody derivative is a modified domain antibody, e.g., a modified single VL or VH domain or two or more VH domains joined by a peptide linker (see, e.g., Ward et al., Nature, 341:544-546 (1989), which is hereby incorporated by reference in its entirety); a maxibody, i.e., two scFvs fused to Fc region (see, e.g., Fredericks et al., Protein Engineering, Design & Selection, 17:95-106 (2004) and Powers et al., J. Immunol. Methods, 251:123-135 (2001), which are hereby incorporated by reference in their entirety); or a peptibody (one or more peptides attached to an Fc region, see PCT Appl. Publ. No. WO00/024782 to Feige, which is hereby incorporated by reference in its entirety). In another embodiment, the agonist LTβR antibody derivative is an immunoglobulin fusion protein, which comprises an agonist LTβR binding domain (i.e., polypeptide comprising one or more heavy chain and/or light chain CDRs as described herein) coupled to a hinge region polypeptide and one or more immunoglobulin constant regions (see e.g., U.S. Patent Appl. Pub. No. 20030133939, which is hereby incorporated by reference in its entirety). Exemplary immunoglobulin fusion protein formats include, without limitation, an IgG-scFv, an IgG-Fab, 2scFv-IgG, 4scFv-IgG, VH-IgG, IgG-VH, and Fab-scFv-Fc. [0099] Another exemplary agonist LTβR antibody derivative of the present disclosure is a multi- specific binding antibody, e.g., a bispecific or tri-specific binding protein. Multi-specific agonist LTβR binding proteins of the present disclosure comprise a first binding domain that binds to LTβR and is coupled to one or more additional binding domains, where each additional binding domain binds a target moiety that is not LTβR. An exemplary agonist LTβR multi-specific binding protein of the disclosure is a bispecific agonist LTβR binding protein that comprises an LTβR binding domain and a tumor-associated antigen binding domain. Exemplary LTβR binding domains of a bispecific agonist LTβR binding protein include the binding domains from any one of the LTβR antibodies disclosed herein. In one embodiment, the bispecific agonist LTβR binding protein comprises an LTβR binding domain that binds one or more amino acid residues of human LTβR cysteine-rich domain 4 (CRD4) comprising amino acid residues 169- 211 of SEQ ID NO: 1. This bispecific agonist binding protein does not inhibit LIGHT binding to LTβR and does not inhibit LT1α2β binding to LTβR. [0100] In accordance with the present disclosure, the agonist LTβR binding protein is a human agonist LTβR binding protein. A human agonist LTβR binding protein comprises variable and constant regions or domains which correspond substantially to human germline immunoglobulin sequences known in the art, including, for example, those described by Kabat et al. (1991). The human agonist LTβR binding protein disclosed herein may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs, and, in particular, CDR3. The human agonist LTβR binding proteins of the present disclosure may have at least one, two, three, four, five, or more positions replaced with an amino acid residue that is not encoded by the human germline immunoglobulin sequence. The definition of human agonist binding proteins as used herein also contemplates fully human antibodies, which include non-artificially and/or non-genetically altered human sequences of antibodies as those can be derived by using technologies or systems known in the art, such as, for example, phage display technology or transgenic mouse technology, including but not limited to the XenoMouse®, which is a transgenic mouse capable of producing human antibodies. [0101] In one embodiment, the agonist LTβR binding protein of the present disclosure is an IgG isotype. The choice of isotype typically will be guided by the desired effector functions, such as antibody- dependent cellular cytotoxicity (ADCC) induction. Exemplary IgG isotypes are IgG1, IgG2, IgG3, and IgG4. In one embodiment, the agonist LTβR binding protein of the present disclosure is an IgG1 isotype. In one embodiment, the agonist LTβR binding protein of the present disclosure is an IgG2 isotype. [0102] In accordance with all aspects of the present disclosure, the binding domain of an exemplary agonist LTβR binding protein disclosed herein comprises one or more VH and VL CDRs that can be delineated using any one of the standard methods known in the art, including and without limitation, the Kabat numbering scheme (Kabat et al., Sequences of Proteins of Immunological Interest, 5th ed., U.S. Dept. of Health and Human Services, NIH (1991)), Chothia numbering scheme (Chothia et al., J. Mol. Biol.196: 901-917 (1987) and Al-Lazikani et al., J. Mol. Biol. 273: 927-948 (1997), which are hereby incorporated by reference in their entirety), the Abhinandan numbering scheme (Abhinandan et al., Mol. Immunol.45: 3832-3839 (2008), which is hereby incorporated by reference in its entirety), the immunogenetic (IMGT) database numbering scheme (Giudicelli et al., Nucl. Acids Res. 34: D781–784 (2006) and Lefranc et al., Dev. Comp. Immunol.27: 55-77 (2003), which are hereby incorporated by reference in their entirety), the Aho numbering scheme (Honegger et al., J. Mol. Biol.309: 657-670 (2001), which is hereby incorporated by reference in its entirety), and the Contact numbering scheme (MacCallum et al., J. Mol. Biol.262732- 745 (1996), which is hereby incorporated by reference in its entirety). The residues of the VH and VL regions that comprise CDRs according to each system are provided in Table 1 below. Table 1. VH and VL CDR Residues According to Known Numbering Schemes [0103] In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a HCDR1, HCDR2, and HCDR3 of any one of the heavy chain variable region sequences as provided in Tables 4, 8, and 12, and a LCDR1, LCDR2, and LCDR3 of the corresponding light chain variable region as also provided in Tables 4, 8, and 12, where the CDRs are defined by the Kabat numbering scheme. In another embodiment, an agonist LTβR binding protein of the present disclosure comprises a HCDR1, HCDR2, and HCDR3 of any one of the heavy chain variable region sequences as provided in Tables 4, 8, and 12, and a LCDR1, LCDR2, and LCDR3 of the corresponding light chain variable region as also provided in Tables 4, 8, and 12, where the CDRs are defined by the Chothia numbering scheme. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a HCDR1, HCDR2, and HCDR3 of any one of the heavy chain variable region sequences as provided in Tables 4, 8, and 12, and a LCDR1, LCDR2, and LCDR3 of the corresponding light chain variable region as provided in Tables 4, 8, and 12, where the CDRs are defined by the AbM numbering scheme. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a HCDR1, HCDR2, and HCDR3 of any one of the heavy chain variable region sequences as provided in Tables 4, 8, and 12, and a LCDR1, LCDR2, and LCDR3 of the corresponding light chain variable region as also provided in Tables 4, 8, and 12, where the CDRs are defined by the IMGT numbering scheme. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a HCDR1, HCDR2, and HCDR3 of any one of the heavy chain variable region sequences as provided in Tables 4, 8, and 12, and a LCDR1, LCDR2, and LCDR3 of the corresponding light chain variable region as also provided in Tables 4, 8, and 12, where the CDRs are defined by the Contact numbering scheme. In one embodiment, the agonist LTβR binding protein is an antibody. In one embodiment, the agonist LTβR binding protein is a bispecific antibody. LTβR Agonist Binding Proteins that Bind CRD4 [0104] In one embodiment, agonist LTβR binding proteins of the present disclosure bind to an epitope comprising residues of CRD4 of LTβR. CRD4 of LTβR span residues 139–181 of SEQ ID NO: 4 (LTβR ECD), which corresponds to residues 169–211 of SEQ ID NO: 1 (full-length LTβR). In one embodiment, the agonist LTβR binding protein described herein binds to an epitope comprising one or more CRD4 residues at positions 168–179 of the extracellular domain of LTβR (SEQ ID NO: 4) (residues 197- 209 of SEQ ID NO: 1) as determined by HDX MS. In one embodiment, the agonist LTβR binding proteins of the present disclosure bind to an epitope comprising residues of LTβR CRD4 and also binds to one or more residues outside of the CRD4. For example, in one embodiment, the agonist LTβR binding protein binds to an epitope comprising residues of CRD4 and residues of the adjacent CRD3 of LTβR. CRD3 of LTβR comprises residues 95–138 of SEQ ID NO: 4, which corresponds to residues 125-168 of the full- length LTβR of SEQ ID NO: 1. [0105] In one embodiment, the agonist LTβR binding proteins of the present disclosure bind to an epitope of LTβR within CRD4 of LTβR and do not bind to a region of LTβR outside of the CRD4 as defined herein. In other words, in one embodiment, the agonist LTβR binding protein binds to an epitope consisting of residues within CRD4 of LTβR. [0106] Binding of an agonist LTβR binding protein to CRD4 of LTβR agonizes receptor signaling and does not inhibit endogenous LTβR ligand (i.e., LIGHT or LTα1β2) binding to the receptor. In some embodiments, the agonist LTβR binding protein having these properties is an antibody. Exemplary agonist LTβR antibodies having these functional features are disclosed herein (see Tables 2–4 and 6–8). In some embodiments, the agonist LTβR binding protein having these properties is a bispecific binding protein. Exemplary agonist LTβR bispecific binding proteins having these functional features comprise a LTβR binding domain from the exemplary agonist LTβR antibodies disclosed herein. [0107] In accordance with the present disclosure, agonist LTβR binding proteins having these functional properties, i.e., binding proteins that bind residues of CRD4 of LTβR and do not block LIGHT binding to LTβR or LTα1β2 binding to LTβR, are defined by their shared heavy chain variable region (VH) CDR structure. These agonist LTβR binding proteins can further be defined by their shared light chain variable region (VL) CDR structure. This shared CDR structure, which is presented as consensus VH CDR and VL CDR sequences, was derived from the alignment of VH and VL domains of exemplary agonist LTβR binding proteins disclosed herein (Table 4), which (i) possess the above noted functional characteristics and (ii) comprise VH and VL amino acid sequences that have at least 90% sequence identity to the VH and VL amino acid sequences, respectively, of the LTβR binding proteins LIBC219081 and LIBC 218979. [0108] Accordingly, in one embodiment, agonist LTβR binding proteins of the present disclosure that (i) bind residues of LTβR CRD4 and (ii) do not block LIGHT binding to LTβR and do not block LTα1β2 binding to LTβR comprise a shared VH CDR structure defined by the HCDR1 amino acid sequence of: X1YX3MX5 (SEQ ID NO: 5), where X1 is S or N; X3 is G, D, or A; and X5 is H or Y; the HCDR2 amino acid sequence of: X1IX3YDX6X7X8X9Y X11X12DSVKG (SEQ ID NO: 6), where X1 is A or V; X3 is W or R; X6 is E or G; X7 is S, R, or T; X8 is N or K; X9 is K, R, or Q; X11 is H or Y; and X12 is A or E; and the HCDR3 amino acid sequence of: X1RX3X4X5X6 X7X8X9YYGX13X14V (SEQ ID NO: 7), where X1 is D or E; X3 is V, G, or I; X4 is V, P, or A; X5 is A, Y, or G; X6 is R, A, G, or H; X7 is P or G; X8 is G, N, D, Y, A or H; X9 is Y, T, or F; X13 is L or M; and X14 is D or A. In some embodiments, the agonist LTβR binding protein is an antibody. In some embodiments, the agonist LTβR binding protein is a bispecific binding protein. [0109] Heavy chain CDR sequences of exemplary agonist LTβR binding proteins (e.g., antibodies or bispecific binding proteins) that bind CRD4 of LTβR, do not block LIGHT or LTα1β2 binding or activity, and comprises a HCDR1 of SEQ ID NO: 5, a HCDR2 of SEQ ID NO: 6, and a HCDR3 of SEQ ID NO: 7 are provided in Table 2 below. TABLE 2: Heavy Chain CDR Sequences of LTβR CRD4 Binders comprising 90% Sequence Identity to the Fv Domains of LIBC219081 and LIBC218979
[0110] In one embodiment, agonist LTβR binding proteins that (i) bind residues of LTβR CRD4, and (ii) do not block LIGHT binding to LTβR and do not block LTα1β2 binding to LTβR comprise a shared VL CDR structure defined by the LCDR1 amino acid sequence of: SGDX4LPX7X8YX10Y (SEQ ID NO: 62), where X4 is A or T; X7 is E, K, Q, D or N; X8 is Q or H; and X10 is A or T; the LCDR2 amino acid sequence of: KDNERPS (SEQ ID NO: 63); and the LCDR3 amino acid sequence of: QSX3DX5SX7X8YX10X11 (SEQ ID NO: 64), where X3 is A or T; X5 is S, G, or N; X7 is G or A; X8 is T, S, or A; X10 is V or M; and X11 is I or V. [0111] Light chain CDR sequences of exemplary agonist LTβR binding proteins that bind CRD4 of LTβR, do not block LIGHT or LTα1β2 binding or activity, and comprises a LCDR1 of SEQ ID NO: 62, a LCDR2 of SEQ ID NO: 63, and a LCDR3 of SEQ ID NO: 64 are provided in Table 3 below. TABLE 3: Light Chain CDRs of Exemplary LTβR CRD4 Binders Comprising 90% Sequence Identity to the Fv Domains of LIBC219081 and LIBC218979
[0112] In one embodiment, agonist LTβR binding proteins that bind residues of human LTβR CRD4 and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR include those binding proteins possessing VH and VL amino acid sequences that have at least 80% sequence identity to the VH and VL amino acid sequences, respectively, of the LTβR binding protein LIBC219081 (SEQ ID NOs: 121 and 122, respectively). In one embodiment, agonist LTβR binding proteins that bind human LTβR CRD4 and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR include those binding proteins possessing VH and VL amino acid sequences that have at least 80% sequence identity to the VH and VL amino acid sequences, respectively, of the LTβR binding protein LIBC218979 (SEQ ID NOs: 123 and 124, respectively). In one embodiment, agonist LTβR binding proteins that bind human LTβR CRD4 and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR include those binding proteins possessing VH and VL amino acid sequences that have at least 80% sequence identity to the VH and VL amino acid sequences, respectively, of LTβR binding proteins LIBC219081 (SEQ ID NOs: 121 and 122, respectively) and LIBC218979 (SEQ ID NOs: 123 and 124, respectively). [0113] In one embodiment, agonist LTβR binding proteins (e.g., antibodies or bispecific binding proteins) that bind human LTβR CRD4 and (a) do not block LIGHT binding to LTβR or (b) do not block LTα1β2 binding to LTβR include those binding proteins possessing VH and VL amino acid sequences that have at least 85% sequence identity to the VH and VL amino acid sequences, respectively, of the LTβR binding protein LIBC219081 (SEQ ID NOs: 121 and 122, respectively). In one embodiment, agonist LTβR binding proteins that bind human LTβR CRD4 and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR include those binding proteins possessing VH and VL amino acid sequences that have at least 85% sequence identity to the VH and VL amino acid sequences, respectively, of the LTβR binding protein LIBC218979 (SEQ ID NOs: 123 and 124, respectively). In one embodiment, agonist LTβR binding proteins that bind human LTβR CRD4 and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR include those binding proteins possessing VH and VL amino acid sequences that have at least 85% sequence identity to the VH and VL amino acid sequences, respectively, of the LTβR binding proteins LIBC219081 (SEQ ID NOs: 121 and 122, respectively) and LIBC218979 (SEQ ID NOs: 123 and 124, respectively). [0114] In one embodiment, agonist LTβR binding proteins (e.g., antibodies or bispecific binding proteins) that bind human LTβR CRD4 and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR include those binding proteins possessing VH and VL amino acid sequences that have at least 90% sequence identity to the VH and VL amino acid sequences, respectively, of the LTβR binding proteins LIBC219081 and LIBC218979. Accordingly, in one embodiment, an agonist LTβR binding protein of the present disclosure comprises a VH amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 121. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a VH amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 123. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a VH amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 121 and the amino acid sequence of SEQ ID NO: 123. Exemplary VH amino acid sequences having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 121 and SEQ ID NO: 123 are provided in Table 4 below. [0115] In one embodiment, agonist LTβR binding proteins (e.g., antibodies or bispecific binding proteins) that bind human LTβR CRD4 and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR include those binding proteins comprising a VH amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 121. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a VH amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 123. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a VH amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 121 and the amino acid sequence of SEQ ID NO: 123. Exemplary VH amino acid sequences having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 121 and SEQ ID NO: 123 are provided in Table 4 below. [0116] In one embodiment, agonist LTβR binding proteins (e.g., antibodies or bispecific binding proteins) that bind human LTβR CRD4 and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR include those binding proteins comprising a VL amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 122. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a VL amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 124. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a VL amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 122 and the amino acid sequence of SEQ ID NO: 124. Exemplary VL amino acid sequences having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 122 and SEQ ID NO: 124 are provided in Table 4 below. [0117] In one embodiment, agonist LTβR binding proteins (e.g., antibodies or bispecific binding proteins) that bind human LTβR CRD4 and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a VH amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 121 and a VL amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 122. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a VH amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 121 and a VL amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 122. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a VH amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 121 and a VL amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 122. [0118] In one embodiment, agonist LTβR binding proteins (e.g., antibodies or bispecific binding proteins) that bind human LTβR CRD4 and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a VH amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 123 and a VL amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 124. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a VH amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 123 and a VL amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 124. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a VH amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 123 and a VL amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 124. [0119] In one embodiment, agonist LTβR binding proteins (e.g., antibodies or bispecific binding proteins) that bind human LTβR CRD4 and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a VH amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 121 and the amino acid sequence of SEQ ID NO: 123 and a VL amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 122 and the amino acid sequence of SEQ ID NO: 124. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a VH amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 121 and the amino acid sequence of SEQ ID NO: 123 and a VL amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 122 and the amino acid sequence of SEQ ID NO: 124. In one embodiment, an agonist LTβR binding protein of the present disclosure comprises a VH amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 121 and the amino acid sequence of SEQ ID NO: 123 and a VL amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 122 and the amino acid sequence of SEQ ID NO: 124. [0120] In one embodiment, agonist LTβR binding proteins (e.g., antibodies or bispecific binding proteins) that bind human LTβR CRD4 and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a VH amino acid sequence having at least 90% sequence identity to the VH amino acid sequence of SEQ ID NO: 121 or SEQ ID NO: 123 and comprise the HCDR1 amino acid sequence of: X1YX3MX5 (SEQ ID NO: 5), where X1 is S or N; X3 is G, D, or A; and X5 is H or Y; the HCDR2 amino acid sequence of: X1IX3YDX6X7X8X9Y X11X12DSVKG (SEQ ID NO: 6), where X1 is A or V; X3 is W or R; X6 is E or G; X7 is S, R, or T; X8 is N or K; X9 is K, R, or Q; X11 is H or Y; and X12 is A or E; and the HCDR3 amino acid sequence of: X1RX3X4X5X6 X7X8X9YYGX13X14V (SEQ ID NO: 7), where X1 is D or E; X3 is V, G, or I; X4 is V, P, or A; X5 is A, Y, or G; X6 is R, A, G, or H; X7 is P or G; X8 is G, N, D, Y, A or H; X9 is Y, T, or F; X13 is L or M; and X14 is D or A. Exemplary VH amino acid sequences of agonist LTβR binding proteins comprising 90% sequence identity to the VH of amino acid sequence of SEQ ID NO: 121 or SEQ ID NO: 123 and comprising the HCDR sequences of SEQ ID NOs: 5, 6, and 7 are provided in Table 4 below. [0121] These agonist LTβR binding proteins may further comprise a VL amino acid sequence having at least 90% sequence identity to the VL amino acid sequence of SEQ ID NO: 122 or SEQ ID NO: 124 and comprise the LCDR1 amino acid sequence of: SGDX4LPX7X8YX10Y (SEQ ID NO: 62), where X4 is A or T; X7 is E, K, Q, D or N; X8 is Q or H; and X10 is A or T; the LCDR2 amino acid sequence of: KDNERPS (SEQ ID NO: 63); and the LCDR3 amino acid sequence of: QSX3DX5SX7X8YX10X11 (SEQ ID NO: 64), where X3 is A or T; X5 is S, G, or N; X7 is G or A; X8 is T, S, or A; X10 is V or M; and X11 is I, or V. Exemplary VL amino acid sequences of agonist LTβR binding proteins comprising 90% sequence identity to the VL of amino acid sequence of SEQ ID NO: 122 or SEQ ID NO: 124 and comprising the LCDR sequences of SEQ ID NOs: 62, 63, and 64 are provided in Table 4 below. [0122] In one embodiment, an agonist LTβR binding protein (e.g., antibody or bispecific binding protein) that binds human LTβR CRD4 and (a) does not block LIGHT binding to LTβR and (b) does not block LTα1β2 binding to LTβR comprises a VH amino acid sequence of: QVQLVESGGGVVQPGRSLRLSCAASGFTFSX31YX33MX35WVRQAPGKGLEWVA X50IX52YDX55X56X57X58YX60X61DSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCARX99RX101X1 02X103X104 X105X106X107YYGX111X112VWGQGTTVTVSS (SEQ ID NO: 119), where X31 is S or N; X33 is G or A; X35 is H or Y; X50 is A or V; X52 is W or R; X55 is E or G; X56 is S, R, or T; X57 is N or K; X58 is K, R, or Q; X60 is H or Y; X61 is A or E; X99 is D or E; X101 is V, G, or I; X102 is V, P, or A; X103 is A, Y, or G; X104 is R, A, G, or H; X106 is G, N, D, Y, A, or H; X107 is Y, T, or F; X111 is L or M; and X112 is D or A. [0123] In one embodiment, an agonist LTβR binding protein (e.g., antibody or bispecific binding protein) that binds human LTβR CRD4 and (a) does not block LIGHT binding to LTβR and (b) does not block LTα1β2 binding to LTβR comprises a VL amino acid sequence of: SYELTQPPSVSVSPRQTARITCSGDX26LPX29X30YX32YWYQQKPGQAPVLVIYKDNERPSGIPERFS GSSSGTTVTLTISGVQAEDEADYYCQSX90DX92SX94X95YX97X98FGGGTKLTVLG (SEQ ID NO: 120), where X26 is A or T; X29 is E, K, Q, D or N; X30 is Q or H; X32 is A or T; X90 is A or T; X92 is S, G, or N; X94 is G or A; X95 is T, S or A; X97 is V or M; and X98 is I or V. [0124] In one embodiment, an agonist LTβR binding protein (e.g., antibody or bispecific binding protein) that binds human LTβR CRD4 and (a) does not block LIGHT binding to LTβR and (b) does not block LTα1β2 binding to LTβR comprises a VH, where the VH comprises an amino acid sequence of SEQ ID NO: 119 and shares at least 90% sequence identity to the VH amino acid sequence of SEQ ID NO: 121 and/or the VH amino acid sequence of SEQ ID NO: 123. The agonist LTβR binding protein further comprises a VL, where the VL comprises an amino acid sequence of SEQ ID NO: 120 and shares at least 90% sequence identity to the VL amino acid sequence of SEQ ID NO: 122 and/or the VL amino acid sequence of SEQ ID NO: 124. [0125] In one embodiment, an agonist LTβR binding protein (e.g., antibody or bispecific binding protein) that binds human LTβR CRD4 and (a) does not block LIGHT binding to LTβR and (b) does not block LTα1β2 binding to LTβR comprises a VH, where the VH comprises an amino acid sequence of SEQ ID NO: 119 and shares at least 95% sequence identity to the VH amino acid sequence of SEQ ID NO: 121 and/or the VH amino acid sequence of SEQ ID NO: 123. The agonist LTβR binding protein further comprises a VL, where the VL comprises an amino acid sequence of SEQ ID NO: 120 and shares at least 95% sequence identity to the VL amino acid sequence of SEQ ID NO: 122 and/or the VL amino acid sequence of SEQ ID NO: 124. [0126] In one embodiment, the agonist LTβR binding proteins of the present disclosure that bind human LTβR CRD4 and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a variable light (VL) domain, a variable heavy (VH) domain, or a combination of VL and VH domain. VH and VL amino acid sequences of exemplary agonist LTβR binding proteins that share 90% sequence identity with the VH and VL amino acid sequences of LIBC219081 and LIBC218979 are provided in Table 4. In some embodiments, the VH domain of the agonist LTβR binding protein comprises any one of the VH amino acid sequences provided in Table 4, or an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of the VH amino acid sequences listed in Table 4. In some embodiments, the VL domain of the agonist LTβR binding protein comprises any one of the VL amino acid sequences provided in Table 4 below, or an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical to any one of the VL amino acid sequences listed in Table 4. TABLE 4: VH and VL Sequences of LTβR CRD4 Binding Proteins Sharing 90% Sequence Identity
[0127] In one embodiment, the agonist LTβR binding protein (e.g., an agonist LTβR antibody or agonist LTβR bispecific binding protein) of the present disclosure binds to human LTβR CRD4, including one or more residues corresponding to residues 198-209 of SEQ ID NO: 1 (residues 168-179 of SEQ ID NO: 4), and (a) does not block LIGHT binding to LTβR and (b) does not block LTα1β2 binding to LTβR. This agonist LTβR binding protein comprises a VH, where the VH comprises a HCDR1 sequence comprising at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 8, a HCDR2 sequence comprising at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 9, and a HCDR3 sequence comprising at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 10. In one embodiment, the VH of this agonist LTβR binding protein comprises the HCDR1 sequence of SEQ ID NO: 5, the HCDR2 sequence of SEQ ID NO: 6, and the HCDR3 sequence of SEQ ID NO: 7. In one embodiment, the VH of this agonist LTβR binding protein comprises the HCDR1 sequence of SEQ ID NO: 8, the HCDR2 sequence of SEQ ID NO: 9, and the HCDR3 sequence of SEQ ID NO: 10. [0128] In accordance with the preceding embodiment, this agonist LTβR binding protein of the present disclosure further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 65, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 66, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 67. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 62, the LCDR2 of SEQ ID NO: 63, and the LCDR3 sequence of SEQ ID NO: 64. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 65, the LCDR2 of SEQ ID NO: 66, and the LCDR3 sequence of SEQ ID NO: 67. An exemplary LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.219081 (BR# 19325; 41B2). [0129] In another embodiment, the agonist LTβR binding protein (e.g., an agonist LTβR antibody or agonist LTβR bispecific binding protein) of the present disclosure binds to human LTβR CRD4, including one or more residues corresponding to residues 197–209 of SEQ ID NO: 1) (i.e., residues 167- 179 of SEQ ID NO: 4), and (a) does not block LIGHT binding to LTβR and (b) does not block LTα1β2 binding to LTβR. This LTβR binding protein comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 11, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 12, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 13. In one embodiment, the VH of this LTβR binding protein comprises the HCDR1 sequence of SEQ ID NO: 5, the HCDR2 sequence of SEQ ID NO: 6, and a HCDR3 sequence of SEQ ID NO: 7. In one embodiment, the VH of this LTβR binding protein comprises the HCDR1 sequence of SEQ ID NO: 11, the HCDR2 sequence of SEQ ID NO: 12, and the HCDR3 sequence of SEQ ID NO: 13. [0130] In accordance with the preceding embodiment, this agonist LTβR binding protein of the present disclosure further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 68, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 69, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 70. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 62, the LCDR2 of SEQ ID NO: 63, and the LCDR3 sequence of SEQ ID NO: 64. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 68, the LCDR2 of SEQ ID NO: 69, and the LCDR3 sequence of SEQ ID NO: 70. An exemplary LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No. 218979 (BR#19319; 23E9). [0131] In another embodiment, the agonist LTβR binding protein (e.g., an agonist LTβR antibody or agonist LTβR bispecific binding protein) of the present disclosure that binds to human LTβR CRD4, and (a) does not block LIGHT binding to LTβR and (b) does not block LTα1β2 binding to LTβR comprises a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 amino acid sequences selected from: (i) SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 71, SEQ ID NO: 72, and SEQ ID NO: 73, respectively, (ii) SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 74, SEQ ID NO: 75, and SEQ ID NO: 76, respectively; (iii) SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 77, SEQ ID NO: 78, and SEQ ID NO: 79, respectively; (iv) SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 80, SEQ ID NO: 81, and SEQ ID NO: 82, respectively; (v) SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 83, SEQ ID NO: 84, and SEQ ID NO: 85, respectively; (vi) SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 86, SEQ ID NO: 87, and SEQ ID NO: 88, respectively; (vii) SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 89, SEQ ID NO: 90, and SEQ ID NO: 91, respectively; (viii) SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94, respectively; (vix) SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 95, SEQ ID NO: 96, and SEQ ID NO: 97, respectively; (x) SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO:98, SEQ ID NO: 99, and SEQ ID NO: 100, respectively; (xi) SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 101, SEQ ID NO: 102, and SEQ ID NO: 103, respectively; (xii) SEQ ID NO: 47, SEQ ID NO: 48 SEQ ID NO: 49, SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106, respectively; (xiii) SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 107, SEQ ID NO: 108, and SEQ ID NO: 109, respectively; (xiv) SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 110, SEQ ID NO: 111, and SEQ ID NO: 112, respectively; (xv) SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 113, SEQ ID NO: 114, and SEQ ID NO: 115, respectively; and (xvi) SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118, respectively. [0132] In another embodiment, the agonist LTβR binding protein (e.g., an agonist LTβR antibody or agonist LTβR bispecific binding protein) of the present disclosure that binds to human LTβR CRD4, and (a) does not block LIGHT binding to LTβR and (b) does not block LTα1β2 binding to LTβR comprises a VH amino acid sequence and a VL amino acid sequence selected from: a VH amino acid sequence of SEQ ID NO: 119 and a VL amino acid sequence of SEQ ID NO: 120; a VH amino acid sequence of SEQ ID NO: 121 and a VL amino acid sequence of SEQ ID NO: 122; a VH amino acid sequence of SEQ ID NO: 123 and a VL amino acid sequence of SEQ ID NO: 124; a VH amino acid sequence of SEQ ID NO: 125 and a VL amino acid sequence of SEQ ID NO: 126; a VH amino acid sequence of SEQ ID NO: 127 and a VL amino acid sequence of SEQ ID NO: 128; a VH amino acid sequence of SEQ ID NO: 129 and a VL amino acid sequence of SEQ ID NO: 130; a VH amino acid sequence of SEQ ID NO: 131 and a VL amino acid sequence of SEQ ID NO: 132; a VH amino acid sequence of SEQ ID NO: 133 and a VL amino acid sequence of SEQ ID NO: 134; a VH amino acid sequence of SEQ ID NO: 135 and a VL amino acid sequence of SEQ ID NO: 136; a VH amino acid sequence of SEQ ID NO: 137 and a VL amino acid sequence of SEQ ID NO: 138; a VH amino acid sequence of SEQ ID NO: 139 and a VL amino acid sequence of SEQ ID NO: 140; a VH amino acid sequence of SEQ ID NO: 141 and a VL amino acid sequence of SEQ ID NO: 142; a VH amino acid sequence of SEQ ID NO: 143 and a VL amino acid sequence of SEQ ID NO: 144; a VH amino acid sequence of SEQ ID NO: 145 and a VL amino acid sequence of SEQ ID NO: 146; a VH amino acid sequence of SEQ ID NO: 147 and a VL amino acid sequence of SEQ ID NO: 148; a VH amino acid sequence of SEQ ID NO: 149 and a VL amino acid sequence of SEQ ID NO: 150; a VH amino acid sequence of SEQ ID NO: 151 and a VL amino acid sequence of SEQ ID NO: 152; a VH amino acid sequence of SEQ ID NO: 153 and a VL amino acid sequence of SEQ ID NO: 154; a VH amino acid sequence of SEQ ID NO: 155 and a VL amino acid sequence of SEQ ID NO: 156; and a VH amino acid sequence of SEQ ID NO: 157 and a VL amino acid sequence of SEQ ID NO: 158. [0133] In another embodiment, the agonist LTβR binding protein (e.g., an agonist LTβR antibody or agonist LTβR bispecific binding protein) of the present disclosure that binds to human LTβR CRD4, and (a) does not block LIGHT binding to LTβR and (b) does not block LTα1β2 binding to LTβR comprises a VH region and/or VL region as described supra and further comprises one or more heavy chain constant regions coupled to the VH region and/or a light chain constant region coupled to the VL region. For example, in one embodiment, the LTβR binding protein is a Fab comprising a VH and first heavy chain constant domain (CH1) coupled to a VL and light chain constant region (CL). In another embodiment, the LTβR binding protein is a F(ab’)2 comprising both LTβR binding regions of a full antibody coupled by the hinge region, where each binding region comprises a VH-CH1 and VL-CL. In another embodiment, the LTβR binding protein is an antibody comprising full light chains (VL-CL) and full heavy chains (VH-CH1- CH2-CH3). [0134] In another embodiment, the agonist LTβR binding protein (e.g., an agonist LTβR antibody or agonist LTβR bispecific binding protein) of the present disclosure that binds to human LTβR CRD4, and (a) does not block LIGHT binding to LTβR and (b) does not block LTα1β2 binding to LTβR comprise a human IgG1 heavy chain. In another embodiment, the agonist LTβR binding protein (e.g., an agonist LTβR antibody or agonist LTβR bispecific binding protein) of the present disclosure that binds to human LTβR CRD4, and (a) does not block LIGHT binding to LTβR and (b) does not block LTα1β2 binding to LTβR comprise a human IgG2 heavy chain. In one embodiment, the human IgG heavy chain is modified to prevent or reduce interaction with Fc gamma receptors. In one embodiment, the human IgG is a Stable Effector Functionless (SEFL) IgG (Liu et al., J Biol. Chem. 292(5):1876-1883), which is hereby incorporated by reference in its entirety). The amino acid sequences of exemplary light chain constant regions and heavy chain constant regions of the LTβR binding proteins of the present disclosure are provided in Table 5 below. Table 5: Exemplary LC and HC Constant Domain Regions
[0135] Exemplary amino acid sequences of LTβR antibodies of the present disclosure that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR are provided in Table 9 herein. [0136] In another embodiment, an agonist LTβR binding protein of the present disclosure (e.g., agonist LTβR antibody or agonist LTβR bispecific binding protein) competes with the LTβR binders LIBC219081 and LIBC218979 for binding to human LTβR CRD4, and (a) does not block LIGHT binding to LTβR and (b) does not block LTα1β2 binding to LTβR. [0137] In accordance with the present disclosure, agonist LTβR binding proteins having these functional properties, i.e., compete with the LTβR binders LIBC219081 and LIBC218979 for binding to CRD4 of LTβR and do not block LIGHT or LTα1β2 binding to LTβR, are defined by their structurally similar VH and VL domains. This shared variable region structure, presented as consensus VH and VL CDR sequences as well as consensus VH and VL sequences, was derived from alignment of exemplary agonist LTβR binding proteins disclosed herein (see Tables 6, 7, and 8), which (i) possess these functional characteristics and (ii) comprise VH and VL amino acid sequences that share at least 90% sequence identity across their respective entire length, i.e. from N-terminus to C-terminus across the FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. [0138] Accordingly, in one embodiment, the agonist LTβR binding proteins (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) of the present disclosure that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a shared VH CDR structure defined by the HCDR1 amino acid sequence of: GX2YMH (SEQ ID NO: 159),where X2 is Y or F; the HCDR2 amino acid sequence of: WINPNX6GGTNYAQKFQG (SEQ ID NO: 160), where X6 is S, N, or R; and the HCDR3 amino acid sequence of: X1X2X3X4GX6X7X8YYGMDV (SEQ ID NO: 161), where X1 is D or A; X2 is R or D; X3 is N, S, or A; X4 is G or S; X6 is V or W; X7 is Y or absent; X8 is Y or absent. Heavy chain CDR sequences of exemplary agonist LTβR binding proteins that bind to human LTβR CRD4, do not block LIGHT binding to LTβR, do not block LTα1β2 binding to LTβR, and comprise a HCDR1 of SEQ ID NO: 159, a HCDR2 of SEQ ID NO: 160, and a HCDR3 of SEQ ID NO: 161 are provided in Table 6 below. [0139] In one embodiment, the agonist LTβR binding proteins of the present disclosure comprising the HCDRs 1–3 of SEQ ID NOs: 159-161, respectively, further comprise a shared VL CDR structure defined by the LCDR1 amino acid sequence of TGTX4SDVGSYNLVS (SEQ ID NO: 278), where X4 is T N, or S; the LCDR2 amino acid sequence of EVX3X4RPS (SEQ ID NO: 279), where X3 is T or S and X4 is K or V; and the LCDR3 amino acid sequence of CSYX4X5SX7TX9V (SEQ ID NO: 280), where X4 is A or V; X5 is D or E; X7 is S or K; X9 is L or W. Light chain CDR sequences of exemplary agonist LTβR binding proteins that bind to human LTβR CRD4, do not block LIGHT binding to LTβR, do not block LTα1β2 binding to LTβR, and comprise a LCDR1 of SEQ ID NO: 278, a LCDR2 of SEQ ID NO: 279, and a LCDR3 of SEQ ID NO: 280 are provided in Table 7 below. [0140] In one embodiment, the agonist LTβR binding proteins of the present disclosure comprising the HCDRs 1–3 of SEQ ID NOs. 159-161, respectively, further comprise a shared VL CDR structure defined by the LCDR1 amino acid sequence of SGDX4LPX7X8YX10Y (SEQ ID NO: 308), where X4 is A or T; X7 is Q, E, N, R, or K; X8 is H or Q; X10 is V, T, or A; the LCDR2 amino acid sequence of KDX3X4RPS (SEQ ID NO: 309) where X3 is N or S; X4 is D or E; and the LCDR3 amino acid sequence of QSADX5SGX8X9VV (SEQ ID NO: 310), where X5 is I, N, or S; X8 is S, A, I, or T; and X9 is F or Y. Light chain CDR sequences of exemplary agonist LTβR binding proteins that bind to human LTβR CRD4, do not block LIGHT binding to LTβR, do not block LTα1β2 binding to LTβR, and comprise a LCDR1 of SEQ ID NO: 308, a LCDR2 of SEQ ID NO: 309, and a LCDR3 of SEQ ID NO: 310 are provided in Table 7 below. TABLE 6. Heavy Chain CDR Sequences of agonist LTβR binding proteins that bind human LTβR CRD4 and do not block LIGHT or LTα1β2 binding to LTβR
TABLE 7. Light Chain CDR Sequences of agonist LTβR binding proteins that bind human LTβR CRD4 and do not block LIGHT or LTα1β2 binding to LTβR
[0141] In another embodiment, the agonist LTβR binding proteins (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) of the present disclosure that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a shared VH CDR structure defined by the HCDR1 amino acid sequence of: X1YGMH (SEQ ID NO: 195), where X1 is A or S; the HCDR2 amino acid sequence of: X1IWYDGNNKYYX12DSVKG (SEQ ID NO: 196), where X1 is L or V, and X12 is E or A; and the HCDR3 amino acid sequence of: DRITX5VRGVTNYGMDV (SEQ ID NO: 197), where X5 is M or R. Heavy chain CDR sequences of exemplary agonist LTßR binding proteins that bind to human LTßR CRD4, do not block LIGHT binding to LTßR, do not block LTa1ß2 binding to LTßR, and comprise a HCDR1 of SEQ ID NO: 195, a HCDR2 of SEQ ID NO: 196, and a HCDR3 of SEQ ID NO: 197 are provided in Table 6 above. [0142] In one embodiment, the agonist LTβR binding proteins of the present disclosure comprising the HCDRs 1–3 of SEQ ID NOs: 195-197, respectively, further comprise a shared VL CDR structure defined by the LCDR1 amino acid sequence of SGDX4LPX7X8YX10Y (SEQ ID NO: 308), where X4 is A or T; X7 is Q, E, N, R, or K; X8 is H or Q; and X10 is V, T, or A; the LCDR2 amino acid sequence of KDX3X4RPS (SEQ ID NO: 309), where X3 is N or S, and X4 is D or E; and the LCDR3 amino acid sequence of QSADX5SGX8X9VV (SEQ ID NO: 310), where X5 is I, N, or S; X8 is S, A, I, or T; X9 is F or Y. Light chain variable region CDR sequences of exemplary agonist LTβR binding proteins that bind to human LTβR CRD4, do not block LIGHT binding to LTβR, do not block LTα1β2 binding to LTβR, and comprise the LCDR1 of SEQ ID NO: 308, the LCDR2 of SEQ ID NO: 309, and the LCDR3 of SEQ ID NO: 310 are provided in Table 7 above. [0143] In another embodiment, agonist LTβR binding proteins (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a shared VH CDR structure defined by the HCDR1 amino acid sequence of: SX2AMH (SEQ ID NO: 224),where X2 is Y or F; the HCDR2 amino acid sequence of: VIWYX5X6X7NX9FYADSVKG (SEQ ID NO: 225), where X5 is D, A, or N; X6 is R or E; X7 is N or S; X9 is K or N; the HCDR3 amino acid sequence of: GDX3X4YX6YX8YGX11DX13 (SEQ ID NO: 226), where X3 is W or R; X4 is N or D; X6 is S, H, or Y; X8 is Y, Q, or K; X11 is M or V; X13 is L or V. Heavy chain CDR sequences of exemplary agonist LTβR binding proteins that bind to human LTβR CRD4, do not block LIGHT binding to LTβR, do not block LTα1β2 binding to LTβR, and comprise a HCDR1 of SEQ ID NO: 224, a HCDR2 of SEQ ID NO: 225, and a HCDR3 of SEQ ID NO: 226 are provided in Table 6 above. [0144] In one embodiment, the agonist LTβR binding proteins of the present disclosure comprising the HCDRs 1–3 of SEQ ID NOs. 224-226, respectively, further comprise a shared VL CDR structure defined by the LCDR1 amino acid sequence of TGX3X4SDVGSYNLVS (SEQ ID NO: 356), where X3 is S or T; X4 is N, S, or I; the LCDR2 amino acid sequence of: EVX3KRPS (SEQ ID NO: 357), where X3 is T, N or S; and the LCDR3 amino acid sequence of: CSYAX5X6X7TYV (SEQ ID NO: 358), where X5 is D or G; X6 is T or S; X7 is R, S, or K. Light chain variable region CDR sequences of exemplary agonist LTβR binding proteins that bind to human LTβR CRD4, do not block LIGHT binding to LTβR, do not block LTα1β2 binding to LTβR, and comprise a LCDR1 of SEQ ID NO: 356, a LCDR2 of SEQ ID NO: 357, and a LCDR3 of SEQ ID NO: 358 are provided in Table 7 above. [0145] In one embodiment, the agonist LTβR binding proteins of the present disclosure (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a variable light (VL) domain, a variable heavy (VH) domain, or a combination of VL and VH domain. In any embodiment, the VH domain of the agonist LTβR binding protein comprises any one of the VH amino acid sequences provided in Table 8 below, or an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of the VH amino acid sequences listed in Table 8. In any embodiment, the VL domain of the agonist LTβR binding protein comprises any one of the VL amino acid sequences provided in Table 8 below, or an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical to any one of the VL amino acid sequences listed in Table 8. [0146] Exemplary agonist LTβR binding proteins of the present disclosure (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprises a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 amino acid sequences selected from: (i) SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, SEQ ID NO: 278, SEQ ID NO: 279, and SEQ ID NO: 280, respectively; (ii) SEQ ID NO: 162, SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 281, SEQ ID NO: 282, and SEQ ID NO: 283, respectively; (iii) SEQ ID NO: 165, SEQ ID NO: 166, SEQ ID NO: 167, SEQ ID NO: 284, SEQ ID NO: 285, and SEQ ID NO: 286, respectively; (iv) SEQ ID NO: 168, SEQ ID NO: 169, SEQ ID NO: 170, SEQ ID NO: 287, SEQ ID NO: 288, and SEQ ID NO: 289, respectively; (v) SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, SEQ ID NO: 290, SEQ ID NO: 291, and SEQ ID NO: 292, respectively; (vi) SEQ ID NO: 174, SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 293, SEQ ID NO: 294, and SEQ ID NO: 295, respectively; (vii) SEQ ID NO: 177, SEQ ID NO: 178, SEQ ID NO: 179, SEQ ID NO: 296, SEQ ID NO: 297, and SEQ ID NO: 298, respectively; (viii) SEQ ID NO: 180, SEQ ID NO: 181, SEQ ID NO: 182, SEQ ID NO: 302, SEQ ID NO: 303, and SEQ ID NO: 304, respectively; (ix) SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, SEQ ID NO: 305, SEQ ID NO: 306, and SEQ ID NO: 307, respectively. [0147] In one embodiment, agonist LTβR binding proteins (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR include those binding proteins that comprise HCDR1, HCDR2, and HCDR3 amino acid sequences of SEQ ID NOs: 159-161, respectively, and LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NOs: 278-280, respectively. These agonist LTβR binding proteins further comprise a VH and VL amino acid sequence selected from: a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 401 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 402; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 403 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 404; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 405 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 406; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 407 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 408; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 409 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 410; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 411 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 412; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 413 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 414; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 415 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 416. VH and VL amino acid sequences described herein are provided in Table 8 below. [0148] In one embodiment, exemplary agonist LTβR binding proteins of the present disclosure (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 amino acid sequences selected from: (i) SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, SEQ ID NO: 308, SEQ ID NO: 309, and SEQ ID NO: 310, respectively; (ii) SEQ ID NO: 189, SEQ ID NO: 190, SEQ ID NO: 191, SEQ ID NO: 314, SEQ ID NO: 315, and SEQ ID NO: 316, respectively; (iii) SEQ ID: 186, SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 311, SEQ ID NO: 312, and SEQ ID NO: 313, respectively; (iv) SEQ ID NO: 192, SEQ ID NO: 193, SEQ ID NO: 194, SEQ ID NO: 317, SEQ ID NO: 318, and SEQ ID NO: 319, respectively. [0149] In one embodiment, agonist LTβR binding proteins of the present disclosure (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR include those binding proteins that comprise HCDR1, HCDR2, and HCDR3 amino acid sequences of SEQ ID NOs: 159-161, respectively, and LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NOs: 308-310, respectively. These agonist LTβR binding proteins further comprise a VH and VL amino acid sequence selected from: a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 417 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 418; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 419 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 420; and a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 421 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 422. VH and VL amino acid sequences described herein are provided in Table 8 below. [0150] In one embodiment, exemplary agonist LTβR binding proteins of the present disclosure (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 amino acid sequences selected from: (i) SEQ ID NO: 195, SEQ ID NO: 196, SEQ ID NO: 197, SEQ ID NO: 308, SEQ ID NO: 309, and SEQ ID NO: 310; (ii) SEQ ID NO: 197, SEQ ID NO: 198, SEQ ID NO: 199, SEQ ID NO: 320, SEQ ID NO: 321, and SEQ ID NO: 322; (iii) SEQ ID NO: 200, SEQ ID NO: 201, SEQ ID NO: 202, SEQ ID NO: 323, SEQ ID NO: 324, and SEQ ID NO: 325, respectively; (iv) SEQ ID NO: 203, SEQ ID NO: 204, SEQ ID NO: 205, SEQ ID NO: 326, SEQ ID NO: 327, and SEQ ID NO: 328, respectively; (v) SEQ ID NO: 206, SEQ ID NO: 207, SEQ ID NO: 208, SEQ ID NO: 329, SEQ ID NO: 330, and SEQ ID NO: 331, respectively; (vi) SEQ ID NO: 209, SEQ ID NO: 210, SEQ ID NO: 211, SEQ ID NO: 332, SEQ ID NO: 333, and SEQ ID NO: 334, respectively; (vii) SEQ ID NO: 212, SEQ ID NO: 213, SEQ ID NO: 214, SEQ ID NO: 335, SEQ ID NO: 336, and SEQ ID NO: 337, respectively; (viii) SEQ ID NO: 215, SEQ ID NO: 216, SEQ ID NO: 217, SEQ ID NO: 338, SEQ ID NO: 339, and SEQ ID NO: 340, respectively; (ix) SEQ ID NO: 218, SEQ ID NO: 219, SEQ ID NO: 220, SEQ ID NO: 341, SEQ ID NO: 342, and SEQ ID NO: 343, respectively; (x) SEQ ID NO: 221, SEQ ID NO: 222, SEQ ID NO: 223, SEQ ID NO: 343, SEQ ID NO: 344, and SEQ ID NO: 345, respectively. [0151] In one embodiment, agonist LTβR binding proteins of the present disclosure (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise HCDR1, HCDR2, and HCDR3 amino acid sequences of SEQ ID NOs: 195-197, respectively, and LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NOs: 308-310, respectively. These agonist LTβR binding proteins further comprise a VH and VL amino acid sequence selected from: a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 423 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 424; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 425 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 426; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 427 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 428; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 429 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 430; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 431 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 432; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 433 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 434; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 435 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 436; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 437 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 438; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 439 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 440. VH and VL amino acid sequences described herein are provided in Table 8 below. [0152] In one embodiment, exemplary agonist LTβR binding proteins of the present disclosure (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 amino acid sequences selected from: (i) SEQ ID NO: 224, SEQ ID NO: 225, SEQ ID NO: 226, SEQ ID NO: 356, SEQ ID NO: 357, and SEQ ID NO: 358, respectively; (ii) SEQ ID NO: 227, SEQ ID NO: 228, SEQ ID NO: 229, SEQ ID NO: 359, SEQ ID NO: 360, and SEQ ID NO: 361, respectively; (iii) SEQ ID NO: 230, SEQ ID NO: 231, SEQ ID NO: 232, SEQ ID NO: 362, SEQ ID NO: 363, and SEQ ID NO: 364, respectively; (iv) SEQ ID NO: 233, SEQ ID NO: 234, SEQ ID NO: 235, SEQ ID NO: 365, SEQ ID NO: 366, and SEQ ID NO: 367, respectively; (v) SEQ ID NO: 236, SEQ ID NO: 237, SEQ ID NO: 238, SEQ ID NO: 368, SEQ ID NO: 369, and SEQ ID NO: 370, respectively; (vi) SEQ ID NO: 239, SEQ ID NO: 240, SEQ ID NO: 241, SEQ ID NO: 371, SEQ ID NO: 372, and SEQ ID NO: 373, respectively; (vii) SEQ ID NO: 242, SEQ ID NO: 243, SEQ ID NO: 244, SEQ ID NO: 374, SEQ ID NO: 375, and SEQ ID NO: 376, respectively; (viii) SEQ ID NO: 245, SEQ ID NO: 246, SEQ ID NO: 247, SEQ ID NO: 377, SEQ ID NO: 378, and SEQ ID NO: 379, respectively; (ix) SEQ ID NO: 248, SEQ ID NO: 249, SEQ ID NO: 250, SEQ ID NO: 380, SEQ ID NO: 381, and SEQ ID NO: 382, respectively; (x) SEQ ID NO: 251, SEQ ID NO: 252, SEQ ID NO: 253, SEQ ID NO: 383, SEQ ID NO: 384, and SEQ ID NO: 385, respectively; (xi) SEQ ID NO: 254, SEQ ID NO: 255, SEQ ID NO: 256, SEQ ID NO: 386, SEQ ID NO: 387, and SEQ ID NO: 388, respectively; (xii) SEQ ID NO: 180, SEQ ID NO: 181, SEQ ID NO: 182, SEQ ID NO: 302, SEQ ID NO: 303, and SEQ ID NO: 304, respectively; ; (xiii) SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, SEQ ID NO: 305, SEQ ID NO: 306, and SEQ ID NO: 307, respectively; (xiv) SEQ ID NO: 257, SEQ ID NO: 258, SEQ ID NO: 259, SEQ ID NO: 389, SEQ ID NO: 390, and SEQ ID NO: 391, respectively. [0153] In one embodiment, agonist LTβR binding proteins of the present disclosure (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise HCDR1, HCDR2, and HCDR3 amino acid sequences of SEQ ID NOs: 224-226, respectively, and LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NOs: 356-358, respectively. These agonist LTβR binding proteins further comprise a VH and VL amino acid sequence selected from: a VH amino acid sequence having at least 90% sequence identity to the VH amino acid sequence of SEQ ID NO: 441 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 442; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 443 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 444; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 445 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 446; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 447 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 448; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 449 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 450; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 451 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 452; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 453 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 454; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 455 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 456; a VH amino acid sequence having at least 90% sequence identity to the VH amino acid sequence of SEQ ID NO: 457 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 458; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 459 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 460; a VH amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VH amino acid sequence of SEQ ID NO: 461 and a VL amino acid sequence having at least 90%, at least 95%, or at least 98% sequence identity to the VL amino acid sequence of SEQ ID NO: 462. VH and VL amino acid sequences described herein are provided in Table 8 below. [0154] In one embodiment, exemplary agonist LTβR binding proteins of the present disclosure (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a combination of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 amino acid sequences selected from (i) SEQ ID NO: 257, SEQ ID NO: 258, SEQ ID NO: 259, SEQ ID NO: 389, SEQ ID NO: 390, and SEQ ID NO: 391, respectively (1319279); (ii) SEQ ID NO: 260, SEQ ID NO: 261, SEQ ID NO: 262, SEQ ID NO: 347, SEQ ID NO: 348 and SEQ ID NO: 349, respectively (1318253); (iii) SEQ ID NO: 263, SEQ ID NO: 264, SEQ ID NO: 265, SEQ ID NO: 350, SEQ ID NO: 351, and SEQ ID NO: 352 (1318209), respectively; (iv) SEQ ID NO: 266, SEQ ID NO: 267, SEQ ID NO: 268, SEQ ID NO: 353, SEQ ID NO: 354, and SEQ ID NO: 355 (1318188), respectively; (v) SEQ ID NO: 269, SEQ ID NO: 270, SEQ ID NO: 271, SEQ ID NO: 392, SEQ ID NO: 393, and SEQ ID NO: 394 (1319569), respectively; (vi) SEQ ID NO: 272, SEQ ID NO: 273, SEQ ID NO: 274, SEQ ID NO: 395, SEQ ID NO: 396, and SEQ ID NO: 397 (1317105), respectively; (vii) SEQ ID NO: 275, SEQ ID NO: 276, SEQ ID NO: 277, SEQ ID NO: 398, SEQ ID NO: 399, and SEQ ID NO: 400 (1318198), respectively; [0155] In another embodiment, LTβR binding proteins of the present disclosure (e.g., agonist LTβR antibodies or agonist LTβR bispecific binding proteins) that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR comprise a VH amino acid sequence and a VL amino acid sequence selected from: a VH amino acid sequence of SEQ ID NO: 401 and a VL amino acid sequence of SEQ ID NO: 402; a VH amino acid sequence of SEQ ID NO: 403 and a VL amino acid sequence of SEQ ID NO: 404; a VH amino acid sequence of SEQ ID NO: 405 and a VL amino acid sequence of SEQ ID NO: 406; a VH amino acid sequence of SEQ ID NO: 407 and a VL amino acid sequence of SEQ ID NO: 408; a VH amino acid sequence of SEQ ID NO: 409 and a VL amino acid sequence of SEQ ID NO: 410; a VH amino acid sequence of SEQ ID NO: 411 and a VL amino acid sequence of SEQ ID NO: 412; a VH amino acid sequence of SEQ ID NO: 413 and a VL amino acid sequence of SEQ ID NO: 414; a VH amino acid sequence of SEQ ID NO: 415 and a VL amino acid sequence of SEQ ID NO: 416; a VH amino acid sequence of SEQ ID NO: 417 and a VL amino acid sequence of SEQ ID NO: 418; a VH amino acid sequence of SEQ ID NO: 419 and a VL amino acid sequence of SEQ ID NO: 420; a VH amino acid sequence of SEQ ID NO: 421 and a VL amino acid sequence of SEQ ID NO: 422; a VH amino acid sequence of SEQ ID NO: 423 and a VL amino acid sequence of SEQ ID NO: 424; a VH amino acid sequence of SEQ ID NO: 425 and a VL amino acid sequence of SEQ ID NO: 426; a VH amino acid sequence of SEQ ID NO: 427 and a VL amino acid sequence of SEQ ID NO: 428; a VH amino acid sequence of SEQ ID NO: 429 and a VL amino acid sequence of SEQ ID NO: 430; a VH amino acid sequence of SEQ ID NO: 431 and a VL amino acid sequence of SEQ ID NO: 432; a VH amino acid sequence of SEQ ID NO: 433 and a VL amino acid sequence of SEQ ID NO: 434; a VH amino acid sequence of SEQ ID NO: 435 and a VL amino acid sequence of SEQ ID NO: 436; a VH amino acid sequence of SEQ ID NO: 437 and a VL amino acid sequence of SEQ ID NO: 438; a VH amino acid sequence of SEQ ID NO: 439 and a VL amino acid sequence of SEQ ID NO: 440; a VH amino acid sequence of SEQ ID NO: 441 and a VL amino acid sequence of SEQ ID NO: 442; a VH amino acid sequence of SEQ ID NO: 443 and a VL amino acid sequence of SEQ ID NO: 444; a VH amino acid sequence of SEQ ID NO: 445 and a VL amino acid sequence of SEQ ID NO: 446; a VH amino acid sequence of SEQ ID NO: 447 and a VL amino acid sequence of SEQ ID NO: 448; a VH amino acid sequence of SEQ ID NO: 449 and a VL amino acid sequence of SEQ ID NO: 450; a VH amino acid sequence of SEQ ID NO: 451 and a VL amino acid sequence of SEQ ID NO: 452; a VH amino acid sequence of SEQ ID NO: 453 and a VL amino acid sequence of SEQ ID NO: 454; a VH amino acid sequence of SEQ ID NO: 455 and a VL amino acid sequence of SEQ ID NO: 456; a VH amino acid sequence of SEQ ID NO: 457 and a VL amino acid sequence of SEQ ID NO: 458; a VH amino acid sequence of SEQ ID NO: 459 and a VL amino acid sequence of SEQ ID NO: 460; a VH amino acid sequence of SEQ ID NO: 461 and a VL amino acid sequence of SEQ ID NO: 462; a VH amino acid sequence of SEQ ID NO: 463 and a VL amino acid sequence of SEQ ID NO: 464; a VH amino acid sequence of SEQ ID NO: 465 and a VL amino acid sequence of SEQ ID NO: 466; a VH amino acid sequence of SEQ ID NO: 467 and a VL amino acid sequence of SEQ ID NO: 468; a VH amino acid sequence of SEQ ID NO: 469 and a VL amino acid sequence of SEQ ID NO: 470; a VH amino acid sequence of SEQ ID NO: 471 and a VL amino acid sequence of SEQ ID NO: 472; and a VH amino acid sequence of SEQ ID NO: 473 and a VL amino acid sequence of SEQ ID NO: 474. VH and VL amino acid sequences described herein are provided in Table 8 below. Table 8: VH and VL amino acid sequences of LTβR binding proteins that compete for binding to CRD4 of LTβR with the LTβR binders LIBC219081 and LIBC218979 and do not block LIGHT or LTα1β2 binding [0156] In another embodiment, the agonist LTβR binding protein (e.g., an agonist LTβR antibody or agonist LTβR bispecific binding protein) of the present disclosure that binds to human LTβR CRD4, and (a) does not block LIGHT binding to LTβR and (b) does not block LTα1β2 binding to LTβR comprises a VH region and/or VL region as described supra and further comprises one or more heavy chain constant regions coupled to the VH region and/or a light chain constant region coupled to the VL region. For example, in one embodiment, the LTβR binding protein is a Fab comprising a VH and first heavy chain constant domain (CH1) coupled to a VL and light chain constant region (CL). In another embodiment, the LTβR binding protein is a F(ab’)2 comprising both LTβR binding regions of a full antibody coupled by the hinge region, where each binding region comprises a VH-CH1 and VL-CL. In another embodiment, the LTβR binding protein is an antibody comprising full light chains (VL-CL) and full heavy chains (VH-CH1- CH2-CH3). Exemplary amino acid sequences of LTβR antibodies of the present disclosure that bind to human LTβR CRD4, and (a) do not block LIGHT binding to LTβR and (b) do not block LTα1β2 binding to LTβR are provided in Table 9 below. Table 9. Antibody HC and LC Sequences of LTβR CRD4 Binding Antibodies
LTβR Agonist Binding Proteins that Bind CRD1, CRD2, and/or CRD3 [0157] In accordance with all aspects of the present disclosure, an agonist LTβR binding protein as described herein, comprises one or more binding domains that bind to and agonize LTβR activity. In one embodiment, this binding domain comprises a heavy chain variable region (VH) or fragment thereof, where the VH comprises one or more complementarity determining regions (i.e., HCDR1, HCDR2, and/or HCDR3), or portions thereof, that bind to LTβR. In one embodiment, this VH comprises a HCDR1 amino acid sequence of any one of SEQ ID NOs: 475-498,740-742, or a modified sequence thereof, wherein said modified sequence contains 1, 2, or 3 amino acid residue modifications as compared to any one of SEQ ID NOs: 475-498 and 740-742. In one embodiment, the VH comprises a HCDR2 amino acid sequence of any one of SEQ ID NOs: 499-528, 743, or a modified sequence thereof, wherein said modified sequence contains 1, 2, or 3 amino acid residue modifications as compared to any one of SEQ ID NOs: 499-528 and 743. In one embodiment, the VH comprises a HCDR3 amino acid sequence of any one of SEQ ID NOs: 529-558, 744-746, or a modified sequence thereof, wherein said modified sequence contains 1, 2, or 3 amino acid residue modifications as compared to any one of SEQ ID NOs: 529-558 and 744-746. The heavy chain CDR sequences of exemplary agonist LTβR binding proteins described herein are provided in Table 10 below. [0158] As described in the Examples herein, paratope mapping studies of several LTβR antibodies disclosed herein showed that, in some cases, binding of a particular LTβR antibody to LTβR did not involve or require all three heavy chain CDR regions of the antibody and/or did not involve all residues of one or more heavy chain CDRs. Heavy chain CDRs shown not to be involved in the LTβR antibody binding interaction are indicated with an asterisk in Table 10 below. Residues of heavy chain CDR regions shown not to be involved in or required for the LTβR antibody binding interaction as identified by paratope mapping or mutational analysis are identified as variable residue (X). The identity of X residues within the sequences of Table 10 is provided in Tables 18-25 herein. Table 10. Heavy Chain CDR Sequences of LTβR Binding Proteins [0159] In one embodiment, the agonist LTβR binding protein of the present disclosure comprises a light chain variable region (VL), where the VL comprises one or more complementarity determining regions (i.e., LCDR1, LCDR2, and/or LCDR3), or portions thereof, that alone or together with the VH CDRs bind to LTβR. In one embodiment, the VL comprises a LCDR1 amino acid sequence of any one of SEQ ID NOs: 559-589 or a modified sequence thereof, wherein said modified sequence contains 1, 2, or 3 amino acid residue modifications as compared to any one of SEQ ID NOs: 559-589. In one embodiment, the VL comprises a LCDR2 amino acid sequence of any one of SEQ ID NOs: 590-618 or a modified sequence thereof, wherein said modified sequence contains 1, 2, or 3 amino acid residue modifications as compared to any one of SEQ ID NOs: 590-618. In one embodiment, the VL comprises a LCDR3 amino acid sequence of any one of SEQ ID NOs: 619-643 or a modified sequence thereof, wherein said modified sequence contains 1, 2, or 3 amino acid residue modifications as compared to any one of SEQ ID NOs: 619-643. The light chain CDR sequences of exemplary agonist LTβR binding proteins described herein are provided in Table 11 below. [0160] As described in the Examples herein, paratope mapping studies of several LTβR antibodies disclosed herein showed that, in some cases, binding of a particular LTβR antibody to LTβR did not involve or require all three light chain CDR regions of the antibody and/or did not involve all residues of one or more light chain CDRs. Light chain CDRs shown not to be involved in the LTβR antibody binding interaction are indicated with an asterisk in Table 11 below. Residues of light chain CDR regions shown not to be involved in or required for the LTβR antibody binding interaction as identified by paratope mapping or mutational analysis are identified as variable residue (X). The identity of X residues within the sequences of Table 11 is provided in Tables 18-25 herein. Table 11. Light Chain CDR Sequences of LTβR Binding Proteins
[0161] In one embodiment, the agonist LTβR binding protein of the present disclosure binds to CRD2 and CRD3 of human LTβR, including one or more residues corresponding to residues 56-64 and 81- 101 of SEQ ID NO: 4 (corresponding to residues 86-94 and 111-131 of SEQ ID NO: 1), and permits endogenous LTβR ligand binding activity as defined herein. This agonist LTβR binding protein comprises a variable heavy domain (VH) comprising a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 501, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 531. Optionally, this VH further comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 475. In one embodiment, the VH of this LTβR binding protein comprises the HCDR2 sequence of SEQ ID NO: 499 and the HCDR3 sequence of SEQ ID NO: 529; or as further defined by the HCDR2 sequence of SEQ ID NO: 500 and the HCDR3 sequence of SEQ ID NO: 530. In one embodiment, the VH of this LTβR binding protein comprises the HCDR2 sequence of SEQ ID NO: 501 and the HCDR3 sequence of SEQ ID NO: 531. Optionally, the VH of this exemplary agonist LTβR binding protein further comprises the HCDR1 of SEQ ID NO: 475. [0162] In accordance with the preceding embodiment, this agonist LTβR binding protein optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 561, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 619. Optionally, the VL further comprises an LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 590. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 559 and the LCDR3 sequence of SEQ ID NO: 619; or as further defined by the LCDR1 sequence of SEQ ID NO: 560 and the LCDR3 sequence of SEQ ID NO: 619; or as further defined by the LCDR1 sequence of SEQ ID NO: 560 and the LCDR3 sequence of SEQ ID NO: 619. Optionally, the VL further comprises an LCDR2 of SEQ ID NO: 590. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.218990 (19320; 30H1). [0163] In another embodiment, the agonist LTβR binding protein of the present disclosure is a binding protein that binds to the CRD1 of LTβR, including one or more residues corresponding to residues 3-9, 20-29, and 38-47 of SEQ ID NO: 4 (corresponding to residues 33-39, 50-59, and 68-77 of SEQ ID NO: 1). In one embodiment, this LTβR binding protein does not block or inhibit endogenous LIGHT binding to LTβR to occur and at least or about 80% of endogenous LTα1β2 binding to LTβR to occur. This LTβR binding protein comprises a VH, where the VH comprises HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 478, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 504, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 534. In one embodiment, the VH of this LTβR binding protein comprises the HCDR1 sequence of SEQ ID NO: 476, the HCDR2 sequence of SEQ ID NO: 502, and the HCDR3 sequence of SEQ ID NO: 532; or as further defined by the HCDR1 sequence of SEQ ID NO: 477, the HCDR2 sequence of SEQ ID NO: 503, and the HCDR3 sequence of SEQ ID NO: 533; or as further defined by the HCDR1 sequence of SEQ ID NO: 478, the HCDR2 sequence of SEQ ID NO: 504, and the HCDR3 sequence of SEQ ID NO: 534. [0164] In accordance with the preceding embodiment, this agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 564, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 593, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 622. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 562, the LCDR2 of SEQ ID NO: 591, and the LCDR3 sequence of SEQ ID NO: 620; or as further defined by the LCDR1 sequence of SEQ ID NO: 563, the LCDR2 of SEQ ID NO: 592, and the LCDR3 sequence of SEQ ID NO: 621; or as further defined by the LCDR1 sequence of SEQ ID NO: 564, the LCDR2 of SEQ ID NO: 593, and the LCDR3 sequence of SEQ ID NO: 622. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.218994 (19321; 31A3) [0165] In another embodiment, the agonist LTβR binding protein of the present disclosure binds to CRD2 and CRD3 of human LTβR, including one or more residues corresponding to residues 56-64 and 81- 101 of SEQ ID NO: 4 (corresponding to residues 86-94 and 111-131 of SEQ ID NO: 1). In one embodiment, this agonist LTβR binding protein does not block endogenous LIGHT or LTα1β2 binding to LTβR at concentrations of < 8nM as measured by the cell based receptor-ligand assay described herein (see e.g., Example 8.2). This LTβR binding protein comprises a VH, where the VH comprises HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 479, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 507, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 537. In one embodiment, the VH of this LTβR binding protein comprises the HCDR1 sequence of SEQ ID NO: 479, a HCDR2 sequence of SEQ ID NO: 505, and a HCDR3 sequence of SEQ ID NO: 535; or as further defined by the HCDR1 sequence of SEQ ID NO: 479, a HCDR2 sequence of SEQ ID NO: 506, and a HCDR3 sequence of SEQ ID NO: 536; or as further defined by the HCDR1 sequence of SEQ ID NO: 479, a HCDR2 sequence of SEQ ID NO: 507, and a HCDR3 sequence of SEQ ID NO: 537. [0166] In accordance with the preceding embodiment, this agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 596. Optionally, the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 565, and optionally comprises an LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 623. In one embodiment, the VL comprises the LCDR2 of SEQ ID NO: 594, or as further defined by the LCDR2 of SEQ ID NO: 595, or as further defined by the LCDR2 of SEQ ID NO: 596. Optionally, the VL comprises the LCDR1 sequence of SEQ ID NO: 565, the LCDR2 of SEQ ID NO: 596, and the LCDR3 sequence of SEQ ID NO: 623. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.219058 (19324; 36G2). [0167] In another embodiment, the agonist LTβR binding protein of the present disclosure is a binding protein that binds to LTβR and does not block or inhibit LIGHT binding to LTβR to occur. This agonist LTβR binding protein comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 480, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 508, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 538. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 408, the HCDR2 of SEQ ID NO: 508, and the HCDR3 sequence of SEQ ID NO: 538. [0168] In accordance with the preceding embodiment, this agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 567, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 600, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 625. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 567, the LCDR2 of SEQ ID NO: 600, and the LCDR3 sequence of SEQ ID NO: 625. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.219037 (19322; 34D1). [0169] In another embodiment, the agonist LTβR binding protein of the present disclosure is a binding protein that binds to LTβR and does not block or inhibit LIGHT binding to LTβR as defined herein. In one embodiment, this agonist LTβR binding protein and does not block or inhibit LIGHT binding to LTβR. This LTβR binding protein comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 4812, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 509, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 539. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 481, the HCDR2 of SEQ ID NO: 509, and the HCDR3 sequence of SEQ ID NO: 539 or as further defined by the HCDR1 sequence of SEQ ID NO: 481, the HCDR2 of SEQ ID NO: 509, and the HCDR3 sequence of SEQ ID NO: 540; or as further defined by the HCDR1 sequence of SEQ ID NO: 481, the HCDR2 of SEQ ID NO: 509, and the HCDR3 sequence of SEQ ID NO: 541. [0170] In accordance with the preceding embodiment, this agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 570, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 601, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 626. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 568, the LCDR2 of SEQ ID NO: 601, and the LCDR3 sequence of SEQ ID NO: 626; or as further defined by the LCDR1 sequence of SEQ ID NO: 569, the LCDR2 of SEQ ID NO: 601, and the LCDR3 sequence of SEQ ID NO: 626; or as further defined by the LCDR1 sequence of SEQ ID NO: 570, the LCDR2 of SEQ ID NO: 601, and the LCDR3 sequence of SEQ ID NO: 626; or as further defined by the LCDR1 sequence of SEQ ID NO: 571, the LCDR2 of SEQ ID NO: 602, and the LCDR3 sequence of SEQ ID NO: 627. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.219098 (19327; 44B1). [0171] In another embodiment, the agonist LTβR binding protein of the present disclosure (e.g., agonist LTβR antibody or agonist LTβR bispecific binding protein) binds to human LTβR CRD1 including one or more residues corresponding to residues 1-19 of SEQ ID NO: 4 (corresponding to residues 31-49 of SEQ ID NO: 1). This agonist LTβR binding protein does not block LIGHT binding to LTβR and does not block LTα1β2 binding to LTβR. This agonist LTβR binding protein comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 483, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 513, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 543. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 483, the HCDR2 of SEQ ID NO: 511, and the HCDR3 sequence of SEQ ID NO: 543; or as further defined the HCDR1 sequence of SEQ ID NO: 483, the HCDR2 of SEQ ID NO: 512, and the HCDR3 sequence of SEQ ID NO: 543; or as further defined the HCDR1 sequence of SEQ ID NO: 483, the HCDR2 of SEQ ID NO: 513, and the HCDR3 sequence of SEQ ID NO: 543. [0172] In accordance with the preceding embodiment, the agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 574, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 603, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 628. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 57217, the LCDR2 of SEQ ID NO: 603, and the LCDR3 sequence of SEQ ID NO: 628; or as further defined by the LCDR1 sequence of SEQ ID NO: 573, the LCDR2 of SEQ ID NO: 603, and the LCDR3 sequence of SEQ ID NO: 628; or as further defined by the LCDR1 sequence of SEQ ID NO: 574, the LCDR2 of SEQ ID NO: 603, and the LCDR3 sequence of SEQ ID NO: 628. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.219051 (19323; 35F5). [0173] In another embodiment, the LTβR binding protein of the present disclosure is an antibody- based molecule that binds to LTβR CRD1 and CRD2, including one or more residues corresponding to residues 38-42 and 56-70 of SEQ ID NO: 4. This LTβR antibody-based molecule comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 742, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 746. Optionally, the VH of this LTβR binding protein further comprises a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 743. In any embodiment, the VH of this LTβR binding protein comprises the HCDR1 sequence of SEQ ID NO: 740 and the HCDR3 sequence of SEQ ID NO: 744; or as further defined by the HCDR1 sequence of SEQ ID NO: 741 and the HCDR3 sequence of SEQ ID NO: 745; or as further defined by the HCDR1 sequence of SEQ ID NO: 742 and the HCDR3 sequence of SEQ ID NO: 746. Optionally, the VH of this exemplary LTβR binding protein further comprises the HCDR2 of SEQ ID NO: 743. [0174] In accordance with the preceding embodiment, this LTβR antibody-based molecule of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 566, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 599. Optionally, the VL further comprises a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 624. In any embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 566 and the LCDR2 of SEQ ID NO: 597; or as further defined by the LCDR1 sequence of SEQ ID NO: 566 and the LCDR2 of SEQ ID NO: 598; or as further defined by the LCDR1 sequence of SEQ ID NO: 566 and the LCDR2 of SEQ ID NO: 599. Optionally, the VL further comprises a LCDR3 of SEQ ID NO: 624. An exemplary LTβR antibody-based molecule comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.219097 (19326; 43D9). [0175] In another embodiment, the agonist LTβR binding protein comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 484, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 514, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 544. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 484, the HCDR2 of SEQ ID NO: 514, and the HCDR3 sequence of SEQ ID NO: 544. This agonist LTβR binding protein further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 575, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 604, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 629. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 575, the LCDR2 of SEQ ID NO: 604, and the LCDR3 sequence of SEQ ID NO: 629. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.218989. [0176] In another embodiment, the agonist LTβR binding protein comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 485, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 515, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 545. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 485, the HCDR2 of SEQ ID NO: 515, and the HCDR3 sequence of SEQ ID NO: 545. This agonist LTβR binding protein of the present disclosure further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 576, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 605, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 630. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 576, the LCDR2 of SEQ ID NO: 605, and the LCDR3 sequence of SEQ ID NO: 630. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.218967. [0177] In another embodiment, the agonist LTβR binding protein of the present disclosure comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 486, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 516, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 546. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 486, the HCDR2 of SEQ ID NO: 516, and the HCDR3 sequence of SEQ ID NO: 546. This agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 577, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 606, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 631. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 577, the LCDR2 of SEQ ID NO: 6068, and the LCDR3 sequence of SEQ ID NO: 631. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.218981. [0178] In another embodiment, the agonist LTβR binding protein of the present disclosure comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 487, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 517, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 547. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 487, the HCDR2 of SEQ ID NO: 517 and the HCDR3 sequence of SEQ ID NO: 547. This agonist LTβR binding protein of the present disclosure further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 578, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 607, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 632. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 578, the LCDR2 of SEQ ID NO: 607, and the LCDR3 sequence of SEQ ID NO: 632. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.218995. [0179] In another embodiment, the agonist LTβR binding protein of the present disclosure comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 488, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 518, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 548. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 488, the HCDR2 of SEQ ID NO: 518, and the HCDR3 sequence of SEQ ID NO: 548. This agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 579, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 608, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 633. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 579, the LCDR2 of SEQ ID NO: 608, and the LCDR3 sequence of SEQ ID NO: 633. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.218996. [0180] In another embodiment, the agonist LTβR binding protein of the present disclosure comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 489, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 519, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 549. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 489, the HCDR2 of SEQ ID NO: 519, and the HCDR3 sequence of SEQ ID NO: 549. This agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 580, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 609, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 634. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 580, the LCDR2 of SEQ ID NO: 609, and the LCDR3 sequence of SEQ ID NO: 634. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.218998. [0181] In another embodiment, the agonist LTβR binding protein of the present disclosure comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 490, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 520, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 550. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 490, the HCDR2 of SEQ ID NO: 520, and the HCDR3 sequence of SEQ ID NO: 550. This agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 581, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 610, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 635. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 581, the LCDR2 of SEQ ID NO: 610, and the LCDR3 sequence of SEQ ID NO: 635. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.219083. [0182] In another embodiment, the agonist LTβR binding protein of the present disclosure comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 491, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 521, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 551. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 491, the HCDR2 of SEQ ID NO: 521, and the HCDR3 sequence of SEQ ID NO: 551. This agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 582, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 611, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 636. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 582, the LCDR2 of SEQ ID NO: 611, and the LCDR3 sequence of SEQ ID NO: 636. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.219092. [0183] In another embodiment, the agonist LTβR binding protein of the present disclosure is a binding protein that binds to LTβR and permits endogenous LTβR ligand binding activity as defined herein. This LTβR binding protein comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 492, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 522, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 552. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 492, the HCDR2 of SEQ ID NO: 522, and the HCDR3 sequence of SEQ ID NO: 552. In one embodiment, the HCDR2 of SEQ ID NO: 522 is modified to substitute the cysteine residues at positions 4 and 8 in SEQ ID NO: 522. In one embodiment, the HCDR2 of this LTβR binding protein comprises an HCDR2 of SEQ ID NO: 523. This agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 583, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 612, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 637. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 583, the LCDR2 of SEQ ID NO: 612, and the LCDR3 sequence of SEQ ID NO: 637. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.219023. [0184] In another embodiment, the agonist LTβR binding protein of the present disclosure comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 494, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 524, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 554. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 494, the HCDR2 of SEQ ID NO: 524, and the HCDR3 sequence of SEQ ID NO: 554. This agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 585, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 614, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 639. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 585, the LCDR2 of SEQ ID NO: 614, and the LCDR3 sequence of SEQ ID NO: 639. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.219095. [0185] In another embodiment, the agonist LTβR binding protein of the present disclosure comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 495, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 525, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 555. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 495, the HCDR2 of SEQ ID NO: 525, and the HCDR3 sequence of SEQ ID NO: 555. This agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 586, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 615, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 640. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 586, the LCDR2 of SEQ ID NO: 615, and the LCDR3 sequence of SEQ ID NO: 640. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.219102. [0186] In another embodiment, the agonist LTβR binding protein of the present disclosure comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 496, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 526, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 556. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 496, the HCDR2 of SEQ ID NO: 526, and the HCDR3 sequence of SEQ ID NO: 556. This agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 587, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 616, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 641. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 587, the LCDR2 of SEQ ID NO: 616, and the LCDR3 sequence of SEQ ID NO: 641. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.218973. [0187] In another embodiment, the agonist LTβR binding protein of the present disclosure comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 497, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 527, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 557. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 497, the HCDR2 of SEQ ID NO: 527, and the HCDR3 sequence of SEQ ID NO: 557. This agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 588, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 617, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 642. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 588, the LCDR2 of SEQ ID NO: 617, and the LCDR3 sequence of SEQ ID NO: 642. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.219044. [0188] In another embodiment, the agonist LTβR binding protein of the present disclosure comprises a VH, where the VH comprises a HCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 498, a HCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 528, and a HCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 558. In one embodiment, the VH comprises the HCDR1 sequence of SEQ ID NO: 498, the HCDR2 of SEQ ID NO: 528, and the HCDR3 sequence of SEQ ID NO: 558. This agonist LTβR binding protein of the present disclosure optionally further comprises a VL, where the VL comprises a LCDR1 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 589, a LCDR2 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence of SEQ ID NO: 618, and a LCDR3 sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence SEQ ID NO: 643. In one embodiment, the VL comprises the LCDR1 sequence of SEQ ID NO: 589, the LCDR2 of SEQ ID NO: 618, and the LCDR3 sequence of SEQ ID NO: 643. An exemplary agonist LTβR binding protein comprising a VH and VL of this embodiment includes, without limitation, the LTβR antibody identified herein as LIBC No.218997. [0189] Suitable amino acid modifications to the heavy chain CDR sequences and/or the light chain CDR sequences of the LTβR binding protein disclosed herein include, for example, conservative substitutions or functionally equivalent amino acid residue substitutions that result in variant CDR sequences having similar or enhanced binding characteristics to those of the CDR sequences described above. Encompassed by the present disclosure are CDRs of Tables 2, 3, 6, 7, 9 and 10 containing 1, 2, 3, 4, 5, or more amino acid substitutions (depending on the length of the CDR) that maintain or enhance LTβR binding of the antibody. The resulting modified CDRs are at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% similar in sequence to the CDRs as provided in Tables 2, 3, 6, 7, 9 and 10. [0190] Suitable amino acid modifications to the heavy chain and light chain CDR sequences disclosed herein include, for example, conservative substitutions or functionally equivalent amino acid residue substitutions that result in variant CDR sequences having similar or enhanced binding characteristics to those of the CDR sequences disclosed herein. Conservative substitutions are those that take place within a family of amino acids that are related in their side chains. Genetically encoded amino acids can be divided into four families: (1) acidic (aspartate, glutamate); (2) basic (lysine, arginine, histidine); (3) nonpolar (alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan); and (4) uncharged polar (glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine). Phenylalanine, tryptophan, and tyrosine are sometimes classified jointly as aromatic amino acids. Alternatively, the amino acid repertoire can be grouped as (1) acidic (aspartate, glutamate); (2) basic (lysine, arginine histidine), (3) aliphatic (glycine, alanine, valine, leucine, isoleucine, serine, threonine), with serine and threonine optionally grouped separately as aliphatic-hydroxyl; (4) aromatic (phenylalanine, tyrosine, tryptophan); (5) amide (asparagine, glutamine); and (6) sulfur-containing (cysteine and methionine) (Stryer (ed.), Biochemistry, 2nd ed, WH Freeman and Co., 1981, which is hereby incorporated by reference in its entirety). Non- conservative substitutions can also be made to the heavy chain CDR sequences and the light chain CDR sequences disclosed herein. Non-conservative substitutions involve substituting one or more amino acid residues of the CDR with one or more amino acid residues from a different class of amino acids to improve or enhance the binding properties of CDR. The amino acid sequences of the heavy chain variable region CDRs and/or the light chain variable region CDRs disclosed herein may further comprise one or more internal neutral amino acid insertions or deletions that maintain or enhance LTβR binding. [0191] The LTβR binding proteins that bind LTβR as described herein may comprise a variable light (VL) chain, a variable heavy (VH) chain, or a combination of VL and VH chains. In one embodiment, the VH chain of the LTβR binding protein comprises any one of the VH amino acid sequences provided in Table 12 below, or an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of the VH amino acid sequences listed in Table 12. In one embodiment, the VL chain of the LTβR binding protein comprises any one of the VL amino acid sequences provided in Table 12 below, or an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical to any one of the VL amino acid sequences listed in Table 12. [0192] In one embodiment, an agonist LTβR binding protein of the present disclosure binds to and agonizes human LTβR (SEQ ID NO: 1) while allowing endogenous LTβR ligand binding and activity (i.e., LIGHT or LTα1β2 binding) as described herein, and comprises a heavy chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to any one of the VH domain amino acid sequences set forth in Table 12. In one embodiment, an agonist LTβR binding protein of the present disclosure binds to and agonizes human LTβR (SEQ ID NO: 1) while allowing endogenous LTβR ligand binding and activity (i.e., LIGHT or LTα1β2 binding) as described herein, and comprises a light chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to any one of the VL domain amino acid sequences set forth in Table 12. In one embodiment, the agonist LTβR binding protein of the present disclosure binds to and agonizes human LTβR (SEQ ID NO: 1) while allowing endogenous LTβR ligand binding and activity (i.e., LIGHT or LTα1β2 binding) as described herein, and comprises a heavy chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to any one of the VH domain amino acid sequences set forth in Table 12, and a light chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the corresponding VL domain amino acid sequence as set forth in Table 12. TABLE 12. LTβR Binding Protein VH and VL Amino Acid Sequences
[0193] In one embodiment, an agonist LTβR binding protein of the present disclosure binds to and agonizes human and cyno LTβR. This agonist LTβR binding protein binds CRD2 and CRD3 of human LTβR at an epitope comprising or consisting of one or more residues at positions 56-64 and 81-101 of SEQ ID NO: 4 (corresponding to residues 86-94 and 111-131 of SEQ ID NO: 1). This agonist LTβR binding protein comprises a heavy chain variable domain having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the VH domain amino acid sequence of SEQ ID NO: 644 and a light chain variable domain having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the VL domain amino acid sequence of SEQ ID NO: 645. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 644 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 645. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 644 and a VL amino acid sequence of SEQ ID NO: 645 (30H1/19320). [0194] In one embodiment, an agonist LTβR binding protein of the present disclosure binds to and agonizes human and cyno LTβR. This agonist LTβR binding protein binds CRD1 of human LTβR at an epitope comprising or consisting of one or more residues at positions 3-9, 12-29, and 38-47 of SEQ ID NO: 4 (corresponding to residues 33-39, 50-59, and 68-77 of SEQ ID NO: 1). This agonist LTβR binding protein allows 100% of LIGHT and/or at least or about 80% of LTα1β2 binding to LTβR to occur and comprises a heavy chain variable domain having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the VH domain amino acid sequence of SEQ ID NO: 646. This LTβR binding protein further comprises a light chain variable domain having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the VL domain amino acid sequence of SEQ ID NO: 647. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 646 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 647. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 646 and a VL amino acid sequence of SEQ ID NO: 647 (19321). [0195] In one embodiment, an agonist LTβR binding protein of the present disclosure binds to and agonizes human and cyno LTβR. This agonist LTβR binding protein binds to CRD2 and CRD3 of human LTβR at an epitope comprising or consisting of one or more residues at positions 56-64 and 81-101 of SEQ ID NO: 4 (corresponding to residues 86-94 and 111-131 of SEQ ID NO: 1). This agonist LTβR binding protein does not inhibit LIGHT and LTα1β2 binding to LTβR at concentrations of <8 nM in the cell based receptor-ligand assay as described herein. This LTβR binding protein and comprises a heavy chain variable domain having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the VH domain amino acid sequence of SEQ ID NO: 648 and a light chain variable domain having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the VL domain amino acid sequence of SEQ ID NO: 649. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 648 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 649. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 648 and a VL amino acid sequence of SEQ ID NO: 649 (19324). [0196] In one embodiment, an agonist LTβR binding protein of the present disclosure binds to and agonizes human and cyno LTβR. This LTβR binding protein binds to CRD1 and CRD2 of human LTβR at an epitope comprising or consisting of one or more residues at positions 38-42, 56-65, and 65-70 of SEQ ID NO: 4. This agonist LTβR binding protein comprises a heavy chain variable domain having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the VH domain amino acid sequence of SEQ ID NO: 650 and a light chain variable domain having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the VL domain amino acid sequence of SEQ ID NO: 651. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 650 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 651. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 650 and a VL amino acid sequence of SEQ ID NO: 651. [0197] In one embodiment, an agonist LTβR binding protein of the present disclosure binds to and agonizes human and cyno LTβR, and does not inhibit endogenous LIGHT binding to LTβR. This agonist LTßR binding protein comprises a heavy chain variable domain having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the VH domain amino acid sequence of SEQ ID NO: 652 and a light chain variable domain having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the VL domain amino acid sequence of SEQ ID NO: 653. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 652 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 653. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 652 and a VL amino acid sequence of SEQ ID NO: 653 (19322). [0198] In one embodiment, an agonist LTβR binding protein of the present disclosure binds to and agonizes human and cyno LTβR, and does not inhibit endogenous LIGHT binding to LTβR. This agonist LTβR binding protein comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 654 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 655 or SEQ ID NO: 657. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 654 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 657. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 654 and a VL amino acid sequence of SEQ ID NO: 657 (19327). [0199] In one embodiment, an LTβR binding protein of the present disclosure binds to and agonizes human and cyno LTβR, and does not inhibit LTα1β2 binding to LTβR and does not inhibit LIGHT binding to LTβR to occur. This agonist LTβR binding protein comprises a heavy chain variable domain having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the VH domain amino acid sequence of SEQ ID NO: 658 and a light chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the VL domain amino acid sequence of SEQ ID NO: 659. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 658 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 659. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 658 and a VL amino acid sequence of SEQ ID NO: 659. (35F5/19323) [0200] In one embodiment, the agonist LTβR binding protein of the present disclosure binds to and agonizes human and cyno LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 660 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 661. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 660 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 661. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 660 and a VL amino acid sequence of SEQ ID NO: 661. [0201] In one embodiment, the agonist LTβR binding protein of the present disclosure binds to and agonizes human and cyno LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 662 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 663. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 662 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 663. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 662 and a VL amino acid sequence of SEQ ID NO: 663. [0202] In one embodiment, the agonist LTβR binding protein of the present disclosure is an agonist binding protein that binds to LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 664 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 665. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 664 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 665. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 664 and a VL amino acid sequence of SEQ ID NO: 665. [0203] In one embodiment, the agonist LTβR binding protein of the present disclosure is an agonist binding protein that binds to LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 666 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 667. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 666 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 667. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 666 and a VL amino acid sequence of SEQ ID NO: 667. [0204] In one embodiment, the agonist LTβR binding protein of the present disclosure is an agonist binding protein that binds to LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 668 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 669. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 668 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 669. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 668 and a VL amino acid sequence of SEQ ID NO: 669. [0205] In one embodiment, the agonist LTβR binding protein of the present disclosure is an agonist binding protein that binds to LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 670 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 671. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 670 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 671. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 670 and a VL amino acid sequence of SEQ ID NO: 671. [0206] In one embodiment, the agonist LTβR binding protein of the present disclosure is an agonist binding protein that binds to LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 672 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 673. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 672 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 673. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 672 and a VL amino acid sequence of SEQ ID NO: 673. [0207] In one embodiment, the agonist LTβR binding protein of the present disclosure is an agonist binding protein that binds to LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 674 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 675. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 674 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 675. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 674 and a VL amino acid sequence of SEQ ID NO: 675. [0208] In one embodiment, the agonist LTβR binding protein of the present disclosure is an agonist binding protein that binds to LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 676 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 677. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 676 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 677. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 676 and a VL amino acid sequence of SEQ ID NO: 677. [0209] In one embodiment, the agonist LTβR binding protein of the present disclosure is an agonist binding protein that binds to LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 678 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 679. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 678 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 679. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 678 and a VL amino acid sequence of SEQ ID NO: 679. [0210] In one embodiment, the agonist LTβR binding protein of the present disclosure is an agonist binding protein that binds to LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 680 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 681. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 680 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 681. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 680 and a VL amino acid sequence of SEQ ID NO: 681. [0211] In one embodiment, the agonist LTβR binding protein of the present disclosure is an agonist binding protein that binds to LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 682 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 683 or SEQ ID NO: 685. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 682 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 683 or SEQ ID NO: 685. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 682 and a VL amino acid sequence of SEQ ID NO: 683 or SEQ ID NO: 685. [0212] In one embodiment, the agonist LTβR binding protein of the present disclosure is an agonist binding protein that binds to LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 686 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 687. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 686 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 687. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 686 and a VL amino acid sequence of SEQ ID NO: 687. [0213] In one embodiment, the agonist LTβR binding protein of the present disclosure is an agonist binding protein that binds to LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 688 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 689. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 688 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 689. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 688 and a VL amino acid sequence of SEQ ID NO: 689. [0214] In one embodiment, the agonist LTβR binding protein of the present disclosure is an agonist binding protein that binds to LTβR and comprises a VH amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 690 and a VL amino acid sequence that is at least 80%, at least 85%, or at least 90% identical to SEQ ID NO: 691. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence that is at least 95% identical to SEQ ID NO: 690 and a VL amino acid sequence that is at least 95% identical to SEQ ID NO: 691. In one embodiment, the agonist LTβR binding protein comprises a VH amino acid sequence of SEQ ID NO: 690 and a VL amino acid sequence of SEQ ID NO: 691. [0215] In one embodiment, the agonist LTβR binding protein of the present disclosure comprises a VH region and/or VL region as described supra and further comprises one or more heavy chain constant regions coupled to the VH region and/or a light chain constant region coupled to the VL region. For example, in one embodiment, the agonist LTβR binding protein is a Fab comprising a VH and first heavy chain constant domain (CH1) coupled to a VL and light chain constant region (CL). In another embodiment, the agonist LTβR binding protein is a F(ab’)2 comprising both LTβR binding regions of a full antibody coupled by the hinge region, where each binding region comprises a VH-CH1 and VL-CL. The complete heavy chain and light chain amino acid sequences of exemplary agonist LTβR antibodies of the present disclosure are provided herein in Table 13. Table 13. Full-length Amino Acid Sequences of LTβR Antibodies
01 RGLEWLGRTYYRSKWYSDYALSVKSRATINPDTSENQFSLQLNS Multi-Specific LTβR Binding Molecules [0216] In another aspect of the present disclosure the agonist LTβR binding protein is a multi- specific agonist LTβR binding protein. In accordance with this aspect of the disclosure, the multi-specific agonist LTβR binding protein comprises a first binding domain that binds to human LTβR (SEQ ID NO: 1), and a second binding domain that binds a non-LTβR protein target (i.e., a protein other than LTβR), where the multi-specific binding protein agonizes LTβR activity and (a) does not inhibit LIGHT binding to LTßR and (b) does not inhibit LT1α2β binding to LTβR. The second binding domain of an exemplary LTβR multi-specific binding protein as described herein, binds to a non-LTβR protein target. In one embodiment, the second binding domain of the LTβR multi-specific binding protein binds to a protein or antigen preferentially expressed by a tumor cell or other cells of the tumor microenvironment (TME). [0217] In one embodiment, the multi-specific agonist LTβR binding protein is monovalent for each of the protein targets bound by the first and second binding domains multi-specific binding protein. In one embodiment, the multi-specific agonist LTβR binding protein is monovalent for the LTβR ligand binding domain and bivalent for the non-LTβR binding domain. [0218] In one embodiment, the multi-specific agonist LTβR binding protein of the present disclosure further comprises one or more additional binding domains. In one embodiment, the multi- specific agonist LTβR binding protein described herein comprises a third binding domain, where the third binding domain binds the same protein target as the first or second binding domain to form a bi-specific binding protein that is bivalent for one of the protein targets bound by the bi-specific binding protein. In another embodiment, the third binding domain binds a different protein target than the first and second binding domains, thereby forming a monovalent trispecific binding protein. In one embodiment, the multi- specific agonist LTβR binding protein can further comprise a fourth binding domain, where the fourth binding domain binds to the same protein target as the first, second, or third binding domain. [0219] In accordance with this aspect of the present disclosure the multi-specific agonist LTβR binding protein can assume any multi-specific binding protein format known in the art. For example, in one embodiment, the multi-specific agonist LTβR binding protein is an agonist LTβR bispecific binding protein or a trispecific agonist LTβR binding protein. In one embodiment, the first, second, and/or third binding domain of the multi-specific agonist LTβR binding domain is a Fab. Alternatively, the first, second, and/or third binding domain of a multi-specific agonist LTβR binding domain is a scFv. In one embodiment, the first binding domain is a Fab, the second binding domain is a scFv, and an optionally present third binding domain is a Fab or scFv. In one embodiment, the second binding domain is a Fab, the first binding domain is a scFv, and an optionally present third binding domain is a Fab or scFv. In one embodiment, both the first and second binding domains are Fabs, and the optionally present third binding domain is a Fab or scFv. In one embodiment, both the first and second binding domains are scFvs, and the optionally present third binding domain is a Fab or scFv. [0220] In one embodiment of the present disclosure the multi-specific agonist LTβR binding protein is a bispecific agonist LTβR binding protein. A “bispecific binding protein” as referred to herein is a binding protein that binds to two different antigens at the same time. Bispecific agonist LTβR binding proteins of the present disclosure encompass any bispecific molecular format known in the art (see e.g., Spiess et al., Mol. Immunol. 67(2): 95-106 (2015), which is hereby incorporated by reference in its entirety). These molecule formats include IgG-like formats which retain the traditional monoclonal antibody structure with two Fab arms and one Fc region, IgG formats containing an appended additional antigen binding moiety, bispecific binding protein fragments, bispecific fusions proteins, and combinations thereof. [0221] In one embodiment, the first and/or second binding domain of the bispecific agonist LTβR binding protein is a Fab. Alternatively, the first and/or second binding domain of the bispecific agonist LTβR binding protein is a scFv. In one embodiment, the first binding domain is a Fab and the second binding domain is a scFv. In one embodiment, the second binding domain is a Fab and the first binding domain is a scFv. In one embodiment, both the first and second binding domains are Fabs. In one embodiment, both the first and second binding domains are scFvs. [0222] In one embodiment, the bispecific agonist LTβR binding protein of the present disclosure is a full-length bispecific IgG or comprises an IgG-like structure. In one embodiment, the bispecific agonist LTβR binding protein is a hetero-IgG that is monovalent for each target protein bound by the bispecific binding protein. Exemplary hetero-IgG bispecific formats comprising Fc domains engineered to enhance heterodimer formation are well known in the art and are suitable formats for the bispecific agonist LTβR binding protein of the present disclosure. These hetero-IgG formats include, without limitation, knob-into- holes format (see e.g., Ridgway et al., “‘Knobs-into-holes’ engineering of antibody CH3 domains for heavy chain heterodimerization,” Protein Eng. 9:617–621 (1996) and Atwell et al., “Stable heterodimers from remodeling the domain interface of a homodimer using a phage display library,” J. Mol. Biol. 270:26–35 (1997), which are hereby incorporated by reference in their entirety), DuoBody format (see e.g., Labrijn et al., “Efficient generation of stable bispecific IgG1 by controlled Fab-arm exchange,” Proc. Natl. Acad. Sci. U.S.A., 110: 5145-5150 (2013), which is hereby incorporated by reference in its entirety); Azymetric format (see e.g., Von Kreudenstein et al., “Improving biophysical properties of a bispecific antibody scaffold to aid developability: quality by molecular design,” mAbs 5:646-654 (2013), which is hereby incorporated by reference in its entirety); charged Fc pairs (see e.g., Gunasekaran et al., “Enhancing antibody Fc heterodimer formation through electrostatic steering effects: applications to bispecific molecules and monovalent IgG,” J. Biol. Chem., 285: 19637-46 (2010) and Strop et al., “Generating bispecific human IgG1 and IgG2 antibodies from any antibody pair,” J. Mol. Biol., 420:204-219 (2012) which are hereby incorporated by reference in their entirety); mAb-Fv (see e.g., Close et al., “A novel bispecific antibody format enables simultaneous bivalent and monovalent co-engagement of distinct target antigens,” mAbs 3: 546-557 (2011), which is hereby incorporated by reference in its entirety); strand-exchange engineered domain (SEED) C(H)3 heterodimer format (see e.g., Davis et al., “SEEDbodies: fusion proteins based on strand-exchange engineered domain (SEED) CH3 heterodimers in an Fc analogue platform for asymmetric binders or immunofusions and bispecific antibodies,” Protein Eng. Des. Sel. 23:195-202 (2010), which is hereby incorporated by reference in its entirety); and differential Protein A affinity (see e.g., U.S. Patent No. 8,586,713 to Davis et al., which is hereby incorporated by referenced in its entirety). [0223] In one embodiment, the bispecific agonist LTβR binding protein of the present disclosure is a construct comprising one or more binding protein fragments. Suitable LTβR bispecific binding protein fragments constructs of the present disclosure include, without limitation, nanobodies comprising two single variable (VHH) domains connected via a peptide linker (Els Conrath et al., “Camel single-domain antibodies as modular building units in bispecific and bivalent antibody constructs,” J. Biol. Chem. 276:7346–50 (2001), which is hereby incorporated by reference in its entirety), and diabodies comprising two scFv fragments coupled together (Holliger et al., “‘Diabodies’: small bivalent and bispecific antibody fragments,” Proc. Natl. Acad. Sci. U.S.A., 90: 6444-6448 (1993), which is hereby incorporated by reference in its entirety). Suitable diabody LTβR bispecific constructs include, without limitation, single chain diabodies (see e.g., Alt et al., “Novel tetravalent and bispecific IgG-like antibody molecules combining single-chain diabodies with the immunoglobulin gamma1 Fc or CH3 region,” FEBS Lett.454: 90-94 (1999), which is hereby incorporated by reference in its entirety), dual-affinity re-targeting diabodies (DART) (see e.g., Johnson et al., “Effector cell recruitment with novel Fv-based dual-affinity re-targeting protein leads to potent tumor cytolysis and in vivo B-cell depletion,” J. Mol. Biol.399: 436-449 (2010), which is hereby incorporated by reference in its entirety), tandem diabodies, and tetravalent tandem diabodies (TandAb) comprising two pairs of VL and VH domains connected in a single polypeptide chain (see e.g., Arndt et al., “A bispecific diabody that mediates natural killer cell cytotoxicity against xenotransplanted human Hodgkin's tumors,” Blood 94: 2562-2568 (1999), which is hereby incorporated by reference in its entirety). Suitable LTβR bispecific constructs also include scFv fragments or diabodies coupled to an Fc portion (e.g., minibodies, Diabody-CH3, scDiabody-CH3, scFv-CH3, minibodies) or fused to one or more other moieties to extend half-life (e.g., fusion to serum albumin or albumin binding proteins). [0224] In one embodiment, the bispecific agonist LTβR binding protein of the present disclosure is a monospecific IgG antibody (e.g., containing the first or second binding domain of the bispecific antibody) engineered for bispecificity with the coupling of an additional binding domain (e.g., the second or first binding domain, respectively) comprising, e.g., a VHH, scFv, 2scFv, Fv, Fab, or antibody mimetic binding domain to either the amino or carboxy termini of either the light or heavy chain(s) of the antibody. Exemplary engineered bispecific binding proteins include, without limitation dual variable domain (DVD)- IgG, IgG(H)-scFv, ScFv-(H)IgG, IgG(L)-scFv, scFv-(L)IgG, IgG((L,H)-Fv, IgG(H)-V, V(H)-IgG, IgG(L)- V, V(L)-IgG, IgG-scFab, 2scFv-IgG, IgG-2scFv, scFv4-Ig (see e.g., Spiess et al., “Alternative molecular formats and therapeutic applications for bispecific antibodies,” Mol. Immunol.67(2): 95-106 (2015), which is hereby incorporated by reference in its entirety). [0225] In one embodiment, the multi-specific agonist LTβR binding protein of the present disclosure is a bispecific agonist LTβR binding protein. This bispecific agonist LTβR binding protein comprises a (i) LTβR binding domain, where the LTβR binding domain binds one or more amino acid residues of human LTβR CRD4 comprising amino acid residues 169-211 of SEQ ID NO: 1, and (ii) a tumor associated antigen binding domain. This bispecific LTβR binding protein agonizes LTβR activity and (a) does not inhibit LIGHT to LTβR and (b) does not inhibit LT1α2β binding to LTβR. [0226] Exemplary LTβR binding domains, i.e., HCDRs and LCDRs, and VH and VL domains, that bind CRD4 of human LTβR are described supra, and include, without limitation the binding domains of LIBC219081 and LIBC218979 as well as binding domains of the LTβR binding proteins provided in Tables 2–4 and 6–8. In particular, suitable first binding domains of the bispecific agonist LTβR binding protein as described herein may comprise a heavy chain variable domain (VH) or fragment thereof comprising one or more of the HCDR1, HCDR2, and/or HCDR3 or portions thereof as set forth in a single row of Table 2 or Table 6. In one embodiment, the first binding domain of the bispecific agonist LTβR binding protein comprises all three of the HCDR1, HCDR2, and HCDR3 or portions thereof as set forth in a single row of Table 2 or Table 6. In one embodiment, the first binding domain of the bispecific agonist LTβR binding protein comprises a light chain variable domain (VL) or fragment thereof comprising one or more of the LCDR1, LCDR2, and/or LCDR3 or portions thereof as set forth in a single row in Table 3 or Table 7. In one embodiment, the first binding domain of the bispecific agonist LTβR binding protein comprises all three of the LCDR1, LCDR2, and LCDR3 or portions thereof as set forth in a single row of Table 3 or Table 7. In one embodiment, the first binding domain of the bispecific agonist LTβR binding protein as described herein comprises a VH or fragment thereof comprising one or more of the HCDR1, HCDR2, and/or HCDR3 or portions thereof as set forth in a single row of Table 2 or Table 6 and a VL or fragment thereof comprising one or more of the LCDR1, LCDR2, and/or LCDR3 or portions thereof of a corresponding binding molecule as set forth in a single row of Table 3 or Table 7. In one embodiment, the first binding domain of the bispecific agonist LTβR binding protein as described herein comprises a VH or fragment thereof comprising all three of the HCDR1, HCDR2, and HCDR3 or portions thereof as set forth in a single row of Table 2 or Table 6 and a VL or fragment thereof comprising all three of the LCDR1, LCDR2, and LCDR3 or portions of a corresponding binding molecule as set forth in a single row of Table 3 or Table 7. This bispecific agonist LTβR binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LT1α2β binding to LTβR. [0227] In one embodiment, the first binding domain of a bispecific agonist LTβR binding protein that binds CRD4 of human LTβR comprises a heavy chain variable domain (VH), a light chain variable domain (VL), or a combination of VH and VL domains. In one embodiment, the VH domain of the first binding domain of the bispecific agonist LTβR binding protein comprises any one of the VH amino acid sequences provided in Table 4 or Table 8, or an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical to any one of the VH amino acid sequences listed in Table 4 or Table 8. In one embodiment, the VL domain of the first binding domain of the bispecific agonist LTβR binding protein comprises any one of the VL amino acid sequences provided in Table 4 or Table 8, or an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical to any one of the VL amino acid sequences listed in Table 4 or Table 8. This bispecific agonist LTβR binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LT1α2β binding to LTβR. [0228] In one embodiment, the first binding domain of a bispecific agonist LTβR binding protein that binds CRD4 of human LTβR comprises a heavy chain variable domain having at least 85%, at least 90%, at least 95%, or 100% sequence identity to any one of the VH domain amino acid sequences set forth in Table 4 or Table 8, and a light chain variable domain having at least 85%, at least 90%, at least 95%, or 100% sequence identity to the corresponding VL domain amino acid sequence as set forth in Table 4 or Table 8. This bispecific agonist LTβR binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LT1α2β binding to LTβR. [0229] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein that binds to CRD4 of human LTβR comprises a VH comprising the HCDR1 amino acid sequence of: X1YX3MX5 (SEQ ID NO: 5), where X1 is S or N; X3 is G, D, or A; and X5 is H or Y; the HCDR2 amino acid sequence of: X1IX3YDX6X7X8X9Y X11X12DSVKG (SEQ ID NO: 6), where X1 is A or V; X3 is W or R; X6 is E or G; X7 is S, R, or T; X8 is N or K; X9 is K, R, or Q; X11 is H or Y; and X12 is A or E; and the HCDR3 amino acid sequence of: X1RX3X4X5X6 X7X8X9YYGX13X14V (SEQ ID NO: 7), where X1 is D or E; X3 is V, G, or I; X4 is V, P, or A; X5 is A, Y, or G; X6 is R, A, G, or H; X7 is P or G; X8 is G, N, D, Y, A or H; X9 is Y, T, or F; X13 is L or M; and X14 is D or A. This bispecific agonist LTβR binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LT1α2β binding to LTβR. [0230] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein that binds to CRD4 of human LTβR further comprises a VL comprising the LCDR1 amino acid sequence of: SGDX4LPX7X8YX10Y (SEQ ID NO: 62), where X4 is A or T; X7 is E, K, Q, D or N; X8 is Q or H; and X10 is A or T; the LCDR2 amino acid sequence of: KDNERPS (SEQ ID NO: 63); and the LCDR3 amino acid sequence of: QSX3DX5SX7X8YX10X11 (SEQ ID NO: 64), where X3 is A or T; X5 is S, G, or N; X7 is G or A; X8 is T, S, or A; X10 is V or M; and X11 is I or V. This bispecific agonist LTβR binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LT1α2β binding to LTβR. [0231] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein that binds to CRD4 of human LTβR comprises a VH amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 121. In one embodiment, an LTβR binding domain comprises a VH amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 123. In one embodiment, an LTβR binding domain comprises a VH amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 121 and the amino acid sequence of SEQ ID NO: 123. Exemplary VH amino acid sequences having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 121 and SEQ ID NO: 123 are provided in Table 4 supra. This bispecific agonist LTβR binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LT1α2β binding to LTβR. [0232] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein that binds to CRD4 of human LTβR comprises a VL amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 122. In one embodiment, the LTβR binding domain comprises a VL amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 124. In one embodiment, the LTβR binding domain comprises a VL amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 122 and the amino acid sequence of SEQ ID NO: 124. Exemplary VL amino acid sequences having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 122 and SEQ ID NO: 124 are provided in Table 4 supra. This bispecific agonist LTβR binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LT1α2β binding to LTβR. [0233] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein that binds to CRD4 of human LTβR comprises a VH amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 121 and a VL amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 122. In one embodiment, the LTβR binding domain comprises a VH amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 121 and a VL amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 122. In one embodiment, an LTβR binding domain comprises a VH amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 121 and a VL amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 122. This bispecific agonist LTβR binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LT1α2β binding to LTβR. [0234] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein comprises a VH amino acid sequence having at least 90% sequence identity to SEQ ID NO: 123 and a HCDR1 amino acid sequence of SEQ ID NO: 5 (X1YX3MX5), a HCDR2 amino acid sequence of SEQ ID NO: 6 (X1IX3YDX6X7X8X9YX11X12DSVKG), and a HCDR3 amino acid sequence of SEQ ID NO: 7 (X1RX3X4X5X6X7X8X9YYGX13X14V). In one embodiment, this LTβR binding domain further comprises a VL amino acid sequence having at least 90% sequence identity to SEQ ID NO: 124 and a LCDR1 amino acid sequence of SEQ ID NO: 62 (SGDX4LPX7X8YX10Y), a LCDR2 amino acid sequence of SEQ ID NO: 63 (KDX3ERPS), and a LCDR3 amino acid sequence of SEQ ID NO: 64 (QSX3DX5SX7X8YX10X11). This bispecific agonist LTβR binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LT1α2β binding to LTβR. [0235] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein comprises a VH, which comprises the HCDR1, HCDR2, and HCDR3 of amino acid sequences of SEQ ID NO: 11-13, respectively, and a VL comprising the LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NO: 68-70, respectively. In one embodiment, the LTβR binding domain comprises a VH comprising the HCDR1, HCDR2, and HCDR3 of amino acid sequences of SEQ ID NO: 8-10, respectively, and a VL comprising the LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NO: 65-67, respectively. This bispecific agonist LTβR binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LT1α2β binding to LTβR. [0236] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein competes for binding to LTβR with the exemplary LTβR binders of LIBC219081 and LIBC218979. In one embodiment, this first binding domain comprises HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 amino acid sequences selected from (i) SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, SEQ ID NO: 278, SEQ ID NO: 279, and SEQ ID NO: 280; (ii) SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, SEQ ID NO: 299, SEQ ID NO: 300, and SEQ ID NO: 301; (iii) SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, SEQ ID NO: 308, SEQ ID NO: 309, and SEQ ID NO: 310; (iv) SEQ ID NO: 195, SEQ ID NO: 196, SEQ ID NO: 197, SEQ ID NO: 308, SEQ ID NO: 309, and SEQ ID NO: 310; (v) SEQ ID NO: 224, SEQ ID NO: 225, SEQ ID NO: 226, SEQ ID NO: 356, SEQ ID NO: 357, and SEQ ID NO: 358. Bispecific agonist LTβR binding proteins comprising a first binding domain with the aforementioned heavy chain and light chain CDRs does not inhibit LIGHT binding to LTβR and does not inhibit LT1α2β binding to LTβR. [0237] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein binds human LTβR CRD1 and comprises a heavy chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the VH domain amino acid sequence of SEQ ID NO: 646 and a light chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the VL domain amino acid sequence of SEQ ID NO: 647. This bispecific LTβR binding protein does not inhibit endogenous LIGHT binding to LTβR and allows 80% of endogenous LTα1β2 binding to LTβR to occur. [0238] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein binds to human LTβR, and comprises a heavy chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the VH domain amino acid sequence of SEQ ID NO: 652 and a light chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the VL domain amino acid sequence of SEQ ID NO: 653. This bispecific LTβR binding protein does not inhibit endogenous LIGHT binding to LTβR. [0239] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein binds to human LTβR, and comprises a heavy chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the VH domain amino acid sequence of SEQ ID NO: 654 and a light chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the VL domain amino acid sequence of SEQ ID NO: 655. This bispecific LTβR binding protein does not inhibit endogenous LIGHT binding to LTβR [0240] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein binds to human LTβR CRD1, and comprises a heavy chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the VH domain amino acid sequence of SEQ ID NO: 658 and a light chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the VL domain amino acid sequence of SEQ ID NO: 659. This bispecific LTβR binding protein does not inhibit endogenous LIGHT binding to LTßR and does not inhibit LTα1β2 binding to LTβR [0241] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein binds to human LTβR CRD2 and CRD3 and comprises a heavy chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the VH domain amino acid sequence of SEQ ID NO: 648 and a light chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the VL domain amino acid sequence of SEQ ID NO: 649. This LTβR binding protein does not inhibit LIGHT and LTα1β2 binding to LTβR at concentrations <8 nM in the cell based receptor-ligand assay as described herein. [0242] In one embodiment, the LTβR binding domain of the bispecific agonist LTβR binding protein binds to human LTβR CRD2 and CRD3 and comprises a heavy chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the VH domain amino acid sequence of SEQ ID NO: 644 and a light chain variable domain having at least 85%, at least 90%, or at least 95% sequence identity to the VL domain amino acid sequence of SEQ ID NO: 645. [0243] In one embodiment, the tumor-associated binding domain of the bispecific agonist LTβR binding protein binds to a tumor-associated antigen (TAA). In one embodiment, the TAA is solid tumor TAA. Suitable TAAs are known in the art and include, without limitation, alpha-fetoprotein (AFP), CD44v6, carbonic anhydrase IX (CAIX), carcinoembryonic antigen (CEA), CD133, hepatocyte growth factor receptor (c-MET), claudin 18.2 (CLDN18.2), claudin 6 (CLDN6), leucine-rich repeat containing protein 15 (LRRC15), epidermal growth factor receptor (EGFR), type III variant epidermal growth factor receptor (EGFRvIII), erythropoietin producing hepatocellular carcinoma A2 (EphA2), epithelial cell adhesion molecule (EpCAM), fetal acetylcholine receptor, folate receptor alpha (FRα), ganglioside GD2 (GD2), glypican-3 (GPC3), guanylyl cyclase C (GUCY2C), human epidermal growth factor receptor 1 (HER1), human epidermal growth factor receptor 2 (ERBB2/HER2), intercellular adhesion molecule 1 (ICAM-1), interleukin 13 receptor α2 (IL13Rα2), interleukin 11 receptor α (IL11Rα), Kirsten rat sarcoma viral oncogene homolog (KRAS), KRAS G12D, L1-cell adhesion molecule (L1CAM), MAGE, MET, mucin 1 (MUC1), mucin 16 (MUC16), mucin 17 (MUC17), natural killer group 2 member D (NKG2D), NYESO-1, prostate stem cell antigen (PSCA), Wilms tumor 1 (WT-1), galectin 9 (Gal9), program cell death 1 ligand 1 (PD-L1), trophoblast glycoprotein (5T4 oncofetal antigen), folate receptor alpha (FOLR1), and tumor-associated calcium signal transducer 2 (TROP2). [0244] Binding proteins capable of binding these TAAs are described in the Examples and readily known in the art. Any of these known binding proteins or a TAA binding domain derived therefrom can readily be utilized as the TAA binding domain of the bispecific agonist LTβR binding protein described herein. For example, and without limitation the TAA binding domain may comprise the CLDN6 binding domain, the CLDN18.2 binding domain, the LRRC15 binding domain, or the MUC17 binding domain described in Example 7 herein. Other suitable TAA binding domains include, without limitation, an anti- alpha-fetoprotein (AFP) antibody or binding domain thereof (see e.g., U.S. Patent No.8,268,312 to Hansen et al., which is hereby incorporated by reference in its entirety); an anti-CD44v6 antibody or binding domain thereof (see e.g., U.S. Patent No.6,972,324 to Adolf et al., which is hereby incorporated by reference in its entirety); an anti-carbonic anhydrase IX (CAIX) antibody or binding domain thereof (see e.g., WO2011139375 to Renner and U.S. Patent No.10,487,153 to Lenferink, which are hereby incorporate by reference in their entirety); an anti-carcinoembryonic antigen (CEA) antibody or binding domain thereof (see e.g., U.S. Patent Appl. Publ. No. 20160075795 to Mossner et al., which is hereby incorporated by reference in its entirety); an anti-CD133 antibody or binding domain thereof (see e.g., U.S. Patent No.11, 098,109 to Vallera and U.S. Patent Appl. Publ. No. 20200354468 to Pfister et al., which are hereby incorporate by reference in their entirety); an anti-hepatocyte growth factor receptor (c-MET) antibody or binding domain thereof (see e.g., U.S. Patent No.9,458,245 to Harms et al., and U.S. Patent No.9,068,011 to Neijssen et al., which are hereby incorporate by reference in their entirety); an anti-claudin 18.2 antibody or binding domain thereof (see e.g., U.S. Patent App. Publ. No.20200055932 to Dahlhoff et al., and U.S. Patent No. 10,421,817 to Hu et al., which are hereby incorporate by reference in their entirety); an anti- claudin 6 antibody or binding domain thereof (see e.g., U.S. Patent No. 11,248,046 to Chambers et al., which is hereby incorporated by reference in its entirety); an anti-epidermal growth factor receptor (EGFR) antibody or binding domain thereof (see e.g., U.S. Patent No.9,695,242 to Chiu et al., and U.S. Patent No. 9,458,236 to van de Winkel et al., which are hereby incorporate by reference in their entirety); an anti-type III variant epidermal growth factor receptor (EGFRvIII) antibody or binding domain thereof (see e.g., U.S. Patent No.10,738,124 to Kirschner et al., and U.S. Patent No. 10,273,309 to Ellwanger et al., which are hereby incorporate by reference in their entirety); an anti-erythropoietin producing hepatocellular carcinoma A2 (EphA2) antibody or binding domain thereof (see e.g., U.S. Patent No.9,676,864 to Bouchard et al., and U.S. Patent No. 10,406,225 to Zhou and Marks, which are hereby incorporate by reference in their entirety); an anti-epithelial cell adhesion molecule (EpCAM) antibody or binding domain thereof (see e.g., U.S. Patent No.8,637,017 to Gunnarsson et al., and U.S. Patent No.9,790,274 to Harvey et al., which are hereby incorporate by reference in their entirety); an anti-fetal acetylcholine receptor antibody or binding domain thereof (see e.g., WO2013011030 to Martinez-Martinez which is hereby incorporated by reference in its entirety); anti-folate receptor alpha (FRα) binding domain (see e.g., U.S. Patent No. 8,475,795 to O’Shannessy, which is hereby incorporated by reference in its entirety); an anti-ganglioside GD2 (GD2) antibody or binding domain thereof (see e.g., U.S. Patent App. Publ. No.20210189000 to Scholz et al., and U.S. Patent App. Publ. No. 20210179732 to Leusen et al., which are hereby incorporate by reference in their entirety); an anti-glypican-3 (GPC3) antibody or binding domain thereof (see e.g., U.S. Patent No. 9,217,033 to Terrett et al., which is hereby incorporated by reference in its entirety); an anti-guanylyl cyclase C (GUCY2C) antibody or binding domain thereof (see e.g., U.S. Patent Appl. Publ. No.20200010566 to Chang et al., which is hereby incorporated by reference in its entirety); an anti-human epidermal growth factor receptor 1 (HER1) antibody or binding domain thereof (see e.g., U.S. Patent Appl. Publ. No. 20180100022 to Bossenmaier et al., which is hereby incorporated by reference in its entirety); an anti- human epidermal growth factor receptor 2 (ERBB2/HER2) antibody or binding domain thereof (see e.g., U.S. Patent No. 11,046,771 to Goeij et al. and U.S. Patent No. 8,722,362 to Alper, which are hereby incorporate by reference in their entirety); an anti-intercellular adhesion molecule 1 (ICAM-1) antibody or binding domain thereof (see e.g., U.S. Patent Appl. Publ. No.20160280788 Hansson et al., and U.S. Patent No. 8,623,369 to Abulrob et al., which are hereby incorporate by reference in their entirety); an anti- interleukin 13 receptor α2 (IL13Rα2) antibody or binding domain thereof (see e.g., U.S. Patent Appl. Publ. No.20200181227 to Balyasnikova et al., which is hereby incorporated by reference in its entirety); an anti- interleukin 11 receptor α (IL11Rα) antibody or binding domain thereof (see e.g., U.S. Patent No.9,340,618 to Edwards et al., which is hereby incorporated by reference in its entirety); an anti-Kirsten rat sarcoma viral oncogene homolog (KRAS) antibody or binding domain thereof (see e.g., U.S. Patent No.11,174,314 to Zhou et al., which is hereby incorporated by reference in its entirety); an anti-L1-cell adhesion molecule (L1CAM) antibody or binding domain thereof (see e.g., U.S. Patent Appl. Publ. No.20220033494 to Hong et al., which is hereby incorporated by reference in its entirety); an anti-MAGE antibody or binding domain thereof (see e.g., U.S. Patent No.8,987,423 to Bergeron et al., and U.S. Patent Appl. Publ. No.20140093514 to Esslinger et al., which are hereby incorporated by reference in their entirety); an anti-hepatocyte growth factor receptor (HGF receptor/MET) antibody or binding domain thereof (see e.g., U.S. Patent No. 8,609,090 to Burgess et al., and U.S. Patent No.8,545,839 to Goetsch et al., which are hereby incorporated by reference in their entirety); an anti-mucin 1 (MUC1) antibody or binding domain thereof (see e.g., U.S. Patent No. 7,183,388 to Denardo et al., and U.S. Patent No.8,951,526 to Yonezawa, which are hereby incorporated by reference in their entirety); an anti-mucin 16 (MUC16) antibody or binding domain thereof (see e.g., U.S. Patent No. 10,941,208 to Haber et al., which is hereby incorporated by reference in its entirety); an anti-mucin 17 (MUC17) antibody or binding domain thereof (see e.g., U.S. Patent Appl. Publ. No.20210130465 to Raum et al., which is hereby incorporated by reference in its entirety) an anti-natural killer group 2 member D (NKG2D) antibody or binding domain thereof (see e.g., U.S. Patent No. 10,526,409 to Urso et al., which is hereby incorporated by reference in its entirety); an anti-cancer/testis antigen 1 (CT6.1) antibody or binding domain thereof (see e.g., U.S. Patent Appl. Publ. No.20190382504, which is hereby incorporated by reference in its entirety); an anti-prostate stem cell antigen (PSCA) antibody or binding domain thereof (see e.g., U.S. Patent No.8,013,128 to Gudas et al., which is hereby incorporated by reference in its entirety); an anti-Wilms tumor 1 (WT-1) antibody or binding domain thereof (see e.g., U.S. Patent No. 11,192,957 to Benz et al., which is hereby incorporated by reference in its entirety); an anti-galectin 9 (Gal9) antibody or binding domain thereof (see e.g., U.S. Patent No.10,344,091 to Koide et al., which is hereby incorporated by reference in its entirety); an anti-program cell death 1 ligand 1 (PD-L1) antibody or binding domain thereof (see e.g., U.S. Patent No.9,988,452 to Freeman et al., which is hereby incorporated by reference in its entirety); an anti-trophoblast glycoprotein (5T4 oncofetal antigen) antibody or binding domain thereof (see e.g., U.S. Patent No.8,044,178 to Boghaert et al., which is hereby incorporated by reference in its entirety); an anti-folate receptor alpha (FOLR1) antibody or binding domain thereof (see e.g., U.S. Patent No.9,207,238 to Ando et al., which is hereby incorporated by reference in its entirety); and anti-tumor-associated calcium signal transducer 2 (trophoblast cell surface antigen 2; TROP2) antibody or binding domain thereof (see e.g., U.S. Patent No.11,192,954 to Tang et al., which is hereby incorporated by reference in its entirety). [0245] In another embodiment, the tumor-associated antigen binding domain of the bispecific LTβR binding protein binds to a stromal associated antigen (SAA) of the tumor microenvironment (TME). Suitable SAAs include, without limitation, fibronectin (FN1), matrix metalloproteinase-2 (MMP2), platelet derived growth factor receptor-β (PDGFRβ), dickkopf-related protein 3 (DKK3), platelet-derived growth factor subunit B (PDGFB), NUAK family SNF1-like kinase 1 (NUAK1), fibroblast growth factor (FGF1), PDZ and LIM domain protein 4 (PDLIM4), gremlin 1(Grem1), and periostin (POSTN). [0246] Binding proteins capable of binding these SAAs are readily known in the art and can readily be utilized as the second binding domain of the LTβR bispecific binding protein described herein. For example, and without limitation, the second binding domain may comprise an anti-fibronectin antibody or binding domain thereof (see e.g., U.S. Patent Appl. Publ. No.20100248262 to Kato et al., which is hereby incorporated by reference in its entirety), an anti-matrix metalloproteinase-2 antibody or binding domain thereof (see e.g., U.S. Patent No. 8,013,125 to Devy which is hereby incorporated by reference in its entirety), an anti-platelet derived growth factor receptor-β (PDGFRβ) antibody or binding domain thereof (see e.g., U.S. Patent No. 7,740,850 to Zhu et al., which is hereby incorporated by reference in its entirety), an anti-dickkopf-related protein 3 antibody or binding domain thereof (see e.g., U.S. Patent Appl. Publ. No.20210340232 to Hwang et al., which is hereby incorporated by reference in its entirety), an anti- platelet-derived growth factor subunit B antibody or binding domain thereof (see e.g., U.S. Patent No. 9,428,577 to Arch et al., which is hereby incorporated by reference in its entirety), an anti-NUAK family SNF1-like kinase 1 (NUAK1) antibody or binding domain thereof, an anti-fibroblast growth factor antibody or binding domain thereof (see e.g., U.S. Patent No. 8,410,250 to Ashkenazi et al., and U.S. Patent No. 8,481,168 to Weng et al., which are hereby incorporated by reference in their entirety), an anti-PDZ and LIM domain protein 4 (PDLIM4) antibody or binding domain thereof, an anti-gremlin 1 antibody or binding domain thereof (see e.g., U.S. Patent Appl. Publ. No. 20180057580 to Chalothorn et al., and U.S. Patent Appl. Publ. No.20210163586 to Dedi et al., which are hereby incorporated by reference in their entirety, and an anti-periostin antibody or binding domain thereof (see e.g., U.S. Patent No.8,372,957 to Taniyama et al., which is hereby incorporated by reference in its entirety). [0247] In one embodiment, the multi-specific LTβR binding protein of the present disclosure is a bispecific LTβR binding protein that is monovalent for LTβR binding. For the LTβR binding domains described herein, it has been discovered that bispecific molecules comprising these LTβR binding domains in monovalent form (but not bivalent form) exhibit cross-linking dependent LTβR agonism. In other words, bispecific molecules comprising monovalent LTβR binding domains require binding of both the first and second binding domains to induce LTβR receptor clustering and achieve LTβR agonism. This bispecific construct, having monovalency for LTβR, is particularly beneficial for targeting LTβR agonism to a particular tissue, such as the tumor microenvironment, because activity is dependent on binding of the first and second binding domains. Additionally, the LTβR binders disclosed herein were specifically screened and selected based on their binding to LTβR at a region, e.g., CRD4, that that does not inhibit endogenous LTβR ligand binding and signaling. Together these features of the LTβR binding proteins disclosed herein ensure that if a LTβR bispecific binding protein binds to LTβR outside of the targeted tumor microenvironment, (i) binding will not induce off-target LTβR signaling in the absence of the second binding domain binding to its target, and (ii) such binding will not block endogenous LTβR ligand (i.e., LIGHT and LTα1β2) signaling in the off-target tissue. These design features provide LTβR binding proteins having superior safety and efficacy properties relative to previously described LTβR binding proteins. Derivatives, Variants, and Mimetics [0248] In one embodiment, the LTβR binding proteins described herein comprise one or more amino acid modifications in the heavy chain constant regions that improve half-life/stability or render the antibody more suitable for expression/manufacturability. In one embodiment, the LTβR binding protein is designed to prevent or reduce interaction with Fc receptors. In exemplary instances, the binding protein is a Stable Effector Functionless (SEFL) binding protein comprising a constant region that lacks the ability to interact with Fcγ receptors. The amino acid mutations and methods of making SEFL antibodies are known in the art, see, e.g., Liu et al., J. Biol. Chem.292: 1876-1883 (2016); and Jacobsen et al., J. Biol. Chem.292: 1865-1875 (2017), which are hereby incorporated by reference in their entirety. In exemplary aspects, an LTβR binding protein described herein is modified to comprise one or more of the following mutations, numbered according to the EU system: L242C, A287C, R292C, N297G, V302C, L306C, and/or K334C. In exemplary aspects, an LTβR binding protein described herein comprises an N297G substitution to form a SEFL binding protein. In exemplary aspects, an LTβR binding protein described herein comprises A287C, N297G, and L306C substitutions to form a SEFL binding protein. In other exemplary aspects, the LTβR binding protein comprises R292C, N297G, and V302C substitutions to form a SEFL2-2 antibody based molecule. [0249] In one embodiment, the agonist LTβR binding proteins as described herein may comprise other half-life extension (HLE) modifications. In one embodiment, the HLE modification occurs in the heavy chain constant region and comprises one or more of the following amino acid substitutions, numbered according to the EU system: M252Y, S254T, and T256E. In exemplary instances, the LTβR binding proteins comprise one or two of M252Y, S254T, and T256E substitutions. In exemplary instances, the LTβR binding proteins of the present disclosure comprise all three of M252Y, S254T, and T256E. In one embodiment, the HLE modification occurs in the heavy chain constant region and comprises one or more of the following substitutions, numbered according to the EU system: L309D, Q311H, and N434S. In exemplary instances, the LTβR binding proteins of the present disclosure comprise one, two or all three of the L309D, Q311H, and N434S substitutions. In exemplary instances, the LTβR binding proteins comprise all three of L309D, Q311H, and N434S substitutions. In one embodiment, the LTβR binding proteins disclosed herein comprise SEFL or SEFL2-2 modifications in combination with any of the herein described HLE modifications. [0250] In certain embodiments, variants of the agonist LTβR binding protein include glycosylation variants wherein the number and/or type of glycosylation site has been altered compared to the amino acid sequences of a parent polypeptide. In certain embodiments, variants comprise a greater or a lesser number of N-linked glycosylation sites than the native protein. Alternatively, substitutions which eliminate this sequence will remove an existing N-linked carbohydrate chain. Also provided is a rearrangement of N- linked carbohydrate chains wherein one or more N-linked glycosylation sites (typically those that are naturally occurring) are eliminated and one or more new N-linked sites are created. Additional binding protein variants include cysteine variants wherein one or more cysteine residues are deleted from or substituted for another amino acid (e.g., serine) as compared to the parent amino acid sequence. Cysteine variants may be useful when antibodies must be refolded into a biologically active conformation such as after the isolation of insoluble inclusion bodies. Cysteine variants generally have fewer cysteine residues than the native protein, and typically have an even number to minimize interactions resulting from unpaired cysteines. [0251] In one embodiment, the agonist LTβR binding proteins disclosed herein (e.g., agonist LTβR antibodies and bispecific agonist LTβR binding proteins) include post translationally modified variants. For example, in one embodiment the agonist LTβR binding proteins comprising a heavy chain, have the C- terminal lysine residue deleted. [0252] Other desired amino acid substitutions (whether conservative or non-conservative) and deletions can be determined by those skilled in the art at the time such substitution or deletion is desired. In certain embodiments, amino acid substitutions can be used, for example, to identify important residues of a binding protein associated with function, to increase or decrease the affinity of the antibodies to the target of interest described herein, reduce susceptibility to proteolysis, reduce susceptibility to oxidation, alter binding affinity for forming protein complexes, and/or confer or modify other physiochemical or functional properties on such polypeptides. According to certain embodiments, single or multiple amino acid substitutions (in certain embodiments, conservative amino acid substitutions) may be made in the naturally-occurring sequence (in certain embodiments, in the portion of the polypeptide outside the domain(s) forming intermolecular contacts). In certain embodiments, a conservative amino acid substitution typically may not substantially change the structural characteristics of the parent sequence (e.g., a replacement amino acid should not tend to break a helix that occurs in the parent sequence or disrupt other types of secondary structure that characterizes the parent sequence). Examples of art-recognized polypeptide secondary and tertiary structures are described in Proteins, Structures and Molecular Principles (Creighton, Ed., W. H. Freeman and Company, New York (1984)); Introduction to Protein Structure (C. Branden and J. Tooze, eds., Garland Publishing, New York, N.Y. (1991)); and Thornton et al. Nature 354:105 (1991), which are each incorporated herein by reference. Nucleic Acid Molecules Encoding LTβR Binding Proteins [0253] The present disclosure further provides nucleic acid molecules comprising a nucleotide sequence encoding an agonist LTβR binding protein of the present disclosure. A “nucleic acid molecule” as used herein encompasses polynucleotides and oligonucleotides and generally refers to a polymer of DNA or RNA, or modified forms thereof, which can be single-stranded or double-stranded, synthesized or obtained (e.g., isolated and/or purified) from natural sources, which can contain natural, non-natural or altered nucleotides, and which can contain a natural, non-natural or altered inter-nucleotide linkage, such as a phosphoroamidate linkage or a phosphorothioate linkage, instead of the phosphodiester found between the nucleotides of an unmodified oligonucleotide. The nucleic acid molecule can comprise any nucleotide sequence which encodes any of the agonist LTβR binding proteins of the present disclosure. In some embodiments, the nucleic acid does not comprise any insertions, deletions, inversions, and/or substitutions. In other embodiments, the nucleic acid comprises one or more insertions, deletions, inversions, and/or substitutions. [0254] In some aspects, the nucleic acid molecules of the present disclosure are recombinant. As used herein, the term “recombinant” refers to molecules that are constructed outside living cells by joining natural or synthetic nucleic acid segments using laboratory methods to form nucleic acid molecules that are not otherwise found in nature. [0255] The nucleic acid molecules of the present disclosure in some aspects are constructed based on chemical synthesis and/or enzymatic ligation reactions using procedures known in the art. See, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual. 3rd ed., Cold Spring Harbor Press, Cold Spring Harbor, NY 2001; and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, NY, 1994. For example, a nucleic acid molecule can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed upon hybridization (e.g., phosphorothioate derivatives and acridine substituted nucleotides). Examples of modified nucleotides that can be used to generate the nucleic acids include, but are not limited to, 5- fluorouracil, 5-bromouracil, 5-chIorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5- (carboxyhydroxymethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridme, 5- carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6- isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2- methylguanine, 3-methylcytosine, 5-methylcytosine, N -substituted adenine, 7-methylguanine, 5- methylammomethyluracil, 5- methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5'- methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil- 5-oxyacetic acid (v), wybutoxosine, pseudouratil, queosine, 2-thiocytosine, 5-methyl-2- thiouracil, 2-thiouracil, 4- thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methylester, 3- (3-amino-3-N-2-carboxypropyl) uracil, and 2,6-diaminopurine. [0256] In one embodiment, the nucleic acid molecule comprises one or more polynucleotides that encode all or part of an agonist LTβR binding protein, for example, one or both chains of a binding protein as disclosed herein. The polynucleotide can be any length as appropriate for the desired use or function, and can be operably coupled to one or more additional sequences, for example, regulatory sequences, and/or be part of a larger nucleic acid molecule, for example, a vector. A polynucleotide is “operably coupled” or “operably linked” to a regulatory sequence if the regulatory sequence affects the expression (e.g., the level, timing, or location of expression) of the polynucleotide sequence. The polynucleotide molecule can be single-stranded or double-stranded and can comprise RNA and/or DNA nucleotides, and artificial variants thereof (e.g., peptide nucleic acids). [0257] In one embodiment, a polynucleotide of the present disclosure encodes an agonist LTβR binding protein disclosed supra and comprises a sequence encoding any one, any two, any three, any four, any five, or any six of the CDRs described supra, including the heavy chain CDRs provided in Tables 2, 6, and 10, and the light chain CDRs provided in Tables 3, 7 and 11. [0258] In one embodiment, polynucleotide molecules of the present disclosure comprise a nucleotide sequence encoding a VH domain and a VL domain of an LTβR binding protein that binds to the CRD4 of LTβR. Accordingly, in one embodiment, the polynucleotide molecule comprises a nucleotide sequence encoding a VH and VL domain selected from: a VH amino acid sequence of SEQ ID NO: 119 and a VL amino acid sequence of SEQ ID NO: 120; a VH amino acid sequence of SEQ ID NO: 121 and a VL amino acid sequence of SEQ ID NO: 122; a VH amino acid sequence of SEQ ID NO: 123 and a VL amino acid sequence of SEQ ID NO: 124; a VH amino acid sequence of SEQ ID NO: 125 and a VL amino acid sequence of SEQ ID NO: 126; a VH amino acid sequence of SEQ ID NO: 127 and a VL amino acid sequence of SEQ ID NO: 128; a VH amino acid sequence of SEQ ID NO: 129 and a VL amino acid sequence of SEQ ID NO: 130; a VH amino acid sequence of SEQ ID NO: 131 and a VL amino acid sequence of SEQ ID NO: 132; a VH amino acid sequence of SEQ ID NO: 133 and a VL amino acid sequence of SEQ ID NO: 134; a VH amino acid sequence of SEQ ID NO: 135 and a VL amino acid sequence of SEQ ID NO: 136; a VH amino acid sequence of SEQ ID NO: 137 and a VL amino acid sequence of SEQ ID NO: 138; a VH amino acid sequence of SEQ ID NO: 139 and a VL amino acid sequence of SEQ ID NO: 140; a VH amino acid sequence of SEQ ID NO: 141 and a VL amino acid sequence of SEQ ID NO: 142; a VH amino acid sequence of SEQ ID NO: 143 and a VL amino acid sequence of SEQ ID NO: 144; a VH amino acid sequence of SEQ ID NO: 145 and a VL amino acid sequence of SEQ ID NO: 146; a VH amino acid sequence of SEQ ID NO: 147 and a VL amino acid sequence of SEQ ID NO: 148; a VH amino acid sequence of SEQ ID NO: 149 and a VL amino acid sequence of SEQ ID NO: 150; a VH amino acid sequence of SEQ ID NO: 151 and a VL amino acid sequence of SEQ ID NO: 152; a VH amino acid sequence of SEQ ID NO: 153 and a VL amino acid sequence of SEQ ID NO: 154; a VH amino acid sequence of SEQ ID NO: 155 and a VL amino acid sequence of SEQ ID NO: 156; and a VH amino acid sequence of SEQ ID NO: 157 and a VL amino acid sequence of SEQ ID NO: 158. [0259] In one embodiment, the polynucleotide molecule of the present disclosure comprises a nucleotide sequence encoding a VH domain and a VL domain of an agonist LTβR binding protein that competes for binding to CRD4 of LTβR with the exemplary LTβR binders of LIBC219081 and LIBC218979. Accordingly, in one embodiment, the polynucleotide molecule comprises a nucleotide sequence encoding a VH and VL domain selected from: a VH amino acid sequence of SEQ ID NO: 401 and a VL amino acid sequence of SEQ ID NO: 402; a VH amino acid sequence of SEQ ID NO: 403 and a VL amino acid sequence of SEQ ID NO: 404; a VH amino acid sequence of SEQ ID NO: 405 and a VL amino acid sequence of SEQ ID NO: 406; a VH amino acid sequence of SEQ ID NO: 407 and a VL amino acid sequence of SEQ ID NO: 408; a VH amino acid sequence of SEQ ID NO: 409 and a VL amino acid sequence of SEQ ID NO: 410; a VH amino acid sequence of SEQ ID NO: 411 and a VL amino acid sequence of SEQ ID NO: 412; a VH amino acid sequence of SEQ ID NO: 413 and a VL amino acid sequence of SEQ ID NO: 414; a VH amino acid sequence of SEQ ID NO: 415 and a VL amino acid sequence of SEQ ID NO: 416; a VH amino acid sequence of SEQ ID NO: 417 and a VL amino acid sequence of SEQ ID NO: 418; a VH amino acid sequence of SEQ ID NO: 419 and a VL amino acid sequence of SEQ ID NO: 420; a VH amino acid sequence of SEQ ID NO: 421 and a VL amino acid sequence of SEQ ID NO: 422; a VH amino acid sequence of SEQ ID NO: 423 and a VL amino acid sequence of SEQ ID NO: 424; a VH amino acid sequence of SEQ ID NO: 425 and a VL amino acid sequence of SEQ ID NO: 426; a VH amino acid sequence of SEQ ID NO: 427 and a VL amino acid sequence of SEQ ID NO: 428; a VH amino acid sequence of SEQ ID NO: 429 and a VL amino acid sequence of SEQ ID NO: 430; a VH amino acid sequence of SEQ ID NO: 431 and a VL amino acid sequence of SEQ ID NO: 432; a VH amino acid sequence of SEQ ID NO: 433 and a VL amino acid sequence of SEQ ID NO: 434; a VH amino acid sequence of SEQ ID NO: 435 and a VL amino acid sequence of SEQ ID NO: 436; a VH amino acid sequence of SEQ ID NO: 437 and a VL amino acid sequence of SEQ ID NO: 438; a VH amino acid sequence of SEQ ID NO: 439 and a VL amino acid sequence of SEQ ID NO: 440; a VH amino acid sequence of SEQ ID NO: 441 and a VL amino acid sequence of SEQ ID NO: 442; a VH amino acid sequence of SEQ ID NO: 443 and a VL amino acid sequence of SEQ ID NO: 444; a VH amino acid sequence of SEQ ID NO: 445 and a VL amino acid sequence of SEQ ID NO: 446; a VH amino acid sequence of SEQ ID NO: 447 and a VL amino acid sequence of SEQ ID NO: 448; a VH amino acid sequence of SEQ ID NO: 449 and a VL amino acid sequence of SEQ ID NO: 450; a VH amino acid sequence of SEQ ID NO: 451 and a VL amino acid sequence of SEQ ID NO: 452; a VH amino acid sequence of SEQ ID NO: 453 and a VL amino acid sequence of SEQ ID NO: 454; a VH amino acid sequence of SEQ ID NO: 455 and a VL amino acid sequence of SEQ ID NO: 456; a VH amino acid sequence of SEQ ID NO: 457 and a VL amino acid sequence of SEQ ID NO: 458; a VH amino acid sequence of SEQ ID NO: 459 and a VL amino acid sequence of SEQ ID NO: 460; a VH amino acid sequence of SEQ ID NO: 461 and a VL amino acid sequence of SEQ ID NO: 462; a VH amino acid sequence of SEQ ID NO: 463 and a VL amino acid sequence of SEQ ID NO: 464; a VH amino acid sequence of SEQ ID NO: 465 and a VL amino acid sequence of SEQ ID NO: 466; a VH amino acid sequence of SEQ ID NO: 467 and a VL amino acid sequence of SEQ ID NO: 468; a VH amino acid sequence of SEQ ID NO: 469 and a VL amino acid sequence of SEQ ID NO: 470; a VH amino acid sequence of SEQ ID NO: 471 and a VL amino acid sequence of SEQ ID NO: 472; and a VH amino acid sequence of SEQ ID NO: 473 and a VL amino acid sequence of SEQ ID NO: 474. [0260] In one embodiment, the polynucleotide molecule of the present disclosure comprises a nucleotide sequence encoding a VH domain and a VL domain of an agonist LTβR binding protein that binds human LTβR. Accordingly, in one embodiment, the polynucleotide comprises a nucleotide sequence encoding a VH and VL domain selected from: a VH amino acid sequence of SEQ ID NO: 644 and a VL amino acid sequence of SEQ ID NO: 645; a VH amino acid sequence of SEQ ID NO: 646 and a VL amino acid sequence of SEQ ID NO: 647; a VH amino acid sequence of SEQ ID NO: 648 and a VL amino acid sequence of SEQ ID NO: 649; a VH amino acid sequence of SEQ ID NO: 650 and a VL amino acid sequence of SEQ ID NO: 651; a VH amino acid sequence of SEQ ID NO: 652 and a VL amino acid sequence of SEQ ID NO: 653; a VH amino acid sequence of SEQ ID NO: 654 and a VL amino acid sequence of SEQ ID NO: 655; a VH amino acid sequence of SEQ ID NO: 656 and a VL amino acid sequence of SEQ ID NO: 657; a VH amino acid sequence of SEQ ID NO: 658 and a VL amino acid sequence of SEQ ID NO: 659; a VH amino acid sequence of SEQ ID NO: 660 and a VL amino acid sequence of SEQ ID NO: 661; a VH amino acid sequence of SEQ ID NO: 662 and a VL amino acid sequence of SEQ ID NO: 663; a VH amino acid sequence of SEQ ID NO: 664 and a VL amino acid sequence of SEQ ID NO: 665; a VH amino acid sequence of SEQ ID NO: 666 and a VL amino acid sequence of SEQ ID NO: 667; a VH amino acid sequence of SEQ ID NO: 668 and a VL amino acid sequence of SEQ ID NO: 669; a VH amino acid sequence of SEQ ID NO: 670 and a VL amino acid sequence of SEQ ID NO: 671; a VH amino acid sequence of SEQ ID NO: 672 and a VL amino acid sequence of SEQ ID NO: 673; a VH amino acid sequence of SEQ ID NO: 674 and a VL amino acid sequence of SEQ ID NO: 675; a VH amino acid sequence of SEQ ID NO: 676 and a VL amino acid sequence of SEQ ID NO: 677; a VH amino acid sequence of SEQ ID NO: 678 and a VL amino acid sequence of SEQ ID NO: 679; a VH amino acid sequence of SEQ ID NO: 680 and a VL amino acid sequence of SEQ ID NO:681; a VH amino acid sequence of SEQ ID NO: 682 and a VL amino acid sequence of SEQ ID NO: 683; a VH amino acid sequence of SEQ ID NO: 684 and a VL amino acid sequence of SEQ ID NO: 685; a VH amino acid sequence of SEQ ID NO: 686 and a VL amino acid sequence of SEQ ID NO: 687; a VH amino acid sequence of SEQ ID NO: 688 and a VL amino acid sequence of SEQ ID NO: 689; a VH amino acid sequence of SEQ ID NO: 690 and a VL amino acid sequence of SEQ ID NO: 691. Exemplary nucleic acid sequences encoding the VH and VL domains of the agonist LTβR binding proteins disclosed herein are provided in Table 14 below Table 14. Nucleic Acid Sequences of LTβR Binding Proteins
[0261] Changes can be introduced into the nucleic acid molecules disclosed herein by mutation, thereby leading to changes in the amino acid sequence of a polypeptide (e.g., the LTβR binding protein) that it encodes. Mutations can be introduced using any technique known in the art. In one embodiment, one or more particular amino acid residues are changed using, for example, a site-directed mutagenesis protocol. In another embodiment, one or more randomly selected residues is changed using, for example, a random mutagenesis protocol. Irrespective of how it is made, a mutant polypeptide can be expressed and screened for a desired property. [0262] Mutations can be introduced into a nucleic acid molecule disclosed herein without significantly altering the biological activity of a polypeptide that it encodes. For example, one can make nucleotide substitutions leading to amino acid substitutions at non-essential amino acid residues. In one embodiment, a nucleotide sequence provided herein for one of the agonist LTβR binding proteins of the present disclosure is mutated such that it encodes an amino acid sequence comprising one or more deletions or substitutions of amino acid residues that are shown herein for the light chains and/or the heavy chains of the LTβR binding proteins of the present disclosure. In another embodiment, the mutagenesis inserts an amino acid adjacent to one or more amino acid residues shown herein for the light and/or heavy chains of the agonist LTβR binding proteins of the present disclosure. Alternatively, one or more mutations can be introduced into the nucleic acid molecules as disclosed herein that selectively changes the biological activity of the agonist LTβR binding protein that it encodes. [0263] The nucleotide sequences of the agonist LTβR binding proteins of the present disclosure, encoding the corresponding amino acid sequences of the antibodies of the present disclosure, can be altered, for example, by random mutagenesis or by site-directed mutagenesis to create an altered polynucleotide comprising one or more particular nucleotide substitutions, deletions, or insertions as compared to the non- mutated polynucleotide. Examples of techniques for making such alterations are described in Walder et al., Gene 42:133 (1986); Bauer et al. Gene 37:73 (1985); Smith et al., 1981, Genetic Engineering: Principles and Methods, Plenum Press; and U.S. Patent Nos.4,518,584 and 4,737,462. These and other methods can be used to make, for example, derivatives of the LTβR binding proteins that have a desired property, for example, increased affinity, avidity, or specificity for a desired target, increased activity or stability in vivo or in vitro, or reduced in vivo side-effects as compared to the underivatized antibody. [0264] In another embodiment, the present disclosure provides vectors comprising a polynucleotide encoding an agonist LTβR binding protein as disclosed herein. A vector is a nucleic acid molecule used to introduce another nucleic acid into a cell. Examples of vectors include, but are not limited to, plasmids, viral vectors, non-episomal mammalian vectors and expression vectors, for example, recombinant expression vectors. [0265] Vectors comprising a polynucleotide of the present disclosure can be prepared using standard recombinant DNA techniques described in, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual.3rd ed., Cold Spring Harbor Press, Cold Spring Harbor, NY (2001); and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, NY (1994), which are hereby incorporated by reference in their entirety. Constructs of expression vectors, which are circular or linear, can be prepared to contain a replication system functional in a prokaryotic or eukaryotic host cell. Replication systems can be derived, e.g., from CoIEl, 2 μ plasmid, λ, SV40, bovine papilloma virus, and the like. [0266] In one embodiment, the expression vector is a circular plasmid (see, e.g., Muthumani et al., “Optimized and Enhanced DNA Plasmid Vector Based In vivo Construction of a Neutralizing anti-HIV-1 Envelope Glycoprotein Fab,” Hum. Vaccin. Immunother. 9: 2253-2262 (2013), which is hereby incorporated by reference in its entirety). Plasmids can transform a target cell by integration into the cellular genome or exist extrachromosomally (e.g., autonomous replicating plasmid with an origin of replication). Exemplary plasmid vectors include, without limitation, pCEP4, pREP4, pVAX, pcDNA3.0, provax, or any other expression vector capable of expressing the heavy chain polypeptide and/or light chain polypeptide encoded by the recombinant nucleic acid sequence construct. [0267] In another embodiment, the expression vector is a linear expression cassette (“LEC”). LECs are capable of being efficiently delivered to a subject via electroporation to express the heavy chain polypeptide and/or light chain polypeptide encoded by the recombinant nucleic acid sequence construct. The LEC may be any linear DNA devoid of a phosphate backbone. In one embodiment, the LEC does not contain any antibiotic resistance genes and/or a phosphate backbone. In another embodiment, the LEC does not contain other nucleic acid sequences unrelated to the desired gene expression. [0268] The LEC may be derived from any plasmid capable of being linearized. The plasmid may be capable of expressing the heavy chain polypeptide and/or light chain polypeptide encoded by the recombinant nucleic acid sequence construct. Exemplary plasmids include, without limitation, pNP (Puerto Rico/34), pM2 (New Caledonia/99), WLV009, pVAX, pcDNA3.0, or provax, or any other expression vector capable of expressing the heavy chain polypeptide and/or light chain polypeptide encoded by the recombinant nucleic acid sequence construct. [0269] In another embodiment, the expression vector is a viral vector. Suitable viral vectors that are capable of expressing full length antibodies or binding portions thereof include, for example, an adeno- associated virus (AAV) vector (see, e.g., Lewis et al., “Generation of Neutralizing Activity against Human Immunodeficiency Virus Type I in Serum by Antibody Gene Transfer,” J. Virol.76:8769-775 (2002); Fang et al., “An Antibody Delivery System for Regulated Expression of Therapeutic Levels of Monoclonal Antibodies In vivo,” Mol. Ther. 15(6): 1153-9 (2007); Buning et al, “Recent Developments in Adeno- associated Virus Vector Technology,” J. Gene Med.10:717-733 (2008), a lentivirus vector (see, e.g., Joseph et al., “Inhibition of In vivo HIV Infection in Humanized Mice by Gene Therapy of Human Hematopoietic Stem Cells with a Lentiviral Vector Encoding a Broadly Neutralizing anti-HIV Antibody,” J. Virol., 84: 6645-53 (2010); and Luo et al., “Engineering Human Hematopoietic Stem/Progenitor Cells to Produce a Broadly Neutralizing anti-HIV Antibody after In vivo Maturation to Human B Lymphocytes,” Blood 113: 1422-1431 (2009)), a retrovirus vector, a replication deficient adenovirus vector and a gutless adenovirus vector (see e.g., U.S. Pat. No. 5,872,005). Methods for generating and isolating adeno-associated viruses (AAVs) suitable for use as vectors are known in the art (see, e.g., Grieger & Samulski, “Adeno-associated Virus as a Gene Therapy Vector: Vector Development, Production and Clinical Applications,” Adv. Biochem. EnginBiotechnol.99: 119-145 (2005); Buning et al, “Recent Developments in Adeno-associated Virus Vector Technology,” J. Gene Med.10:717-733 (2008)). [0270] The expression vector construct encoding the agonist LTβR binding protein as described herein can include the polynucleotide encoding a heavy chain polypeptide, a heavy chain variable region, or a fragment thereof. The heavy chain polypeptide can include a variable heavy chain (VH) region and/or at least one constant heavy chain (CH) region. The at least one constant heavy chain region can include a constant heavy chain region 1 (CH1), a constant heavy chain region 2 (CH2), and a constant heavy chain region 3 (CH3), and/or a hinge region. In some embodiments, the heavy chain polypeptide can include a VH region and a CH1 region. In other embodiments, the heavy chain polypeptide can include a VH region, a CH1 region, a hinge region, a CH2 region, and a CH3 region. The expression construct can also include a polynucleotide sequence encoding a light chain polypeptide, a light chain variable region, or a fragment thereof. The light chain polypeptide can include a variable light chain (VL) region and/or a constant light chain (CL) region. [0271] In some aspects, the vector comprises one or more regulatory sequences. A “regulatory sequence” is a nucleic acid that affects the expression (e.g., the level, timing, or location of expression) of a nucleic acid to which it is operably linked. Exemplary regulatory sequences include transcription and translation initiation and termination codons, which are specific to the type of host (e.g., bacterium, fungus, plant, or animal) into which the vector is to be introduced, as appropriate and taking into consideration whether the vector is DNA- or RNA-based. Suitable regulatory sequences are selected on the basis of the host cells to be used for expression and are operably linked to the nucleic acid sequence to be expressed. Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cells (e.g., SV40 early gene enhancer, Rous sarcoma virus promoter and cytomegalovirus promoter), those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue- specific regulatory sequences), and those that direct inducible expression of a nucleotide sequence in response to particular treatment or condition (e.g., the metallothionein promoter in mammalian cells and the tet-responsive and/or streptomycin responsive promoter in both prokaryotic and eukaryotic systems (see e.g., Voss et al., Trends Biochem. Sci.11:287 (1986), Maniatis et al., Science 236:1237 (1987)). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc. The expression vectors of the disclosure can be introduced into host cells to thereby produce proteins or peptides encoded by nucleic acids as described herein. [0272] The expression construct can further encode a protease cleavage site. The protease cleavage site can be recognized by a protease or peptidase. The protease can be an endopeptidase or endoprotease, for example, but not limited to, furin, elastase, HtrA, calpain, trypsin, chymotrypsin, trypsin, and pepsin. In other embodiments, the protease can be a serine protease, a threonine protease, cysteine protease, aspartate protease, metalloprotease, glutamic acid protease, or any protease that cleaves an internal peptide bond (i.e., does not cleave the N-terminal or C-terminal peptide bond). The protease cleavage site can include one or more amino acid sequences that promote or increase the efficiency of cleavage. [0273] The expression construct can further encode a linker sequence. The linker sequence can encode an amino acid sequence that spatially separates and/or links the one or more components of the expression construct (heavy chain and light chain components of the encoded antibody). [0274] In one embodiment, a first expression vector construct encodes a heavy chain polypeptide that includes a VH and CH1, and a second expression vector construct encodes a light chain polypeptide that includes a VL and CL. An alternative arrangement includes a first vector encoding a heavy chain polypeptide that includes VH, CH1, hinge region, CH2, and CH3, and a second vector encoding the light chain polypeptide that includes VL and CL. [0275] In another embodiment, the expression vector construct encodes a heavy chain polypeptide that includes VH and CH1, and a light chain polypeptide that includes VL and CL, and a linker sequence is positioned between the nucleic acid sequence encoding the heavy chain polypeptide and the nucleic acid sequence encoding the light chain polypeptide. [0276] In an alternative embodiment, the expression vector construct encodes a heavy chain polypeptide that includes VH and CH1, and a light chain polypeptide that includes VL and CL, and a nucleic acid sequence encoding a protease cleavage site is positioned between the nucleic acid sequence encoding the heavy chain polypeptide and the nucleic acid sequence encoding the light chain polypeptide. [0277] In another embodiment, the expression vector construct encodes a heavy chain polypeptide that includes VH, CH1, hinge region, CH2, and CH3, and a light chain polypeptide that includes VL and CL, and a linker sequence is positioned between the nucleic acid sequence encoding the heavy chain polypeptide and the nucleic acid sequence encoding the light chain polypeptide. [0278] In yet another embodiment, the expression vector construct encodes a heavy chain polypeptide that includes VH, CH1, hinge region, CH2, and CH3, and a light chain polypeptide that includes VL and CL, and a heterologous nucleic acid sequence encoding the protease cleavage site is positioned between the nucleic acid sequence encoding the heavy chain polypeptide and the nucleic acid sequence encoding the light chain polypeptide. [0279] The vector can include one or more marker genes, which allow for selection of transformed or transfected hosts. Marker genes include biocide resistance, e.g., resistance to antibiotics, heavy metals, etc., complementation in an auxotrophic host to provide prototrophy, and the like. Suitable marker genes for the presently disclosed expression vectors include, for instance, neomycin/G418 resistance genes, hygromycin resistance genes, histidinol resistance genes, tetracycline resistance genes, and ampicillin resistance genes. [0280] The vector can comprise a native or normative promoter operably linked to the nucleotide sequence encoding the agonist LTβR binding protein. The selection of promoters, e.g., strong, weak, inducible, tissue-specific, and developmental-specific, is within the ordinary skill of the artisan. Similarly, the combining of a nucleotide sequence with a promoter is also within the skill of the artisan. The promoter can be a non-viral promoter or a viral promoter, e.g., a cytomegalovirus (CMV) promoter, an SV40 promoter, an RSV promoter, and a promoter found in the long-terminal repeat of the murine stem cell virus. [0281] In another embodiment, the present disclosure provides host cells into which a recombinant expression vector of the disclosure has been introduced. A host cell is a cell that is used to express a nucleic acid, e.g., a polynucleotide encoding the LTβR binding protein as described herein. Suitable host cells include prokaryotic cells and eukaryotic cells as described in more detail below. A host cell refers not only to the particular cell containing a nucleic acid molecule of interest, but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to, e.g., mutation or environmental influence, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of “host cell” as used herein. [0282] Prokaryotic host cells include gram negative or gram positive organisms, for example E. coli or bacilli. In exemplary aspects, the cell is a eukaryotic cell, including, but not limited to, a yeast cell, filamentous fungi cell, protozoa cell, algae cell, insect cell, or mammalian cell. Such host cells are described in the art. See, e.g., Frenzel, et al., Front Immunol 4: 217 (2013). In exemplary aspects, the eukaryotic cells are mammalian cells. In exemplary aspects, the mammalian cells are non-human mammalian cells. In some aspects, the cells are Chinese Hamster Ovary (CHO) cells and derivatives thereof (e.g., CHO-K1, CHO pro-3, CS9), mouse myeloma cells (e.g., NS0, GS-NS0, Sp2/0), cells engineered to be deficient in dihydrofolatereductase (DHFR) activity (e.g., DUKX-X11, DG44), human embryonic kidney 293 (HEK293) cells or derivatives thereof (e.g., HEK293T, HEK293-EBNA), green African monkey kidney cells (e.g., COS cells, VERO cells), human cervical cancer cells (e.g., HeLa), human bone osteosarcoma epithelial cells U2-OS, adenocarcinomic human alveolar basal epithelial cells A549, human fibrosarcoma cells HT1080, mouse brain tumor cells CAD, embryonic carcinoma cells P19, mouse embryo fibroblast cells NIH 3T3, mouse fibroblast cells L929, mouse neuroblastoma cells N2a, human breast cancer cells MCF-7, retinoblastoma cells Y79, human retinoblastoma cells SO-Rb50, human liver cancer cells Hep G2, mouse B myeloma cells J558L, or baby hamster kidney (BHK) cells (Gaillet et al.2007; Khan, Adv Pharm Bull 3(2): 257-263 (2013)). In a particular embodiment, the host cell is CS9 (a CHO cell line). [0283] Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., for resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Additional selectable markers include those which confer resistance to drugs, such as G418, hygromycin and methotrexate. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die), among other methods. [0284] The transformed cells can be cultured under conditions that promote expression of the LTβR binding protein, and the binding protein recovered by conventional protein purification procedures. Methods of LTβR Binding Protein Production [0285] The LTβR binding proteins as disclosed herein can be produced by any method known in the art for the synthesis of binding proteins and/or proteins, in particular, by chemical synthesis or preferably, by recombinant expression techniques. Suitable methods of de novo synthesizing polypeptides are described in, for example, Chan et al., Fmoc Solid Phase Peptide Synthesis, Oxford University Press, Oxford, United Kingdom, 2005; and Peptide and Protein Drug Analysis, ed. Reid, R., Marcel Dekker, Inc., 2000. [0286] Recombinant expression techniques involve the construction of an expression vector containing a polynucleotide that encodes an agonist LTβR binding protein as described herein. Once a polynucleotide encoding the agonist LTβR binding protein has been obtained, the vector for the production of the agonist LTβR binding protein may be produced by recombinant DNA technology. An expression vector is constructed containing the agonist LTβR binding protein coding sequence and appropriate transcriptional and translational control signals. These methods include, for example, in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. [0287] The expression vector is transferred to a host cell by conventional techniques and the transfected cells are then cultured by conventional techniques to produce an agonist LTβR binding protein of the disclosure. In one embodiment of the disclosure, vectors encoding both the heavy and light chains of an antibody may be co-expressed in the host cell for expression of the entire immunoglobulin molecule. [0288] A variety of host-expression vector systems may be utilized to express the agonist LTβR binding proteins of the disclosure. Such host-expression systems represent vehicles by which the coding sequences of interest may be produced and subsequently purified, but also represent cells which may, when transformed or transfected with the appropriate nucleotide coding sequences, express binding protein of the disclosure in situ. Bacterial cells such as E. coli, and eukaryotic cells are commonly used for the expression of a recombinant antibody molecule, especially for the expression of whole recombinant antibody molecule. For example, mammalian cells such as Chinese hamster ovary cells (CHO), in conjunction with a vector such as the major intermediate early gene promoter element from human cytomegalovirus is an effective expression system for antibodies (Foecking et al., Gene 45:101 (1986); Cockett et al., Nat. Biotech. 8:2 (1990)). [0289] In addition, a host cell strain which modulates the expression of the inserted sequences or modifies and processes the gene product in a desired fashion may also be selected. Such modifications (e.g., glycosylation) and processing (e.g., cleavage) of protein products may be important for the function of the binding protein. Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins and gene products. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the foreign protein expressed. To this end, eukaryotic host cells which possess the cellular machinery for proper processing of the primary transcript, glycosylation, and phosphorylation of the gene product may be used. Such mammalian host cells include, but are not limited to, CHO cells, COS cells, 293 cells, 3T3 cells, NS0 cells, VERO cells, BHK cells, or myeloma cells. [0290] For long-term, high-yield production of recombinant proteins, like an LTβR binding protein of the present disclosure, stable expression is preferred. For example, cell lines which stably express the LTβR antibody molecule may be engineered. Rather than using expression vectors which contain viral origins of replication, host cells can be transformed with DNA controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker. Following the introduction of the foreign DNA, engineered cells may be allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media. The selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell lines. This method may advantageously be used to engineer cell lines which express the LTβR binding protein. Such engineered cell lines may be particularly useful in screening and evaluation of compounds that interact directly or indirectly with the antibody molecule. [0291] A number of selection systems may be used, including but not limited to the herpes simplex virus thymidine kinase (see e.g., Wigler et al., Cell 11:223 (1977)), hypoxanthine-guanine phosphoribosyltransferase (see e.g., Szybalska & Szybalski, Proc. Natl. Acad. Sci. USA 48:202 (1992)), and adenine phosphoribosyltransferase (see e.g., Lowy et al., Cell 22:817 (1980)) genes can be employed in tk, hgprt or aprt-cells, respectively. Also, antimetabolite resistance can be used as the basis of selection for the following genes: dhfr, which confers resistance to methotrexate (see e.g., Wigler et al., Proc. Natl. Acad. Sci. USA 77:357 (1980); O'Hare et al., Proc. Natl. Acad. Sci. USA 78:1527 (1981)); gpt, which confers resistance to mycophenolic acid (see e.g., Mulligan & Berg, Proc. Natl. Acad. Sci. USA 78:2072 (1981)); neo, which confers resistance to the aminoglycoside G-418 (see e.g., Wu and Wu, Biotherapy 3:87-95 (1991)); and hygro, which confers resistance to hygromycin (see e.g., Santerre et al., Gene 30:147 (1984)). Methods commonly known in the art of recombinant DNA technology may be routinely applied to select the desired recombinant clone, and such methods are described, for example, in Ausubel et al. (eds.), Current Protocols in Molecular Biology, John Wiley & Sons, NY (1993); Kriegler, Gene Transfer and Expression, A Laboratory Manual, Stockton Press, NY (1990); and in Chapters 12 and 13, Dracopoli et al. (eds), Current Protocols in Human Genetics, John Wiley & Sons, NY (1994); Colberre-Garapin et al., J. Mol. Biol.150:1 (1981). [0292] The host cell may be co-transfected with two expression vectors of the disclosure, for example, the first vector encoding an agonist LTβR binding protein heavy chain or variable domain thereof as described herein and the second vector encoding a LTβR binding protein light chain or variable domain thereof as described herein. The two vectors may contain identical selectable markers which enable equal expression of heavy and light chain polypeptides. Alternatively, a single vector may be used which encodes, and is capable of expressing, for example, both heavy and light chain polypeptides. In such situations, the light chain should be placed before the heavy chain to avoid an excess of toxic free heavy chain (see e.g., Proudfoot, Nature 322:52 (1986); Kohler, Proc. Natl. Acad. Sci. USA 77:2197 (1980)). The coding sequences for the heavy and light chains may comprise cDNA or genomic DNA. [0293] LTβR single chain binding proteins may be formed by linking heavy and light chain variable domain (Fv region) fragments via an amino acid bridge (short peptide linker), resulting in a single polypeptide chain. Such single-chain Fvs (scFvs) have been prepared by fusing DNA encoding a peptide linker between DNAs encoding the two variable domain polypeptides (VL and VH). The resulting polypeptides can fold back on themselves to form antigen-binding monomers, or they can form multimers (e.g., dimers, trimers, or tetramers), depending on the length of a flexible linker between the two variable domains (see e.g., Kortt et al., Prot. Eng.10:423 (1997); Kortt et al., Biomol. Eng.18:95-108 (2001)). By combining different VL and VH-comprising polypeptides, one can form multimeric scFvs that bind to different epitopes (Kriangkum et al., Biomol. Eng. 18:31-40 (2001)). Techniques developed for the production of single chain binding proteins include those described in U.S. Patent No. 4,946,778; Bird et al., Science 242:423 (1988); Huston et al., Proc. Natl. Acad. Sci. USA 85:5879 (1988); Ward et al., Nature 334:544 (1989); de Graaf et al., Methods Mol Biol.178:379-87 (2002). [0294] In one embodiment, a bispecific LTβR binding protein capable of binding LTβR and a TAA or SAA as described herein can be produced using methods known in the art, see e.g., U.S. Patent Appl. Publ. No.20200071425 to Yan et al. or U.S. Patent No.8,592,562 to Kannan et al.. In one embodiment, a bispecific agonist LTβR binding protein as described herein is produced using the methods described in U.S. Patent Appl. Publ. No.20100233173 to Wu et al.; U.S. Patent Appl. Publ. No.20100105873 to Allan et al.; or U.S. Patent Appl. Publ. No.20090155275 to Wu et al. In some embodiments, a bispecific agonist LTβR binding protein capable of binding LTβR and a TAA or SAA as described herein is produced using the methods described in U.S. Patent Appl. Publ. No. 20090175867 to Thompson et al., and U.S. Patent Appl. Publ. No.20110033483 to Thompson et al. [0295] The bispecific agonist LTβR binding protein described herein can alternatively be produced by the direct recovery of Fab′ fragments recombinantly expressed, e.g., in E. coli, and can be chemically coupled to form bispecific antibodies (see e.g., Carter et al., Applications for Escherichia coli-Derived Humanized Fab’ Fragments: Efficient Construction of Bispecific Antibodies. In: Rosenberg, M., Moore, G.P. (eds) The Pharmacology of Monoclonal Antibodies. Handbook of Experimental Pharmacology, v.113. Springer, Berlin, Heidelberg). [0296] Once an agonist LTβR binding protein has been produced by any of the means described herein, it is purified using standard immunoglobulin purification methods. Suitable purification methods include, without limitation, chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and size-exclusion chromatography), centrifugation, or differential solubility. In addition, the binding proteins of the present disclosure can be fused to heterologous polypeptide sequences described herein or otherwise known in the art, to facilitate purification. Pharmaceutical Compositions [0297] Compositions comprising an agonist LTβR binding protein (e.g., an agonist LTβR antibody or bispecific agonist LTβR binding protein), in the form of a polypeptide, a nucleic acid, a vector, a host cell, or a combination thereof, are provided herein. In one embodiment, a pharmaceutical composition of the present disclosure comprises the agonist LTβR binding protein, or a polynucleotide encoding the same, in an isolated and/or purified form. In one embodiment, the composition comprises a combination of two or more different binding proteins (e.g., different structures) and/or polynucleotides of the present disclosure. [0298] Pharmaceutical compositions of the present disclosure comprise agents which enhance the chemico-physico features of the agonist LTβR binding protein or polynucleotide encoding the same, e.g., via stabilizing at certain temperatures (e.g., room temperature), increasing shelf life, reducing degradation, e.g., oxidation protease mediated degradation, increasing half-life of the agonist LTβR binding protein, etc. [0299] In exemplary aspects of the present disclosure, the composition additionally comprises a pharmaceutically acceptable carrier, diluents, or excipient. In some embodiments, the LTβR binding protein or polynucleotide encoding the same as presently disclosed (hereinafter referred to as “active agents”) are formulated into a pharmaceutical composition comprising the active agent, along with a pharmaceutically acceptable carrier, diluent, or excipient. In this regard, the present disclosure further provides pharmaceutical compositions comprising an active agent which pharmaceutical composition is intended for administration to a subject, e.g., a mammal. [0300] In some embodiments, the active agent is present in the pharmaceutical composition at a purity level suitable for administration to a patient. In some embodiments, the active agent has a purity level of at least about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99%, and a pharmaceutically acceptable diluent, carrier or excipient. In some embodiments, the compositions contain an active agent at a concentration of about 0.001 to about 30.0 mg/ml. [0301] In exemplary aspects, the pharmaceutical compositions comprise a pharmaceutically acceptable carrier. As used herein, the term “pharmaceutically acceptable carrier” includes any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions such as an oil/water or water/oil emulsion, and various types of wetting agents. The term also encompasses any of the agents approved by a regulatory agency of the US Federal government or listed in the US Pharmacopeia for use in animals, including humans. [0302] The pharmaceutical composition can comprise any pharmaceutically acceptable ingredients, including, for example, acidifying agents, additives, adsorbents, aerosol propellants, air displacement agents, alkalizing agents, anticaking agents, anticoagulants, antimicrobial preservatives, antioxidants, antiseptics, bases, binders, buffering agents, chelating agents, coating agents, coloring agents, desiccants, detergents, diluents, disinfectants, disintegrants, dispersing agents, dissolution enhancing agents, dyes, emollients, emulsifying agents, emulsion stabilizers, fillers, film forming agents, flavor enhancers, flavoring agents, flow enhancers, gelling agents, granulating agents, humectants, lubricants, mucoadhesive, ointment bases, ointments, oleaginous vehicles, organic bases, pastille bases, pigments, plasticizers, polishing agents, preservatives, sequestering agents, solubilizing agents, solvents, stabilizing agents, suppository bases, surface active agents, surfactants, suspending agents, thickening agents, tonicity agents, toxicity agents, viscosity-increasing agents, water-absorbing agents, water-miscible cosolvents, water softeners, or wetting agents (see, e.g., the Handbook of Pharmaceutical Excipients, Third Edition, A. H. Kibbe (Pharmaceutical Press, London, UK, 2000); Remington’s Pharmaceutical Sciences, Sixteenth Edition, E. W. Martin (Mack Publishing Co., Easton, Pa., 1980)). [0303] In exemplary aspects, the pharmaceutical composition comprises formulation materials that are nontoxic to recipients at the dosages and concentrations employed. In one embodiment, pharmaceutical compositions comprising an active agent and one or more pharmaceutically acceptable salts, polyols, surfactants, osmotic balancing agents, tonicity agents, anti-oxidants, antibiotics, antimycotics, bulking agents; lyoprotectants; anti-foaming agents; chelating agents; preservatives; colorants; analgesics; or additional pharmaceutical agents. In exemplary aspects, the pharmaceutical composition comprises one or more polyols and/or one or more surfactants, optionally, in addition to one or more of the above noted excipients. [0304] In certain embodiments, the pharmaceutical composition can contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition. In such embodiments, suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen-sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta-cyclodextrin); fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents; emulsifying agents; hydrophilic polymers (such as polyvinylpyrrolidone); low molecular weight polypeptides; salt-forming counterions (such as sodium); preservatives (such as bcnzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide); solvents (such as glycerin, propylene glycol or polyethylene glycol); sugar alcohols (such as mannitol or sorbitol); suspending agents; surfactants or wetting agents (such as pluronics, PEG, sorbitan esters, polysorbates such as polysorbate 20, triton, tromethamine, lecithin, cholesterol, tyloxapol); stability enhancing agents; tonicity enhancing agents (such as alkali metal halides, preferably sodium or potassium chloride, mannitol sorbitol); delivery vehicles; diluents; excipients and/or pharmaceutical adjuvants. See, REMINGTON'S PHARMACEUTICAL SCIENCES, 18″ Edition, (A. R. Genrmo, ed.), 1990, Mack Publishing Company. [0305] The pharmaceutical compositions can be formulated to achieve a physiologically compatible pH. In some embodiments, the pH of the pharmaceutical composition can be for example between about 4 or about 5 and about 8.0 or about 4.5 and about 7.5 or about 5.0 to about 7.5. Methods of Treatment [0306] Another aspect of the present disclosure is directed methods of treating a subject in need thereof, where the method comprises administering an effective amount of an agonist LTβR binding protein as described herein, e.g., an agonist LTβR antibody or a bispecific agonist LTβR binding protein, or pharmaceutical composition comprising the same to the subject in need thereof. In one embodiment, the agonist LTβR binding protein is one that binds to CRD4 of human LTβR and (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LT1α2β binding to LTβR. In one embodiment, this agonist LTβR binding protein is an agonist LTβR antibody. In one embodiment, the agonist LTβR binding protein is a bispecific LTβR binding protein comprising (i) a LTβR binding domain, wherein the LTβR binding domain binds one or more amino acid residues of human LTβR CRD4 comprising amino acid residues 169-211 of SEQ ID NO: 1; and (ii) a tumor-associated antigen binding domain. This bispecific LTβR binding protein agonizes LTβR activity and (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LT1α2β binding to LTβR. In one embodiment, this bispecific agonist LTβR binding protein that is monovalent for LTβR binding. [0307] In one embodiment, a subject in need thereof is a subject having cancer. In one embodiment, the subject has a solid tumor. Without being bound to a particular theory, agonizing LTβR activity in the tumor microenvironment enhances T cell infiltration to the tumor microenvironment and induces the formation of tertiary lymphoid structures (TLS). This activity of LTβR enhances and/or provides anti-tumor T cell activity in the tumor microenvironment. Thus, in one embodiment, administration of an agonist LTβR binding protein or pharmaceutical composition comprising the same is suitable for inducing and/or enhancing an anti-tumor immune response in a subject having a tumor. As used herein the term “subject” refers to a mammal, including humans, and can be used interchangeably with the term “patient”. [0308] Accordingly, provided herein are methods of enhancing T cell numbers and activity in the tumor microenvironment of a subject, enhancing T cell survival and effector function in the tumor microenvironment of a subject, and enhancing cytotoxicity against target cells (e.g., cancer cells) within the tumor microenvironment of a subject. In exemplary embodiments, the methods comprise administering to the subject the pharmaceutical composition of the present disclosure in an effective amount. In exemplary aspects, the T cell activity or immune response is directed against a cancer cell or cancer tissue or a tumor cell or tumor. In exemplary aspects, the immune response is a humoral immune response. In exemplary aspects, the immune response is an innate immune response. In exemplary aspects, the immune response which is enhanced is a T-cell mediated immune response. [0309] As used herein, the term “enhance” and words stemming therefrom do not require or infer a 100% or complete enhancement or increase. Rather, there are varying degrees of enhancement of which one of ordinary skill in the art recognizes as having a potential benefit or therapeutic effect. In this respect, the pharmaceutical compositions of the present disclosure may enhance, e.g., T cell activity, or enhance an immune response, to any amount or level beyond the amount or level of T cell activity or immune response present in the absence of treatment with an LTβR binding protein as described herein. In exemplary embodiments, the enhancement of anti-tumor immunity provided by the methods of the present disclosure is at least or about a 10% enhancement, at least or about a 20% enhancement, at least or about a 30% enhancement, at least or about a 40% enhancement, at least or about a 50% enhancement, at least or about a 60% enhancement, at least or about a 70% enhancement, at least or about a 80% enhancement, at least or about a 90% enhancement, at least or about a 95% enhancement, at least or about a 98% enhancement in anti-tumor immunity. [0310] Methods of measuring T cell activity and immune responses are known in the art. T cell activity can be measured by, for example, a cytotoxicity assay, such as those described in Fu et al., PLoS ONE 5(7): e11867 (2010). Other T cell activity assays that are suitable for measuring a response are described in Bercovici et al., Clin Diagn Lab Immunol. 7(6): 859–864 (2000). Suitable methods of measuring immune responses include those described in e.g., Macatangay et al., Clin Vaccine Immunol 17(9): 1452-1459 (2010) and Clay et al., Clin Cancer Res.7(5):1127-35 (2001). [0311] A subject in need of treatment with the agonist LTβR binding protein as described herein include, without limitation, subjects having cancer, and particularly subjects having a solid tumor. In exemplary embodiments, the method comprises administering to the subject an agonist LTβR binding protein or a pharmaceutical composition comprising an agonist LTβR binding protein in an amount effective to treat the cancer or the solid tumor in the subject. The cancer treatable by the methods and agonist LTβR binding proteins disclosed herein (e.g., agonist LTβR antibody or bispecific agonist LTβR binding protein) can be any cancer, e.g., any malignant growth or tumor caused by abnormal and uncontrolled cell division that may spread to other parts of the body through the lymphatic system or the blood stream. In one embodiment, the cancer or solid tumor is a “cold” tumor, i.e., a tumor surrounded by cells that suppress an anti-tumor immune response. [0312] In one embodiment, the subject to be treated with an agonist LTβR binding protein as described herein has a tumor selected from mesothelioma, a pancreatic tumor, an ovarian tumor, a lung tumor, an esophageal tumor, a gastric tumor, a hepatic tumor, a colorectal tumor, a cervical tumor, an endometrial tumor, a breast tumor, a renal tumor, a bladder tumor, a testicular tumor, a prostate tumor, a brain tumor, a bone tumor, and a head and neck tumor. In one embodiment, the cancer is selected from alveolar rhabdomyosarcoma, cancer of the anus, anal canal, or anorectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, gallbladder, or pleura, cancer of the nose, nasal cavity, or middle ear, cancer of the oral cavity, cancer of the vulva, colon cancer, esophageal cancer, cervical cancer, gastrointestinal carcinoid tumor, hypopharynx cancer, kidney cancer, larynx cancer, liver cancer, lung cancer (e.g., non-small cell lung cancer (NSCLC)), malignant mesothelioma, melanoma, nasopharynx cancer, ovarian cancer, pancreatic cancer, peritoneum, omentum, and mesentery cancer, pharynx cancer, prostate cancer, rectal cancer, renal cancer (e.g., renal cell carcinoma (RCC)), small intestine cancer, soft tissue cancer, stomach cancer, testicular cancer, thyroid cancer, ureter cancer, and urinary bladder cancer. In exemplary embodiments, the subject has a solid tumor and the agonist LTβR binding protein (e.g., agonist LTβR antibody or bispecific agonist LTβR binding protein) is administered to the subject in an amount effective to treat the tumor in the subject. [0313] The term “treatment” encompasses alleviation of at least one symptom or other embodiment of a disorder, or reduction of disease severity, and the like. An agonist LTβR binding protein, in particular an agonist LTβR antibody or bispecific binding protein that binds CRD4 of human LTβR and does not block endogenous LTβR ligand binding according to the present disclosure, need not effect a complete cure, or eradicate every symptom or manifestation of a disease, to constitute a viable therapeutic agent. As is recognized in the pertinent field, therapeutic agents may reduce the severity of a given disease state, but need not abolish every manifestation of the disease to be regarded as useful therapeutic agents. Simply reducing the impact of a disease (for example, by reducing the number or severity of its symptoms, or by increasing the effectiveness of another treatment, or by producing another beneficial effect), or reducing the likelihood that the disease will occur or worsen in a subject, is sufficient. One embodiment of the disclosure is directed to a method comprising administering to a patient an agonist LTβR binding protein in an amount and for a time sufficient to induce a sustained improvement over baseline of an indicator that reflects the severity of the particular disorder. In one embodiment, the method comprising administering to a patient an agonist LTβR binding protein as disclosed herein in an amount and for a time sufficient to convert a cold tumor into a hot tumor by increasing the immune cell infiltration and/or immune cell anti-tumor activity in the tumor microenvironment. In one embodiment, the method further involves administering the agonist LTβR binding protein in combination with one or more immunomodulators, e.g., PD(L)1-axis inhibitors, to further stimulate the immune cells infiltrating into the tumor microenvironment. [0314] The term “prevention” encompasses prevention of at least one symptom or other embodiment of a disorder, and the like. A prophylactically administered treatment incorporating an agonist LTβR binding protein (e.g., an agonist LTβR antibody or bispecific agonist LTβR binding protein) that binds CRD4 of LTβR and does not block endogenous LTβR ligand binding activity as disclosed herein, need not be completely effective in preventing the onset of a condition in order to constitute a viable prophylactic agent. Simply reducing the likelihood that the disease will occur or worsen in a subject, is sufficient. In one embodiment, prophylactic administration of the agonist LTβR binding protein as described herein is effective at preventing a tumor from turning into a cold tumor by enhancing immune cell infiltration into the tumor microenvironment. In one embodiment, prophylactic administration of the agonist LTβR binding protein as described herein is effective at preventing a tumor growth by enhancing immune cell infiltration and enhancing the anti-tumor immune response in the tumor microenvironment. [0315] As is understood in the pertinent field, a pharmaceutical composition comprising an agonist LTβR binding protein as disclosed herein is administered to a subject in a manner appropriate to the indication and the composition. In one embodiment, pharmaceutical compositions comprising an agonist LTβR binding protein that binds to CRD4 of LTβR and does not inhibit endogenous LTβR ligand binding (e.g., an agonist LTβR antibody or bispecific agonist LTβR binding protein) is administered by any suitable technique, including but not limited to parenterally, intravenous, intramuscular, intralesional, intraperitoneal or subcutaneous routes, by bolus injection, or continuous infusion. Delivery by inhalation includes, for example, nasal or oral inhalation, use of a nebulizer, inhalation of the agonist LTβR binding protein in aerosol form, and the like. Other alternatives include oral preparations including pills, syrups, or lozenges. [0316] Advantageously, the agonist LTβR binding proteins can be administered in the form of a composition comprising one or more additional components such as a physiologically acceptable carrier, excipient or diluent. Optionally, the composition additionally comprises one or more physiologically active agents. In various particular embodiments, the composition comprises one, two, three, four, five, or six physiologically active agents in addition to one or more agonist LTβR binding proteins. [0317] Kits for use by medical practitioners are provided including one or more agonist LTβR binding proteins and a label or other instructions for use in treating any of the conditions discussed herein. In one embodiment, the kit includes a sterile preparation of one or more agonist LTβR binding proteins, which may be in the form of a composition as disclosed herein, and may be in one or more vials. [0318] Dosages and the frequency of administration may vary according to such factors as the route of administration, the particular agonist LTβR binding proteins employed, the nature and severity of the disease to be treated, whether the condition is acute or chronic, and the size and general condition of the subject. Appropriate dosages can be determined by procedures known in the pertinent art, e.g., in clinical trials that may involve dose escalation studies. [0319] An agonist LTβR binding protein that binds to CRD4 of LTβR and does not inhibit endogenous LTβR ligand binding activity as disclosed herein, may be administered, for example, once or more than once, e.g., at regular intervals over a period of time. In particular embodiments, a LTβR binding protein is administered over a period of at least once a month or more, e.g., for one, two, or three months or even indefinitely. For treating chronic conditions, long-term treatment is generally most effective. However, for treating acute conditions, administration for shorter periods, e.g., from one to six weeks, may be sufficient. In general, the agonist LTβR binding protein is administered until the patient manifests a medically relevant degree of improvement over baseline for the chosen indicator or indicators. [0320] An agonist LTβR binding protein that binds CRD4 of LTβR and/or does not inhibit endogenous LTβR ligand binding activity as disclosed herein, may preferably be administered in conjunction with the administration of an immunomodulatory therapeutic. In one embodiment, the immunomodulatory therapeutic is a checkpoint inhibitor. Suitable checkpoint inhibitors are known in the art and include, for example and without limitation, a PD-1 inhibitor, PD-L1 inhibitor, CTLA-4 inhibitor, TIM-3 inhibitor, LAG-3 inhibitor, NKG2A inhibitor, CD73 inhibitor, and TIGIT inhibitor, and any combination thereof. Suitable combination therapies are described in more detail below. Combination Therapies [0321] Particular embodiments of methods and compositions of the disclosure involve the use of at least one agonist LTβR binding protein and one or more other therapeutics useful for treating or preventing cancer. In one embodiment, agonist LTβR binding protein is administered alone or in combination with other agents useful for treating a subject having a solid tumor. Examples of such agents include both proteinaceous and non-proteinaceous drugs. When multiple therapeutics are co-administered, dosages may be adjusted accordingly, as is recognized in the pertinent art. “Co-administration” and combination therapy are not limited to simultaneous administration, but also include treatment regimens in which an agonist LTβR binding protein is administered at least once during a course of treatment that involves administering at least one other therapeutic agent to the patient. In certain embodiments, an agonist LTβR binding protein is administered prior to the administration of at least one other therapeutic agent. In certain embodiments, agonist LTβR binding protein is administered concurrent with the administration of at least one other therapeutic agent. In certain embodiments, an agonist LTβR binding protein is administered subsequent to the administration of at least one other therapeutic agent. [0322] In one embodiment, the at least one other therapeutic agent is an immunomodulatory therapeutic, in particular a checkpoint inhibitor or a T cell engaging therapeutic. Suitable checkpoint inhibitors are known in the art and include, for example and without limitation, a PD-1 inhibitor, PD-L1 inhibitor, CTLA-4 inhibitor, TIM-3 inhibitor, LAG-3 inhibitor, NKG2A inhibitor, CD73 inhibitor, and TIGIT inhibitor, and any combination thereof. [0323] In one embodiment, the agonist LTβR binding protein that binds CRD4 of LTβR and does not inhibit endogenous LTβR ligand binding activity as disclosed herein (e.g., an agonist LTβR antibody or bispecific agonist LTβR binding protein), is administered in combination with a PD-1 inhibitor, e.g., an anti-PD-1 antibody. Examples of suitable anti-PD-1 antibodies include, without limitation, nivolumab (Opdivo®/KEGG D10316), pembrolizumab (Keytruda®/KEGG D10574), Cemiplimab (Libtayo®/KEGG D11108), Dostarlimab (TSR-042/KEGG D11366), Spartalizumab (KEGG D11605), and pidilizumab (CT- 011; KEGG D10390). [0324] In one embodiment, the agonist LTβR binding protein that binds CRD4 of LTβR and does not inhibit endogenous LTβR ligand binding activity as disclosed herein is administered in combination with a PD-L1 inhibitor, e.g., an anti-PD-L1 antibody. Examples of suitable anti-PD-L1 antibodies include, without limitation, Atezolizumab (Tecentriq®; KEGG D10773), Avelumab (Bavencio®; KEGG D10817), and Durvalumab (Imfinzi®; KEGG D10808) [0325] In one embodiment, the agonist LTβR binding protein that binds CRD4 of LTβR and does not inhibit endogenous LTβR ligand binding activity as disclosed herein is administered in combination with a CTLA-4 inhibitor. A suitable CTLA-4 inhibitor is the monoclonal antibody Ipilimumab (Yervoy; KEGG D04603). [0326] In one embodiment, the agonist LTβR binding protein that binds CRD4 of LTβR and does not inhibit endogenous LTβR ligand binding activity as disclosed herein is administered in combination with a TIM-3 inhibitor, e.g., an anti-TIM-3 antibody. Examples of suitable anti-TIM-3 antibodies include, without limitation, sabatolimab (MBG453; Novartis); LY3321367 (Eli Lilly), and TSR-022 (Tesaro). [0327] In one embodiment, the agonist LTβR binding protein that binds CRD4 of LTβR and/or does not inhibit endogenous LTβR ligand binding activity as disclosed herein is administered in combination with a LAG-3 inhibitor, e.g., an anti-LAG-3 antibody. An exemplary anti-LAG-3 antibody suitable for use in combination with the LTβR binding protein described herein includes, without limitation, Relatlimab (KEGG D11350). [0328] In one embodiment, the agonist LTβR binding protein that binds CRD4 of LTβR and does not inhibit endogenous LTβR ligand binding activity as disclosed herein is administered in combination with an inhibitor of NKG2-A/NKG2-B type II integral membrane protein (NKG2A), e.g., an anti- NKG2A antibody. An exemplary anti- NKG2A antibody suitable for use in combination with the LTβR binding protein described herein includes, without limitation, BMS-986315 (Bristol Myers Squibb®). [0329] In one embodiment, the agonist LTβR binding protein that binds CRD4 of LTβR and does not inhibit endogenous LTβR ligand binding activity as disclosed herein is administered in combination with a CD73 inhibitor. Suitable CD73 inhibitors for use in combination with the LTβR binding protein described herein include, without limitation, the small molecule CD73 inhibitors OP-5244 (Du et al., J. Med. Chem. 63:10433-10459 (2020), which is hereby incorporated by reference in its entirety) and LY- 3475070 (Eli Lilly). [0330] In one embodiment, the agonist LTβR binding protein that binds CRD4 of LTβR and does not inhibit endogenous LTβR ligand binding activity as disclosed herein is administered in combination with a TIGIT inhibitor, e.g., an anti-TIGIT antibody. Examples of suitable anti-TIGIT antibodies include, without limitation, BMS-986207 (Bristol-Myers Squibb); Tiragolumab (Roche)), and MK-7684 (Merck), and COM902 (Compugen). [0331] The disclosure having been described, the following Embodiments and Examples are offered by way of illustration, and not limitation. EMBODIMENTS [0332] The disclosure provides the following non-liming embodiments. [0333] Embodiment 1 of the disclosure is directed to an agonist Lymphotoxin β Receptor (LTβR) binding protein, wherein said binding protein binds an epitope comprising one or more residues of human LTβR cysteine-rich domain 4 (CRD4), wherein human LTβR CRD4 comprises amino acid residues 169- 211 of SEQ ID NO: 1, and wherein said binding protein (a) does not inhibit LIGHT binding to LTβR or (b) does not inhibit LTα1β2 binding to LTβR. [0334] Embodiment 2 is the agonist LTβR binding protein of embodiment 1, wherein said binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LTα1β2 binding to LTβR. [0335] Embodiment 3 is the agonist LTβR binding protein of embodiment 1 or 2, wherein said binding protein binds to one or more residues of LTβR CRD4 comprising residues 197-209 of SEQ ID NO: 1. [0336] Embodiment 4 is the agonist LTβR binding protein of embodiments 1-3, wherein inhibition of LIGHT and/or LTα1β2 binding to LTβR in the presence of the agonist LTβR binding protein is measured in a cell-based receptor-ligand binding assay, said assay comprising the steps of: incubating LTβR expressing cells with media containing the agonist LTβR binding protein for 1 hour; contacting the LTβR expressing cells, after said incubating, with a detectable LIGHT ligand, a detectable LTα1β2 ligand, or a combination thereof to allow the detectable ligands to bind to LTβR; detecting, after said contacting, the detectable LIGHT and/or LTα1β2 ligands bound to LTβR expressing cells in the presence of the LTβR binding protein; and identifying the agonist LTβR binding protein as not inhibiting LIGHT or LTα1β2 binding to LTβR based on said detecting. [0337] Embodiment 5 is the agonist LTβR binding protein of any one of embodiments 1–4, wherein said binding protein comprises: a heavy chain variable domain (VH) amino acid sequence having at least 90% sequence identity to SEQ ID NO: 121 or SEQ ID NO: 123 and a light chain variable domain (VL) amino acid sequence having at least 90% sequence identity to SEQ ID NO: 122 or SEQ ID NO: 124. [0338] Embodiment 6 is the agonist LTβR binding protein of any one of embodiments 1–4, wherein said binding protein comprises: a VH amino acid sequence having at least 90% sequence identity to SEQ ID NO: 121 and SEQ ID NO: 123, and a VL amino acid sequence having at least 90% sequence identity to SEQ ID NO: 122 and SEQ ID NO:124. [0339] Embodiment 7 is the agonist LTβR binding protein of any one of embodiments 1–4, wherein said binding protein comprises: a VH amino acid sequence having at least 95% sequence identity to SEQ ID NO: 121 and SEQ ID NO: 123, and a VL amino acid sequence having at least 95% sequence identity to SEQ ID NO: 122 and SEQ ID NO:124. [0340] Embodiment 8 is the agonist LTβR binding protein of any one of embodiments 1–7, wherein said binding protein comprises: a VH comprising the HCDR1 amino acid sequence of X1YX3MX5 (SEQ ID NO: 5), wherein X1 is S or N; X3 is G, D, or A; and X5 is H or Y; the HCDR2 amino acid sequence of X1IX3YDX6X7X8X9Y X11X12DSVKG (SEQ ID NO: 6), wherein X1 is A or V; X3 is W or R; X6 is E or G; X7 is S, R, or T; X8 is N or K; X9 is K, R, or Q; X11 is H or Y; and X12 is A or E; and the HCDR3 amino acid sequence of X1RX3X4X5X6 X7X8X9YYGX13X14V (SEQ ID NO: 7), wherein X1 is D or E; X3 is V, G, or I; X4 is V, P, or A; X5 is A, Y, or G; X6 is R, A, G, or H; X7 is P or G; X8 is G, N, D, Y, A or H; X9 is Y, T, or F; X13 is L or M; and X14 is D or A; a VL comprising the LCDR1 amino acid sequence of SGDX4LPX7X8YX10Y (SEQ ID NO: 62), wherein X4 is A or T; X7 is E, K, Q, D or N; X8 is Q or H; and X10 is A or T; the LCDR2 amino acid sequence of KDNERPS (SEQ ID NO: 63); and the LCDR3 amino acid sequence of QSX3DX5SX7X8YX10X11 (SEQ ID NO: 64), wherein X3 is A or T; X5 is S, G, or N; X7 is G or A; X8 is T, S, or A; X10 is V or M; and X11 is I or V. [0341] Embodiment 9 is the agonist LTβR binding protein of any one of embodiments 1–8, wherein said binding protein comprises: a VH amino acid sequence having at least 90% sequence identity to SEQ ID NO: 121 and a HCDR1 amino acid sequence of SEQ ID NO: 5, a HCDR2 amino acid sequence of SEQ ID NO: 6, and a HCDR3 amino acid sequence of SEQ ID NO: 7; and a VL amino acid sequence having at least 90% sequence identity to SEQ ID NO: 122 and a LCDR1 amino acid sequence of SEQ ID NO: 62, a LCDR2 amino acid sequence of SEQ ID NO: 63, and a LCDR3 amino acid sequence of SEQ ID NO: 64. [0342] Embodiment 10 is the agonist LTβR binding protein of any one of embodiments 1–9, wherein said binding protein comprises: a VH comprising the HCDR1, HCDR2, and HCDR3 of amino acid sequences of SEQ ID NO: 11-13, respectively, and a VL comprising the LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NO: 68-70, respectively; or a VH comprising the HCDR1, HCDR2, and HCDR3 of amino acid sequences of SEQ ID NO: 8-10, respectively, and a VL comprising the LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NO: 65-67, respectively. [0343] Embodiment 11 is the agonist LTβR binding protein of any one of embodiments 1–10, wherein the binding protein is an antibody. [0344] Embodiment 12 is the agonist LTβR binding protein of any one of embodiments 1–10, wherein the binding protein is a bispecific binding protein. [0345] Embodiment 13 is directed to a bispecific Lymphotoxin β Receptor (LTβR) binding protein, said binding protein comprising: an LTβR binding domain, wherein the LTβR binding domain binds an epitope comprising one or more residues of human LTβR cysteine-rich domain 4 (CRD4), wherein said LTβR CRD4 comprises amino acid residues 169-211 of SEQ ID NO: 1; and a tumor-associated antigen binding domain, wherein the bispecific binding protein agonizes LTβR activity, and (a) does not inhibit LIGHT binding to LTβR or (b) does not inhibit LT1α2β binding to LTβR. [0346] Embodiment 14 is the bispecific agonist LTβR binding protein of embodiment 13, wherein said binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LTα1β2 binding to LTβR. [0347] Embodiment 15 is the bispecific agonist LTβR binding protein of embodiment 13, wherein the epitope comprises one or more residues of LTβR CRD4 at positions 197-209 of SEQ ID NO: 1. [0348] Embodiment 16 is the bispecific agonist LTβR binding protein of any one of embodiments 13–15, wherein inhibition of LIGHT and/or LTα1β2 binding to LTβR in the presence of the bispecific agonist LTβR binding protein is measured in a cell-based receptor-ligand binding assay, said assay comprising the steps of: incubating LTβR expressing cells with media containing the bispecific agonist LTβR binding protein for 1 hour; contacting the LTβR expressing cells, after said incubating, with a detectable LIGHT ligand, a detectable LTα1β2 ligand, or a combination thereof to allow the detectable ligands to bind to LTβR; detecting, after said contacting, the detectable LIGHT and/or LTα1β2 ligands bound to LTβR expressing cells in the presence of the bispecific agonist LTβR binding protein; and identifying the bispecific agonist LTβR binding protein as not inhibiting LIGHT or LTα1β2 binding to LTβR based on said detecting. [0349] Embodiment 17 is he bispecific agonist LTβR binding protein of any one of embodiments 13-15, wherein the LTβR binding domain comprises: a VH amino acid sequence having at least 90% sequence identity to SEQ ID NO: 121 or SEQ ID NO: 123, and a VL amino acid sequence having at least 90% sequence identity to SEQ ID NO: 122 or SEQ ID NO: 124. [0350] Embodiment 18 is the bispecific agonist LTβR binding protein of embodiment 13, wherein the LTβR binding domain comprises: a VH amino acid sequence having at least 90% sequence identity to SEQ ID NO: 121 and SEQ ID NO: 123 and a VL amino acid sequence having at least 90% sequence identity to SEQ ID NO: 122 and SEQ ID NO: 124. [0351] Embodiment 19 is the bispecific agonist LTβR binding protein of embodiment 13, wherein the LTβR binding domain comprises: a VH amino acid sequence having at least 95% sequence identity to SEQ ID NO: 121 and SEQ ID NO: 123 and a VL amino acid sequence having at least 95% sequence identity to SEQ ID NO: 122 and SEQ ID NO: 124. [0352] Embodiment 20 is the bispecific agonist LTβR binding protein of any one of embodiments 13–19, wherein the LTβR binding domain comprises: a VH comprising the HCDR1 amino acid sequence of X1YX3MX5 (SEQ ID NO: 5), wherein X1 is S or N; X3 is G, D, or A; and X5 is H or Y; the HCDR2 amino acid sequence of X1IX3YDX6X7X8X9Y X11X12DSVKG (SEQ ID NO: 6), wherein X1 is A or V; X3 is W or R; X6 is E or G; X7 is S, R, or T; X8 is N or K; X9 is K, R, or Q; X11 is H or Y; and X12 is A or E; and the HCDR3 amino acid sequence of X1RX3X4X5X6 X7X8X9YYGX13X14V (SEQ ID NO: 7), wherein X1 is D or E; X3 is V, G, or I; X4 is V, P, or A; X5 is A, Y, or G; X6 is R, A, G, or H; X7 is P or G; X8 is G, N, D, Y, A or H; X9 is Y, T, or F; X13 is L or M; and X14 is D or A; a VL comprising the LCDR1 amino acid sequence of SGDX4LPX7X8YX10Y (SEQ ID NO: 62), wherein X4 is A or T; X7 is E, K, Q, D or N; X8 is Q or H; and X10 is A or T; the LCDR2 amino acid sequence of KDNERPS (SEQ ID NO: 63); and the LCDR3 amino acid sequence of QSX3DX5SX7X8YX10X11 (SEQ ID NO: 64), wherein X3 is A or T; X5 is S, G, or N; X7 is G or A; X8 is T, S, or A; X10 is V or M; and X11 is I or V. [0353] Embodiment 21 is he bispecific agonist LTβR binding protein of any one of embodiments 13–20, wherein said binding protein comprises: a VH amino acid sequence having at least 90% sequence identity to SEQ ID NO: 121 and a HCDR1 amino acid sequence of SEQ ID NO: 5, a HCDR2 amino acid sequence of SEQ ID NO: 6, and a HCDR3 amino acid sequence of SEQ ID NO: 7; and a VL amino acid sequence having at least 90% sequence identity to SEQ ID NO: 122 and a LCDR1 amino acid sequence of SEQ ID NO: 62, a LCDR2 amino acid sequence of SEQ ID NO: 63, and a LCDR3 amino acid sequence of SEQ ID NO: 64. [0354] Embodiment 22 is the bispecific agonist LTβR binding protein of embodiment 13, wherein the VH comprises the HCDR1, HCDR2, and HCDR3 of amino acid sequences of SEQ ID NO: 11-13, respectively, and the VL comprises the LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NO: 68-70, respectively; or the VH comprises the HCDR1, HCDR2, and HCDR3 of amino acid sequences of SEQ ID NO: 8-10, respectively, and the VL comprises the LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NO: 65-67, respectively. [0355] Embodiment 23 is the bispecific agonist LTβR binding protein of any one of embodiments 13–22, wherein the bispecific binding protein comprises only one LTβR binding domain. [0356] Embodiment 24 is the bispecific agonist LTβR binding protein of any one of embodiments 13–22, wherein the LTβR binding domain is a Fab. [0357] Embodiment 25 is the bispecific agonist LTβR binding protein of any one of embodiments 13–24, wherein binding protein comprises one tumor-associated antigen binding domain. [0358] Embodiment 26 is the bispecific agonist LTβR binding protein of embodiment 25, wherein the tumor-associated antigen binding domain is a Fab. [0359] Embodiment 27 is the bispecific agonist LTβR binding protein of any one of embodiments 13-24, wherein binding protein comprises two tumor-associated antigen binding domains. [0360] Embodiment 28 is the bispecific agonist LTβR binding protein of any one of embodiments 13–22, wherein the LTβR binding domain is a Fab and the tumor-associated antigen binding domain is a Fab. [0361] Embodiment 29 is the bispecific agonist LTβR binding protein of any one of embodiments 13–28, wherein the LTβR binding domain and the tumor-associated antigen binding domain are each coupled to an Fc portion. [0362] Embodiment 30 is the bispecific agonist LTβR binding protein of embodiment 29, wherein the Fc portion does not bind to an Fc-gamma receptor. [0363] Embodiment 31 is directed to a polynucleotide encoding the agonist LTβR binding protein of any one of embodiments 1–12. [0364] Embodiment 32 is a vector comprising the polynucleotide of embodiment 31. [0365] Embodiment 33 is a host cell comprising the polynucleotide of embodiment 31 or the vector of embodiment 32. [0366] Embodiment 34 is one or more polynucleotides encoding the bispecific agonist LTβR binding protein of any one of embodiments 13–30. [0367] Embodiment 35 is a vector comprising the one or more polynucleotides of embodiment 34. [0368] Embodiment 36 is a host cell comprising the one or more polynucleotides of embodiment 34 or the vector of embodiment 35. [0369] Embodiment 37 is a pharmaceutical composition comprising: the agonist LTβR binding protein of any one of embodiments 1–12, the bispecific agonist LTβR binding protein of any one of embodiments 13–30, the one or more polynucleotides of embodiments 31 or 34, or the vector of embodiments 32 or 35, and a pharmaceutically acceptable carrier. [0370] Embodiment 38 is the agonist LTβR binding protein of any one of embodiments 1–12 for use as a medicament. [0371] Embodiment 39 is the agonist LTβR binding protein of any one of embodiments 1–12 for use in the treatment of cancer. [0372] Embodiment 40 is the agonist LTβR binding protein of any one of embodiments 1–12 for use in the manufacture of a medicament for the treatment of cancer [0373] Embodiment 41 is the bispecific agonist LTβR binding protein of any one of embodiments 13–30 for use as a medicament. [0374] Embodiment 42 is the bispecific agonist LTβR binding protein of any one of embodiments 13–30 for use in the treatment of cancer. [0375] Embodiment 43 is the bispecific agonist LTβR binding protein of any one of embodiments 13–30 for use in the manufacture of a medicament for the treatment of cancer. [0376] Embodiment 44 is directed to a method of treating cancer in a subject, said method comprising: administering, to the subject having cancer, an agonist Lymphotoxin β Receptor (LTβR) binding protein, wherein said binding protein binds an epitope comprising one or more residues of human LTβR cysteine-rich domain 4 (CRD4), wherein human LTβR CRD4 comprises amino acid residues 169- 211 of SEQ ID NO: 1, and wherein said binding protein (a) does not inhibit LIGHT binding to LTβR or (b) does not inhibit LTα1β2 binding to LTβR. [0377] Embodiment 45 is a method of treating cancer in a subject, said method comprising: administering, to the subject having cancer, a bispecific Lymphotoxin β Receptor (LTβR) binding protein, said binding protein comprising: an LTβR binding domain, wherein the LTβR binding domain binds an epitope comprising one or more amino acid residues of human LTβR cysteine-rich domain 4 (CRD4), wherein human LTβR CRD4 comprises amino acid residues 169-211 of SEQ ID NO: 1; and a tumor- associated antigen binding domain, wherein the bispecific binding protein agonizes LTβR activity, and (a) does not inhibit LIGHT binding to LTβR or (b) does not inhibit LT1α2β binding to LTβR. [0378] Embodiment 46 is the method of embodiment 44 or embodiment 45 further comprising: administering an immunomodulatory therapeutic in conjunction with said agonist LTβR binding protein or bispecific LTβR binding protein. [0379] Embodiment 47 is the method of embodiments 41 or 42, wherein the subject has a solid tumor selected from the group consisting of mesothelioma, a pancreatic tumor, an ovarian tumor, a lung tumor, an esophageal tumor, a gastric tumor, a hepatic tumor, a colorectal tumor, a cervical tumor, an endometrial tumor, a breast tumor, a renal tumor, a bladder tumor, a testicular tumor, a prostate tumor, a brain tumor, a bone tumor, and a head and neck tumor.
EXAMPLES [0380] The following Examples are given merely to illustrate the present invention and not in any way to limit its scope. Example 1: Tumor Associated Antigen (TAA)-targeted LTβR Agonism Exhibits Therapeutic Efficacy in In Vivo Tumor Models [0381] 1.1 EpCAM Targeted LTβR Agonism Induces HEV Formation and Increases Lymphocyte Infiltration in Murine B16F10 Melanoma Model. huEpCAM-B16F10 tumor cells were implanted subcutaneously in the right flank of female wild type C57BL/6 animals on study day 0. Tumors were assigned on day 10 into different treatment groups (n=10/group) with an average tumor volume of about 100 mm3. Animals were dosed once every three days intravenously with either 30mg/kg of control isotype mIgG1 (Amgen, PL-11445-3) or increasing doses (0.3, 3, and 30 mg/kg) of huEpCAM-muLTβR (5G11) bispecific agonist LTβR tool antibody (Amgen, 7622-1). Tumors were harvested on day 20. Half of the tumor was dissociated for flow cytometry analysis and the other half was formalin fixed for histological analysis. As shown in FIG.1, the total number of CD3+ T cells (FIG.1A) infiltrating into the tumor environment increased with the 3 mg/kg dose, and the total number of CD19+ B cells (FIG. 1B) infiltrating into the tumor environment increased in a dose-dependent manner. T and B cell infiltration was assessed using flow cytometry. As shown in FIG.2, huEpCAM-LTβR treatment induced the formation of high endothelial venules (HEVs) in the tumor environment (bottom image). The presence of HEVs was not observed in the isotype control treated tumor tissue (FIG.2, top image). The presence of HEVs was assessed by immunohistochemical staining using anti-PNAd (Meca79) mAb. [0382] 1.2 LRRC15 Targeted LTβR Agonism Induces Lymphocyte Infiltration and Inhibits Tumor Growth in KPC M5 Tumor Model. KPC M5 pancreatic tumor cells were implanted subcutaneously in the right flank of female wild type C57BL/6 mice on day 0 of the study. Tumors were grown for 10 days in which they reached approximately 100mm3 and then were randomized into respective groups (n=5/group). Animals were dosed twice a week for three doses of a mouse tool LRRC15 x LTβR bispecific antibodies (BsAbs) (36017-1 and 28786-1/64506-1) at 3 mpk or with Isotype control mIgG1 N297G (PL-57469). Tumors and serum were harvested three days following the last dose of LRRC15 x LTβR BsAbs (day 20). Tumors were collected with skin attached on the periphery. The attached skin was removed and the tumor was dissociated for flow cytometry analysis. As seen in FIG.3, an increase in T cell infiltration (CD3+ cells) into the tumor following LRRC15 x LTβR bispecific antibody treatment compared to isotype control was observed. [0383] In a separate study, KPC M5 pancreatic tumor cells (100k/mouse) were implanted subcutaneously in the right flank of female wild type C57BL/6 mice on day 0. Tumors were grown for 10 days until the average tumor volume reached 100mm3. Animals were randomized into groups to receive LRRC15 x LTβR BsAb (36017-1) or isotype control treatments (n=10/group). Animals were dosed intraperitoneally, twice a week for 9 doses (or until they exited) with 3mg/kg of control isotype mIgG1 (11445-3), twice a week for 9 doses with 3 mg/kg of LRRC15 x LTβR BsAb, or once every three days for 3 doses with 100 µg/mouse of anti-PD1 antibody (7358-1). Tumors were measured and body weights were weighted twice a week until tumors reached greater or equal to 2000mm3 or if animals reached twice the median survival limit. As shown in FIG.4, PD-1 antibody treatment (■) did not significantly inhibit tumor growth compared to isotype (●), producing a tumor growth inhibition (TGI) of only 4.64%. Tumors treated with LRRC15 x LTβR BsAb monotherapy (▼) did produce a statistically significant TGI of 20.76% compared to isotype. The combination of LRRC15 x LTβR BsAb and PD-1 antibody did lead to a greater TGI of 32.37%, but there was no statistical significance between the two treatment groups. Example 2: Generation of Human LTβR Binding Proteins [0384] Fully human antibodies to human LTβR were generated by immunizing XenoMouse® transgenic mice. The XenoMouse® and its utility for generating human antibodies is disclosed in U.S. Pat. Nos. 6,114,598; 6,162,963;6,833,268; 7,049,426; 7,064,244, and Green et al., Nature Genetics 7:13-21 (1994); Mendez et al., Nature Genetics 15:146-156 (1997); Green and Jakobovitis, J. Ex. Med, 188:483- 495 (1998); Kellerman and Green, Current Opinion in Biotechnology 13, 593-597 (2002), which are hereby incorporated by reference in their entirety). Multiple immunogens and routes of immunization were used to generate anti-human LTβR immune responses. Transgenic XenoMouse® that produce human immunoglobulin G (IgG) 2 or IgG 4 antibodies were immunized intradermally 12-16 times over 6-8 weeks with GeneGun (BioRad) protocol that delivered gold microparticles coated with plasmid DNA encoding human LTβR and molecular adjuvants. Alternatively, animals were subcutaneously immunized with CHO- S cells that were transiently transfected with human or cyno LTβR expression vectors. For soluble protein immunization, mice were subcutaneously injected with human LTβR recombinant protein at 5 µg protein per boost twice weekly for 6-8 weeks. Cyno LTβR antigen was introduced to mice at week 4 and was injected on an alternating schedule with human LTβR antigen. To select animals producing antibodies that were specific to LTβR, sera from immunized mice were tested for binding to the human and cyno LTβR expressed on transiently transfected HEK 293 cells and analyzed by fluorescence-activated cell sorting (FACS). The fold GeoMean shift over background was applied to select the responding mice with the highest native titer to human and cyno LTβR. The selected mice received a final boost 4 days before tissue harvest followed by B cell enrichment. The harvest and immunogen details are listed in Table 15. Table 15. Summary of XenoMouse® Immunization and Antibody Harvest Example 3: Preparation of Monoclonal Antibodies Hybridoma Generation. [0385] Animals exhibiting suitable serum titers were identified and lymphocytes were obtained from spleen and/or draining lymph nodes. Pooled lymphocytes (from each harvest) were dissociated from lymphoid tissue by grinding in a suitable medium (for example, RPMI 1640 media; Invitrogen, Carlsbad, CA). B cells were selected and/or expanded using standard methods, and fused with a suitable fusion partner using techniques known in the art. Example 4: First Round of Screening Hybridoma Pools for LTβR Binder Identification [0386] 4.1 Clonal anti-LTβR Hybridoma Generation from Hybridoma Pools. XenoMouse ® hybridoma cultures from harvest 1 to 6 were thawed and grown in DMEM Selection Medium for 3-4 days. Culture medium was changed to BDQY Hybridoma Medium a day before FACS enrichment sorting. Cells were washed in 10 mL sterile FACS buffer and then incubated with biotin-labelled recombinant human LTβR (R&D Systems, Cat: 7538LR) at 2 to 5 µg/mL concentration in 1 mL reaction volume for 30 minutes at 4°C. For harvest 5 and 6 hybridoma cultures, 100 µg/mL polyclonal human IgG (Jackson ImmunoResearch, Cat: 009-000-003) were also added in this step to block anti-Fc binders. After one wash in 10 mL FACS buffer, 1 mL antibody cocktail containing 5 µg/mL each of Alexa Fluor 488 conjugated goat anti-human IgG Fc Fab (Jackson ImmunoResearch, Cat: 109-547-008) and Alexa Fluor 647 conjugated streptavidin (Jackson ImmunoResearch, Cat: 016-600-084) was added to the cells. The cells were then incubated at 4°C for 30 minutes. After the incubation, the cells were washed in 10 mL FACS buffer, resuspended in 2 mL of BDQY Hybridoma Medium containing 5 µL of 7-AAD (BD Pharmingen, Cat: 559925) then put through a 40-micron cell strainer to remove any clumps. Cells were bulk sorted on BD FACSAria® by gating on live cell population dual positive for Alexa Fluor 488 and Alexa Fluor 647 fluorescence signals. After an initial round of enrichment sort to bring the target population from <1% to >20%, the target cells were then single cell sorted onto 384-well microtiter plates containing BDQY hybridoma medium and cultured for up to 2 weeks before the supernatants were collected for screening. [0387] 4.2 Initial Selection of LTβR Specific Binding Antibodies. Human LTβR (pTT5.2:VK1O2O12::huLTβR(31-435) C-173003 (DNA-38098)), was expressed on host Human Embryonic Kidney 293 cells by transfection using expression vectors, Opti-MEM® media (Gibco™, Cat. No.31985088) and 293Fectin™ reagent (Invitrogen, Cat. No.12347019) following the protocol set out by the manufacturer. Twenty-four hours post transfection, 13000 transfected cells were resuspended per 15µL volume FACS buffer (Phosphate Buffered Saline (1X) 0.0067M (PO4) (Cytiva Cat No: SH30256.02), 2% Fetal Bovine Serum (Hyclone Cat No:SH30396.03) with Hoechst nuclear stain at 30µg/mL (Hoechst 33342 Solution (20 mM), ThermoFisher Catalog number: 62249). Cells were incubated with 15µL of hybridoma supernatant for 1 hour at room temperature in Corning® 384-well Flat Clear Bottom Black Polystyrene TC- treated Microplates. Cells were washed two time with 50µL PBS using AquaMax 4000 Plate Washer (Molecular Devices). Alexa Fluor 488-conjugated AffiniPure Goat Anti-Human IgG (Jackson 109-545- 098) was added at 5µg/mL final concentration for 20 minutes at room temp. Cells were washed twice with 50µL PBS to remove unbound detection reagent and an additional 30µL of FACS buffer was added to resuspend cells with Microplate orbital plate shaker (Big Bear Automation Model HT-91000). Plates were read on CellInsight CX7 High-Content Screening (HCS) Platform using Acquire only and Cell Health Profiling Bio-Apps HCS Studio 2.0 Software. The number of binders from each harvest are listed in Table 16. Table 16. LTβR Binders for each Harvest [0388] 4.3 LTβR Single Point and Potency Functional Assay On assay day 1, human melanoma A375 cells (ATCC, CRL-1619) were plated in growth media (DMEM, 10% FBS, 4mM L-glutamine, 1.5 g/L sodium bicarbonate, 4.5 g/L glucose) at 10,000 cells per well (in 50µL) in 384-well assay plates. The plates were incubated overnight at 37°C /5% CO2. On assay day 2, 40µL/well of culture supernatant was removed from the 384-well assay plates. Protein G (Sigma, Cat# P4689) was prepared in assay media (growth media contain 2% FBS) at final concentration of 0.5 µg/mL. Anti-LTβR mAb (R&D systems, Clone 71315 and Clone 31G4D8) was prepared at final concentration of 1µg/mL and 5 µg/mL respectively, titrated 1:3 down for total 8 points. For single point screening, exhausted supernatant (ESN) containing anti- huLTβR antibody was added at final concentration of 1µg/mL. Testing samples were transferred to desired wells in the 384-well assay plate, with or without the addition of Protein G as the crosslinker. Final total volume in the 384-well assay plate was 50µL/well. The assay plates were incubated overnight at 37°C /5% CO2. On assay day 3, 16µL of supernatant was transferred out from the 384-well assay plates to the 384- well low volume plates by robotics. Chemokine IL-8 release was measured by detection kit (Cisbio, Cat# 62IL8PEC) following manufacturer’s instruction, and was read out by microplate reader at 665nm and 615nm. Relative IL-8 release was presented as the ratio of signals obtained at 665nm / 615nm. Antibodies exhibiting low activity without Protein G crosslinking, but high active with Protein G crosslinking, were advanced for potency testing. [0389] For functional potency screening, ESN was first normalized to 10µg/mL, then further diluted in assay medium to the final concentration of 1µg/mL, titrated 1:3 down for total 8 points. The interpolated EC50, transit EC50 (when signal =4) and max activity (when ENS used at 1µg/mL) of anti-LTβR antibody was determined by a four-parameter logistic fit model of Genedata Screener (Smart fit). The results of the functional potency analysis, Transit EC50 and Max Activity (ratio of signal obtained at 665 nm / 615 nm) for LTβR antibodies is provided in Table A of FIG.5. [0390] 4.4 Selectivity and Cross-reactivity of LTβR Specific Binding Antibodies Cynomolgus Major LTβR (pTT5.2:VK1O2O12::cyLTβR (31-253) C173083 (DNA-38100)), cynomolgus minor LTβR (pTT5.2:VK1O2O12::cyLTβR_minor (31-434) C173082 (DNA-38099)), murine LTβR (pTT5.2:VK1O2O12::muLTβR_native(31-415) - DNA-37605), Tumor Necrosis Receptor Super Family 1 (pTT5:huTNFRp55 (huTNFRSF1) C-159747 - DNA-22292) and Tumor Necrosis Receptor Super Family 2 (pTT5:huTNFRp75-FL (TNFRSF2) C-159746 - DNA-22291) were each expressed on host HEK 293 cells by transfection using expression vectors, Opti-MEM® media (Gibco™, Cat. No. 31985088) and 293Fectin™ reagent (Invitrogen, Cat. No. 12347019) following the protocol set out by the manufacturer. Hybridoma supernatants were screened for the presence of monoclonal antibodies binding to cyno Major LTβR, cyno minor LTβR, Mu LTβR, TNRFSF1 and TNRFSF2 by incubating antibodies on each of the transfected cells for 1 hour, followed by two wash steps to remove the primary antibody. The cells were then incubated with a goat anti-human Fc antibody conjugated to Alexa647 (Jackson Immunochemicals 109-605-098) for 15 minutes and washed two times to remove unbound detection reagent. The binding was detected by FACS using the Intellicyt Accuri iQue™ platform. Data analysis was performed using Intellicyt ForeCyt® Enterprise Client Edition software. HEK 293 cells transfected using an empty pTT5 expression vector (mock transfection) were included and data is presented as GeoMean fold over mock transfected cells. As shown in Table A of FIG. 5, none of the LTβR antibodies exhibited binding to TNRFSF1 or TNRFSF2. [0391] 4.5 Relative Epitope Binning/Profiling. Biotinylated recombinant soluble human LTβR protein Fc Chimera (R&D Systems 7538-LR-100) was coupled at 2 µg/mL concentration to streptavidin coated, uniquely barcoded LumAvidin Beads® (LumAvidin Microspheres, Luminex Corp., Austin,Texas, U.S.A.) for 30 minutes in the dark at room temperature and washed twice. The reference antibody hybridoma supernatant samples at 5µg/mL concentration were incubated with the antigen-coated beads for 1 hour in the dark at room temperature and washed three times. Beads were resuspended in FACS buffer containing an immunoassay stabilizer solution (Stabilguard™, SurModics). The antigen-coated, reference antibody-bound beads were pooled and then divided into individual sample wells containing a normalized (2µg/ml) test antibody (hybridoma supernatant) sample (or negative control), incubated for 1 hour in the dark at room temperature and washed twice. The samples were then incubated with Mo anti-HuG2, G3, G4 (PL-46339, made from the sequence of Calbiochem HP6030 antibody which was discontinued) for 1 hour in the dark at room temperature and washed twice. Samples were incubated with a goat anti-mouse Fc antibody conjugated to Alexa488 (Jackson Immunochemicals 115-545-071) for 15 minutes in the dark at room temp and washed two times to remove unbound detection reagent and resuspended in FACS buffer. Samples were analyzed using an Intellicyt iQue™ Screener Platform. To determine the antibody competition/binding profiles of the individual test antibodies, the reference-only antibody binding signal was subtracted from the reference plus test antibody signal for each competition/binding reaction (i.e., across the entire reference antibody set). An individual antibody binding profile was defined as the collection of net binding values for each competition/binding reaction. The degree of similarity between individual profiles was then assessed by calculating the coefficient of determination between each of the test antibody profiles. Test antibodies showing high degrees of similarity (R2 > 0.8) to each other were then grouped into common binning profiles. Using this method, the LTβR binding antibodies were sub-divided into 6 unique binning profiles (A, B, C, D, E and F). Antibodies that displayed a unique binning profile (as defined above) but shared a relatively high degree of similarity to another profile (R2 = 0.7-0.8) were categorized as a sub-bin (i.e., A.1, A.2, etc.) of that profile. The results for relative epitope binning of the LTβR antibodies are shown in Table A of FIG.5. [0392] 4.6 Identification of LTβR Receptor-Ligand Non-Blocking Antibodies using Single- point FACS Bead-based Receptor-ligand Assay. Human LIGHT-Alexa 647 and human LTα1β2-Alexa 647 were prepared by conjugating human LIGHT (R&D Systems, Cat. No.664-LI/CF) and human LTα1β2 (R&D Systems, Cat. No.8884-LY/CF) using an Alexa Fluor 647 Microscale Protein Labeling Kit (Thermo Fisher Scientific, Cat. No. A30009) following the protocol set out by the manufacturer. Hybridoma supernatants containing human LTβR-binding antibodies were assayed for their ability to block human LIGHT and human LTα1β2 binding to human LTβR-His via a FACS-based receptor-ligand assay. If a LTβR antibody prevented human LIGHT-Alexa 647 or human LTα1β2-Alexa 647 from binding to human LTβR-His, the flow cytometry geometric mean (GeoMean) signal decreases relative to the GeoMean signal achieved in the absence of LTβR antibody thus resulting in a high percent inhibition value of ligand binding due to competition. Table A of FIG. 5 shows the receptor-ligand interaction blocking ability of select hybridoma supernatant samples and reflects the percent inhibition of human LIGHT or human LTα1β2 binding to human LTβR-His in the presence of indicated hybridoma supernatant. [0393] Briefly, Biotinylated human LTβR-His was captured on streptavidin (SA) coated beads (Spherotech, Cat. No. SVP-60-5) in FACS buffer [1xPhosphate Buffered Saline (Cytiva, Cat. No. SH30256.02) + 2% fetal bovine serum (Hyclone Cat No. SH30396.03)] for 30 minutes at room temperature. The beads were then washed twice in FACS buffer by centrifugation for 2 minutes at 3500 RPM. The coated beads were resuspended in immunoassay stabilizing solution (StabilGuardTM SurModics, Cat. No. SG01). Human LTβR-specific monoclonal antibodies (15µL at 10µg/mL) were combined with 15µL of coated beads such that the final concentration of LTβR antibody was at 5µg/mL and incubated for 1 hour at room temperature using 96 well V-bottom polystyrene FACS plates (Corning, Cat. No. 3897). Then 30µL of human LIGHT-Alexa 647 or human LTα1β2-Alexa 647 was added at 9µg/mL in FACS buffer and incubated for 30 minutes at room temperature in the dark. The final concentration of human LIGHT-Alexa 647 or human LTα1β2-Alexa 647 was at 4.5µg/mL. FACS plates were topped up with 140uL of FACS buffer, then washed once in FACS buffer by centrifugation for 2 minutes at 3500 RPM. Samples were resuspended in 30µL of FACS buffer and were read on an iQue flow cytometry machine with Intellicyt autosampler, according to the manufacturer’s recommendations; data analysis was done on Intellicyt ForeCyt® Enterprise Client Edition 6.2 (R3). [0394] The amount of human LIGHT-Alexa 647 or human LTα1β2-Alexa 647 was quantified by GeoMean fluorescence signal by flow cytometry analysis, and the signal was converted to a percent inhibition of receptor-ligand (R-L) interaction. Loss of ligand binding signal in the presence of LTβR antibodies was calculated as percent inhibition of R-L binding. The maximum GeoMean signal for human LIGHT-Alexa 647 or human LTα1β2-Alexa 647 was determined by averaging the GeoMean signals of the ligand-Alexa 647 signal over 12 replicates that were incubated with irrelevant exhaust supernatant (ESN) binding to biotinylated human LTβR-His. The minimum GeoMean signal for human LIGHT-Alexa 647 or human LTα1β2-Alexa 647 was determined from GeoMean signal of the ligand-Alexa 647 signal incubated with an irrelevant human IgG2 control binding to irrelevant biotinylated human TREM1-His. Percent inhibition of biotinylated human LTβR-His:ligand (human LIGHT or human LTα1β2) of human LTβR antibodies or an isotype control antibody was calculated using the following equation: Percent (%) inhibition = 1 – (Experimental GeoMean - Minimum GeoMean) / (Maximum GeoMean – Minimum GeoMean) For some LTβR antibodies a negative percent inhibition value was obtained when the experimental GeoMean signal was higher than the maximum GeoMean signal, possibly due to confirmational changes by the LTβR antibodies binding to biotinylated human LTβR-His, thus potentially resulting in higher ligand-Alexa 647 GeoMean signal (i.e., a higher level of endogenous ligand was allowed to bind). Any potential confirmational changes would not be seen using irrelevant ESN as the irrelevant antibody would not bind to biotinylated human LTβR-His. [0395] Background signal in this assay was found to be up to ~20% for LIGHT and ~15% for LTα1β2, due to the use of irrelevant samples in place of the ESNs to determine the minimum signal of the assay. ESN samples are subtracted from this minimum to determine the net assay signals to calculate the % inhibition. Because of the high level of background, an LTβR antibody exhibiting ~20% inhibition via this assay was considered a non-blocker via this cell based assay. The cell-based assay described in Example 8 was developed to confirm non-blocking activity of the LTβR antibodies. [0396] 4.7 Affinity Gap Analysis. Affinity was measured on a BIAcore® 3000 from GE Healthcare. Experiments were run at 25°C. The running buffer was HBS-P (10 mM HEPES, pH7.4, 150 mM NaCl, 0.05% Surfactant P-20; Cytiva cat# BR100827) supplemented with 0.5% BSA, and kinetics were at a high flow rate (100 µl/min). 10 mM Glycine, pH 1.7 was used for regeneration. A mouse anti- human antibody was diluted to 0.065mg/mL in 10nM Sodium Acetate, pH 5 and covalently coupled to the sample and reference flowcell (Fc1) of a CM5 sensor chip (Cytiva cat# 29104988) using amine coupling reagent (Cytiva cat# BR100050). Unpurified anti-LTβR mAbs were diluted in HBS-P to 1 µg/ml and captured on flowcell 2, 3, or 4 to obtain a capture level of 100 RU – 200 RU. Fc1 was used as a reference. The target, human or cyno LTβR, was injected as analyte at 150 nM, 50 nM, 16.7 nM, 5.6 nM, and 1.85 nM with the 50 nM concentration run twice to gage reproducibility. The dissociation time was 10 minutes to allow for screening of the large antibody panel. The data was double background referenced in that both a reference Fc and a 0 nM analyte concentration were subtracted from the data. A 1:1 Langmuir binding model with mass transfer was used to analyze the data in the BIAcore® evaluation software. The results for human and cyno major are shown in Table B of FIG.5. [0397] 4.8 Molecular Rescue and Sequencing of LTβR Agonist Antibodies. RNA (total or mRNA) was purified from wells containing the agonist LTβR antibody-producing hybridoma cells using a Qiagen RNeasy mini or the Invitrogen mRNA catcher plus kit. Purified RNA was used to amplify the antibody heavy and light chain variable region (V) genes using cDNA synthesis via reverse transcription, followed by a polymerase chain reaction (RT-PCR). The fully human antibody gamma heavy chain was obtained using the Qiagen One Step Reverse Transcriptase PCR kit (Qiagen). This method was used to generate the first strand cDNA from the RNA template and then to amplify the variable region of the gamma heavy chain using multiplex PCR. The 5’ gamma chain-specific primer annealed to the signal sequence of the antibody heavy chain, while the 3’ primer annealed to a region of the gamma constant domain. The fully human kappa and lambda light chains were obtained using the Qiagen One Step Reverse Transcriptase PCR kit (Qiagen). This method was used to generate the first strand cDNA from the RNA template and then to amplify the variable region of the light chain using multiplex PCR. The 5’ light chain-specific primer annealed to the signal sequence of the antibody light chain while the 3’ primer annealed to a constant region of the light chain. [0398] The amplified cDNA was purified enzymatically using exonuclease I and alkaline phosphatase and the purified PCR product was sequenced directly. Amino acid sequences were deduced from the corresponding nucleic acid sequences bioinformatically. Two additional, independent RT-PCR amplification and sequencing cycles were completed for each hybridoma sample in order to confirm that any mutations observed were not a consequence of the PCR. The derived amino acid sequences were then analyzed to determine the germline sequence origin of the antibodies and to identify deviations from the germline sequence. Example 5: LTβR Antibody Engineering [0399] Select anti-LTβR antibodies were converted to a standard antibody format of the IgG1 subtype by fusing the VH domains to the CH1-CH2-CH3 sequence and VL domains to CL or CK sequence. The CH2 domain of this antibody isotype has been engineered for reduced effector function by incorporating an N297G mutation and for improved thermostability through an engineered disulfide bond (R292C, V302C); this antibody isotype is designated SEFL2.2. [0400] The anti-LTβR antibodies were additionally engineered to remove “hotspots,” or residues that were computationally predicted or empirically determined to impact the molecule’s expression, purification, homogeneity, thermal stability, colloidal stability, long-term storage stability, in vivo pharmacokinetics, and/or immunogenicity. A variety of amino acid mutations at these hotspots in the variable heavy (VH) and variable light (VL) domains were designed based on conservation, co-variation, chemical similarity, predictions from structural modeling, and prior knowledge from other antibody engineering campaigns. Engineered antibodies were designed that included both single mutations and combinations of mutations. Table 17 (below) provides a summary of the single and combination mutations introduced into a subset of LTβR antibodies and the binding affinity (KD) of the engineered antibodies. The position of the identified substitution is relative to a reference sequence derived from Honegger and Pluckthun, “Yet Another Numbering Scheme for Immunoglobulin Variable Domains: An Automatic Modeling and Analysis Tool,” J. Mol. Biol.309: 657-670 (2001), which is hereby incorporated by reference in its entirety. Table 17. LTβR Antibody Hotspot Engineering Example 6: Epitope and Paratope Mapping of LTβR Agonist Antibodies [0401] 6.1 Hydrogen/deuterium exchange (HDX) mass spectrometry (MS). Epitope and paratope mapping of select agonist LTβR antibodies was carried out using HDX MS. HDX MS measures the deuterium exchange rate of protein back bone amide hydrogens. HDX MS experiments were performed with a Twin HTS PAL HDX system (LEAP Technologies, Carrboro. NC), configured to perform online digestion on a pepsin column, and interfaced with an Orbitrap mass spectrometer (Elite, ThermoFisher Scientific, San Jose, CA), as previously described (see e.g., Chalmers et al., Anal. Chem. 78: 1005-1014 (2006) and Zhang et al., Structure 18: 1332-1341 (2010), which are hereby incorporated by reference in their entirety) or a Twin HTS PAL HDX system configured to perform in-solution digestion, and interfaced with an Orbitrap Eclipse mass spectrometer (ThermoFisher Scientific, San Jose, CA), in a manner similar to that previously described (Zhang et al., Anal. Chem. 84(11):4942-4949 (2012), which is hereby incorporated by reference in its entirety). [0402] 6.1.1 HDX MS Experiments Performed with Twin HTS PAL HDX System with On- Column Digestion (“System 1”): The HDX reactions for epitope/paratope mapping of LTβR antibodies (LIBC218990, LIBC218944, LIBC219058, LIBC219081, and LIBC219097) were performed at three conditions: LTβR extracellular domain (ECD) antigen only, LTβR ECD/antibody domain complexes, and antibody Fabs only, respectively. Given that LTβR and evaluated antibodies have high binding affinity with kD in low nM range and the binding ratio is 2:1, LTβR/antibody complexes can be readily formed by preincubating LTβR and antibodies at the final concentrations of ~20 µM and ~10 µM, respectively. The H/D exchange reaction was initiated by 5-fold dilution protein samples with 10 mM acetate in D2O (pD 5.2) as indicated for a predetermined time (10 s, 1, 10 min, 1, 4, and 12 h) at 25°C. The exchange reaction was quenched by mixing 1:1 with ice-cold 200 mM sodium phosphate, 4 M guanidine HCl, 0.5 M Tris(2- carboxyethyl)phosphine (TCEP), pH 2.4. The quenched protein mixture was passed over a custom-packed 2 mm × 2 cm pepsin (Fisher Scientific, Pittsburgh, PA) column (Agilent Technologies, Santa Clara, CA) at a flow rate of 200 μL/min. Digested peptides were captured on a 2 mm × 1 cm C18 trap column (Waters Corporation, Milford, MA) and desalted for 3 minutes at a flow rate of 0.2 mL/min. Peptides were then separated by using a 2.1 mm × 5 cm C18 column (1.9 μm Hypersil Gold; Thermo Fisher Scientific, Waltham, MA) with a 9.5 minute linear gradient of 5–40 % acetonitrile in 0.1% formic acid at a flow rate of 0.2 mL/min. Protein digestion and peptide separation were carried out in thermal chamber maintained at 1°C to reduce back exchange. LC-MS data were acquired with a mass resolving power of 60,000 for ions of m/z 400. Each experiment was performed in duplicate to provide an estimate of variation. [0403] Tandem mass spectrometry (MS/MS) experiments were performed under the same conditions as described above. Product-ion spectra were acquired in a data-dependent mode, and the 10 most abundant ions were selected for product-ion analysis. All data were processed with the software MassAnalyzer (Zhang et al., Anal. Chem.84: 4942-4949 (2012), which is hereby incorporated by reference in its entirety) for the peptide identification and the deuterium level calculation. Approximately 500 peptides were analyzed with sequence coverage of at least 97% for all mAb2 polypeptide chains. All HDX-MS data were normalized to 100% deuterium concentration and the percent deuterium incorporation was plotted against labeling time in log scale with Prism v 6.02 (GraphPad Software, La Jolla, CA). [0404] 6.1.2 HDX MS Experiments Performed with Twin HTS PAL HDX System with In- solution Digestion (“System 2”): For paratope mapping, LTβR/antibody complex was formed by incubating the antibody Fab domain with excess amount (1.5-fold) of LTβR extracellular domain (ECD) antigen, and analyzed with the free antibody Fab domain in parallel. Deuterium labeling was initiated by diluting each sample 10-fold into a 100 mM phosphate buffer in D2O. After a set length of labeling time (6 labeling times from 15 s to 2 h, each at least in duplicate), the labeling was quenched by diluting 4-fold into a quench/denaturation buffer (pH 2.7) containing 0.625 M tris(2-carboxyethyl)phosphine (TCEP) and ~5.8M urea at 1°C. Pepsin was then added to the quenched solution, followed by injecting into the sample loop at 1°C, and a 6 min digestion delay before the loop was switched inline for gradient elution. Peptides were separated on a 1 mm × 5 cm C18 column (Waters CSH, 1.7µM) at 1°C with a 9.5-minute linear gradient of 5–40 % acetonitrile in 0.035% trifluoracetic acid (TFA), 0.1% formic acid at a flow rate of 0.2 mL/min. Three peptides, including bradykinin, angiotensin and Leu-enkephalin, were used as internal standards to correct for back exchange. [0405] For epitope mapping, LTβR/antibody complex was formed by incubating the LTβR ECD antigen with excess amount (1.5 fold) of each antibody Fab, and analyzed with the free antigen in parallel. H/D exchange labeling and digestion was performed the same way as described above, except that a 1:1 pepsin/protease type XIII mixture was used for digestion, and the digestion was performed at ~7°C for 6 min prior to injecting into the sample loop, due to the difficulty of digesting the LTβR ECD by pepsin using the standard condition. [0406] All MS data were collected on a Thermo Scientific Orbitrap Eclipse high-resolution mass spectrometer, with electrospray ionization interface. MS data were collected at 120k resolution setting. For each paratope or epitope experiment, data-dependent MS/MS were also collected for three injections from each of the two unlabeled samples (free and complex) for peptide identification. [0407] All data were processed on the software MassAnalyzer for the peptide identification, deuterium level calculation, back exchange correction using internal standards and the full- deuteration control (Zhang et al., Anal. Chem. 84(11):4942-4949 (2012), which is hereby incorporated by reference in its entirety) [0408] 6.2 Epitope Mapping Results. The results of the epitope mapping experiments are provided in FIGs.4–8. Comparison of the deuterium exchange graphs of peptides derived from LTβR alone and LTβR in complex with an antibody identifies the epitope regions bound by the examined antibodies, where regions of LTβR bound by the antibody are protected from deuterium exchange. Note that the N- terminal residue of a peptide does not have an amide hydrogen for measurement and is excluded in reporting the epitope regions. As shown in FIGs. 6 and 8, the LTβR antibodies LIBC218990-1 (19320) and LIBC219058 (19324) bound to residues within CRD2 of LTβR as shown by a reduction in deuterium present in complex peptides consisting of amino acid residues 56-64 and 81-101 of the LTβR ECD (SEQ ID NO: 4). Thus, the epitope for LIBC218990-1 and the epitope for LIBC219058 comprise one or more residues within the amino acid sequence of SYNEHWNY (residues 57–64 of SEQ ID NO: 4) and one or more residues within the amino acid sequence of EIAPCTSKRKTQCRCQPGMF (residues 82-101 of SEQ ID NO: 4). No other regions of the LTβR: LTβR-antibody complexes were protected from deuterium exchange (data not shown). [0409] LTβR antibody LIBC218994 (19321) bound residues within CRD1, particularly one or more residues within residues 4–9, 21–29, and 39–47 of the LTβR ECD (SEQ ID NO: 4) (see FIG.7).Thus, the epitope for LIBC218944 comprises one or more residues within the amino acid sequences of PPYASE (residues 4–9 of SEQ ID NO: 4), YEPQHRICC (residues 21–29 of SEQ ID NO: 4), and SAKCSRIRD (residues 39–47 of SEQ ID NO: 4). No other regions of the LTβR: LTβR-antibody complexes were protected from deuterium exchange (data not shown). [0410] LTβR antibody LIBC219081 (19325) bound residues within CRD4, particularly residues within the stretch of residues at positions 168-179 of the LTβR ECD (SEQ ID NO: 4) (see FIG.9). Thus, the epitope for LIBC219081 comprises one or more residues within the amino acid sequence of EAAPGTAQSDTT (residues 168–179 of SEQ ID NO: 4). No other regions of the LTβR: LTβR-antibody complexes were protected from deuterium exchange (data not shown). [0411] The LTβR antibody LIBC219097 (19326) bound to a region of LTβR spanning CRD1 and CRD2 comprising residues in the region of 39–42 and 57–70 of the LTβR ECD (SEQ ID NO: 4) (see FIG. 10). A comparison of the deuterium uptake curves for peptides comprising residues 38-42 and residues 37-47 shows that the shorter peptide of residues 38-42 has relatively large protection from deuterium exchange, while the longer peptide 37-47 has relatively small protection. This indicates that the protection mainly occurred in the overlapping shorter peptide, and thus narrows the epitope region to residues 39-42 of the LTβR ECD. Thus, the epitope for LIBC219097 comprises one or more residues with the amino acid sequence of SAKC (residues 39–42 of SEQ ID NO: 4) and SYNEHWNYLTICQL (resides 57–70 of SEQ ID NO: 4). No other regions of the LTβR: LTβR-antibody complexes were protected from deuterium exchange (data not shown). [0412] The LTβR antibody LIBC218979 (19319) bound to residues of LTβR within CRD4 of the LTβR ECD (SEQ ID NO: 4). Upon LIBC218979 binding to the LTβR ECD, deuterium uptake decreased in LTβR peptides 167-177 and 167-181, but not in peptides 154-166 and 178-193, indicating the protected region is within residues 168-178 (FIG. 11). No other regions of the LTβR: LTβR-antibody complexes were protected from deuterium exchange (data not shown). Thus, the epitope comprises one or more residues within the amino acid sequence of EAAPGTAQSDT (residues 168-179 of SEQ ID NO: 4). [0413] The LTβR antibody LIBC219051 (19323) bound to N-terminal region of the LTβR ECD including CRD1. Upon LIBC219051 binding to the LTβR ECD, deuterium uptake decreased in LTβR peptides 1-9, 1-20, and 10-20, but not in peptide 19-28, indicating the protected region is within residues 1- 19 (FIG. 12). No other regions of the LTβR: LTβR-antibody complexes were protected from deuterium exchange (data not shown). Thus, the epitope comprises one or more residues within the amino acid sequence of QAVPPYASENQTCRDQEKE (residues 1-19 of SEQ ID NO: 4). Note that Q1 has been converted to pyro-E, which contains a measurable amide hydrogen. Data also shows that the binding is independent of the glycosylation status on residue N10. [0414] 6.3 Paratope Mapping Results. The results of the paratope mapping experiments are provided in FIGs.13–19. Similar to epitope mapping, a comparison of deuterium uptake in heavy and light chain variable domain peptides derived from unbound and LTβR-bound antibody was used to identify paratope regions of the examined antibodies. A reduction in deuterium uptake within a peptide region of a bound vs. unbound antibody indicates at least some region of the examined peptide is involved in the binding interaction. As noted above, the N-terminal residues of an examined peptide does not have an amide hydrogen for measurement, therefore it is excluded when reporting paratope regions. Because this method examines deuterium exchange in small antibody derived peptides (rather than individual residues), resolution of the paratope is not at the residue level. However, the method can reliably identify stretches of residues that are not involved in the binding interaction. [0415] FIG.13 shows a series of deuterium uptake graphs for peptides derived from unbound and bound LTβR antibody LIBC218990 (19320). Peptides of the bound antibody (i.e., antibody-LTβR complex) protected from deuterium exchange are identified within their corresponding heavy chain and light chain variable sequences at the bottom of the figure (see boxed residues). The location of the CDRs within each variable region sequence are underlined. The deuterium uptake graph of the heavy chain peptide consisting of residues 27-34 of SEQ ID NO: 644 shows no protection from deuterium uptake. This heavy chain peptide spans HCDR1 residues 31–35, indicating HCDR1 of LIBC218990 is not involved in the binding interaction with LTβR. Similarly, deuterium uptake in the complexed light chain peptide of residues 50–70 of SEQ ID NO: 645 also shows no protection from deuterium uptake. This light chain peptide spans LCDR2 residues 51–57 indicating that LCDR2 of LIBC218990 is also not involved in the binding interaction of this antibody with LTβR. [0416] HCDR2 of LIBC218990 comprises residues 50–66 of SEQ ID NO: 644. However, only residues within the first half of this HCDR2 region are involved in the binding interaction (i.e., residues 51- 59) as shown by the protection from deuterium exchange observed for the complexed heavy chain peptide of residues 50–59 and lack of protection observed in the complexed heavy chain peptide of residues 60–66 of SEQ ID NO: 644 (FIG.13). Similarly, while LCDR1 of LIBC218990 spans VL residues 24–35 (SEQ ID NO: 645), based on deuterium uptake of peptides overlapping this region, only residues 29–33 of SEQ ID NO: 645 appear to be involved in LCDR1 interaction with LTβR (FIG.13). The peptides examined in the region of HCDR3 and LCDR3 of LIBC218990 include framework regions on one or both ends of the respective CDR region. While these framework residues have been included in the boxed region, their involvement in binding interaction cannot be resolved using this method. [0417] Similar to LIBC218990, paratope mapping of LIBC219058 (19324) (FIG. 15) and LIBC219097 (19326) (FIG.17) shows that not all six CDRs of these antibodies are involved in the binding interaction between these respective antibodies and LTβR. In particular, with regard to LIBC219058 (FIG. 15), complexed peptides of the VL consisting of residues 23–33 of SEQ ID NO: 649 were not protected from deuterium exchange indicating LCDR1 is not involved in the interaction with LTβR. Likewise, complexed peptides of VL consisting of residues 87–116 and 107–116 of SEQ ID NO: 649 also showed no protection from deuterium exchange indicating LCDR3 is not involved in the antibody binding to LTβR. With regard to LIBC219097 (FIG.17), complexed peptides of VH consisting of residues 47–61 and 62–75 of SEQ ID NO: 650 were not protected from deuterium exchange indicating HCDR2 is not involved in the antibody interaction with LTβR (FIG.17A). Similarly, the complexed VL peptide consisting of residues 87–112 of SEQ ID NO: 651 were not protected from deuterium exchange indicating that LCDR3 of LIBC219097 is not involved in binding to LTβR (FIG.17B). [0418] FIGs. 14 and 16 show deuterium uptake graphs for peptides derived from unbound and bound LTβR antibody LIBC218994 (19321) (FIGs.14A–14B) and LTβR antibody LIBC219081 (19325) (FIGs.16A–16B). Peptides of the bound antibody (i.e., antibody-LTβR complex) protected from deuterium exchange are identified within their corresponding heavy chain and light chain variable chain sequences at the bottom of each figure (see boxed residues). The location of the CDRs within each variable region sequence are underlined. In contrast to LIBC218990, LIBC219058, and LIBC219097, paratope mapping of LIBC218994 and LIBC219081 antibodies shows that residues within each of the three VH and VL CDRs are involved in the binding interaction with LTβR. In some instances, where multiple peptides covered the CDR region, residues within particular CDRs not involved in the binding interaction were also identified. See e.g., graphs for VH peptides 48–57 and 58–68 of SEQ ID NO: 646 (FIG.14A) showing residues 49-57 but not 58-66 of HCDR2 are involved in the binding interaction of LIBC218994 with LTβR. See also graphs for VH peptides 49–59 and 60–68 of SEQ ID NO: 121 (FIG.16A) showing residues 50-59 but not 60-66 of HCDR2 are involved in the binding interaction of LIBC219081 with LTβR. [0419] FIGs 18A-18B show deuterium uptake graphs for peptides derived from unbound and bound LTβR antibody LIBC218979 (19319). Peptides of the bound antibody (i.e., antibody-LTβR complex) protected from deuterium exchange are identified within their corresponding heavy chain (FIG.18A) and light chain (FIG. 18B) variable chain sequences at the bottom of each figure (see boxed residues). The location of the CDRs within each variable region sequence are underlined. Analysis of the deuterium uptake graphs shows that residues within each of the three VH and VL CDRs of LIBC218979 are involved in the binding interaction with LTβR. [0420] FIGs 19A-19B show deuterium uptake graphs for peptides derived from unbound and bound LTβR antibody LIBC219051 (19323). Peptides of the bound antibody (i.e., antibody-LTβR complex) protected from deuterium exchange are identified within their corresponding heavy chain (FIG.19A) and light chain (FIG. 19B) variable chain sequences at the bottom of each figure (see boxed residues). The location of the CDRs within each variable region sequence are underlined. Analysis of the deuterium uptake graphs shows that residues within each of the three VH and VL CDRs of LIBC219051 are involved in the binding interaction with LTβR. [0421] Based on the paratope mapping and hotspot engineering, the CDR residues of LTβR antibodies LBC218990, LIBC218994, LIBC219058, LIBC219081, LIBC219097, LIBC218979, LIBC219098, and LIBC219051 that are important for LTβR binding interaction are summarized in Tables 16-22 below. CDR residues of the antibodies not identified as being involved in or critical to the LTβR binding interaction (identified as “X” in CDR sequences of Tables 16-22) can be substituted with any amino acid residue, with a conservative amino acid substitution, or with a hotspot remediated amino acid residue as identified in each of Tables 18-25 below.
Example 7: Bispecific Molecule Production and Functional Testing [0422] Tumor antigen associated (TAA) or stromal antigen associated (SAA)-targeted agonist LTβR binding proteins capable of binding (i) human LTβR (huLTβR) and human Claudin 18.2 (CLDN18.2), (ii) huLTβR and human Claudin 6 (CLDN6), (iii) huLTβR and human MUC17, or (iv) huLTβR and LRRC15 were generated in an AmAb format (i.e., Fab x scFv) or heteroIgG format. These binding proteins were generated using the variable region binding domains of LTβR antibodies (i.e., LTβR antibodies 36G2 (19324), 31A3 (19321), 23E9 (19319) and 41B2 (19325)) described herein and variable regions for the respective SAA or TAA as provided in Table 26 below. The amino acid sequences of the CLDN18.2, CLDN6, MUC17, and LRRC15 variable regions are provided below in Table 27. [0423] The panel of agonist LTβR bispecific binding proteins generated in the AmAb or heteroIgG format (see Table 26) was evaluated for cross-linking dependent LTβR signaling activity in an in vitro co-culture assay. In this assay, chemokine IL-8 release by LTβR expressing human melanoma cells co-cultured with CHO or Saos-2 cells stably expressing the relevant SAA or TAA is indicative of cross-linking dependent LTβR signaling activity by the test antibody. Table 26. Parental and Bispecific Antibodies Table 27. Amino Acid Sequences of SAA and TAA Binders [0424] On day 1 of this assay, LTβR expressing human melanoma A375 cells (ATCC, CRL-1619) were harvested, counted, and plated in growth medium (DMEM, 10% FBS, 4 mM L-glutamine, 1.5 g/L sodium bicarbonate, 4.5 g/L glucose) at 10,000 cells per well (in 50 µL) to the 384-well assay plates (Costar, Cat# 3701). The plates were incubated overnight at 37°C/5%CO2. On day 2 of the assay, testing molecules were titrated in assay medium (DMEM, 2% FBS, 4 mM L-glutamine, 1.5 g/L sodium bicarbonate, 4.5 g/L glucose) from 10nM 1:3 down for 11 points. The culture supernatant was removed at 40 µL from each well of the 384-well assay plates. The titrated testing molecules were then transferred to the 384-well assay plates pre-seeded with LTβR expressing A375 cells and were left to incubate at room temperature for 30 minutes. Target stable expressing Hamster Ovarian cells (CHOs) or human osteosarcoma Saos-2 cells were harvested, counted, resuspended in assay medium and transferred to the assay plate following plate layout. The assay plates were then incubated at 37°C/5% CO2 overnight. The ratio of LTβR to either CLDN6, CLDN18.2, MUC17, LRRC15 expressing cells or corresponding non-expressing cells was set to 1:1 based on assay development data. The various target expressing cells provides the cross-linking for the testing molecules and corresponding non-target expressing cells were used to determine cross-linking independency of the test molecules. On assay Day 3, the supernatant from the assay wells were measured for chemokine IL-8 release by detection kit (Cisbio, Cat# 62IL8PEC) following manufacturer’s instructions, and was read out by EnVision (PerkinElmer) at 665 nm and 615nm. Relative IL-8 release was presented by ratio = signal 665nm / signal 615nm. [0425] For analysis, the interpolated EC50, transit EC50, and max activity of test molecule was determined by a four-parameter logistic fit model of Genedata Screener (Smart fit). Interpolated EC50 is inflection point in the dose curve based on each binding protein and transit EC50 is the value at a particular point on the Y axis which is around EC50 for the majority of molecules.The EC90 was calculated using interpolated EC50 and hill slope in the formula of: EC90 = (90/100-90)√Hill Slope EC50. [0426] The max activity for the bispecific antibodies was calculated by the highest signal of each molecule divided by the average signal of the corresponding neutral control. A summary of individual antibody potency is provided in Table 28 below and shown in FIGs.20-23. [0427] The majority of the max activity for LTβR x CLDN6 BsAbs ranged between 2.98 to 4.12- fold over neutral control (FIG.20). Molecules containing huLTβR 31A3 had the best EC50 values which was around 75 pM. The molecules with huLTβR 36G2 had EC50 values ranged from 90.65 to 183.10 pM. All molecules exhibited cross-linking dependent activity. [0428] The majority of the max activity for the LTβR x CLDN18.2 BsAbs ranged between 4.14 to 4.32-fold over neutral control (FIG. 21). All LTβR x CLDN18.2 molecules had similar EC50 values and exhibited cross-linking dependent activity. [0429] The majority of the max activity for the LTβR x MUC17 BsAbs ranged between 2.70 to 3.26-fold over neutral control (FIG.22). All LTβR x MUC17 BsAb molecules had similar EC50 values and exhibited cross-linking dependent activity. [0430] The majority of the max activity for the LTβR x LRRC15 BsAbs ranged between 4.46 to 5.37-fold over neutral control (FIG.23). The LTβR x LRRC15 BsAb molecules had EC50 values ranging from 46.42 to 108.12. All LTβR x LRRC15 BsAb molecules exhibited cross-linking dependent activity. Table 28: Summary of LTβR Bispecific Molecule Potency Example 8: Confirmation of LTβR Receptor-Ligand Non-Blocking Activity Using Cell Based Assay. [0431] Human LIGHT-Alexa 647 and human LTα1β2-Alexa 647 were prepared by conjugating human LIGHT (R&D Systems, Cat. No.664-LI/CF) and human LTα1β2 (R&D Systems, Cat. No.8884- LY/CF) using an Alexa Fluor 647 Microscale Protein Labeling Kit (Thermo Fisher Scientific, Cat. No. A30009) following the protocol set out by the manufacturer. Human LTβR-binding antibodies or bispecific antibodies comprising an LTβR-binding antibody were assayed for their ability to not block human LIGHT and human LTa1b2 binding to human LTβR transiently expressed on HEK 293T cells via a FACS-based receptor-ligand assay. The samples were co-stained with human IgG to additionally evaluate if the non- blocking of the ligands was due to non-binding of the LTβR antibodies on human LTβR transiently expressed on HEK293T cells. If a LTβR antibody did not prevent human LIGHT-Alexa 647 or human LTα1β2-Alexa 647 from binding to human LTβR transiently expressed on HEK 293T cells, the flow cytometry geometric mean (GeoMean) signal increases relative to the GeoMean signal achieved in the absence of LTβR antibody thus resulting in a low percent inhibition value of ligand binding due to non- competition. [0432] Briefly, Human LTβR was expressed on host human embryonic kidney 293 cells by transfection using an expression vector expressing huLTβR cDNA [pTT5.2:VK1O2O12::huLTβR(31-435) C173003 (DNA-38098)] with Opti-MEM® Reduced Serum Medium (Gibco, Cat: 31985-088) and 293FectinTM Reagent (Gibco REF:12347-019, P/N 53020LT) following the protocol set out by the manufacturer.7.5uL of human LTβR-specific monoclonal antibodies were titrated in a dose titration curve and incubated for 1 hour at 4°C with 7.5uL of transfected hu LTβR cells in FACS buffer [1XPBS + 2% Fetal Bovine Serum (Sigma-Aldrich, Cat.No. F2442-500mL) ] using 96 well FACS plates (Corning Cat. No 3702). Then 15µL of human LIGHT-Alexa 647 or human LTα1β2-Alexa 647 was added at 1.112µg/mL, in conjunction with 5ug/mL of Alexa Fluor 488-conjugated AffiniPure goat anti-human IgG (Jackson ImmunoResearch, Cat: 109-545-098) in FACS buffer and incubated for 20 minutes at room temperature in the dark. The final concentration of human LIGHT-Alexa 647 or human LTα1β2-Alexa 647 was at 0.556µg/mL and the final concentration of Alexa 488 goat anti human IgG was at 2.5ug/mL. FACS plates were topped up with 170uL of FACS buffer, then washed once in FACS buffer by centrifugation for 2 minutes at 2500 RPM. Samples were resuspended in 45µL of FACS buffer and were read on an iQue flow cytometry machine with Intellicyt autosampler, according to the manufacturer’s recommendations; data analysis was done on Intellicyt ForeCyt® Enterprise Client Edition 6.2 (R3). [0433] The amount of human LIGHT-Alexa 647 or human LTα1β2-Alexa 647 was quantified by GeoMean fluorescence signal by flow cytometry analysis, and the signal was converted to a percent inhibition of receptor-ligand (R-L) interaction. Loss of ligand binding signal in the presence of LTβR antibodies was calculated as percent inhibition of R-L binding. The maximum GeoMean signal for human LIGHT-Alexa 647 or human LTα1β2-Alexa 647 was determined by averaging the GeoMean signals of the ligand-Alexa 647 signal over 4 replicates that were incubated with human LTβR transiently expressed on HEK 293T cells. The minimum GeoMean signal for human LIGHT-Alexa 647 or human LTα1β2-Alexa 647 was determined from GeoMean signal of the ligand-Alexa 647 signal incubated with HEK 293T cells transfected with a mock vector. Percent inhibition of human LTβR:ligand (human LIGHT or human LTα1β2) of human LTβR antibodies or an isotype control antibody was calculated using the following equation: Percent (%) inhibition = 1 – (Experimental GeoMean - Minimum GeoMean) / (Maximum GeoMean – Minimum GeoMean) [0434] For some LTβR antibodies a negative percent inhibition value was obtained when the experimental GeoMean signal was higher than the maximum GeoMean signal, possibly due to confirmational changes by the LTβR antibodies binding to human LTβR transiently expressed on HEK 293T cells, thus potentially resulting in higher ligand-Alexa 647 GeoMean signal (i.e., a higher level of endogenous ligand was allowed to bind in the presence of the LTβR antibody compared to in its absence). [0435] The amount of LTβR antibody binding to human LTβR transiently expressed on HEK293T cells was evaluated using an Alexa 488 goat anti human IgG stain and quantified by the GeoMean fluorescence signal by flow cytometry analysis, using a calculation of GeoMean specific fold over irrelevant supernatant. A GeoMean calculation of greater than 2.0 was used as a cutoff for LTβR antibody binding to human LTβR transiently expressed on HEK293T cells. [0436] FIG.24A and 24B are graphs plotting inhibition of LIGHT (FIG.24A) and LTα1β2 (FIG. 24B) binding to LTβR transiently expressed on HEK293T cells over an increasing concentration of the indicated agonist LTβR binding proteins. Human IgG1 isotype and commercially available rat anti-human LTβR antibody (Carlos-1; Invitrogen; Cat. No. MA125845) served as a negative and positive controls, respectively. A summary of the ligand blocking activity of the tested agonist LTβR binding proteins is provided in Table 29 below. FIG. 24C shows concentration dependent LTβR binding by the indicated binder molecules. Table 29. Summary of LTβR Ligand Blocking Activity of Select Agonist LTβR Binding Proteins [0437] LTβR ligand blocking activity of bispecific LTβR binding proteins was also assessed. FIG. 25A and 26A are graphs showing inhibition of LTα1β2 binding to cell expressed LTβR by the indicated LTβR-LRRC15 bispecific binders, and FIGs. 25B and 26B show inhibition LIGHT binding to cell expressed LTβR by the same LTβR-LRRC15 bispecific binders. A summary of the ligand blocking activity of the tested LTβR bispecific binding proteins is provided above in Table 29. FIGs.25C and 26C shows concentration dependent LTβR binding by the indicated bispecific binding proteins. [0438] This data shows that LTβR antibodies 19325 (LIBC219081) and 19319 (LIBC218979) that bind CRD4 do not inhibit LTα1β2 or LIGHT binding to LTβR over all concentrations tested in both antibody and bispecific binding protein formats. Example 9: Rescreening of Hybridoma Pools to Identify Additional LTβR CRD4 Binding Non- Ligand Blocking Antibodies [0439] 9.1 Clonal anti-LTβR Hybridoma Generation from Hybridoma Pools. XenoMouse® hybridoma cultures from harvest 1 to 6 were thawed and grown in DMEM Selection Medium for 3-4 days. Culture medium was changed to BDQY Hybridoma Medium a day before FACS enrichment sorting. Cells were washed in 10 mL sterile FACS buffer and then incubated with biotin-labelled recombinant human LTβR (R&D Systems, Cat: 7538LR) at 3 µg/mL concentration and human LTα1β2- Alexa 647 (R&D Systems, Cat. No.8884-LY/CF) at 20 µg/mL concentration in 2 mL reaction volume for 30 minutes at 4 degrees Celsius. For all hybridoma cultures, 100 µg/mL polyclonal human IgG (Jackson ImmunoResearch, Cat: 009-000-003) was also added in this step to block anti-Fc binders. After one wash in 10 mL FACS buffer, 1 mL antibody cocktail containing 5 µg/mL each of Alexa Fluor 488 conjugated goat anti-human IgG Fc Fab (Jackson ImmunoResearch, Cat: 109-547-008) and BV421 conjugated streptavidin (BD biosciences, Cat: 563259) was added to the cells. The cells were then incubated at 4°C for 30 minutes. After the incubation, the cells were washed in 10 mL FACS buffer, resuspended in 2 mL of BDQY Hybridoma Medium containing 5 µL of 7-AAD (BD Pharmingen, Cat: 559925) then put through a 40 micron cell strainer to remove any clumps. Cells were bulk sorted on BD FACSAria by gating on live cell population, then on dual positive for Alexa Fluor 488 IgG and BV421 LTβR fluorescence signals, and finally on Alexa Fluor 647 LTα1β2 and BV421 LTβR fluorescence signals. After an initial round of enrichment sort to bring the target population from <1% to >20%, the target cells were then single cell sorted onto 384-well microtiter plates containing BDQY hybridoma medium and cultured for up to 2 weeks before the supernatants were collected for screening. [0440] 9.2 Relative Epitope Binning/Profiling. Biotinylated goat anti human IgG Fc capture antibody (Jackson ImmunoResearch, Cat: 109-065-098) was coupled at 2ug/mL concentration streptavidin coated, uniquely barcoded LumAvidin Beads® (LumAvidin Microspheres, Luminex Corp., Austin,Texas, U.S.A.) for 30 minutes in the dark at room temperature and washed twice. The reference antibody hybridoma supernatant samples at 4µg/mL concentration were incubated with the goat anti human IgG Fc- coated beads for 30 minutes in the dark at room temperature and washed twice. His-tagged human LTβR antigen (VK1O2O12::huLTβR(31-227)::8xHis, 46449-2) made up at 60nM and combined with Chrompure human IgG, whole molecule (Jackson ImmunoResearch, Cat: 009-000-003) at 5ug/mL were incubated with the coated beads for 30 minutes in the dak at room temperature and washed twice. Beads were resuspended in FACS buffer containing Stabilguard® (SurModics SG01). [0441] Sample wells containing normalized (4ug/mL) test antibody (hybridoma supernatant) were incubated with Zenon™ Anti-Human Fab (Zenon™ Alexa Fluor™ 488 Human IgG Labelling Kit, Thermo Fisher Scientific, Cat: Z25402) at 0.06 ug label per well for 15 minutes in the dark at room temperature. Chrompure human IgG, whole molecule (Jackson ImmunoResearch, Cat: 009-000-003) at 7.2 ug block per well was then added to Zenon™ labeled sample wells and incubated for 15 minutes in the dark at room temperature. [0442] The antigen-coated, reference antibody-bound beads were pooled and then divided into individual sample wells containing the Zenon™ labeled test antibody (hybridoma supernatant) sample (or negative control), incubated for 30 minutes in the dark at room temperature and washed twice. The final concentration of the test antibody (hybridoma supernatant) was at 1ug/mL. The samples were washed twice to remove unbound detection reagent and resuspended in FACS buffer. Samples were analyzed using an Intellicyt iQue™ Screener Platform. To determine the antibody competition/binding profiles of the individual test antibodies, the reference-only antibody binding signal was subtracted from the reference plus test antibody signal for each competition/binding reaction (i.e., across the entire reference antibody set). An individual antibody binding profile was defined as the collection of net binding values for each competition/binding reaction. The degree of similarity between individual profiles was then assessed by calculating the coefficient of determination between each of the test antibody profiles. Test antibodies showing high degrees of similarity (R2 > 0.7) to each other were then grouped into common binning profiles. Using this method, the LTβR binding antibodies were sub-divided into 7 unique binning profiles (A, B, C, D, F, G and H). Candidate antibodies sharing a common binning profile with the LTβR antibodies identified herein as 19325 (41B2) and 19319 (23E9), which bind to CRD4 of LTβR as determined by HDX- MS analysis (see Example 6.2), were identified and are provided in the Tables of FIGs. 27. Confirmation that these candidate antibodies bind CRD4 of LTβR was carried out using an internal epitope mapping assay. [0443] 9.3 Confirmation of Non-Ligand Blocking Activity of LTβR Antibodies Identified in Rescreen Using Cell Based Assay. Hybridoma supernatants containing human LTβR-binding antibodies (5 µg/mL) were assayed for their ability to not block human LIGHT and human LTα1β2 binding to human LTβR transiently expressed on HEK 293T cells via the FACS-based receptor-ligand assay described in Example 8. Each hybridoma supernatant containing a human LTβR-binding antibody was tested for ligand blocking activity in duplicate. The percent inhibition for each LTβR-binding antibody that shares an epitope binning profile with the LTβR antibodies identified herein as 19325 (41B2) and 19319 (23E9), which bind to CRD4 of LTβR, is provided in the Table of FIG.27. As discussed above, a negative percent inhibition value was obtained when the experimental GeoMean signal was higher than the maximum GeoMean signal, possibly due to confirmational changes by the LTβR antibodies binding to human LTβR transiently expressed on HEK 293T cells, thus potentially resulting in higher ligand-Alexa 647 GeoMean signal (i.e., a higher level of endogenous ligand was allowed to bind in the presence of the LTβR antibody compared to in its absence). [0444] 9.4 Confirmation of Non-Ligand Blocking Activity of LTβR Antibodies Identified in Rescreen Using Carterra Assay. To further confirm the non-ligand blocking activity of the LTβR antibodies, hybridoma supernatants containing LTβR-binding antibodies were assayed for their ability to block human LIGHT (R&D Systems, Cat. No. 664-LI/CF) and human LTα1β2 (R&D Systems, Cat. No. 8884-LY/CF) binding to human LTβR-His via a Carterra-based receptor-ligand assay. If a LTβR antibody prevented human LIGHT or human LTα1β2 from binding to human LTβR-His, the response (RU) from injection of ligand after exposing receptor to antibodies would not increase relative to the RU achieved in the presence of LTβR receptor alone, thus preventing the formation of a three-component sandwich complex due to competition. The Table of FIG.27 shows the receptor-ligand interaction blocking ability of select hybridoma supernatant samples as measured by this Caterra method. [0445] Briefly, the panel of human LTβR-binding antibodies was captured on a streptavidin (SA) chip (SAHC30M, Carterra Part # 4294) with pre-loaded biotinylated anti-huFc VHH (Chromotek, Cat#: shurbGB-1) in HBSTE buffer [10 mM HEPES, pH7.4, 150 mM NaCl, 0.05% tween-20 and 1 mM EDTA; made in house] at 25°C on a Carterra® LSA. The antibodies were normalized and diluted to 2 µg/mL and printed on spots of chip by 96-channel printhead for 15 mins. The chip was then injected with human LTβR- His at 300 nM using single flow cell, with association time of 5 mins to saturate the receptor binding and dissociation time of 1 min which is the minimal value allowed by software to minimize the dissociation. Human LIGHT or human LTα1β2 ligand was injected immediately after that at 150 nM with 5 mins association and 1 min dissociation.10 mM Glycine, pH 1.5 (Carterra Part # 3639) was used for regeneration before the re-printing of antibodies for the other ligand assay. [0446] LTβR antibody loading, human LTβR-His receptor binding, and human LIGHT or human LTα1β2 ligand sandwiching were quantified by RU using Kinetics software (Carterra). The sandwich level was calculated as a ratio of ligand RU to receptor RU. The minimum sandwich level was determined with an irrelevant human IgG1 control measured in the same experimental setting. For some LTβR antibodies, sandwich level values were low, possibly due to low concentration of antibody, injection bulk shift effect, weak binder towards LTβR or fast LTβR dissociation rate. Thus, these antibodies, which cannot be decided whether it is a non-blocker or blocker, were indicated as “NA” in result table. [0447] 9.5 Affinity Gap Analysis. Affinity was measured on a Carterra LSA at 25°C in HBSTE running buffer [10 mM HEPES, pH7.4, 150 mM NaCl, 0.05% tween-20 and 1 mM EDTA]. 10 mM Glycine, pH 1.5 (Carterra Part # 3639) was used for regeneration. Hybridoma supernatants containing LTβR -binding antibodies were normalized and diluted to 0.3 µg/mL and printed for 10 mins onto the spots of a streptavidin (SA) chip (SAHC30M, Carterra Part # 4294) with pre-loaded biotinylated anti-huFc VHH (Chromotek, Cat#: shurbGB-1) using 96-channel printhead. Buffer wells and irrelevant human IgG1 sample were used as negative controls. The target, human or cyno LTβR was injected as analyte at 243 nM, 81 nM, 27 nM, 9 nM, 3 nM and 1 nM. The association time was 5 mins and dissociation time was 30 minutes. The data was double background referenced in that both the reference spot on the chip and a 0 nM analyte concentration were subtracted from the data. A 1:1 Langmuir binding model was used to analyze the data in the Kinetics software (Carterra). The results for human and cyno affinity gaps are shown in the Table of FIG.27. [0448] Each reference cited herein is hereby incorporated by reference in its entirety for all that it teaches and for all purposes. [0449] The present disclosure is not to be limited in scope by the specific embodiments described herein, which are intended as single illustrations of individual embodiments of the disclosure, and functionally equivalent methods and components are disclosed. Indeed, various modifications of the invention, in addition to those shown and described herein will become apparent to those skilled in the art from the foregoing description and accompanying drawings. Such modifications are intended to fall within the scope of the appended claims.

Claims

CLAIMS 1. An agonist Lymphotoxin β Receptor (LTβR) binding protein, wherein said binding protein binds an epitope comprising one or more residues of human LTβR cysteine-rich domain 4 (CRD4), wherein human LTβR CRD4 comprises amino acid residues 169-211 of SEQ ID NO: 1, and wherein said binding protein (a) does not inhibit LIGHT binding to LTβR or (b) does not inhibit LTα1β2 binding to LTβR.
2. The agonist LTβR binding protein of claim 1, wherein said binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LTα1β2 binding to LTβR.
3. The agonist LTβR binding protein of claim 1, wherein the epitope comprises one or more residues of LTβR CRD4 at positions 197-209 of SEQ ID NO: 1.
4. The agonist LTβR binding protein of any one of claims 1–3, wherein inhibition of LIGHT and/or LTα1β2 binding to LTβR in the presence of the agonist LTβR binding protein is measured in a cell-based receptor-ligand binding assay, said assay comprising the steps of: incubating LTβR expressing cells with media containing the agonist LTβR binding protein for 1 hour; contacting the LTβR expressing cells, after said incubating, with a detectable LIGHT ligand, a detectable LTα1β2 ligand, or a combination thereof to allow the detectable ligands to bind to LTβR; detecting, after said contacting, the detectable LIGHT and/or LTα1β2 ligands bound to LTβR expressing cells in the presence of the LTβR binding protein; and identifying the agonist LTβR binding protein as not inhibiting LIGHT or LTα1β2 binding to LTβR based on said detecting.
5. The agonist LTβR binding protein of any one of claims 1–3, wherein said binding protein comprises: a heavy chain variable domain (VH) amino acid sequence having at least 90% sequence identity to SEQ ID NO: 121 or SEQ ID NO: 123 and a light chain variable domain (VL) amino acid sequence having at least 90% sequence identity to SEQ ID NO: 122 or SEQ ID NO: 124.
6. The agonist LTβR binding protein of any one of claims 1–3, wherein said binding protein comprises: a VH amino acid sequence having at least 90% sequence identity to SEQ ID NO: 121 and SEQ ID NO: 123, and a VL amino acid sequence having at least 90% sequence identity to SEQ ID NO: 122 and SEQ ID NO:124.
7. The agonist LTβR binding protein of any one of claims 1–3, wherein said binding protein comprises: a VH amino acid sequence having at least 95% sequence identity to SEQ ID NO: 121 and SEQ ID NO: 123, and a VL amino acid sequence having at least 95% sequence identity to SEQ ID NO: 122 and SEQ ID NO:124.
8. The agonist LTβR binding protein of any one of claims 1–7, wherein said binding protein comprises: a VH comprising the HCDR1 amino acid sequence of X1YX3MX5 (SEQ ID NO: 5), wherein X1 is S or N; X3 is G, D, or A; and X5 is H or Y; the HCDR2 amino acid sequence of X1IX3YDX6X7X8X9Y X11X12DSVKG (SEQ ID NO: 6), wherein X1 is A or V; X3 is W or R; X6 is E or G; X7 is S, R, or T; X8 is N or K; X9 is K, R, or Q; X11 is H or Y; and X12 is A or E; and the HCDR3 amino acid sequence of X1RX3X4X5X6 X7X8X9YYGX13X14V (SEQ ID NO: 7), wherein X1 is D or E; X3 is V, G, or I; X4 is V, P, or A; X5 is A, Y, or G; X6 is R, A, G, or H; X7 is P or G; X8 is G, N, D, Y, A or H; X9 is Y, T, or F; X13 is L or M; and X14 is D or A; a VL comprising the LCDR1 amino acid sequence of SGDX4LPX7X8YX10Y (SEQ ID NO: 62), wherein X4 is A or T; X7 is E, K, Q, D or N; X8 is Q or H; and X10 is A or T; the LCDR2 amino acid sequence of KDNERPS (SEQ ID NO: 63); and the LCDR3 amino acid sequence of QSX3DX5SX7X8YX10X11 (SEQ ID NO: 64), wherein X3 is A or T; X5 is S, G, or N; X7 is G or A; X8 is T, S, or A; X10 is V or M; and X11 is I or V.
9. The agonist LTβR binding protein of any one of claims 1–8, wherein said binding protein comprises: a VH amino acid sequence having at least 90% sequence identity to SEQ ID NO: 121 and a HCDR1 amino acid sequence of SEQ ID NO: 5, a HCDR2 amino acid sequence of SEQ ID NO: 6, and a HCDR3 amino acid sequence of SEQ ID NO: 7; and a VL amino acid sequence having at least 90% sequence identity to SEQ ID NO: 122 and a LCDR1 amino acid sequence of SEQ ID NO: 62, a LCDR2 amino acid sequence of SEQ ID NO: 63, and a LCDR3 amino acid sequence of SEQ ID NO: 64.
10. The agonist LTβR binding protein of any one of claims 1–9, wherein said binding protein comprises: a VH comprising the HCDR1, HCDR2, and HCDR3 of amino acid sequences of SEQ ID NO: 11- 13, respectively, and a VL comprising the LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NO: 68-70, respectively; or a VH comprising the HCDR1, HCDR2, and HCDR3 of amino acid sequences of SEQ ID NO: 8- 10, respectively, and a VL comprising the LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NO: 65-67, respectively.
11. The agonist LTβR binding protein of any one of claims 1–10, wherein the binding protein is an antibody.
12. The agonist LTβR binding protein of any one of claims 1–10, wherein the binding protein is a bispecific binding protein.
13. A bispecific Lymphotoxin β Receptor (LTβR) binding protein, said binding protein comprising: an LTβR binding domain, wherein the LTβR binding domain binds an epitope comprising one or more residues of human LTβR cysteine-rich domain 4 (CRD4), wherein said LTβR CRD4 comprises amino acid residues 169-211 of SEQ ID NO: 1; and a tumor-associated antigen binding domain, wherein the bispecific binding protein agonizes LTβR activity, and (a) does not inhibit LIGHT binding to LTβR or (b) does not inhibit LT1α2β binding to LTβR.
14. The bispecific agonist LTβR binding protein of claim 13, wherein said binding protein (a) does not inhibit LIGHT binding to LTβR and (b) does not inhibit LTα1β2 binding to LTβR.
15. The bispecific agonist LTβR binding protein of claim 13, wherein the epitope comprises one or more residues of LTβR CRD4 at positions 197-209 of SEQ ID NO: 1.
16. The bispecific agonist LTβR binding protein of any one of claims 13–15, wherein inhibition of LIGHT and/or LTα1β2 binding to LTβR in the presence of the bispecific agonist LTβR binding protein is measured in a cell-based receptor-ligand binding assay, said assay comprising the steps of: incubating LTβR expressing cells with media containing the bispecific agonist LTβR binding protein for 1 hour; contacting the LTβR expressing cells, after said incubating, with a detectable LIGHT ligand, a detectable LTα1β2 ligand, or a combination thereof to allow the detectable ligands to bind to LTβR; detecting, after said contacting, the detectable LIGHT and/or LTα1β2 ligands bound to LTβR expressing cells in the presence of the bispecific agonist LTβR binding protein; and identifying the bispecific agonist LTβR binding protein as not inhibiting LIGHT or LTα1β2 binding to LTβR based on said detecting.
17. The bispecific agonist LTβR binding protein of claim 13, wherein the LTβR binding domain comprises: a VH amino acid sequence having at least 90% sequence identity to SEQ ID NO: 121 or SEQ ID NO: 123, and a VL amino acid sequence having at least 90% sequence identity to SEQ ID NO: 122 or SEQ ID NO: 124.
18. The bispecific agonist LTβR binding protein of claim 13, wherein the LTβR binding domain comprises: a VH amino acid sequence having at least 90% sequence identity to SEQ ID NO: 121 and SEQ ID NO: 123 and a VL amino acid sequence having at least 90% sequence identity to SEQ ID NO: 122 and SEQ ID NO: 124.
19. The bispecific agonist LTβR binding protein of claim 13, wherein the LTβR binding domain comprises: a VH amino acid sequence having at least 95% sequence identity to SEQ ID NO: 121 and SEQ ID NO: 123 and a VL amino acid sequence having at least 95% sequence identity to SEQ ID NO: 122 and SEQ ID NO: 124
20. The bispecific agonist LTβR binding protein of any one of claims 13–19, wherein the LTβR binding domain comprises: a VH comprising the HCDR1 amino acid sequence of X1YX3MX5 (SEQ ID NO: 5), wherein X1 is S or N; X3 is G, D, or A; and X5 is H or Y; the HCDR2 amino acid sequence of X1IX3YDX6X7X8X9Y X11X12DSVKG (SEQ ID NO: 6), wherein X1 is A or V; X3 is W or R; X6 is E or G; X7 is S, R, or T; X8 is N or K; X9 is K, R, or Q; X11 is H or Y; and X12 is A or E; and the HCDR3 amino acid sequence of X1RX3X4X5X6 X7X8X9YYGX13X14V (SEQ ID NO: 7), wherein X1 is D or E; X3 is V, G, or I; X4 is V, P, or A; X5 is A, Y, or G; X6 is R, A, G, or H; X7 is P or G; X8 is G, N, D, Y, A or H; X9 is Y, T, or F; X13 is L or M; and X14 is D or A; a VL comprising the LCDR1 amino acid sequence of SGDX4LPX7X8YX10Y (SEQ ID NO: 62), wherein X4 is A or T; X7 is E, K, Q, D or N; X8 is Q or H; and X10 is A or T; the LCDR2 amino acid sequence of KDNERPS (SEQ ID NO: 63); and the LCDR3 amino acid sequence of QSX3DX5SX7X8YX10X11 (SEQ ID NO: 64), wherein X3 is A or T; X5 is S, G, or N; X7 is G or A; X8 is T, S, or A; X10 is V or M; and X11 is I or V.
21. The bispecific agonist LTβR binding protein of any one of claims 13–20, wherein said binding protein comprises: a VH amino acid sequence having at least 90% sequence identity to SEQ ID NO: 121 and a HCDR1 amino acid sequence of SEQ ID NO: 5, a HCDR2 amino acid sequence of SEQ ID NO: 6, and a HCDR3 amino acid sequence of SEQ ID NO: 7; and a VL amino acid sequence having at least 90% sequence identity to SEQ ID NO: 122 and a LCDR1 amino acid sequence of SEQ ID NO: 62, a LCDR2 amino acid sequence of SEQ ID NO: 63, and a LCDR3 amino acid sequence of SEQ ID NO: 64.
22. The bispecific agonist LTβR binding protein of claim 13, wherein the VH comprises the HCDR1, HCDR2, and HCDR3 of amino acid sequences of SEQ ID NO: 11-13, respectively, and the VL comprises the LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NO: 68-70, respectively; or the VH comprises the HCDR1, HCDR2, and HCDR3 of amino acid sequences of SEQ ID NO: 8- 10, respectively, and the VL comprises the LCDR1, LCDR2, and LCDR3 amino acid sequences of SEQ ID NO: 65-67, respectively.
23. The bispecific agonist LTβR binding protein of any one of claims 13–22, wherein the bispecific binding protein comprises only one LTβR binding domain.
24. The bispecific agonist LTβR binding protein of any one of claims 13–22, wherein the LTβR binding domain is a Fab.
25. The bispecific agonist LTβR binding protein of any one of claims 13–24, wherein binding protein comprises one tumor-associated antigen binding domain.
26. The bispecific agonist LTβR binding protein of claim 25, wherein the tumor-associated antigen binding domain is a Fab.
27. The bispecific agonist LTβR binding protein of any one of claims 13-24, wherein binding protein comprises two tumor-associated antigen binding domains.
28. The bispecific agonist LTβR binding protein of any one of claims 13–22, wherein the LTβR binding domain is a Fab and the tumor-associated antigen binding domain is a Fab.
29. The bispecific agonist LTβR binding protein of any one of claims 13–28, wherein the LTβR binding domain and the tumor-associated antigen binding domain are each coupled to an Fc portion.
30. The bispecific agonist LTβR binding protein of claim 29, wherein the Fc portion does not bind to an Fc-gamma receptor.
31. A polynucleotide encoding the agonist LTβR binding protein of any one of claims 1–12.
32. A vector comprising the polynucleotide of claim 31.
33. A host cell comprising the polynucleotide of claim 31 or the vector of claim 32.
34. One or more polynucleotides encoding the bispecific agonist LTβR binding protein of any one of claims 13–30.
35. A vector comprising the one or more polynucleotides of claim 34.
36. A host cell comprising the one or more polynucleotides of claim 34 or the vector of claim 35.
37. A pharmaceutical composition comprising: the agonist LTβR binding protein of any one of claims 1–12, the bispecific agonist LTβR binding protein of any one of claims 13–30, the one or more polynucleotides of claims 31 or 34, or the vector of claims 32 or 35, and a pharmaceutically acceptable carrier.
38. The agonist LTβR binding protein of any one of claims 1–12 for use as a medicament.
39. The agonist LTβR binding protein of any one of claims 1–12 for use in the treatment of cancer.
40. The agonist LTβR binding protein of any one of claims 1–12 for use in the manufacture of a medicament for the treatment of cancer
41. The bispecific agonist LTβR binding protein of any one of claims 13–30 for use as a medicament.
42. The bispecific agonist LTβR binding protein of any one of claims 13–30 for use in the treatment of cancer.
43. The bispecific agonist LTβR binding protein of any one of claims 13–30 for use in the manufacture of a medicament for the treatment of cancer.
44. A method of treating cancer in a subject, said method comprising: administering, to the subject having cancer, an agonist Lymphotoxin β Receptor (LTβR) binding protein, wherein said binding protein binds an epitope comprising one or more residues of human LTβR cysteine-rich domain 4 (CRD4), wherein human LTβR CRD4 comprises amino acid residues 169-211 of SEQ ID NO: 1, and wherein said binding protein (a) does not inhibit LIGHT binding to LTβR or (b) does not inhibit LTα1β2 binding to LTβR.
45. A method of treating cancer in a subject, said method comprising: administering, to the subject having cancer, a bispecific Lymphotoxin β Receptor (LTβR) binding protein, said binding protein comprising: an LTβR binding domain, wherein the LTβR binding domain binds an epitope comprising one or more amino acid residues of human LTβR cysteine-rich domain 4 (CRD4), wherein human LTβR CRD4 comprises amino acid residues 169-211 of SEQ ID NO: 1; and a tumor-associated antigen binding domain, wherein the bispecific binding protein agonizes LTβR activity, and (a) does not inhibit LIGHT binding to LTβR or (b) does not inhibit LT1α2β binding to LTβR.
46. The method of claim 44 or claim 45 further comprising: administering an immunomodulatory therapeutic in conjunction with said agonist LTβR binding protein or bispecific LTβR binding protein.
47. The method of claims 41 or 42, wherein the subject has a solid tumor selected from the group consisting of mesothelioma, a pancreatic tumor, an ovarian tumor, a lung tumor, an esophageal tumor, a gastric tumor, a hepatic tumor, a colorectal tumor, a cervical tumor, an endometrial tumor, a breast tumor, a renal tumor, a bladder tumor, a testicular tumor, a prostate tumor, a brain tumor, a bone tumor, and a head and neck tumor.
EP24741027.7A 2023-06-12 2024-06-11 Lymphotoxin beta receptor agonist binding proteins Pending EP4724490A2 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202363472565P 2023-06-12 2023-06-12
PCT/US2024/033443 WO2024258870A2 (en) 2023-06-12 2024-06-11 Lymphotoxin beta receptor agonist binding proteins

Publications (1)

Publication Number Publication Date
EP4724490A2 true EP4724490A2 (en) 2026-04-15

Family

ID=91899198

Family Applications (1)

Application Number Title Priority Date Filing Date
EP24741027.7A Pending EP4724490A2 (en) 2023-06-12 2024-06-11 Lymphotoxin beta receptor agonist binding proteins

Country Status (14)

Country Link
EP (1) EP4724490A2 (en)
KR (1) KR20260025131A (en)
CN (1) CN121399157A (en)
AR (1) AR132931A1 (en)
AU (1) AU2024305352A1 (en)
CL (1) CL2025003919A1 (en)
CO (1) CO2025018800A2 (en)
IL (1) IL325097A (en)
JO (1) JOP20250305A1 (en)
MX (1) MX2025015224A (en)
PE (1) PE20260306A1 (en)
TW (1) TW202506733A (en)
UY (1) UY40783A (en)
WO (1) WO2024258870A2 (en)

Family Cites Families (78)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4737462A (en) 1982-10-19 1988-04-12 Cetus Corporation Structural genes, plasmids and transformed cells for producing cysteine depleted muteins of interferon-β
US4518584A (en) 1983-04-15 1985-05-21 Cetus Corporation Human recombinant interleukin-2 muteins
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
DE69120146T2 (en) 1990-01-12 1996-12-12 Cell Genesys Inc GENERATION OF XENOGENIC ANTIBODIES
US6673986B1 (en) 1990-01-12 2004-01-06 Abgenix, Inc. Generation of xenogeneic antibodies
US5872005A (en) 1994-11-03 1999-02-16 Cell Genesys Inc. Packaging cell lines for adeno-associated viral vectors
CA2722378C (en) 1996-12-03 2015-02-03 Amgen Fremont Inc. Human antibodies that bind tnf.alpha.
US6660843B1 (en) 1998-10-23 2003-12-09 Amgen Inc. Modified peptides as therapeutic agents
US6833268B1 (en) 1999-06-10 2004-12-21 Abgenix, Inc. Transgenic animals for producing specific isotypes of human antibodies via non-cognate switch regions
US20030133939A1 (en) 2001-01-17 2003-07-17 Genecraft, Inc. Binding domain-immunoglobulin fusion proteins
US7183388B2 (en) 2001-03-30 2007-02-27 The Regents Of The University Of California Anti-MUC-1 single chain antibodies for tumor targeting
US6972324B2 (en) 2001-05-18 2005-12-06 Boehringer Ingelheim Pharmaceuticals, Inc. Antibodies specific for CD44v6
US7595378B2 (en) 2001-06-13 2009-09-29 Genmab A/S Human monoclonal antibodies to epidermal growth factor receptor (EGFR)
JP5138867B2 (en) 2002-08-01 2013-02-06 イミューノメディクス、インコーポレイテッド α-fetoprotein Immu31 antibody and fusion protein and method of use thereof
US7595379B2 (en) 2003-05-30 2009-09-29 Agensys, Inc. Antibodies and related molecules that bind to PSCA proteins
TWI476206B (en) 2003-07-18 2015-03-11 Amgen Inc a specific binding agent for hepatocyte growth factor
AU2006265936A1 (en) 2005-07-01 2007-01-11 Medimmune, Llc An integrated approach for generating multidomain protein therapeutics
US8017119B2 (en) 2005-12-28 2011-09-13 Daiichi Sankyo Company, Ltd. Antibody against periostin, and a pharmaceutical composition comprising it for preventing or treating a disease in which periostin is involved
DK2368914T3 (en) 2006-03-10 2019-03-04 Wyeth Llc Anti-5T4 antibodies and uses thereof
NZ573646A (en) 2006-06-12 2012-04-27 Wyeth Llc Single-chain multivalent binding proteins with effector function
CA2682390A1 (en) 2007-04-17 2008-10-30 Imclone Llc Pdgfr.beta.-specific inhibitors
ME02345B (en) 2007-07-17 2016-08-31 Squibb & Sons Llc Monoclonal antibodies against glypican-3
KR20100058509A (en) 2007-07-31 2010-06-03 메디뮨 엘엘씨 Multispecific epitope binding proteins and uses thereof
AU2008337517B2 (en) 2007-12-14 2014-06-26 Novo Nordisk A/S Antibodies against human NKG2D and uses thereof
JP6157046B2 (en) 2008-01-07 2017-07-05 アムジェン インコーポレイテッド Method for generating antibody Fc heterodimer molecules using electrostatic steering effect
AU2009221916A1 (en) 2008-03-03 2009-09-11 Dyax Corp. Metalloproteinase 9 and metalloproteinase 2 binding proteins
US8545839B2 (en) 2008-12-02 2013-10-01 Pierre Fabre Medicament Anti-c-Met antibody
MA33208B1 (en) 2009-03-25 2012-04-02 Genentech Inc ANTI-FGFR3 ANTIBODIES AND METHODS OF USE THEREOF
EP2236517A1 (en) 2009-03-31 2010-10-06 Takara Bio, Inc. Anti-fibronectin fragment monoclonal antibody
AU2010249531A1 (en) 2009-05-21 2011-12-15 Tamarisk Technologies, L.L.C. Alginate-based building materials
GB0909904D0 (en) 2009-06-09 2009-07-22 Affitech As Product
MY192182A (en) 2009-06-26 2022-08-04 Regeneron Pharma Readily isolated bispecific antibodies with native immunoglobulin format
KR101528013B1 (en) 2009-08-31 2015-06-16 로슈 글리카트 아게 Affinity-matured humanized anti cea monoclonal antibodies
UY32914A (en) 2009-10-02 2011-04-29 Sanofi Aventis ANTIBODIES SPECIFICALLY USED TO THE EPHA2 RECEIVER
JP5660486B2 (en) 2010-02-12 2015-01-28 国立大学法人 鹿児島大学 Antibodies against mucin 1 (MUC1) protein and uses thereof
PT3904391T (en) 2010-03-10 2024-10-14 Genmab As Monoclonal antibodies against c-met
WO2011130580A1 (en) 2010-04-15 2011-10-20 Alper Biotech, Llc Monoclonal antibodies against her2 antigens, and uses therefor
EP2563816B1 (en) 2010-04-27 2014-11-12 National Research Council of Canada Anti-icam-1 single domain antibody and uses thereof
WO2011139375A1 (en) 2010-05-06 2011-11-10 Ludwig Institute For Cancer Research Ltd Antibodies directed against carbonic anhydrase ix and methods and uses thereof
CA2800488A1 (en) 2010-05-26 2011-12-01 Regents Of The University Of Minnesota Single-chain variable fragment anti-cd133 antibodies and uses thereof
EP2576621B1 (en) 2010-05-27 2019-04-10 Genmab A/S Monoclonal antibodies against her2
GB201011771D0 (en) 2010-07-13 2010-08-25 Bioinvent Int Ab Biological material and particular uses thereof
EP2595657A4 (en) 2010-07-22 2015-09-23 Univ California ANTITUMOR ANTIBODY ANTIBODIES AND METHODS OF USING SAME
JP5883443B2 (en) 2010-07-22 2016-03-15 グラクソスミスクライン バイオロジカルズ ソシエテ アノニム Novel antigen binding protein
WO2012163771A1 (en) 2011-06-03 2012-12-06 Ct Atlantic Ltd. Magea3 binding antibodies
SI2731972T1 (en) 2011-07-15 2018-04-30 Eisai R&D Management Co., Ltd. Antibodies to the alpha folate receptor and their use
EP2548891A1 (en) 2011-07-18 2013-01-23 Universiteit Maastricht Human monoclonal antibody against the gamma subunit of the acetylcholine receptor for use in the treatment of rhabdomyosarcoma.
CA2890483A1 (en) 2012-11-09 2014-05-15 Robert ARCH Platelet-derived growth factor b specific antibodies and compositions and uses thereof
MX361088B (en) 2012-11-21 2018-11-26 Janssen Biotech Inc ANTIBODIES OF THE RECEIVER OF THE ISOLATED EPIDERMAL GROWTH FACTOR / OF THE RECEPTOR OF THE HEPATOCITES GROWTH FACTOR (EGFR / C-MET) BIESPECFICOS.
US9207238B2 (en) 2012-12-07 2015-12-08 Kyowa Hakko Kirin Co., Ltd. Anti-FOLR1 antibody
CN117843785A (en) 2013-02-07 2024-04-09 Csl有限公司 IL-11R binding protein and its application
HK1220465A1 (en) 2013-03-06 2017-05-05 Merrimack Pharmaceuticals, Inc. Anti-c-met tandem fc bispecific antibodies
US9790274B2 (en) 2013-03-14 2017-10-17 The Board Of Regents Of The University Of Texas System Monoclonal antibodies targeting EpCAM for detection of prostate cancer lymph node metastases
US20140308285A1 (en) 2013-03-15 2014-10-16 Amgen Inc. Heterodimeric bispecific antibodies
LT3030581T (en) 2013-08-07 2021-05-25 Affimed Gmbh Antibody binding sites specific for egfrviii
JP6632984B2 (en) 2014-03-11 2020-01-22 リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. Anti-EGFRvIII antibodies and uses thereof
KR20160145119A (en) 2014-05-14 2016-12-19 에프. 호프만-라 로슈 아게 Her1 antigen binding proteins binding to the beta-hairpin of her1
US9856324B2 (en) 2014-06-04 2018-01-02 MabVax Therapeutics, Inc. Human monoclonal antibodies to ganglioside GD2
EP4245376A3 (en) 2014-10-14 2023-12-13 Novartis AG Antibody molecules to pd-l1 and uses thereof
WO2016123143A1 (en) 2015-01-26 2016-08-04 The University Of Chicago CAR T-CELLS RECOGNIZING CANCER-SPECIFIC IL 13Rα2
WO2016154623A2 (en) 2015-03-26 2016-09-29 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Anti-cd133 monoclonal antibodies and related compositions and methods
EP4019552A1 (en) 2015-06-10 2022-06-29 National Research Council of Canada Carbonic anhydrase ix-specific antibodies and uses thereof
HK1248255A1 (en) 2015-06-24 2018-10-12 优瑞科生物技术公司 Constructs targeting ny-eso-1 peptide/mhc complexes and uses thereof
MA46046A (en) 2016-08-29 2019-07-03 Regeneron Pharma ANTI-GREMLIN-1 (GREM1) ANTIBODIES AND METHODS FOR USING THESE ANTIBODIES IN THE TREATMENT OF PULMONARY ARTERIAL HYPERTENSION
JP7066690B2 (en) 2016-09-23 2022-05-13 リジェネロン・ファーマシューティカルズ・インコーポレイテッド Anti-MUC16 (mucin 16) antibody
WO2018069871A2 (en) 2016-10-13 2018-04-19 Sorrento Therapeutics, Inc. Anti-kras binding proteins
GB201621635D0 (en) 2016-12-19 2017-02-01 Ucb Biopharma Sprl Crystal structure
CN107446050A (en) 2017-08-11 2017-12-08 百奥泰生物科技(广州)有限公司 The compound and method of Trop2 positive diseases treatment
EP3684818A2 (en) 2017-09-21 2020-07-29 UMC Utrecht Holding B.V. Anti-gd2 antibody for the treatment of neuroblastoma
CA3080120C (en) 2017-10-27 2023-11-21 New York University Anti-galectin-9 antibodies and uses thereof
MX2020006119A (en) 2017-12-21 2020-08-24 Hoffmann La Roche Antibodies binding to hla-a2/wt1.
TW201940518A (en) 2017-12-29 2019-10-16 美商安進公司 Bispecific antibody construct directed to MUC17 and CD3
MX2020012607A (en) 2018-05-23 2021-01-29 Pfizer Antibodies specific for gucy2c and uses thereof.
WO2020003210A1 (en) 2018-06-29 2020-01-02 Kangwon National University University-Industry Cooperation Foundation Anti-l1cam antibodies and uses thereof
WO2020025792A1 (en) 2018-08-03 2020-02-06 Amgen Research (Munich) Gmbh Antibody constructs for cldn18.2 and cd3
CA3116314A1 (en) 2018-10-15 2020-04-23 Board Of Regents, The University Of Texas System Monoclonal antibodies against human dickkopf3 and uses thereof
CN109762067B (en) 2019-01-17 2020-02-28 北京天广实生物技术股份有限公司 Antibodies that bind human Claudin18.2 and uses thereof
MA54955A (en) 2019-02-15 2021-12-22 Integral Molecular Inc ANTI-CLAUDINE 6 ANTIBODIES AND THEIR USES

Also Published As

Publication number Publication date
CN121399157A (en) 2026-01-23
AR132931A1 (en) 2025-08-13
CL2025003919A1 (en) 2026-01-23
IL325097A (en) 2026-02-01
JOP20250305A1 (en) 2025-12-11
AU2024305352A1 (en) 2025-12-04
WO2024258870A2 (en) 2024-12-19
PE20260306A1 (en) 2026-02-11
MX2025015224A (en) 2026-02-03
KR20260025131A (en) 2026-02-23
CO2025018800A2 (en) 2026-03-26
UY40783A (en) 2024-12-31
WO2024258870A8 (en) 2025-12-11
TW202506733A (en) 2025-02-16

Similar Documents

Publication Publication Date Title
US12252536B2 (en) Caninized antibodies
US12258411B2 (en) Anti-CCR8 antibodies and uses thereof
AU2020286284B2 (en) Novel anti-CD39 antibodies
US10233258B2 (en) Bispecific binding proteins that bind CD40 and mesothelin
US12441792B2 (en) Antibodies specific for immunoglobulin-like transcript 3 (ILT3) and uses thereof
US20210015860A1 (en) Compositions and methods of use for augmented immune response and cancer therapy
US20210070855A1 (en) Anti-cd47 antibodies that do not cause significant red blood cell agllutination
CA2977621C (en) Antibody binding to tfpi and composition comprising the same
WO2016109415A1 (en) Anti-cd47 antibodies and uses thereof
CN114728065A (en) Antibodies against CD3 and BCMA and bispecific binding proteins prepared therefrom
KR20130028055A (en) Cd127 binding proteins
TW202337898A (en) Novel anti-tslp antibodies
US12435151B2 (en) Anti-TNFR2 antibodies and uses thereof
WO2021013142A1 (en) Anti-4-1bb antibody, antigen-binding fragment thereof, and bispecific antibody
TW202216765A (en) Anti-pd-1 antibodies
US20230272056A1 (en) Affinity matured anti-lap antibodies and uses thereof
WO2024258870A2 (en) Lymphotoxin beta receptor agonist binding proteins
RU2829997C1 (en) Anti-cldn-18.2 antibody and use thereof
CA3277013A1 (en) Bispecific antibody fusion molecules and methods of use thereof
AU2024346729A1 (en) Bispecific antibody fusion molecules targeting cd180 and cd3 and methods of use thereof
HK40067877A (en) Antibodies to cd3 and bcma, and bispecific binding proteins made therefrom

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20251201

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR