EP4720255A1 - Bifidobacterium longum transitional microorganism - Google Patents

Bifidobacterium longum transitional microorganism

Info

Publication number
EP4720255A1
EP4720255A1 EP24733105.1A EP24733105A EP4720255A1 EP 4720255 A1 EP4720255 A1 EP 4720255A1 EP 24733105 A EP24733105 A EP 24733105A EP 4720255 A1 EP4720255 A1 EP 4720255A1
Authority
EP
European Patent Office
Prior art keywords
longum
transitional
seq
strain
suitably
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP24733105.1A
Other languages
German (de)
French (fr)
Inventor
Stéphane DUBOUX
Olga SAKWINSKA
Omar DELANNOY-BRUNO
Catherine NGOM-BRU
Léa SIEGWALD
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Societe des Produits Nestle SA
Nestle SA
Original Assignee
Societe des Produits Nestle SA
Nestle SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Societe des Produits Nestle SA, Nestle SA filed Critical Societe des Produits Nestle SA
Publication of EP4720255A1 publication Critical patent/EP4720255A1/en
Pending legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N1/00Microorganisms; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
    • C12N1/20Bacteria; Culture media therefor
    • C12N1/205Bacterial isolates
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES, NOT OTHERWISE PROVIDED FOR; PREPARATION OR TREATMENT THEREOF
    • A23L33/00Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/135Bacteria or derivatives thereof, e.g. probiotics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/66Microorganisms or materials therefrom
    • A61K35/74Bacteria
    • A61K35/741Probiotics
    • A61K35/744Lactic acid bacteria, e.g. enterococci, pediococci, lactococci, streptococci or leuconostocs
    • A61K35/745Bifidobacteria
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y302/00Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
    • C12Y302/01008Endo-1,4-beta-xylanase (3.2.1.8)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y302/00Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
    • C12Y302/01055Alpha-N-arabinofuranosidase (3.2.1.55)
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23VINDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2002/00Food compositions, function of food ingredients or processes for food or foodstuffs
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23VINDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2200/00Function of food ingredients
    • A23V2200/30Foods, ingredients or supplements having a functional effect on health
    • A23V2200/32Foods, ingredients or supplements having a functional effect on health having an effect on the health of the digestive tract
    • A23V2200/3204Probiotics, living bacteria to be ingested for action in the digestive tract
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12RINDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
    • C12R2001/00Microorganisms ; Processes using microorganisms
    • C12R2001/01Bacteria or Actinomycetales ; using bacteria or Actinomycetales

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Nutrition Science (AREA)
  • Biomedical Technology (AREA)
  • Food Science & Technology (AREA)
  • Polymers & Plastics (AREA)
  • Virology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Molecular Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Coloring Foods And Improving Nutritive Qualities (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

The present invention relates to a Bifidobacterium longum transitional microorganism strain deposited with CNCM under number CNCM I-5942 or a B. Longum transitional strain having an identifying characteristic of the B. Longum transitional strain deposited under deposit number CNCM I-5942.

Description

BIFIDOBACTERIUM LONGUM TRANSITIONAL MICROORGANISM FIELD OF THE INVENTION The present invention relates to a Bifidobacterium longum transitional strain. BACKGROUND TO THE INVENTION Nutrition plays a critical role in the development across all areas (including cognitive, motor sensory, dentition, musculo-skeletal, immunity, and social development) in infants and young children. Further, the gastrointestinal or “gut” microbiome during infancy can play a significant role in the health and development of the infant both during infancy and later on in life (see e.g., Tanaka and Nakayama.2017. Allergol. Int.66(4): 515-522). Various factors, including diet, can significantly influence the microbiome structure and thus influence the health and development of an infant both during infancy and later in life. During infancy, a mammal, including a human, will transition from a diet that is composed of all or primarily a mother’s milk to one of solid foods. This is referred to as the “transitional period”, “transitional feeding period”, or “weaning”. As this occurs, significant changes in the gut microbiome structure can take place due the change in diet and other stressors during that time (see e.g., Vatanen et al., 2019. Nature Microbiology. 4:470-479; Dizzell et al., 2021. PLOS ONE. https://doi.org/10.1371/journal.pone.0248924; Moore and Townsend. 2019. Open Biol. Sep; 9(9): 190128; Magne et al. 2006. FEMS Microbiology Ecology, 58(3): 563- 571; and Edwards C.A. Ann Nutr Metab 2017;70:246-250). The change in microbiome structure can in turn impact the physiologic, cognitive, anatomical, health or other state or characteristic of the mammal. Although several studies have and are currently investigating the gut microbiome during infancy and young childhood, the gut microbiome and its impact on the immediate and lifelong health and well-being of the infant is far from being well characterized. Paralleling the lack of characterization and understanding of the gut microbiome in infancy and young childhood is also a paucity of compositions and formulations capable of facilitating a healthy gut microbiome appropriate for infant or young child use. As such, there exists a need for improved characterization and understanding of the gut microbiome and compositions and methods to support and/or establish a healthy gut microbiome, particularly in infants and young children. Transition between a fully milk-based diet, either breast-feeding or formula feeding, and solid foods rich in proteins and fibres results in an increase of bacterial numbers in the gut leading to the evolution in a microbial composition associated with adult individuals. Weaning is considered as a stressful and complex process and the disruption of gut microbiota can lead to microbiota dysbiosis that is linked to pathogenesis of both intestinal disorders, such as diarrhoea, IBD, IBS and coeliac disease and extra-intestinal disorders, such as allergies, asthma, metabolic syndrome, cardiovascular disease and obesity. It would be desirable to reduce the stress induced by weaning to develop and maintain a heathy gut microbiota. Vatanen et al. have described Bifidobacterium longum subsp microorganisms of a clade that is present in the gut microbiome of the transitional feeding period of mammals, particularly humans, and demonstrated that this distinct Bifidobacterium longum clade expanded with introduction of solid foods and harbored enzymes for utilizing both breast milk and solid food substrates (Cell; 2022 Nov 10;185(23):4280-4297.e12). WO2023/278441 describes that this Bifidobacterium longum clade is greater in relative abundance during the transitional feeding period (e.g. weaning period) than either B. longum subsp. infantis (B. infantis) or B. longum subsp longum. Further, the relative abundance of B. longum subsp infantis decreases at the beginning of the transitional feeding period until the end of the transitional feeding period while B. longum subsp longum begins to increase in abundance. However, there exists a need for compositions and methods that are particularly suited and advantageous for supporting the transition between milk-based diet and solid in infants and young children. SUMMARY OF THE INVENTION The present invention is based, at least in part, on the provision of a novel Bifidobacterium longum transitional microorganism strain. This B. longum transitional strain is referred to herein as NCC 5025; and was deposited with the Collection Nationale de Cultures de Micro- organisms (CNCM), Institute Pasteur by SOCIÉTÉ DES PRODUITS NESTLÉ S.A according to Budapest Treaty on the 29th of March 2023 receiving the deposit number CNCM I-5942. Accordingly, in a first aspect the present invention provides a B. longum transitional microorganism strain deposited with Collection Nationale de Cultures de Micro-organismes (CNCM) under deposit number CNCM I-5942 or a B. longum transitional strain having an identifying characteristic of the B. longum transitional strain deposited under deposit number CNCM I-5942. In a further aspect the invention provides a B. longum transitional microorganism strain which has an Average Nucleotide Identity (ANI) of at least 99% compared to the B. longum strain deposited with the CNCM under deposit number CNCM I-5942. Suitably, the B. longum transitional microorganism strain has at least one identifying characteristic of the B. longum transitional strain deposited under deposit number CNCM I-5942, as described herein. In another aspect, the present invention provides a composition comprising a B. longum transitional strain according to the present invention; suitably wherein the composition comprises at least one further probiotic and/or prebiotic. The invention further provides use of a B. longum transitional strain according to the present invention to promote and/or assist the transition from a milk-based diet to solid food in an infant and/or in a young child. In a further aspect, the invention provides a method of promoting and/or assisting the transition from a milk-based diet to solid food in an infant and/or in a young child, the method comprising administering to the infant and/or to the young child a B. longum transitional strain according to the present invention. The present B. longum transitional strain is considered to have several advantageous characteristics which make it particularly suited for supporting the transition between a milk- based diet and solid in infants and young children, for example when used as a probiotic or as part of a synbiotic. Without wishing to be bound by theory, the present B. longum transitional strain may provide one or more of the following advantages: a) free of antibiotic resistance to the set of antibiotics considered relevant by EFSA; b) a unique Carbohydrate Active EnZyme (CaZy) profile, including the presence of a GH43 subfamily 17 enzyme, that was not characterized to date in the B. longum species; c) advantageous growth on 3-FL; without wishing to be bound by theory, this capacity is believed to render the present B. longum transitional strain competitive in the weaning infant gut environment; d) advantageous growth on a set of food derived fibers (e.g. inulin and arabinan). Overall, the present B. longum transitional strain is particularly adapted to the weaning period and may perform in this environment better than other B. longum transitional strains. In addition, the present B. longum transitional strain may perform better on a diet containing food derived fiber (e.g. in adulthood) than other B. longum transitional strains. FIGURES Figure 1 - UPGMA phylogenetic tree of B. Longum genomes Figure 2 - Carbohydrate-Active Enzymes (CAZymes) harbored by B. longum transitional strains, including NCC 5025. Figure 3 - The genetic region of NCC 5025 encompassing the unique GH43_17 encoding gene. Figure 4 - Growth profile of B. longum transitional strains, including NCC 5025 on 3-FL as sole carbon source. The final panel represents the obtained growth rates k for each tested strain. Figure 5 – Growth profile of different B. longum transitional strains on A) Inulin and B) Arabinan as a substrate DETAILED DESCRIPTION Various preferred features and embodiments of the present invention will now be described by way of non-limiting examples. The skilled person will understand that they can combine all features of the invention disclosed herein without departing from the scope of the invention as disclosed. Any reference to prior art documents in this specification is not to be considered an admission that such prior art is widely known or forms part of the common general knowledge in the field. All publications mentioned in the specification are herein incorporated by reference. As used in this specification, the words “comprises”, “comprising”, and similar words, are not to be interpreted in an exclusive or exhaustive sense. In other words, they are intended to mean “including, but not limited to“. The terms “comprises”, “comprising”, and similar words also include the term “consisting of“. The practice of the present invention will employ, unless otherwise indicated, conventional techniques which are within the capabilities of one of ordinary skill in the art. Such techniques are explained in the literature. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. Numeric ranges are inclusive of the numbers defining the range and all percentages disclosed herein are on a w/w basis, unless stated otherwise. As used herein the term “about” means approximately, in the region of, roughly, or around. When the term “about” is used in conjunction with a numerical value or range, it modifies that value or range by extending the boundaries above and below the numerical value(s) set forth. In general, the terms “about” and “approximately” are used herein to modify a numerical value(s) above and below the stated value(s) by 10%. All percentages are by weight unless otherwise stated. The terms “about” or “approximatively” as used herein when referring to a measurable value such as a parameter, an amount, a temporal duration, and the like, are meant to encompass variations of and from the specific value, such as the variation of 1/-10% or less, 1/-5% or less, 1/-1% or less, and +/0.1% or less of and from the specific value, insofar such variations are appropriate to perform in the disclosed invention. It is to be understood that the value to which the modifier “about” or “approximately” refers is itself also specifically, and preferably, disclosed. Reference to a sequence which has a percent identity to any one of the SEQ ID NOs detailed herein may refers to a sequence which has the stated percent identity over the entire length of the SEQ ID NO referred to. Identity comparisons can be conducted by eye or, more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs can calculate percentage homology or identity between two or more sequences. Percentage identity may be calculated over contiguous sequences, i.e., one sequence is aligned with the other sequence and each amino acid in one sequence is directly compared with the corresponding amino acid in the other sequence, one residue at a time. This is called an “ungapped” alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues. Although this is a very simple and consistent method, it fails to take into consideration that, for example, in an otherwise identical pair of sequences, one insertion or deletion in the nucleotide sequence may cause the following codons to be put out of alignment, thus potentially resulting in a large reduction in percent identity when a global alignment is performed. Consequently, most sequence comparison methods are designed to produce optimal alignments that take into consideration possible insertions and deletions without penalising unduly the overall identity score. This is achieved by inserting “gaps” in the sequence alignment to try to maximise local identity. However, these more complex methods assign “gap penalties” to each gap that occurs in the alignment so that, for the same number of identical amino acids, a sequence alignment with as few gaps as possible, reflecting higher relatedness between the two compared sequences, will achieve a higher score than one with many gaps. “Affine gap costs” are typically used that charge a relatively high cost for the existence of a gap and a smaller penalty for each subsequent residue in the gap. This is the most commonly used gap scoring system. High gap penalties will of course produce optimised alignments with fewer gaps. Most alignment programs allow the gap penalties to be modified. However, it is preferred to use the default values when using such software for sequence comparisons. For example when using the GCG Wisconsin Bestfit package the default gap penalty for amino acid sequences is -12 for a gap and -4 for each extension. Calculation of maximum percentage identity therefore firstly requires the production of an optimal alignment, taking into consideration gap penalties. A suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestfit package (University of Wisconsin, U.S.A.; Devereux et al. (1984) Nucleic Acids Res.12: 387), minimap or Burrows- Wheeler Aligner (BWA). Examples of other software that can perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubel et al. (1999) ibid – Ch.18), FASTA (Atschul et al. (1990) J. Mol. Biol.403-410) and the GENEWORKS suite of comparison tools. Both BLAST and FASTA are available for offline and online searching (see Ausubel et al. (1999) ibid, pages 7-58 to 7-60). However, for some applications, it is preferred to use the GCG Bestfit program. Another tool, called BLAST 2 Sequences is also available for comparing protein and nucleotide sequences (see FEMS Microbiol. Lett. (1999) 174: 247-50; FEMS Microbiol. Lett. (1999) 177: 187-8). Suitably, the percentage identity may be calculated over a minimum coverage shared between the two sequences to be aligned using at least 80%, at least 85%, at least 90%, at least 95% or at least 99% coverage. The alignment process itself is typically not based on an all-or-nothing pair comparison. Instead, a scaled similarity score matrix is generally used that assigns scores to each pairwise comparison based on chemical similarity or evolutionary distance. An example of such a matrix commonly used is the BLOSUM62 matrix – the default matrix for the BLAST suite of programs. GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table if supplied (see the user manual for further details). For some applications, it is preferred to use the public default values for the GCG package, or in the case of other software, the default matrix, such as BLOSUM62. Once the software has produced an optimal alignment, it is possible to calculate percent homology, preferably percent sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result The terms “subject”, “individual” and “patient” are used interchangeably to refer to a vertebrate, preferably a mammal, more preferably a human. Mammals include but are not limited to murines, simians, humans, farm animals, sport animals and pets. The term “infant” means a human subject under the age of 12 months or an age equivalent non-human animal. The terms “young child” or “toddler” as used herein may mean a human subject aged between 12 months and 5 years of age. Suitably, a “young child” may refer to an age equivalent non- human animal. The expressions “complementary feeding period”, “complementary period”, “transitional period”, “transitional feeding period” and “weaning period” can be interchangeably used and refer to the period during which the milk, either breast milk or formula, is substituted by other foods in the diet of an infant or a young child. The infant or the young child is typically moved or transitioned gradually from exclusive milk-feeding, either breast feeding or formula feeding, to mixed diet comprising milk and/or solid foods. The transitional period depends on the infant or young child but typically falls between about 4 months and about 18 months of age, such as between about 6 and about 18 months of age, but can in some instances extend up to about 24 months or more. For humans, the weaning period typically starts between 4 and 6 months of age and is considered completed once the infant and/or the young child is no longer fed with breast milk or infant formula, typically at about 24 months of age. In some embodiments, the weaning period is between 4 and 24 months. The expressions “composition” or “nutritional composition” refer to any kind of composition or formulation that provides a nutritional benefit to an individual and that may be safely consumed by a human or an animal. A nutritional composition may be in solid (e.g. powder), semi-solid or liquid form and may comprise one or more macronutrients, micronutrients, food additives, water, etc. For instance, the nutritional composition may comprise the following macronutrients: a source of proteins, a source of lipids, a source of carbohydrates and any combination thereof. Furthermore, the nutritional composition may comprise the following micronutrients: vitamins, minerals, fiber, phytochemicals, antioxidants, prebiotics, probiotics, bioactives, metabolites (e.g. butyrate, Docosahexaenoic acid (DHA), Eicosapentaenoic acid (EPA), Gamma-Linolenic acid (GLA)) and any combination thereof. The composition may also contain food additives such as stabilizers (when provided in liquid or solid form) or emulsifiers (when provided in liquid form). The amount of the various ingredients (e.g. the oligosaccharides) can be expressed in g/100 g of composition on a dry weight basis when it is in a solid form, e.g. a powder, or as a concentration in g/L of the composition when it refers to a liquid form (this latter also encompasses liquid composition that may be obtained from a powder after reconstitution in a liquid such as milk, water, e.g. a reconstituted infant formula or follow-on/follow-up formula or infant cereal product or any other formulation designed for infant or young child nutrition). Generally, a nutritional composition can be formulated to be taken enterally, orally, parenterally, or intravenously, and it usually includes one of more nutrients selected from: a lipid or fat source, a protein source, and a carbohydrate source. Preferably, a nutritional composition is for oral use. In a particular embodiment, the nutritional composition is a “synthetic nutritional composition”. The expression “synthetic nutritional composition” means a mixture obtained by chemical and/or biological means. Suitably, the nutritional composition may comprise a fiber; for example as defined herein. The expression "infant formula" as used herein refers to a foodstuff intended for particular nutritional use by infants during the first months of life and satisfying by itself the nutritional requirements of this category of person (Article 2(c) of the European Commission Directive 91/321/EEC 2006/141/EC of 22 December 2006 on infant formulae and follow-on formulae). It also refers to a nutritional composition intended for infants and as defined in Codex Alimentarius (Codex STAN 72-1981) and Infant Specialities (incl. Food for Special Medical Purpose). The expression "infant formula" encompasses both “starter infant formula” and “follow-up formula” or “follow-on formula”. A “follow-up formula” or “follow-on formula” is given from the 6th month onwards. It constitutes the principal liquid element in the progressively diversified diet of this category of person. The expression “baby food” means a foodstuff intended for particular nutritional use by infants or young children during the first years of life. The expression “infant cereal composition” means a foodstuff intended for particular nutritional use by infants or young children during the first years of life. The expression “growing-up milk” (or GUM) refers to a milk-based drink generally with added vitamins and minerals, that is intended for young children or children. The terms “fortifier” refers to liquid or solid nutritional compositions suitable for fortifying or mixing with human milk, infant formula, growing-up milk or human breast milk fortified with other nutrients. Accordingly, the fortifier can be administered after dissolution in human breast milk, in infant formula, in growing-up milk or in human breast milk fortified with other nutrients or otherwise it can be administered as a stand-alone composition. The composition of the invention may be a supplement. The supplement may be in the form of tablets, capsules, pastilles or a liquid for example. The supplement may further contain protective hydrocolloids (such as gums, proteins, modified starches), binders, film forming agents, encapsulating agents/materials, wall/shell materials, matrix compounds, coatings, emulsifiers, surface active agents, solubilizing agents (oils, fats, waxes, lecithins etc.), adsorbents, carriers, fillers, co compounds, dispersing agents, wetting agents, processing aids (solvents), flowing agents, taste masking agents, weighting agents, jellifying agents and gel forming agents. The supplement may also contain conventional pharmaceutical additives and adjuvants, excipients and diluents, including, but not limited to, water, gelatine of any origin, vegetable gums, lignin-sulfonate, talc, sugars, starch, gum arabic, vegetable oils, polyalkylene glycols, flavouring agents, preservatives, stabilizers, emulsifying agents, buffers, lubricants, colorants, wetting agents, fillers, and the like. Further, the supplement may contain an organic or inorganic carrier material suitable for oral or parenteral administration as well as vitamins, minerals trace elements and other micronutrients in accordance with the recommendations of Government bodies such as the USRDA. The term “metabolize” is used herein to mean that a substrate can by broken down, adsorbed and/or utilized by a microorganism. For example, the substrate may promote and/or contribute to the growth and/or survival of the microorganism. Suitably, the term “capable of metabolizing the glycan substrate” may mean that the B. longum transitional strain encodes at least one CAZyme which is capable of utilizing the glycan substrate. For example, the CAZyme may be capable of catalyzing the hydrolysis of a glycosidic bond within the glycan substrate. Suitably, the B. longum transitional strain may encode at least one, at least two, at least three, at least four or at least five CAZymes that are capable of utilizing the glycan substrate. Suitably, the term “capable of metabolizing the glycan substrate” may mean that the glycan substrate (or a fiber or ingredient comprising the glycan substrate) is capable of promoting growth and/or survival of the B. longum transitional strain (e.g. when added to an anaerobic culture of the B. longum transitional strain). Growth and/or survival of the B. longum transitional strain through time may be determined by measuring the abundance using a strain-specific gene – for example using qPCR methods or by measuring growth via optical density of the cells at 580 nm. An illustrative assay for measuring growth of a B. longum transitional strain in the presence of glycan substrates (e.g. in the form of fiber) is provided in the present examples. A glycan substrate capable of promoting growth and/or survival of the B. longum transitional strain may increase the number of B. longum transitional bacteria in an anaerobic culture by at least 20%, at least 30%, at least 40%, at least 50%, at least 75% or at least 100% compared to the number of B. longum transitional bacteria in a control anaerobic culture which does not comprise the HMO. Suitably, a glycan substrate capable of promoting growth and/or survival of the B. longum transitional strain may increase the number of B. longum transitional bacteria in an anaerobic culture by a statistically significant amount (e.g. p-value <0.05 as determined by one-way ANOVA) compared to the number of B. longum transitional bacteria in a control anaerobic culture which does not comprise the glycan substrate. A “glycan substrate” refers to a glycan that can be metabolized by a microorganism. A glycan substrate may be, for example, a glycoconjugate, oligo- or polysaccharide. Glycoconjugate glycans may comprise N-linked glycans or O-linked glycans within glycoproteins and proteoglycans, or glycolipids. For example, an O-linked glycan may comprise a protein or peptide where the oxygen atom of a serine or threonine residue is linked to a monosaccharide, oligo- or polysaccharide as in the case with glycosaminoglycans (GAGs). Further examples of “glycan substrates” are cellulose, which is a glycan composed of β-1,4-linked D-glucose, and chitin, which is a glycan composed of β-1,4-linked N-acetyl-D-glucosamine. Glycans may be homo- or heteropolymers of monosaccharide residues and can be linear or branched. “Glycan substrate” as used herein encompasses, for example, oligosaccharides and polysaccharides. The “oligosaccharide” may refer to a carbohydrate that has greater than 2 but relatively few monosaccharide units (typically 3, 4, 5, 6, and up to 10). Exemplary oligosaccharides include, but are not limited to, fructo-oligosaccharides, galacto-oligosaccharides (raffinose, stachyose, verbascose), maltooligosaccharides, gentio-oligosaccharides, cellooligosaccharides, milk oligosaccharides (e.g., those present in secretions from mammary glands), isomalto- oligosaccharides, lactosucrose, mannooligosaccharides, melibiose-derived oligosaccharides, pectic oligosaccharides, xylo-oligosaccharides. The term “polysaccharide” may refer to a carbohydrate that has more than ten monosaccharide units. Exemplary polysaccharides include, but are not limited to, starch, arabinogalactan, arabinan, beta-glucan, laminarin, chrysolaminarin, xylan, arabinoxylan, mannan, fucoidan, rhamnogalacturonan and galactomannan. It is to be understood that there is not a precise cut-off or distinction between the terms oligosaccharide and polysaccharide, nor is such a distinction necessary to practice the invention. The term “glycosaminoglycan” (GAG) or mucopolysaccharide refers to long linear polysaccharides consisting of repeating disaccharide units (i.e. two-sugar units). The repeating two-sugar unit consists of a uronic sugar and an amino sugar, with the exception of keratan, where in the place of the uronic sugar it has galactose. GAGs are classified into four groups based on core disaccharide structures. “Mucins”, as used herein, may refer to a family of high molecular weight, heavily glycosylated proteins (glycoconjugates). Mucins' key characteristic is their ability to form gels; therefore they are a key component in most gel-like secretions, serving functions from lubrication to cell signaling to forming mechanical and chemical barriers. The term “HMO” or “HMOs” refers to human milk oligosaccharide(s). These carbohydrates are highly resistant to enzymatic hydrolysis, indicating they may display essential functions not directly related to their caloric value. It has been especially illustrated they play a vital role in the early development of infants and young children, such as the maturation of the immune system. Many different kinds of HMOs are found in the human milk. Each individual oligosaccharide is based on a combination of glucose, galactose, sialic acid (N- acetylneuraminic acid), fucose and/or N-acetylglucosamine with many and varied linkages between them, thus accounting for the enormous number of different oligosaccharides in human milk – over 130 such structures have been identified so far. Almost all of them have a lactose moiety at their reducing end while sialic acid and/or fucose (when present) occupy the terminal position at the non-reducing ends. Depending on the presence of fucose and sialic acid in the oligosaccharide structure, the HMOs can be divided as non-fucosylated (neutral) or fucosylated (neutral) and sialylated (acidic) and non-sialylated molecules, respectively. The expression “fucosylated oligosaccharide” refers to an oligosaccharide having a fucose residue. It has a neutral nature. Some examples are 2’-fucosyllactose (2-FL), 3-fucosyllactose (3-FL), difucosyllactose (DiFL), lacto-N-fucopentaose (e.g. lacto-N-fucopentaose I, lacto-N- fucopentaose II, lacto-N-fucopentaose III, lacto-N-fucopentaose V), lacto-N-fucohexaose, lacto-N-difucohexaose I, fucosyllacto-N-hexaose, fucosyllacto-N-neohexaose, difucosyllacto- N-hexaose I, difucosyllacto-N-neohexaose II and any combination thereof. Fucosylated oligosaccharides represents the largest fraction of human milk with 2’-FL constituting up to 30% of the total HMOs. Fucosylated oligosaccharides are thought to reduce the risk of infections and inflammations and to boost growth and metabolic activity of specific commensal microbes reducing inflammatory response. The expression “N-acetylated oligosaccharide(s)” encompasses both “N-acetyl-lactosamine” and “oligosaccharide(s) containing N-acetyl-lactosamine”. They are neutral oligosaccharides having an N-acetyl-lactosamine residue. Suitable examples are LNT (lacto-N-tetraose), para- lacto-N-neohexaose (para-LNnH), LNnT (lacto-N-neotetraose), DSLNT (disialyllacto-N- tetraose), and any combinations thereof. Other examples are lacto-N-hexaose, lacto-N- neohexaose, para- lacto-N-hexaose, para-lacto-N-neohexaose, lacto-N-octaose, lacto-N- neooctaose, iso- lacto-N-octaose, para- lacto-N-octaose and lacto-N-decaose. The expressions “at least one fucosylated oligosaccharide” and “at least one N-acetylated oligosaccharide” should be understood as “at least one type of fucosylated oligosaccharide” and “at least one type of N-acetylated oligosaccharide”. The term “sialylated oligosaccharide” refers to an oligosaccharide having a charged sialic acid residue. It has an acidic nature. Some examples are 3’-sialyllactose (3-SL), 6’-sialyllactose (6- SL), sialyllacto-N-tetraose (Lst – e.g. Lst-a, Lst-b or Lst-c). Suitably, the term “capable of metabolizing the HMO” may mean that the B. longum transitional strain encodes at least one CAZyme which is capable of utilizing the HMO. For example, the CAZyme may be capable of catalyzing the hydrolysis of a glycosidic bond within the HMO. Suitably, the B. longum transitional strain may encode at least one, at least two, at least three, at least four or at least five CAZymes that are capable of utilizing the HMO. Suitably, the term “capable of metabolizing the HMO” may mean that the HMO is capable of promoting growth and/or survival of the B. longum transitional strain (e.g. when added to an anaerobic culture of the B. longum transitional strain). Growth and/or survival of the B. longum transitional strain through time may be determined by measuring the abundance using a strain specific genes, for example with qPCR methods or by measuring growth via optical density of the cells at 580 nm. The term fibers is used herein to refer to carbohydrates that are indigestible by a human or animal. Such fibers are also discussed in relation to carbohydrates herein. Suitably, the fiber can be fermented by the present B. longum transitional strain. As used herein, the expressions “fiber” or “fibers” or “dietary fiber” or “dietary fibers” within the context of the present invention indicate the indigestible portion, in small intestine, that reaches the large intestine, of food derived from plants which comprises two main components: soluble fiber, which dissolves in water and insoluble fiber. Mixtures of fibers are comprised within the scope of the terms above mentioned. Soluble fiber is readily fermented in the colon into gases and physiologically active byproducts and can be prebiotic and viscous. Insoluble fiber does not dissolve in water, is metabolically inert and provides bulking, or it can be prebiotic and metabolically ferment in the large intestine. Chemically, dietary fiber consists of carbohydrate polymers with three or more monomeric units which are not hydrolyzed by endogenous enzymes in the small intestine or the upper tract of the digestive system, such as arabinoxylans, cellulose, and many other plant components such as resistant starch, resistant dextrins, inulin, lignin, chitins, pectins, arabinans, arabinogalactans, galactans, xylans, beta-glucans, and oligosaccharides. Non- limiting examples of dietary fibers are: prebiotic fibers such as Fructo-oligosaccharides (FOS), inulin, galacto-oligosaccharides (GOS), fruit fiber, vegetable fiber, cereal fiber, resistant starch such as high amylose corn starch. As used herein, “added fiber” or “added dietary fiber” indicates an ingredient mainly or totally constituted by fiber which is added to the complementary nutritional composition and whose content in fiber contributes to the total fiber content of the composition. The total fiber content of the complementary nutritional composition is provided by the sum of amount of fiber naturally present in ingredients used in the recipe (for example from whole grain cereal flour) plus amount of added fiber. Suitably, the present composition may be a probiotic composition. The term “prebiotic” means non-digestible carbohydrates that beneficially affect the host by selectively stimulating the growth and/or the activity of healthy bacteria such as bifidobacteria in the colon of humans (Gibson GR, Roberfroid MB. Dietary modulation of the human colonic microbiota: introducing the concept of prebiotics. J Nutr.1995;125:1401-12). The term “probiotic” means microbial cell preparation or components of microbial cells with a beneficial effect on the health or well-being of the host (Salminen S, Ouwehand A. Benno Y. et al. “Probiotics: how should they be defined” Trends Food Sci. Technol.1999:10107-10). The microbial cells according to the present invention are generally bacteria. The term “cfu” should be understood as colony forming unit. The “gut microbiota” is the composition of microorganisms (including bacteria, archaea and fungi) that live in the digestive tract. The term “gut microbiome” may encompass both the “gut microbiota” and their “theater of activity”, which may include their structural elements (nucleic acid, proteins, lipids, polysaccharides), metabolites (signaling molecules, toxins, organic and inorganic molecules) and molecules produced by coexisting hosts and structured by the surrounding environmental conditions (Berg, G., et al., 2020. Microbiome, 8(1), pp.1-22). Bifidobacterium longum transitional microorganism strain In a first aspect, the present invention provides a Bifidobacterium longum transitional microorganism strain deposited with Collection Nationale de Cultures de Micro-organismes (CNCM) under deposit number CNCM I-5942 or a B. longum transitional strain having the identifying characteristic of the B. longum transitional strain deposited under deposit number CNCM I-5942. Suitably, a Bifidobacterium longum transitional strain may be referred to herein as B. longum subsp. juvenis. Suitably, an identifying characteristic of the present B. longum transitional strain may refer to one or more of the phenotypic or genotypic characteristics described herein. In another aspect, the present invention provides a B. longum transitional microorganism strain which has an Average Nucleotide Identity (ANI) of at least 99% to the B. longum transitional strain deposited with the CNCM under deposit number CNCM I-5942. In some embodiments, the B. longum transitional strain has an ANI of at least at least 99.0%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9%, compared to the B. longum strain deposited with the CNCM under deposit number CNCM I-5942. Preferably, the B. longum transitional strain has an ANI of at least 99.9% compared to the B. longum strain deposited with the CNCM under deposit number CNCM I-5942. Suitably, the B. longum transitional strain has an ANI of at least 98.1%, at least 98.2%, at least 98.3%, at least 98.4%, of at least 98.5%, of at least 98.6%, of at least 98.6 %, of at least 98.7 %, of at least 98.8 %, of at least 98.9 %, of at least 99 %, of at least 99.1 %, of at least 99.2 %, of at least 99.3 %, of at least 99.4 %, of at least 99.5 %, of at least 99.6 %, of at least 99.7 %, of at least 99.8 %, or of at least 99.9 % compared to the B. longum strain deposited with the CNCM under deposit number CNCM I-5942 and has at least one identifying characteristics of the B. Longum transitional strain deposited under deposit number CNCM I-5942 – as described herein. Suitably, the B. longum transitional strain has an ANI of at least 98.4%, of at least 98.5%, of at least 98.6%, of at least 98.6 %, of at least 98.7 %, of at least 98.8 %, of at least 98.9 %, of at least 99 %, of at least 99.1 %, of at least 99.2 %, of at least 99.3 %, of at least 99.4 %, of at least 99.5 %, of at least 99.6 %, of at least 99.7 %, of at least 99.8 %, or of at least 99.9 % compared to the B. longum strain deposited with the CNCM under deposit number CNCM I- 5942 and has at least one identifying characteristics of the B. longum transitional strain deposited under deposit number CNCM I-5942 – as described herein. Methods for sequencing microbial genomes are well known in the art (see e.g. Segerman; Front. Cell. Infect. Microbiol.; 2020; 10; Article 527102 & Donkor; Genes; 2013; 4(4); 556-572). By way of example, metagenomics methods may be used. Suitable metagenomics methods may be performed using shotgun sequencing data, for example. Suitable metagenomics methods are known in the art and include MetaPhlAn 3.0, for example (see Beghini et al.; eLife 2021;10: e65088; https://huttenhower.sph.harvard.edu/metaphlan). The “Average Nucleotide Identity (ANI)” is a term of art that refers to a distance-based approach to delineate species based on pair-wise comparisons of their genome sequences and is an in silico alternative to the traditional DNA-DNA hybridization (DDH) techniques that have been used for phylogenetic definition of a species (Goris et al., 2007, “DNA-DNA hybridization values and their relationship to whole-genome sequence similarities”, Int. J. Syst. Evol. Microbiol.57: 81-91). Based on DDH, strains with greater than 70% relatedness would be considered to belong to the same species (see e.g., Wayne et al., 1987, Report of the Ad- Hoc-Committee on Reconciliation of Approaches to Bacterial Systematics. Int J Syst Bacteriol 37: 463-464). ANI is similar to the aforementioned 70% DDH cutoff value and can be used for species delineation. ANI has been evaluated in multiple labs and has become the gold standard for species delineation (see e.g., Kim et al., 2014, “Towards a taxonomic coherence between average nucleotide identity and 16S rRNA gene sequence similarity for species demarcation of prokaryotes”, Int. J. Syst. Evol. Micr.64: 346-351; Richter et al., 2009, “Shifting the genomic gold standard for the prokaryotic species definition”, P Natl Acad Sci USA 106: 19126-19131; and Chan et al., 2012, “Defining bacterial species in the genomic era: insights from the genus Acinetobacter”, Bmc. Microbiol.12)). The ANI of the shared genes between two strains is known to be a robust means to compare genetic relatedness among strains, and that ANI values of about 95% correspond to the 70% DNA-DNA hybridization standard for defining a species. See, e.g., Konstantinidis and Tiedje, Proc Natl Acad Sci USA, 102(7):2567-72 (2005); and Goris et al., Int Syst Evol Microbiol.57(Pt 1):81-91 (2007). The ANI between two bacterial genomes is calculated from pair-wise comparisons of all sequences shared between any two strains and can be determined, for example, using any of a number of publicly available ANI tools, including but not limited to OrthoANI with usearch (Yoon et al. Antonie van Leeuwenhoek 110:1281-1286 (2017)); ANI Calculator, JSpecies (Richter and Rossello-Mora, Proc Natl Acad Sci USA 106:19126-19131 (2009)); and JSpeciesWS (Richter et al., Bioinformatics 32:929-931 (2016)). Other methods for determining the ANI of two genomes are known in the art. See, e.g., Konstantinidis, K. T. and Tiedje, J. M., Proc. Natl. Acad. Sci. U.S.A., 102: 2567-2572 (2005); and Varghese et al., Nucleic Acids Research, 43(14):6761-6771 (2015). In a particular embodiment, the ANI between two bacterial genomes can be determined, for example, by averaging the nucleotide identity of orthologous genes identified as bidirectional best hits (BBHs). Protein-coding genes of a first genome (Genome A) and second genome (Genome B) are compared at the nucleotide level using a similarity search tool, for example, NSimScan (Novichkov et al., Bioinformatics 32(15): 2380-23811 (2016)). The results are then filtered to retain only the BBHs that display at least 70% sequence identity over at least 70% of the length of the shorter sequence in each BBH pair. The ANI of Genome A to Genome B is defined as the sum of the percent identity times the alignment length for all BBHs, divided by the sum of the lengths of the BBH genes. These and ANI determination techniques are known in the art. According to the present invention, a B. longum transitional strain deposited with the CNCM under deposit number CNCM I-5942 represents the reference genome to which a test genome is compared. In some embodiments, the B. longum transitional strain of the present invention is isolated from a human. In some other embodiments, the B. longum transitional strain is not of the subspecies B. longum subsp. longum or B. longum subsp. infantis. Suitably, the B. longum transitional strain is provided as a probiotic. Suitably, the B. longum transitional stain is provided in a composition. Antibiotic Resistance Suitably, the present B. longum transitional strain does not harbor transferable antibiotic resistance to one or more antibiotics, preferably one or more European Food Standard Agency (EFSA) relevant antibiotics (see European Food Safety Authority. 2012. Guidance on the assessment of bacterial susceptibility to antimicrobials of human and veterinary importance. EFSA J 10:2740). Antibiotic resistance refers to the ability of microorganisms to withstand antibiotic treatments. The overuse or misuse of antibiotics has been linked to the emergence and spread of microorganisms which are resistant to them, rendering treatment ineffective and posing a serious risk to public health. In addition, the wide-spread use of antibiotics means that it is increasingly challenging to provide bacterial strains that do not have transferrable resistance to one or more EFSA relevant antibiotics. It is known that a single gene may instill antibiotic resistance against a particular antibiotic, and that bacteria can transfer genes through horizontal gene transfer via conjugation, transduction or transformation. Accordingly, it is known that antibiotic resistance may be transferred between bacteria via horizontal gene transfer; including in the gut microbiome. It is therefore advantageous that the present B. longum transitional strain does not harbor transferrable antibiotic resistance to one or more antibiotics as this reduces the risk of the antibiotic resistance being transferred to other components of the microbiome when the present B. longum transitional strain is used as a probiotic. Antibiotics resistance has been well-described and antibiotic resistance may be determined using any suitable assay known in the art. By way of example, phenotypic and/or genetic methods may be used. Phenotypic methods typically involve measuring the growth of a test bacteria in the presence of a suitable concentration of the antibiotic under consideration. In addition, a number of genes mediating antibiotic resistance are known. Accordingly, genetic methods for determining antibiotic resistance comprise determining the presence of one or more antibiotic resistance genes in the genome of the test bacteria (for example by PCR, DNA microarray, whole-genome sequencing and metagenomics, and matrix-assisted laser desorption ionization-time of flight mass spectrometry). Suitably, phenotypic antibiotic testing of may be performed according to the recommendations made by EFSA (EFSA J 16, e05206, doi:10.2903/j.efsa.2018.5206 (2018)); for example following the official method ISO 10932. An illustrative method for determining antibiotic resistance is detailed in the present Examples. Antibiotic resistance and underlying genes present in Bifidobacterium are known in the art (see e.g. Duranti et al.; Appl Environ Microbiol.2017 Feb 1; 83(3): e02894-16.). As such, the skilled person is able to determine whether a test Bifidobacterium is resistant to one or more antibiotics. Suitably, the present B. longum transitional strain is not resistant to at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, or at least 7 EFSA relevant antibiotics. Suitably, the B. longum transitional strain is not resistant to any one of tetracycline and erythromycin. Suitably, the B. longum transitional strain is not resistant to any one of tetracycline, erythromycin, clindamycin and ampicillin. Suitably, the B. longum transitional strain is not resistant to any of tetracycline, erythromycin, clindamycin, ampicillin, gentamycin, streptomycin, chloramphenicol and vancomycin. Resistance to tetracycline may be afforded by tet(W) or tet(Q) genes which encode ribosomal protection proteins. Suitably, the present B. Longum transitional strain may lack a tet(W) gene. Suitably, the present B. longum transitional strain may lack a tet(W) gene encoding a polypeptide shown as SEQ ID NO: 1 or a variant which shares at least 80% sequence identity to SEQ ID NO: 1. Suitably, the variant may share at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity with SEQ ID NO: 1. SEQ ID NO: 1 MKIINIGILAHVDAGKTTLTESLLYASGAISEPGSVEKGTTRTDTMLLERQRGITIQAAVTSFQWHRCKVNIVDT PGHMDFLAEVYRSLAVLDGAILVISAKDGVQAQTRILFHALRKMNIPTVIFINKIDQAGVDLQSVVQSVRDKLSA DIIIKQTVSLSPEIVLEENTDIEAWDAVIENNDKLLEKYIAGEPISREKLVREEQRRVQDASLFPVYYGSAKKGL GIQPLMDAVTGLFQPIGEQGSAALCGSVFKVEYTDCGQRRVYLRLYSGTLRLRDTVALAGREKLKITEMRIPSKG EIVRTDTAYPGEIVILPSDSVRLNDVLGDPTRLPRKRWREDPLPMLRTSIAPKTAAQRERLLDALTQLADTDPLL RCEVDSITHEIILSFLGRVQLEVVSALLSEKYKLETVVKEPTVIYMERPLKAASHTIHIEVPPNPFWASIGLSVT PLPLGSGVQYKSRVSLGYLNQSFQNAVRDGIRYGLEQGLFGWNVTDCKICFEYGLYYSPVSTPADFRSLAPIVLE QALKESGTQLLEPYLSFTLYAPREYLSRAYHDAPKYCATIETVQVKKDEVVFTGEIPARCIQAYRTDLAFYTNGQ SVCLTELKGYQAAVGKPVIQPRRPNSRLDKVRHMFSKIT Suitably, the present B. Longum transitional strain may lack a tet(Q) gene. Suitably, the present B. longum transitional strain may lack a tet(Q) gene encoding a polypeptide shown as SEQ ID NO: 2 or a variant which shares at least 80% sequence identity to SEQ ID NO: 2. Suitably, the variant may share at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity with SEQ ID NO: 2. SEQ ID NO: 2 MRFDNASNVVYYCLIQMNIINLGILAHIDAGKTSVTENLLFASGATEKCGRVDNGDTITDSMDIEKRRGITVRAS TTSIIWNGVKCNIIDTPGHMDFIAEVERTFKMLDGAVLILSAKEGIQAQTKLLFNTLQKLQIPTIIFINKIDRAG VNLERLYLDIKTNLSQDVLCMQTVVDGSVYPVCSQTYIKEEYKEFVCDHDDNILERYLADSEIPPTDYWNTIIAL VAKAKVYPVLHGSAMFNIGINELMDAITSFILPPASVSDRLSAYLYKIEHDPKGHKRSFLKIIDGSLRLRDVVRI NDSEKSIKIKNLKTIYQGREINVDEVGANDIAIVEDMEDFRIGDYLGAEPCLIQGLSHQHPALKSSVRPDKPEER SKVISALNTLWIEDPSLSFSINSYSDELEISLYGLTQKEIIQTLLEERFSVKVHFDEIKTIYKERPIKKVNKIIQ IEVPPNPYWATIGLTLEPLPLGAGLQIESDISYGYLNHSFQNAVFEGIRMSCQSGLHGWEVTDLKVTFTQAEYYS PVSTPADFRQLTPYVFRLALQQSGVDILEPMLYFELQIPQEASSKAITDLQKMMSEIEDISCNNEWCHIKGKVPL NTSKDYASEVSSYTKGLGIFMVKPCGYQITKDGYSDNIRMNEKDKLLFMFQKSMSLK Resistance to erythromycin may be afforded by the erm(49) gene which encodes a rRNA methylase. Suitably, the present B. Longum transitional strain may lack a erm(49) gene. Suitably, the present B. Longum transitional strain may lack of erm(49) gene encoding a polypeptide shown in SEQ ID NO: 3or a variant which shares at least 80% sequence identity to SEQ ID NO: 3. Suitably, the variant may share at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity with SEQ ID NO: 3. SEQ ID NO: 3 MRNIKDTQNFLHSKELVRHLIGICNIKLDDVVIEIGPGKGIITNELAHKARKVVAIEFDEELYEKLKNKFQSNNK VDIIYGDILNYTPRIPSYCVFSNIPFNITSEILNKFLSDKKNEKMFLIMQYEPFIKYAGNPYGAETLRSMLYKPF FDMDLKYRFDPSDFKPAPQARIVLASFERKQFPDVKKEEEKLYKDFLAYIYTNKGETFFAKIKTLFSSNQIKRVW GQIKIDKTTKISEVPYESILKVFKLFFLYGTDANKQLVVNSFNNMNKQNNKLQKNHRNNSKAKSWNSNRKRKPYH RNNV Resistance to erythromycin and clindamycin may be afforded by the erm(X) gene which encodes a ribosomal protection protein. Suitably, the present B. Longum transitional strain may lack an erm(X) gene. Suitably, the present B. Longum transitional strain may lack an erm(X) gene which encodes a protein comprising SEQ ID NO: 4 or a variant which shares at least 80% sequence identity to SEQ ID NO: 4. Suitably, the variant may share at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity with SEQ ID NO: 4. SEQ ID NO: 4 MSAYGHGRHENGQNFLTNHKIINSIIDLVKQTSGPIIEIGPGSGALTHPMAHLGRAITAVEVDAKLAAKLTQETS SAAVEVVHDDFLNFRLPATPCVIVGNIPFHLTTAILRKLLHAPAWTDAVLLMQWEVARRRAGVGASTMMTAQWSP WFTFHLGSRVPRTAFRPQPNVDGGILVIRRVGDPKIPIEQRKAFQAMVHTVFTARGRGIGEILRRAGLFSSRSET QSWLRSRGIDPATLPPRLHTNDWIDLFQVTGSSLPHHRPISPSGSSQRPPQQKNRSRRR Resistance to streptomycin may be afforded by a mutation within the rpSL gene which encodes a ribosomal S12 protein. More specifically, a mutation at nucleotide position 128, replacing an A residue to a G residue was shown to provide streptomycin resistance (see Kiwaki & Sato; Int J Food Microbiol. 2009 Sep 15;134(3):211-5). Suitably, the present B. Longum transitional strain may have an A residue a position 128 of the rpSL gene. Suitably, the present B. Longum transitional strain does not comprise a G128A mutation in the rpSL gene. An illustrative rpSL gene sequence comprising an A at position 128 is shown as SEQ ID NO: 5. SEQ ID NO: 5 TTGCCTACTATTGAACAGCTCGTCCGTAAGGGACGTCAGGCAAAGCCGAAGAAGTCCAAGACTTTGGCCCTGAAG GGCAGCCCGCTGCGTCGCGGCGTGTGCACCCGTGTCTACACCACCACCCCGAAGAAGCCGAACTCGGCTCTGCGT AAGGTCGCTCGTGTGCGCCTGTCCTCGGGCATCGAAGTCACCGCCTACATTCCGGGCGAGGGCCACAACCTGCAG GAGCACTCCATCGTGCTCGTGCGCGGCGGCCGTGTGAAGGATCTCCCGGGTGTGCGTTACCACATCGTGCGTGGC GCGCTCGATACCCAGGGTGTCAAGGACCGTAAGCAGGGTCGTTCCCTGTATGGAGCAAAGAAGGCGAAGTAA Resistance to chloramphenicol may be afforded by the crmX gene which encodes a ribosomal protection protein. Suitably, the present B. longum transitional strain may lack a crmX gene. Suitably, the present B. longum transitional strain may lack a crmX gene encoding a polypeptide comprising SEQ ID NO: 6 or a variant which shares at least 80% sequence identity to SEQ ID NO: 6. Suitably, the variant may share at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity with SEQ ID NO: 6. SEQ ID NO: 6 MPFALYMLALAVFVMGTSEFMLAGLLPAIATELDVSVGTAGLLTSAFAVGMVVGAPVMAAFARRWPPRLTLIVCL LVFAGSHVIGAMTPVFSLLLITRVLSALANAGFLAVALSTATTLVPANQKGRALSILLSGTTIATVVGVPAGALL STALGWRTTFWAIAILCIPAAVGVIRGVTNNVGRSETSATSPRLRVELSQLATPRLILAMALGALNNGGTFAAFT FLAPIVTETAGLAEAWVSVALVMFGIGSFLGVTIAGRLSDQRPGLVLAVGGPLLLTGWIVLAVVASHPVALIVLV LVQGFLSFGVGSTLITRVLYAASGAPTMGGSYATAALNIGAAAGPVLGALGLATGLGLLAPVWVASVLTAIALVI MLLTRRALTKTAAEAN Glycan Substrate / Carbohydrate-Active Enzymes (CAZymes) The present B. longum transitional strain encodes a specific profile of Carbohydrate-Active Enzymes (CAZymes). Carbohydrate-active enzymes (CAZymes) are responsible for the synthesis and breakdown of glycoconjugates, oligo- and polysaccharides. They typically correspond to 1-5% of the genes in the living organism. Glycoconjugates, oligo- and polysaccharides play essential roles in many biological functions, for example as structure and energy reserve components and in many intra- and intercellular events. The Carbohydrate Active Enzyme (CAZy) classification is a sequence-based family classification system that correlates with the structure and molecular mechanism of CAZymes (www.cazy.org). CAZymes include glycoside hydrolyases (GH), glycosyltransferases (GT), polysaccharide lyases (PL), carbohydrate esterases (CE), and carbohydrate-binding module families (CBM) GHs catalyze the hydrolysis of glycosidic bonds between two or more carbohydrates or between a carbohydrate and a non-carbohydrate moiety. In most cases, the hydrolysis of the glycosidic bond is catalyzed by two amino acid residues of the enzyme: a general acid (proton donor) and a nucleophile/base. Depending on the spatial position of these catalytic residues, hydrolysis occurs via overall retention or overall inversion of the anomeric configuration. A GH classification system is provided by the CAZy classification. Herein, GHs are divided into families based on molecular function (e.g., GH1, GH2, GH3, GH4, etc.). These families are then further divided into subfamilies based on subgroups found within a family that share a more recent ancestor and, typically more uniform in molecular function (e.g., GH13_1, GH13_2, GH13_3, GH13_4, etc.). Suitably, the present B. Longum transitional strain encodes a glycosyl hydrolase family 43_17 (GH43_17) enzyme. GH43_17 comprises both α-L-arabinofuranosidase (EC 3.2.1.55) and endo-β-1,4-xylanase (EC 3.2.1.8) activities, with capacity to breakdown complex carbohydrates like arabinan, arabinogalactan, and arabinoxylan. Suitably, the GH43_17 gene comprises SEQ ID NO: 7 or a sequence with at least 60% sequence identity to SEQ ID NO: 7. Suitably, the GH43_17 gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 7. SEQ ID NO: 7 ATGAAACGAACTGACATCCACCTGCGCGATCCGTTCGTCCTGCCTCACGACGGTGTCTATTACCTGTATGGCACC CGCGCTGATAACGTGTGGGGCGCGATGGATGGTTTTGATTGCTACACCAGCCGCGACCTTGACAATTGGGAGGGT CCGTTCGAGGTGTTCCACAAGCCGGATGAATTCACGGCCGACCGTGCTTACTGGGCGCCCGAATGCTACGAGCGA GACGGTGTATTCCACCTGATTGCCACGCTCGGCGAGCCGGACGGGCGCAAAAGCGTGCACATGCTACGCGCTGAT AGTCCGCTTGATCCGTTCGAATATGTCTGCCGGCTGACCGATCCGAATCAGTCCTGCATTGACGGAACTCTGCAT GGTGAAGGTACCGATATGTGGCTTGTCTACTCGCATTCCTTGGAGGATGTGCCCGCCGGAGACATGGATGCCGTA CGTCTGTCCTCCGACCTGACTCGGACGGTGGGGGAGAGCATGACATTGTTCCAGGCCTCGGATGCGCCGTGGGCG GTGCCGGTGCCGTTCGCGAAAGCGGAATTCGGCATCGACGAGGACGCCTACTTCTCCGATGGTCCCTGCCTGTGC AGGCTTTCCAACGGACGGCTGGCGATGCTGTGGTCGAGCTGGTCGACGGAAGGCGGATATGCAGTCGGCCAGGCC ATCAGCGAATCAGGGTCGATTGCTGGGCCTTGGACGCAATGCCCCGAGCCTCTGCTTAGCCACGGCGGCCACGGC ATGCTGTTCAACGGTCTCGATGGCGTGCTGCGTTACGCGGTCCACTCGCCCAACGACCCCGGCCAGGAACGGCCT ACGTTTTTGTGCGTCGAAGAACAAGACGGGCTGCTGACGATTACGGAATAG Suitably, the GH43_17 gene may encode a protein shown as SEQ ID NO: 8 or a sequence with at least 80% sequence identity to SEQ ID NO: 8. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 8. SEQ ID NO: 8 MKRTDIHLRDPFVLPHDGVYYLYGTRADNVWGAMDGFDCYTSRDLDNWEGPFEVFHKPDEFTADRAYWAPECYER DGVFHLIATLGEPDGRKSVHMLRADSPLDPFEYVCRLTDPNQSCIDGTLHGEGTDMWLVYSHSLEDVPAGDMDAV RLSSDLTRTVGESMTLFQASDAPWAVPVPFAKAEFGIDEDAYFSDGPCLCRLSNGRLAMLWSSWSTEGGYAVGQA ISESGSIAGPWTQCPEPLLSHGGHGMLFNGLDGVLRYAVHSPNDPGQERPTFLCVEEQDGLLTITE Suitably, the present B. Longum transitional strain comprises a glycosyl hydrolase family 43_22 (GH43_22) gene. Suitably, the GH43_22 gene comprises SEQ ID NO: 9 and/or 10, or a sequence with at least 60% sequence identity to SEQ ID NO: 9 or 10. Preferably, the present B. Longum transitional strain comprises a GH43_22 gene with at least 60% sequence identity to SEQ ID NO: 9 and a GH43_22 gene with at least 60% sequence identity to SEQ ID NO: 10. Suitably, the GH43_22 gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 9 or 10. SEQ ID NO: 9 GTGAAGCATTGGAAGAAGATGGCAGCATCGTTGGTTGCAATATCAACGATGATGGCAGTAGTTCCGACGACGTAT GCCATGGAATCGGAAGATTCCCAACCACAGACAACCGATACCGCGACAGTGCAGACTACTAAGGCTGCTGAACCG ACGCTGCTCGCCAGCTGGGACTTCACGGGCAAAAACGGCACCACGAACAGCGCGATTGCCGATTCGACCGGCAAG TACAACCTGACGCTGAAGGACGGCGCCAAGATCGAACAGTACGGTGACCGCAGCACCAACGAGGCGCTCTCACTG CGCGGCGATGGCCAGTACGCCCAGATCGATGACCAGCTGTTCAAGGATGCGGGCGACTCCTTCACTCTGGAGTTC GCGTCCAAGACTCGTCACGACGACAGCGGCAAGTTCTTCTCGTTCATCGTCGGCAAGGACGGCTCGAACGACGCC AACACCACCGATCAGGCCAACGCCAACAAGTACCTGATGTTCTACAACAGCAAGACCGCCATCAAGGGCGTTATC TCAAACAACAACTGGGGTAACGAACAGGGATCCAAGGTCACCGTTTCCGGCAACGACAACAGCTGGGCCGATTAC AAGATTGTCGTGGACGGCACCAACCTTGCCGTGTTCCGCAACAATGCCCTGATTATTTTCAAGGCCAACACCGGC ATCAAGATGAGCGATCTCGGTGCGACCACCGCCTACATCGGCAAGTCGTTCTACTCCGTCGATGAGTACTGGAAT GGTGCAATGGATGATATCAAGGTCTACAGGGGCGCTGACCTGACCATGCCGACCGCCGTTGCGATTTCCGGTACC GGTGTGGTGAACAACAAGCTCACCCTGATTGAGAAGGACTCCACCAAGCTCACCGCCACCGTCACTCCGGACGAC GCCGTGAGCAAGAACGTCACCTGGTCCTCCTCCGATGAGTCCGTGGCCAAGGTCGCCGCAGACGGTACTGTAACC GGCGTCAAGGCTGGTACTGCCACCATCACCGCCACCACTGAGCTGGGTGGTGTGAAGGCCGAACTGCCCGTCACC GTTGAGCCGATGAACGCCCAGAACGCCGCCGCAGCCGACCTCGATGCCGCGATTGCTGCGCTGAAAGTTCCGGCG GCCGAGAATCTGCCGCTAGTCGCCAAGGGCACCAAGAACGGCTCGGCGATTACGTGGAAGTCCTCGGACGAGAAG CTCATTACGTCCACTAACGAGAAGTACGAAAACAAGACCACTGGTGCCGATGACCCGTATCGTGGTGCTGGCATC ATCAATCGTCCGGCCTACGGCGACGGTGATTCCAAGCCGGTTACGCTGACCGCCACCGCTTCCTACAACGGCGGT GAGAAGGTCACCAAGACCATCGAGGTCACTGTCAAGGAGAAGACCCGCATCGCGCCTGACACCGGCTATGCGGCC GTCACTTTTGAGAGCGACAGCAACGGTGGAGAAAAGGCCTGGGTGGCTTCCACTGAGAAGAACGATTTCTTCACG TTTAAGACTCGCAACAATGGCCAGGCGGTACTTACCAATGATGCAGACACGGGTGGCTTGCGTGACATGTTCGTG CTGCGTTCCCACGAAGGCGACAAGTACTACCTGATTGCCACTGATCTCAAGGTCTCGTCAATGGGCTGGAGCCAG AACCAGGTTAACGGTTCTCGGAAAGTTGAGGTCTACGAGTCCACCGATATGATGAACTGGACCCGTACCAACGGC GACGGCAACGGCGGCATCACCATCAACACGCCGAACGCCGGTATGACCTGGGCGCCGGAAGCTTACTGGGATGAT GACCTGAACGCTTACGTGGTGTTCTTCTCTTCCCGCATGTTCACTGATGACACCCGTACCACTCCGGTCAAGAAC GACAAAACCGGCAATAGCTCCTATGCTCAGGTGCGTTACGCCATCACCCGCGACTTCGTGAACTTCACCGAGCCG CAGATGTGGCAGGACACCGGCTACTCGCGCATTGATTCCACCGTGCGTAAGATCGGTGGCTACTACTACCGATTC ACCAAGAATGAGCAGGGCGGTGCCGCTGGCGATTACATCACCACTGGTAAGAGCATCTTCCTTGAGCGTTCCAAG GTGCTGACTGCACCGACCACCGAGGCATCTCCGGGTCAGGACCCGAACACCGGTTGGCAGTGCTCGAGCAGGCGT TGCTGCCGTTCGAAGGACCAGAGACCATCAAGCTCAACAAGGATGACGAACTCAACACGAAGGACGACGACGGCT ACATTCTGCTGTCCGACAACTTCGCCTACCGTGCATTTATGACCACGGGTGCCGAGCTTTCCAAGACCACGTGGG ACAACCCGATGACCAAGCGTTACCCGGACTTCAACAACGAAAAGAAGCCGGTCAAAGCCGAGCCGGGCGCTCAGG GCTACATCACTCAGGGTGCTAACGGCGGTCTGCCGGACAAGGTGCGTCACGGTGCGTTCGTGAACGTGCCTGAGT CTGTGCTCAAGGTGACGAAGTCCTGGACCGCTGCCAACCCGACGCACATCGAGGCTGTTGACTCCACCACCAAGG CCGTGTACAACGCCGGCACCCGCGAGCTCACCGCCACGGTGACCGCCGCCGATAAGGGCACGCTCGCCGGTTCGG TGAAGTTCTCTGCTGGCGACTGGTCCAAGACCGTGAAGCTCGACGCCGAAGGCAAGGCCACTGTGACCCTCCCGG CCAGCGTCTCTGGCACTGTTGCGGTTGCTTACGACGGCTACACCGATGGTTTGGTCAATCCATCCGATACTACGG TTGACGGCATTGAACAGGGCAAGGTCGATTTGGCTGAGCTCAACAAGCAGATCGCTGCCGCCGAAGCGCTCAAGG AATCCGACTACACGGCCGATTCCTGGGCCAAGCTTGCCGCCGCGCTGAAGACTGCCAAGGCCGCGCTCGCCGCTG AGAATCAGGGCGAGGTCGATACCGCCGCAGCCGACCTTAAGACCGCAATCGAAGCCCTGCAGAAGGCTCCGACCA ATCCGGGCGAAGGTGACGGAGATAAGGGCGACGGCAATAAGCCGACTACCCCGACCACCGGCGACAAGACCAACG TCAACAAGCCCGGCAGCGCGCTGAGCAATACCGGTACGGCCGTGCTCGGCCTGGGTGGTGCCGTGGTAGTACTCG CCATCGCCGGCATCTCCCTAACCCTCTGGCGCAAGCGTCGCGCCTGA SEQ ID NO: 10 ATGGGAAAGCTGATACGAAAGGCAACCGGACTCACGGTCGGCGTGGCAACACTGCTCGCTGGTCTGGTGCTGCCG ATGACGGCCAGTGCCGAGAGCGCATCGCCAATCGATGCCAGTCCGATCATCCACTATTCATTCGATAACGCACTG ACGTCCAAGACCATCGCCAACGAGGGCAGCGCGGCCAACAGCGATGCCACCCTATCCGGCGACGCCACGGTGGCC AATGGCCAGATCAACCTGACCGGCTCGCAAACCATTAGCGTGCCGACCACGGCCATCGCCGGTAAGAAGGACGTC ACCGTCTCCATCTGGCTCAAGAACAATTACGGCAACGGCAATACCGCCGCCGCGTACATCGGCGCGGCCAAGACC GGCAATTATCCGGCCAACGGTTACTGGCTGCTCAACCCGGCCAACCCGAGTGGCTACGCGAAATCCGTAATGACC AATGCCACTGCGGCCGACCCGAATAACAGCCCGTGGGGCACCGAAGTCGGCCCTGGATCGACGAACGCCGCCATC ACCGGCACCAAGGCCACCAGCGATTTGGCTCTGTACACCACCGTCATCAACGGCACCAACAGCACTATGAGCTTC TACCTCAACGGCAAGCAGGTTGGAGACGCCACCTACGCCATTCCGGCCGGTGGCCTGACCAATTACGGCGATCTC GTCGCCTACATTGGCAAGTCCTCCTACGCTGACCCGAACTCCAAGCTCGACGTGGACGATTACGCCGTATACGAC ACTGCCATCAGCGCCGCAGACGTGACCAAGCTGTATGACGTTCAGGTGCTCGACAAGGCCGAGGCCGCTGTCAAG GCCGCTGTGCCCGCATCCGCTACCGAGGACTTCACCCTGCCGACCAGCGCCGCTGGTGTGAGCGTCGCGTGGAAG TCGGACAACGCAGCCATCGCCGTTGACAACGCCACCGGCAAGGCCACGGTCACTCGTCCGGCCGCAACCGCAGCT GATGCCGAGGTGACCCTCACCGTCACGTTCGGCAACAACGCCAAAACCGCCGCCTACACGGTCCTCGTGCCGAAG CAGCTCTCCGATGCCGAGCAAGCCAAGGCCGACCTTGACGCCATCACCATCGAGGACTCCGACGACATCCGTAGC AACTTCTCCGTGCCCACCAAGGGCAACAATGGTTCGACCATCTCGTGGGGAGTGACCGGTGGCAAGGATATCGCC ACACTAGGCGAAGGCGTGAGCGACAAATCTCGAACGGTCACTGTTAAGCGCCCTGCCGCCGGTAGCGATGCCGCC ACTGTGACGCTCAAAGCCACTGCCAAGTACGATACCGCCACTGAAACTAAGACCTTCACCGTCACCATTCAGCCG ATGCCTGCCGCCGAAGAGAAGGACGAGGCCTACGTGTGGGCGTTCTTCACCGGCGAGGGCGTGGGCGGCGAGAAA ATCAGCCTCGCGGCCTCCAAGGGCAACGATGCGCTCGACTGGAACACGCTGAACAACGGCACGCCGATATTCACT TCCGAGTTTGGCGAGAAGGGTTTGCGCGATCCGTTCATCATGAAGTCCAAGGACGGCGACAAGTTCTACATGCTC GCCACCGATCTGAAGATTGACGGTCGTGCCCCCCTCAACGGGCTGAATGGCTTTGCTGGTGCACAGGCTAACGGT TCCAAGTACATTGAGATCTGGAAGTCCGACGATCTGGTCAACTGGTCCAAGCAAAGCCACGTCAAAGTGAGCTCT GATTACGCAGGCAACACTTGGGCGCCTGAGGCCTACTACGACGAGGAAATCGGCAAGTACGTGGTCTATTGGGCC TCGAACCTGTACGACAACACCGACGAGAACAGCCGCAAGCAGCTGACCTACAACCGCATGGTGTACGTCACCACC GATGACTTCGTCAACTTCTCCGACCCGACAGTGTGGATTGACGTTGATCGCCGAGGCGGTGCAGGCAGTGGATCC ATCGATGTGACCGTGCAAAAGGTAGGGGATACCTACTACCGCATCTACAAAGATGAAAACACGATGTCTTTGCGT CAGGAGAAGTCCACAGATTTGACTGCCGCAATTGGTGGTGCCGGCGTGAAGAACTACGCCGATGCGCTTAAGGGT AGTGCATGGAGCGAAGTTGCCACGAACATCGGTAAAGGCCAGGCTAACGGTTACGGTAAAACCTTCACTTCCGGC GAAGGTCCATCGCTATTCAAGGCCAACGATGGCGATGTGAACGGCTACCAGTACTACCTGTTCGCCGACCAGCCG AGCTATCATCAAGGTCCAAACCACTATGTGCCGATGGCGACTGAGGATATCGCCAGCGGTCAGTGGACCGTTATC GGCAATAAGATGCCTGAGGCGAACTTCCCGACCAACTCCGATGGCGGCAAGCCGCGCCACGGAACCGTGCTGCCC GTGACCCGCGCCCAGTACCAGAAGGTGCTGGAGGCATACGCCCCGGCTGTGGCTGTGAAGTCCGTTGACGCGCTG TCTGCCGAGACAACGGTTGGTGTGGCTCCGACGCTGCCGGAGACCGCGCATCTGACTCATGCGGACGGTTCCGTT TCTGACGTTGCAGTTGAGTGGGATGCCATTGACGCATCTTTCTACGCCAAGACCGGCACCTTCACCGTCAAGGGC ATCACCCAAGACGATTCCCGTATGCCGGTTGAGGCTACCGTCATTGTGAACGGCATCGACCTCTCCAAGGCGACC GTCACCGTCGAACCCAACGAGTTCACCGCAGACGGCGCTGCCAAGGAACCAGCCGTGACCGTTGTACTCGATGGC GCGACGCTCAAGGAAGGCGCCGACTATACGGTGGCCTATACGAACAACGTCGAACCTGGCACTGCCACAGTGACC GTAACCGGCGCTGGCAAGTACTCCGGTACTGTCTCGGCAACGTTCACCATCAAGGCCGCCGAGCCCGGCTCCACG CTGGACAAGTCCAAGTTGCAGGCGCTTGTCGATAAGGTGAAGGGCTATAACAAGGCTGATTACCAGTCTGGTTGG GATGCTTTCGCCGTCGCGCTCGCCGACGCGCAGCAGGTGTTGCAGAACTCCACCGACCAGCAGGAAGTGGACAAG GCGTTGTCTCGGCTCCAGTCCGCCGTCGACAAGCTGGTCAAGAAGTCCGGCGATTCCGGCAAGACCGATGGCAAG GATGACGGCACGCAAAAGCCCGCCGCCAAGCCGGGCAGCGCTCTGTCCAACACCGGCGCCTCGGTGTTCGGTGTG GGTATCACCGCGGTCATACTGCTCGCCGCCGCCGGCGCCGCCTACGCCTTCCGCAAGCGCCGCGCCTGA Suitably, the GH43_22 gene may encode a protein shown as SEQ ID NO: 11 or 12, or a sequence with at least 80% sequence identity to SEQ ID NO: 11 or 12. Preferably, the B. Longum transitional strain comprises a GH43_22 gene encoding a protein shown as SEQ ID NO: 11 or a sequence with at least 80% sequence identity to SEQ ID NO: 11m and a GH43_22 gene encoding a protein shown as SEQ ID NO: 12, or a sequence with at least 80% sequence identity to SEQ ID NO: 12. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 11 or 12 SEQ ID NO: 11 MKHWKKMAASLVAISTMMAVVPTTYAMESEDSQPQTTDTATVQTTKAAEPTLLASWDFTGKNGTTNSAIADSTGK YNLTLKDGAKIEQYGDRSTNEALSLRGDGQYAQIDDQLFKDAGDSFTLEFASKTRHDDSGKFFSFIVGKDGSNDA NTTDQANANKYLMFYNSKTAIKGVISNNNWGNEQGSKVTVSGNDNSWADYKIVVDGTNLAVFRNNALIIFKANTG IKMSDLGATTAYIGKSFYSVDEYWNGAMDDIKVYRGADLTMPTAVAISGTGVVNNKLTLIEKDSTKLTATVTPDD AVSKNVTWSSSDESVAKVAADGTVTGVKAGTATITATTELGGVKAELPVTVEPMNAQNAAAADLDAAIAALKVPA AENLPLVAKGTKNGSAITWKSSDEKLITSTNEKYENKTTGADDPYRGAGIINRPAYGDGDSKPVTLTATASYNGG EKVTKTIEVTVKEKTRIAPDTGYAAVTFESDSNGGEKAWVASTEKNDFFTFKTRNNGQAVLTNDADTGGLRDMFV LRSHEGDKYYLIATDLKVSSMGWSQNQVNGSRKVEVYESTDMMNWTRTNGDGNGGITINTPNAGMTWAPEAYWDD DLNAYVVFFSSRMFTDDTRTTPVKNDKTGNSSYAQVRYAITRDFVNFTEPQMWQDTGYSRIDSTVRKIGGYYYRF TKNEQGGAAGDYITTGKSIFLERSKVLTAPTTEASPGQDPNTGWQLLEQALLPFEGPETIKLNKDDELNTKDDDG YILLSDNFAYRAFMTTGAELSKTTWDNPMTKRYPDFNNEKKPVKAEPGAQGYITQGANGGLPDKVRHGAFVNVPE SVLKVTKSWTAANPTHIEAVDSTTKAVYNAGTRELTATVTAADKGTLAGSVKFSAGDWSKTVKLDAEGKATVTLP ASVSGTVAVAYDGYTDGLVNPSDTTVDGIEQGKVDLAELNKQIAAAEALKESDYTADSWAKLAAALKTAKAALAA ENQGEVDTAAADLKTAIEALQKAPTNPGEGDGDKGDGNKPTTPTTGDKTNVNKPGSALSNTGTAVLGLGGAVVVL AIAGISLTLWRKRRA SEQ ID NO: 12 MGKLIRKATGLTVGVATLLAGLVLPMTASAESASPIDASPIIHYSFDNALTSKTIANEGSAANSDATLSGDATVA NGQINLTGSQTISVPTTAIAGKKDVTVSIWLKNNYGNGNTAAAYIGAAKTGNYPANGYWLLNPANPSGYAKSVMT NATAADPNNSPWGTEVGPGSTNAAITGTKATSDLALYTTVINGTNSTMSFYLNGKQVGDATYAIPAGGLTNYGDL VAYIGKSSYADPNSKLDVDDYAVYDTAISAADVTKLYDVQVLDKAEAAVKAAVPASATEDFTLPTSAAGVSVAWK SDNAAIAVDNATGKATVTRPAATAADAEVTLTVTFGNNAKTAAYTVLVPKQLSDAEQAKADLDAITIEDSDDIRS NFSVPTKGNNGSTISWGVTGGKDIATLGEGVSDKSRTVTVKRPAAGSDAATVTLKATAKYDTATETKTFTVTIQP MPAAEEKDEAYVWAFFTGEGVGGEKISLAASKGNDALDWNTLNNGTPIFTSEFGEKGLRDPFIMKSKDGDKFYML ATDLKIDGRAPLNGLNGFAGAQANGSKYIEIWKSDDLVNWSKQSHVKVSSDYAGNTWAPEAYYDEEIGKYVVYWA SNLYDNTDENSRKQLTYNRMVYVTTDDFVNFSDPTVWIDVDRRGGAGSGSIDVTVQKVGDTYYRIYKDENTMSLR QEKSTDLTAAIGGAGVKNYADALKGSAWSEVATNIGKGQANGYGKTFTSGEGPSLFKANDGDVNGYQYYLFADQP SYHQGPNHYVPMATEDIASGQWTVIGNKMPEANFPTNSDGGKPRHGTVLPVTRAQYQKVLEAYAPAVAVKSVDAL SAETTVGVAPTLPETAHLTHADGSVSDVAVEWDAIDASFYAKTGTFTVKGITQDDSRMPVEATVIVNGIDLSKAT VTVEPNEFTADGAAKEPAVTVVLDGATLKEGADYTVAYTNNVEPGTATVTVTGAGKYSGTVSATFTIKAAEPGST LDKSKLQALVDKVKGYNKADYQSGWDAFAVALADAQQVLQNSTDQQEVDKALSRLQSAVDKLVKKSGDSGKTDGK DDGTQKPAAKPGSALSNTGASVFGVGITAVILLAAAGAAYAFRKRRA Suitably, the present B. Longum transitional strain comprises a glycosyl hydrolase family 43_27 (GH43_27) gene. Suitably, the GH43_27 gene comprises SEQ ID NO: 13 or a sequence with at least 60% sequence identity to SEQ ID NO: 13. Suitably, the GH43_27 gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 13. SEQ ID NO: 13 ATGACAACCAAACCATCGATAGGCAAACGCCTGCTCGGCGCGATGCTGGCAGTGCCGATGGCGCTCGCCGGCATG GGAATCGGCGCGACCACGGCGGTCGCGGCCGATACCGTTCCGACCAATAATCTCATCGCCGCCTACGACTTCACC ACGAAGCCAAGTGACGGCAAGACCGTGGCCAACAGTGCGCCGAACGCTACGCTTGGCGCGGCCGAAGTACAGAAC TCCGCCGACTCGCTTTGGGCCGATGATGCCCTCACCCTTTCCGGCGGTGCCAAGACCGGCACCGGCGACTGGGTC AAGCTGCCCTCGAATCTGCTGTCCGGCAAGGACGCCGCCACGGTGCAGTTGGAGGTCAAAGCGGATTCCAGCATG CTCAATGCTTTCCATTTCCTGTGGAACATCGGTAACGACAGCTCCGATACGGAGTATTTCTTCGCCACGCTCAAC TGCGGCAGTTCGCGTAACCCGCTCGTCGGCCTGAAATCGGGCGGTACGGAGACGCTCGTGCAGTCCAGCTCCTGC GTGGCCAAGGCCGACCAATGGTTGTCGGTGACCGCCACCATTGATGGCACCGCCGCGAAACTGTACATCGACGGC ACGCAGGTGGCATCCGGCACCGTGCCGGCCAAACTGTCCAGCGTCAAGGACCAGTCGCTCAACACCATCGGCCGT TCGCCGTGGCCCGACAACCTGTTCAAGGGCGCGGTCTCGAACTTCCGCGTATACGATGCCGCGCTCACCGCCGAT CAGGTCGCCGCGATCAGCACTGCCGATGCCTCAATTCATGCCGGTGAACTCACCGGTTCCGTGCTGAACGGCATC ATCATCCCCACGACGGTCGACGATCCGTTCATTTCGCTGCCCACTGCGAACGGCGTGACGTGGGCGTCCTCCGAT AGCAGCGTCATCGCGACTGACGGCACGGTCAACCAGCCCGCCAAGGGCGAGGCAGCCAAGACTGTCACGCTGACC GCCGCCGTCACGATCCGTGGCCAGACCGCTACGAAGGAATTCACGGTCACAGTCAACCCGACCACGAAAACTGCC GCTGAACAGCTCAAGGAAGCCGCGGCCGGCTACGTGATCCCGTCCGTCGTGCGTTCCGGAGACGCCCTCCCGGCG GCTGTGAATGGCACTACCGTCACGGTTACGTCCACTAAGGACGTAGCCGTCGAGGATGGCAAGATCACCATCGAT GGCGACGAGGCCACGACCGGTACCATCACCGTCGAGTTCTCCAAGAACGGTCTCGCCGGCATCGAGCCCATTACC AAGGTCTTCACCGTAAAGGTGCTGCCCGCCGCGAAGTCCGCGACCATCGCCGCCTATGATTGCAACGCCACCAGC GCCGACGAGGCCAACAACGGCGACATCGCCTACAGCATGCACCTCGCGTTGCAGAACGCTGACGGTTCGTACACC CCGTACAACGAGAATTACGGTATCTTCTTCGCACGTTCGCCGAAGGCGCAGAATCTCAACGAGAACCTCGACGGC AATGATTACCGCAGTCTCAAGGATCCGAGCCTGCTCCGCATGGCCGACGGCACCTATGGCGTGATTTCCGTGCGT ACCAACCGCGGCACCGCCACCGGTGACTCCACCGCGAAGTCCAGCGTGCTCATCGCCACCTCCGAAGACCTGCTC ACCTATAGCGAACAGGAGAACTCCGGTTCCATCGTCGACCTTGGCGAGACCAACGGCGTCAACGCTCCGTACGCC GTGTACGACACCGCCAGCAAGCAGTATGTTGTCGGCTGGGCCGATGACAACGGCGTGGCCAAGTACACCACGTTC GATTCGCTCAAGGGCTCCGCGTCCAAGCATGGCAGCGTACTGTACGGTTCCATCGCCAAGTCCGGCGTACTCGAT GCCGACGGCGTGCAGGGCATCGCGAACTTCCGCTCCGGTGCCACCATCGCGGTGGACGAGGCGACCGTCAAGGCG CTCAACACCCGTTACGGCCGCTCTGAGAACACCGGCACGAGCAATCTCACTGACATCACCGTCGAGAAAGGTTCC TCGATTGATGAGATGACCTCGCAGCTGCCGAAGAACGTGGACCTCACTTACTCCGACGGTTCTACCGGCTCCCTG CCGATTTCCTCATGGAACACTGAGGGTATAGATCTGACGAAGGTGGGTGATTACACTGTCACCGGCACCGTCAAG CAGACCGAATACCAGATTCCGTTCGCCGAGGACCGCGCCGATCCATCGGTGTATAAGTGGCAGTGGACGCATGAG GTCGACGGCAAGGAAGTCACCGAAACCAAGTTCCTGATGATCGCTTCCAACGACATCCAAGGTGATGTCACTTGG CAGCATGGTTCGCCCCACATGCCGTTCCGCATGGCCGACACGATTTCCGGTCTCGCCGACGAGCCGGGCAACCCG AATGCCCTGATTCAGTCGAACGGCTACAACAACAAGGAGGTGTCGCTGCTCAAGGCTGGCGACAAGGACTCCGAG GGTAATGCCATCATGCACAGCTTCTGGGCTCCAGAAATTCATGAGATTGATGGTAGGCTCACGATTCTGTTCATG GCCGGATACGGCAACACATGGTCCAACGGCAAGTCGGTGTACATGCAGCTCAAGCAGGATGCCGACGGTCATGAC CTCGACCCGACCGACCCCGATAACTGGACTGTGCCGACACCGATCTACCGCAATGACGCCTCGCTGCTCAACGGT AACAAGCAGCTCGCAGCCACAGCGTCCGGCGGAGTGGGCATGTCGCTCGACATGACCTATTTCCAGGATGCCGAC GGCAGGTCCTACTACGCCTGGCAGCAGCTCGGCGCCACCTACATCGCCACGATGGATCCGAAGGACCCGGCCCAT GTGACCAGCTCCCCGGTGCGCATCGTCACCCCGGAGTATGCGTGGAACGCCGCCATAGCCGAAGGTCCGAACGTG ACCCTGCGCGACGGCAAGCTGTACCTCATGTTCTCCGGTTCCGGCGTGGGTAAGACATACACCACTGGGCTGGCC GTAGCGGATGCCTCCGGTACTGACCTGACCGACCCGGCCAGTTGGACGGTGCTCAACTACCCGATTCAGAAGTCC GGTCCGTTCAACGGTGAGATGCAGCTCGGCACCGGTCACGGCATGTGGAGCGAGGACGAAGATGGCAACCAGATC TACGTGTTCCACGCCTATGCCACGAAGAATCTCGGATCCGTGAATGCTGCCGGCCGCGACATGTTCGTGCGCCGT GTGCACTGGGCCGCCGACGGCATGCCGGTGTTCGACATGAGCTCTTCCGAGGAGCTGGCGAACAAGATCGTTTCC GTTACGGTGCATGTGGTTGACGATGCGGTTGCGGTCGATAAGTCTGGTTTGTCCAAGGCGCTTGCGTCCGCCAAG CAGCTGCACGGGTCCGACTACACCGCCGCCTCGTGGAAGGCGTTTGCCACGATGCTGGCCTCCGCTGAGAAGGTC TATGCCGACGATACTGCTACGCAGAAGGACGTCGATGACACGACCGTCGCGTTGGTCAAGGCGCAGGCTGCGTTA GTGAAGATTGATGGTTCCGATTCAGGCGATGGCTCGGGCGATTCGACTAAGCCGAGCGACGGTTCGAGCGTCGAT GCGGGAGATAAGACGTGCAACAATCTTGGTTTGTCCAAGACCGGTGCGGCTGTGCTTAGTCTTAGCGGCGTAGCC GTGGCGCTTGCTGTCGCCGGTATCGCTCTGACTCTCCAGCGCAAGCGTCGCGCCTGA Suitably, the GH43_27 gene may encode a protein shown as SEQ ID NO: 14 or a sequence with at least 80% sequence identity to SEQ ID NO: 14. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 14. SEQ ID NO: 14 MTTKPSIGKRLLGAMLAVPMALAGMGIGATTAVAADTVPTNNLIAAYDFTTKPSDGKTVANSAPNATLGAAEVQN SADSLWADDALTLSGGAKTGTGDWVKLPSNLLSGKDAATVQLEVKADSSMLNAFHFLWNIGNDSSDTEYFFATLN CGSSRNPLVGLKSGGTETLVQSSSCVAKADQWLSVTATIDGTAAKLYIDGTQVASGTVPAKLSSVKDQSLNTIGR SPWPDNLFKGAVSNFRVYDAALTADQVAAISTADASIHAGELTGSVLNGIIIPTTVDDPFISLPTANGVTWASSD SSVIATDGTVNQPAKGEAAKTVTLTAAVTIRGQTATKEFTVTVNPTTKTAAEQLKEAAAGYVIPSVVRSGDALPA AVNGTTVTVTSTKDVAVEDGKITIDGDEATTGTITVEFSKNGLAGIEPITKVFTVKVLPAAKSATIAAYDCNATS ADEANNGDIAYSMHLALQNADGSYTPYNENYGIFFARSPKAQNLNENLDGNDYRSLKDPSLLRMADGTYGVISVR TNRGTATGDSTAKSSVLIATSEDLLTYSEQENSGSIVDLGETNGVNAPYAVYDTASKQYVVGWADDNGVAKYTTF DSLKGSASKHGSVLYGSIAKSGVLDADGVQGIANFRSGATIAVDEATVKALNTRYGRSENTGTSNLTDITVEKGS SIDEMTSQLPKNVDLTYSDGSTGSLPISSWNTEGIDLTKVGDYTVTGTVKQTEYQIPFAEDRADPSVYKWQWTHE VDGKEVTETKFLMIASNDIQGDVTWQHGSPHMPFRMADTISGLADEPGNPNALIQSNGYNNKEVSLLKAGDKDSE GNAIMHSFWAPEIHEIDGRLTILFMAGYGNTWSNGKSVYMQLKQDADGHDLDPTDPDNWTVPTPIYRNDASLLNG NKQLAATASGGVGMSLDMTYFQDADGRSYYAWQQLGATYIATMDPKDPAHVTSSPVRIVTPEYAWNAAIAEGPNV TLRDGKLYLMFSGSGVGKTYTTGLAVADASGTDLTDPASWTVLNYPIQKSGPFNGEMQLGTGHGMWSEDEDGNQI YVFHAYATKNLGSVNAAGRDMFVRRVHWAADGMPVFDMSSSEELANKIVSVTVHVVDDAVAVDKSGLSKALASAK QLHGSDYTAASWKAFATMLASAEKVYADDTATQKDVDDTTVALVKAQAALVKIDGSDSGDGSGDSTKPSDGSSVD AGDKTCNNLGLSKTGAAVLSLSGVAVALAVAGIALTLQRKRRA Suitably, the present B. Longum transitional strain comprises a glycosyl hydrolase family 43_29 (GH43_29) gene. Suitably, the GH43_29 gene comprises SEQ ID NO: 15 or a sequence with at least 60% sequence identity to SEQ ID NO: 15. Suitably, the GH43_29 gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 15. SEQ ID NO: 15 ATGAGTTTCCATGTATCCGCGCAATCGGTTCGCGCGGTGGCCGGTGGACTCGTCGCCGCAGCGACATTGCTGTCA GGCCTTGCCCTTGCGCCGACCGCAATGGCCGCCGATTCAGCCACCGCTGACAACGCGCCCAGCGTTGCCGGTCAC GCGTATAACGAACTGCCGTATAACAATCCTGATGTCACCGTCACCCAAATCGACAATAGCGCACTGCCCAGCTAC ATGCGCAACCCCATCGGGCAGAACGAGGGTATTGACACCCCGAACGATCTTTCGCAGAACTACTACTCTGCAGAT GCATCCGCGCTGAGCTATGACGGCAAACTCTTCGTCTTCACCGGTCACGATGAGGCTTCGCCCGACTACGGCTCC TTCAACATGAAGGACTGGGGCGTATACGTCACCGATGAAGACGGCCTGAATCAAGGCAAATGGACACATTACAAG ACCATCGCCAAGGCAGACCTGTTCAGCTGGGCCACCGGCGATGGCGCGTACGCCGGCCAAGTCGTAGCCGACGAT AACGGCACCCCGAGCGACACTTCCGATGATTGGTTCTACTACTACGTGCCGGTGAAGGACAAGGCTTCTGAGGCG GCTGGACAGGACCCGTTCGCCATCGGCGTGGCCAAGTCGAAGAGTCCGCTCGGCCCGTGGAAGGATACCATCGGC AAGCCGCTGCTCACCACATCGCAAACCCAGATTGAAACCATCGATCCGGCATTCTTTGTGGACGAGGATGGCACC GGATATTTGCACTTTGGTACGTTCGGCACTCAGCTCGCCATCAAGATGAAGAAGGACGCCACAACCGGCCGCACC TCATACACCGAGGTGGAAACCAAGGCTGATGGCACCACGCCGAACCTCCACACCATGAAGGACGCGGACAGCAAC GCGAACGGCCCGAAGGGATTCTTCGAGGCGGCGTGGGTGTTCCGTAAGGGCGATACCTATTACAACGTGTACGAC GGCGGTAAGCCCGGTTCGGGCACGGCCACCTGCGTGGAATCGAACTATCAAGCTTGCATCCAGTACTCCACTTCC GACAGCCCGCTCGGCCCATGGAAGTACCAAGGCGTAATCGTGCCTTCTGGCTCGGCCACCACGATGCACCCCTCG GTGCTCCAGTTCGGCGACAAATGGTATGTGACCTATCACACCGGCGACAAGGAAGGCGGCACCGATTTCCGCCGT GCCGTGTGCATTGATGAAGTCGATTGGACCGCCGACGGCCAGATGGTTTCCACCGCCCATCCAACCAAGGCCGAG AAAACGCAGCCCTCCACCAACGTGGCTCCGTACGCAAAGGTGAGCGCCACGTTCACTGAAACGCCTGCTTGGAAG GGTTCGGTGAACGACGGCCGTGTGTTGCAAACCGCTGTGGTCCCGCCGAATCACTGGACCAACTACCGTTCTATC CCGCAATCGCAGTCCGGCGATTCTCTGGTCTACCAATGGGATGGCACTGTGCGCGTCAACTCGTCTAAGGTTTGG TTCGACGTGGATTCCAACGCTCTGCGCGCGCCCGCCTCGTGGAAGATTCAGTACTTGGACGCGGACGGCACATGG AAGGATGTCATCAACCCGAGTGCCTATACAACGACCACAGGCAAGGCCAACCCCAACGCCGTCACCTTCGATGCG GTGACCACTACTGCCTTAAAGCTCGACATGACCGGTCAAGCTGTGGATGGCGGCTATGCCTCCGTGGCCGTTGCT GAATGGGAAGTCGGCTCCGACTCCAGCGAATCGCCGGCAATCACTGCGCCGAAGAGCGTGACCACCGCCACCGGT ACTGCGCCTACTCTGCCGGCCACAGTGGATGTGAAGTACGGGAACCCAACCGTTGCCTCCCCAGTAATTTGGCGT CCAGTTGATGCTTCCTCGTATGCCAAGGTCGGTTCGTTTACGGCCTACGGCGTGGTCGCCGGCGTGCCCGGTGAG GCAAGCGAGCAGGGCAATGTGTCGGTAAATGTCACCGTGCAGGACGGCTACCAGCCTGCCGCTGATACCACGAAG CCGACTGTAACCGTTGCCGTTACTGCTAACGCAGGCAATAGCGAGTGGCTCACCACCGCTCCGTTCGCCACCGTG CAGGCCACGGACGACACCGCACCTATCGCCAAGCTGGAGATTTCCGCTGATCAAGGCAAGAGCTGGACCACCATC GCCGCGAATGCAAACGCGGCCATTGCCACGCTTTCCCAGCAGGGCGATGTCGAAGTGTGGGCTCGCGCCACCGAT CAGGCCGGCAACGTTTCCGACGTGGCCAAGGCCGGCGGCAAGGTGGACTCCGCCGCGCCAACCGTGACCGCCGCC GCCGATAAGGAGGAGCGCACGCTGACCTTGACCGCTGATGACGGCACCGGTTCCGGTGTCGCATCAATTGAATAC CGCATTGGCACAGACGGTCAATGGGCCACGTACAGCAAGCCGATTGCTGCACCGAGCGCGTCGCGCGCCACCGTG TACTACCGCGCCACCGATAAGGCCGGCAACGTGTCCGCTTCGGCGAAAACCGACATTCCATCCGACACTTCCGTG CCGCTGACCGGCTACATTGAGGGCGATGCCACCGCCACCGATGTGGACGGCAAGGCATCCGGCTGGGTCAAGGGT GCCGCCGCGTTGAACGACGGCAAGATCATTCCCGATATCACCATTGCCAACGAGGATGTCTGGGGCACTTGGCCC AACACCGGTGAGATGCGCCTCGACTACGAGTGGGACCGTGAAGTGACTATCGACTCTAGCCGCGTGCAATTCACC TCGGATGATGGCGGATTGGGTATTCCGGCATCGTGGGAATTGCAGTACTGGGACGCCTTGGCGAACAACGGTGCC GGCAACTTCGTGGATATTCCCGACGCCACCTACACTGTGACCGCCAATTCACCGTCTGCTGGCTGGGCCACCGGC GATGCCAAGGGGTGGTCTGATGGCACGTGGAACACTCCGGTCAAGACTACCAAGTTGCGTATGGTTATCACGTCC GGCTCGGCTTCTCCGGCTGTTGCCGAATGGCAGGTTCATGCCATTGACGACAGTACGCCTGAGCCGCCTGAGCCC ACACCGATCGACAAGACCGAGCTCAAGCAGGCGCTCGCTGACTCGCCTAAGGCTGACGATGCCTCCAAGTACACC GAGACTTCATGGGCGGAGTACGCGGCGGTATTGGATTCGGCGCAGCAGGTGTATAAGGCTGAGGATGCCACCGAA GCTGCGGTGGTGGATGCCGCAACCCAGCTGAAGCAGGCAGCGAAGAAGCTGGTGCTTGTAGCTACGGTGCAAGAT CGTGCCGCGCTGAGCGCTCAGCTCGATGCCGCTGCTGCCGTGGATCGCACAAAGTGGACTGATGAATCGCTGGCC GTGCTTGATTCGGCAGTCGCTACGGCGAATGCGCTGACGAGTGATGGTCAGGCCGCCCAGTCTGACGTACAGGCT GCGACTGAGGCAATCAGCGATGCCATCGCGGGTCTGGTTGAGAAGAGCACCACGAAGCCTGGCCAGGGTGGCGAT AAGCCCGGTTCCGGCACGGACAAGCCCAACCAAGGCAACGATTCCAACCAGAACAAGGGTGATGCAGACTCCGGC AAGCACAAGAAGATACCTGACACCGGTGCAGCCGTGCTTGGTGTTGGCATCCTCGCCGTGGTACTTGCTGTTGCG GGTGTAATCATCCTCAAGCGCCGCAAGTCCGGTACCTGCTAG Suitably, the GH43_29 gene may encode a protein shown as SEQ ID NO: 16 or a sequence with at least 80% sequence identity to SEQ ID NO: 16. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 16. SEQ ID NO: 16 MSFHVSAQSVRAVAGGLVAAATLLSGLALAPTAMAADSATADNAPSVAGHAYNELPYNNPDVTVTQIDNSALPSY MRNPIGQNEGIDTPNDLSQNYYSADASALSYDGKLFVFTGHDEASPDYGSFNMKDWGVYVTDEDGLNQGKWTHYK TIAKADLFSWATGDGAYAGQVVADDNGTPSDTSDDWFYYYVPVKDKASEAAGQDPFAIGVAKSKSPLGPWKDTIG KPLLTTSQTQIETIDPAFFVDEDGTGYLHFGTFGTQLAIKMKKDATTGRTSYTEVETKADGTTPNLHTMKDADSN ANGPKGFFEAAWVFRKGDTYYNVYDGGKPGSGTATCVESNYQACIQYSTSDSPLGPWKYQGVIVPSGSATTMHPS VLQFGDKWYVTYHTGDKEGGTDFRRAVCIDEVDWTADGQMVSTAHPTKAEKTQPSTNVAPYAKVSATFTETPAWK GSVNDGRVLQTAVVPPNHWTNYRSIPQSQSGDSLVYQWDGTVRVNSSKVWFDVDSNALRAPASWKIQYLDADGTW KDVINPSAYTTTTGKANPNAVTFDAVTTTALKLDMTGQAVDGGYASVAVAEWEVGSDSSESPAITAPKSVTTATG TAPTLPATVDVKYGNPTVASPVIWRPVDASSYAKVGSFTAYGVVAGVPGEASEQGNVSVNVTVQDGYQPAADTTK PTVTVAVTANAGNSEWLTTAPFATVQATDDTAPIAKLEISADQGKSWTTIAANANAAIATLSQQGDVEVWARATD QAGNVSDVAKAGGKVDSAAPTVTAAADKEERTLTLTADDGTGSGVASIEYRIGTDGQWATYSKPIAAPSASRATV YYRATDKAGNVSASAKTDIPSDTSVPLTGYIEGDATATDVDGKASGWVKGAAALNDGKIIPDITIANEDVWGTWP NTGEMRLDYEWDREVTIDSSRVQFTSDDGGLGIPASWELQYWDALANNGAGNFVDIPDATYTVTANSPSAGWATG DAKGWSDGTWNTPVKTTKLRMVITSGSASPAVAEWQVHAIDDSTPEPPEPTPIDKTELKQALADSPKADDASKYT ETSWAEYAAVLDSAQQVYKAEDATEAAVVDAATQLKQAAKKLVLVATVQDRAALSAQLDAAAAVDRTKWTDESLA VLDSAVATANALTSDGQAAQSDVQAATEAISDAIAGLVEKSTTKPGQGGDKPGSGTDKPNQGNDSNQNKGDADSG KHKKIPDTGAAVLGVGILAVVLAVAGVIILKRRKSGTC Suitably, the present B. Longum transitional strain comprises a glycosyl hydrolase family 121 (GH121) gene. Suitably, the GH121 gene comprises SEQ ID NO: 17 or a sequence with at least 60% sequence identity to SEQ ID NO: 17. Suitably, the GH121 gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 17. SEQ ID NO: 17 ATGCATCAATCAACACGAAAGCGGTGGCTTGCGTCAATCGGCGCGGTTGCAGCGGTCGCCACACTGGCCACCGGC GGTGCAGTCACCGCGCAGGCAGCCGATGCGCCCGTCATCAAGAATGCGGATGTGGCATATCCGTCGTTCAAGGGA TCTGATGATCCGATGAAGACGGCGGCGAACAACACCACATATAACCCTGCCGTCAGCTATCTGCAGGAGACATTC GATAACGACGTGAAGAACCTGGCCGGCATCGACACCGACCATGACTTCTGGATCGATAAGATTCTCACCCGTACT GGTGCACAGCCAACTGGTAAAGGCACGAACGACAAGGGTGCTTACTCGTATGAAGGCTCCGACGGCAACAACTAC CTGTTCACCCGTGGTCGCGCCGCCTACATGTACACGCACACGCCTAATCAGCTCGGTTTTGTGGGTGATACCGCC TACTGGGACCAGACCAGCAGGAGCGGCTTCACCGTTACCGTAAACGCTGATGGATCAAACCAGACCCTTAACGAA GACGCCTCCCAGCGCAAGCAGACGCCGAGCTACTTCACCTCCCTGTTCCAGACCGGTGGCAAGAGCCTCAAGATC AAGGAAGTCAAGTACATCACCTACAACAACGTGATGGTTGCGAACCTCACCGTGGAAAGCACGCAGGACCGCGAT GTCACACTGACCACGGCCTCGCCGTTCGCCGCCGAGGGTGCTGATGGTGCCACCGAACTTACTGGCCGCGTGAAC GTCAAGAACAACCTGACGACCATCTATCCGCGCTTCTCCGCCAACAACCAGGACGGTTCCAACTGGATCGTCAGC GGTGGCAAACTCACCAGCACGTTGAGCCTCAAGGCCAACGAACCGCAGACCGTCAAGATTCAGCTCGGCCTGATC GCCAACGAACTGCCTGACTCCACCAAGGAATATGAGGCCCGTTACACCGGCGACCTTAAGGATGCTGCCGCCTCC TACAAGGATTCCGTGACCACCTACAACAAGTGGTGGGTCGATAACGCTCCCTACGTGGACACTCCGGAAGACAAT ATCGATAAGACCGTGGTCTACCGCTGGTGGCTGAGCCGTTTCAACATGCTCGACGCCAACATGCCTGGCAACACC TTCCAGTACCCGACCTCCATCGAGGGTGTGCTCGGCTACAACAACCAAATCGTGCTCACCTCCGGCATGTTCATG ATGGACCCCAAGTGGTTCCGCAACCCCGAGTACTCCTACGGCACCTGGCTTTCCGCCGGCGATACCGCCAAGAAG AGCAAGGCGGGCTATTACTACTACCACGACAATCCGGGCGACCCGGCCAACTGGAACCATAGCTACACGCAGTAC ATCACGCGCGCCGGCTGGGACTCCTACAAGGTGCACGGCGGTCCGTCCACCGTGGCCGAGGAGCTGGCCGACCAG GGTGCCGAGGACGTGCAAGGTCTACTCGCTTCCAAGAGCGAGCCGGACAACAACGACAACCAGAACAACAATGAC AACAGCTTGATTGACTGGTCCTGGTGGTCGATGACCGGTAACGATGCCGACGCCGTTTCCTTCTCTGAGCCGGGT CGCTCCGGCCAGCGCATGGATCGCGCCGATGGTTCCGCCAATATGTGGGCCAACGCCAATGCGGCTGCTCAGGCC TACAAGGCCGCTGGCGATACCGCCAACGCCGAGAAGATGCAGGCCATCGCCGACAAGATCCAGAAAGAAGTCACC ACTGAACTGTGGGACAAGTCCGACAACCTGCTCAAGCACAAGTGGCTGAACGACGGTGCTTTCGCCAAGTACAAG GAGATCAATAACTACTACCCGTACTCCGAAGGCCTGATGCCTACCGGCAACGAAGATTACAACAAGGCTCTGCGC CTGTTCGAGGATTCCAACGAGTTCCCGATCTTCCCGTTCTTCACCGCCAACCAGGCGGACAAGGCGGCGCTGAAC TTCCCCGGTTCCAACAACTTCTCCATTATCAACGCACAGCCGCTGCTGCAGGTCTATTCAGCCGGCATCCGCAAT TACGATGCAGCCAAGAACGGTTACATCACCAATGAGCAGTTCAAGAAACTGCTGTACTGGGTGGCGTTCGCGCAC TATCAGGGCGGCGATAACAACTACCTTGATCAAAACGAGTTCTGGAACGAGGATAACAACAACGTCGGCGATGTA AACGGTGACGGCGTGATCAACAACCTCGACAAGAACCTTGACGCCGCACAGAACGGCGGCAAGATCACCTACCGC TCCTGGATCCACCACACCCAGCTCGGCACCACGAACTGGACGATGGTCGAGGACGTAGCCGGTATGGTGCCGCGC GAGGATAACAAGATTGAGCTGAACCCGATTGAGATCCCCGGCTGGAACTACTTCACGGTGAACAACCTGAGCTAC CACGGTCAAGATGTTTCCATCGTGTGGGATAAGGACGGCAGCCACTATGGTGGACCTGCTGGCTACAGCCTGTAC GTGGGGGGCAAGCTCGCCTTCACTTCCGACAAGCTCGCACACCTCATTTACGATCCGTCCACGGGCACCGTTGAG GATGCCGACAAGGCCGGCGTAACCATCACCAATGCCGCTGGTTCTGATATCAAGGCCGCCAACCAGGTTGCCTTC ACCGCCGACCAGCGTGTGACCGACCTGTTCGCCAAGTCCGGTGCCAACGTCGACTCCGCTTCCAAGTCCACCACG AATGTGGCCAAGGACGCGGACGTGACCGGTACCACCTACGCCGAGAAGGACACCAACTACCCGGCCAAGAACGCG GTGGACGGCAAGACCGTGATGGAATCGTTCTGGGGTACCAAGGGTTCTGAGAACAAGACCGACACGCTCAATATC AAGTTCAAGGACGGCAAGCAGAAGATCGACGACCTCCGCTTGTACTTCTACCAGAGCTCGTCCAGCCAGACCATC TCCGGCTATGCCGAGCCCGCCAACTACAAGTTGGAGTACCAGAAGGATGACGGCACATGGGCCCCGATTGCGGAT CAGGTGCGCACCCCGAACTACGCGGGCGCGAACTACAACCGTATCCAGTTCACTCCGGTGGAGACCACGACTATC CGCGTCACCTTCACGCCGCAGGCCGGCATGGCCGTCGGTGTCAAGGAGATCGAAGCCTACAACACCGGTATCAAG GCTGACGGCACTTCCGAGAACCAGGCTCCGCAGGTGGATGCTTACGTGTCTTCCAGCACCTCATCCGGTGCCAAG CTCGTCGGTACGGTGAAGGATGACGGTCTGCCCGCAGAAGGCGACGTCACCACCAAGTGGGAGCTGGTTTCCGGC CCCGAGGGCGGTACCGCGAAGTTCGTGGACGATACTGCTGCCAGCACCACCGTCACCTTCAACAAGGAAGGCGAC TACGTTCTGAAGCTCACCGCTTCCGATGGCGAGAAGGAAGGCTCCAAGGAAATCACCGTTCACGGCATCCCCTCT GACGGTACCGTGAACGTAGCCCCGCAGTCGAGCGCCTCTGCCAGCTACACCAACGGCTACCAGCCGAAGGACAAC GCCAAGAAGGTCATCGACGGTCAGGTGGTATACACCAACACGCCGAACGAGACCTGGAACAACTGGGGCGACAAC ACTGGTGTGGAGCCGTGGCTGCAACTGAAGTGGGCCGGCAAGGTGCCACTGAAGAAGGCCAAGGTCTTCTTCTGG ACCGATGGCGGTGGCGTGCCGATGGCCTCATCTTGGAAGCTCCAGTACGCTGACGCTGACGGTAACTGGCAGGAT GTGAAGCTGGCTGACGGCCAGTCCTACACGGTCAATCAGAACGAAGGCAACGAAGTGAAGTTCGCCGACACCGTC GAAACCGACAAGCTGCGCGTGGTCTTCCCGAAGGGCGCCATCGTGGGTGCTTCCGAGTTCGAGGCGTACGCCATC GAGCCGGTGAGCGTGGACGAAGTCAACCGACTGGTGCAGACCGGTTCCAAGGCCGATGATCTGAAGCTGCCCTCC ACCGTGAGCGCCGTATACACCGACGGTTCTCGCCGTGACCTCGCCGTCACGTGGGATAAGGTGACCGACGCTCAG CTGGCCGCCGATGCCGTATTCGATGTCAAGGGCATCGTCGCTGGTGCGCTGAGCGGTACGGTTGCACACATCGCA GCTCGTTCCGATACCGCATTGCAGACCGTGGGTAATGCGCAGCCGGTTGAGCAGACCGTCTACCAGAACGCCAAG TCCATCGACCTGCCCGCCACGGTTCCGGTGAAGTTCCCGAACGGATACAACGACGACCGCAAGGTCACGTGGAAG GATGCCGACATCAAGGCCATCGACCTGACCAAGGTTGGTGACTACGAGGTGGCTGGTACCGTCGACGACGGTTCG TCTTCCGCAGCTGCCAAGCTCACTGTCCACGTGGTTGCCGACCCGAACGGTTCCTCCACTCCTGAGCCTGAGCCT GAGCCGTTGGTCGGTTGGATTGAAGGCAAGGCGACCAAGACCACCATTTCGCCTGATTCCGAGGCGACCTGGTCA CCGGCCGAAGGCAAGCTCAACGACGGCGTAGTCGTCGATGATACTTGGCCGACCACGGATGATCAGAACGTCAAC GACAAGGTCTGGGGTTCTTGGGGCAAGGCAAAGGACGGCATGTACGCCCAGTACGACTTCGGTCAGTCCGTGACC GTTGACCAGAGCCGCGCCCAGTTCTGGGCCAACTTCGCTGAGACTGACGATTCGAAGGGTGGTCTGGAAGTCCCG GACGCTTGGAAGATTCAGTACCTCGCCGAGGATGGTTCTTGGAAGGATGTCGAGCCCACCGAGGATTACACCATT GTGCGTAACTCGCCGGCTTCTCGTGCGGATACCGATGCCAAAGGTTGGAGCACTGTGACCTTCAAGCCGGTCGCC ACCAAGTCGCTGCGACTCGTGCTCACTCCGCACACCGGCAGCAGCACCTTCGGGGCCGCCGTGGCCGAGTGGGGC GTGCATGGTATTGACGGCACCGAGCCTGAACCTACCCCGGTCGACAAGACCGCGCTCGAGTCGGCTCTTGACACA GCCAACGGCCTCGATGCAAGCCGCTACACCGCCGCTTCATGGGCTGAGTTCCAGCAAATCATTGACGCTGCCCAG GCTGTGTACGACGATGCCAACGCCACCGCAGAACAGGTCGCCGAGCAGGTGACCAAGCTCGAGGACGGCCAGAAG GCACTCGTTGCGCTCGCCACCGACGTGGAGAAGTCCACGTTGCAGGCGGCCATCGATGCGGCCAAAGCCGAGGCC GCTTCCGGCAAGTACACGGATAAGAGTGTCGAGGCCTTGAACAAGGCCATCGAGGCTGCGGAAGGTGTGCTCAAG GTCGGTGAGGTCGGTGAGGTCACTCAGGCCGCCGTCCAGGAAGCGTCCGCTTCGCTGAACAAGGCCGTCAAGGCC TTGGAAGAGAAGCCCGCCGCCGAAACGGTGAAGAAGGAGTCCCTCGAGGCTTCCATCGAGCAGGCCAAGAAGGCT GACAAGTCGAAGTACACCGAGGAGGCATGGCAGGCTCTGCAGAGCCAGATTGCCGCCGCTCAGAAGGTGTACGAC GACAAGGATGCCAAGCAGGCCGATGTCGATGCCGCACAGGATGCCCTTGACAAGGCATTTTGGGCCACCAAGGTT GAGCAGAAGCCCGGCTCCCAGCAGCCTGGTGTGACCGACACTGATAAGGATGATAAGGACAACAAGGGTGATCGT GTGCCTCCGACTGGTGCCGCGGTTTCCGTAGTTGCTGCGGCTGCCGTGCTGCTCACCGCCGCAGGCGTGACCATC CTGAAGCGTCGCCAGTCCGGCGACCACGGTTCGGCTCGCCACTCGGCCTGA Suitably, the GH121 gene may encode a protein shown as SEQ ID NO: 18 or a sequence with at least 80% sequence identity to SEQ ID NO: 18. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 18. SEQ ID NO: 18 MHQSTRKRWLASIGAVAAVATLATGGAVTAQAADAPVIKNADVAYPSFKGSDDPMKTAANNTTYNPAVSYLQETF DNDVKNLAGIDTDHDFWIDKILTRTGAQPTGKGTNDKGAYSYEGSDGNNYLFTRGRAAYMYTHTPNQLGFVGDTA YWDQTSRSGFTVTVNADGSNQTLNEDASQRKQTPSYFTSLFQTGGKSLKIKEVKYITYNNVMVANLTVESTQDRD VTLTTASPFAAEGADGATELTGRVNVKNNLTTIYPRFSANNQDGSNWIVSGGKLTSTLSLKANEPQTVKIQLGLI ANELPDSTKEYEARYTGDLKDAAASYKDSVTTYNKWWVDNAPYVDTPEDNIDKTVVYRWWLSRFNMLDANMPGNT FQYPTSIEGVLGYNNQIVLTSGMFMMDPKWFRNPEYSYGTWLSAGDTAKKSKAGYYYYHDNPGDPANWNHSYTQY ITRAGWDSYKVHGGPSTVAEELADQGAEDVQGLLASKSEPDNNDNQNNNDNSLIDWSWWSMTGNDADAVSFSEPG RSGQRMDRADGSANMWANANAAAQAYKAAGDTANAEKMQAIADKIQKEVTTELWDKSDNLLKHKWLNDGAFAKYK EINNYYPYSEGLMPTGNEDYNKALRLFEDSNEFPIFPFFTANQADKAALNFPGSNNFSIINAQPLLQVYSAGIRN YDAAKNGYITNEQFKKLLYWVAFAHYQGGDNNYLDQNEFWNEDNNNVGDVNGDGVINNLDKNLDAAQNGGKITYR SWIHHTQLGTTNWTMVEDVAGMVPREDNKIELNPIEIPGWNYFTVNNLSYHGQDVSIVWDKDGSHYGGPAGYSLY VGGKLAFTSDKLAHLIYDPSTGTVEDADKAGVTITNAAGSDIKAANQVAFTADQRVTDLFAKSGANVDSASKSTT NVAKDADVTGTTYAEKDTNYPAKNAVDGKTVMESFWGTKGSENKTDTLNIKFKDGKQKIDDLRLYFYQSSSSQTI SGYAEPANYKLEYQKDDGTWAPIADQVRTPNYAGANYNRIQFTPVETTTIRVTFTPQAGMAVGVKEIEAYNTGIK ADGTSENQAPQVDAYVSSSTSSGAKLVGTVKDDGLPAEGDVTTKWELVSGPEGGTAKFVDDTAASTTVTFNKEGD YVLKLTASDGEKEGSKEITVHGIPSDGTVNVAPQSSASASYTNGYQPKDNAKKVIDGQVVYTNTPNETWNNWGDN TGVEPWLQLKWAGKVPLKKAKVFFWTDGGGVPMASSWKLQYADADGNWQDVKLADGQSYTVNQNEGNEVKFADTV ETDKLRVVFPKGAIVGASEFEAYAIEPVSVDEVNRLVQTGSKADDLKLPSTVSAVYTDGSRRDLAVTWDKVTDAQ LAADAVFDVKGIVAGALSGTVAHIAARSDTALQTVGNAQPVEQTVYQNAKSIDLPATVPVKFPNGYNDDRKVTWK DADIKAIDLTKVGDYEVAGTVDDGSSSAAAKLTVHVVADPNGSSTPEPEPEPLVGWIEGKATKTTISPDSEATWS PAEGKLNDGVVVDDTWPTTDDQNVNDKVWGSWGKAKDGMYAQYDFGQSVTVDQSRAQFWANFAETDDSKGGLEVP DAWKIQYLAEDGSWKDVEPTEDYTIVRNSPASRADTDAKGWSTVTFKPVATKSLRLVLTPHTGSSTFGAAVAEWG VHGIDGTEPEPTPVDKTALESALDTANGLDASRYTAASWAEFQQIIDAAQAVYDDANATAEQVAEQVTKLEDGQK ALVALATDVEKSTLQAAIDAAKAEAASGKYTDKSVEALNKAIEAAEGVLKVGEVGEVTQAAVQEASASLNKAVKA LEEKPAAETVKKESLEASIEQAKKADKSKYTEEAWQALQSQIAAAQKVYDDKDAKQADVDAAQDALDKAFWATKV EQKPGSQQPGVTDTDKDDKDNKGDRVPPTGAAVSVVAAAAVLLTAAGVTILKRRQSGDHGSARHSA Suitably, the B. Longum transitional strain comprises a GH43_17 gene and one or more genes selected from a GH43_22, GH43_27, GH43_29 and GH121 gene as defined herein. Suitably, the B. Longum transitional strain comprises a GH43_17, GH43_22, GH43_27, GH43_29 and GH121 gene as defined herein. Suitably, one or more of the arabinan-degrading GHs described herein comprises a signal peptide. A ‘signal peptide’ may refer to a short amino acid sequence, typically present at the N-terminus of a polypeptide, which allows the polypeptide to be secreted out of abacterial cell. Without wishing to be bound by theory, this may advantageously allow the present B. longum transitional strain to act as a primary degrader of complex structures of arabinan when present in high molecular weight, usually in the diet. Suitably, a ‘primary degrader’ may refer to a bacterium that is capable of depolymerizing specific polysaccharides to mono-, di-, and oligosaccharides that they can take up and ferment themselves to acidic end products such as acetate or lactate. Suitably, the GH43_22, GH43_27, GH43_29, GH_121, GH43_24 and/or GH30_5 enzyme may comprise a signal peptide. Suitably, each of the GH43_22, GH43_27, GH43_29, GH_121, GH43_24 and GH30_5 enzymes may comprise a signal peptide. Suitably, the present B. longum transitional strain comprises a glycosyl hydrolase family gene that encodes a CAZyme that targets arabinogalactans. Suitably, the present B. longum transitional strain comprises a glycosyl hydrolase family 43_24 (GH43_24) gene. Suitably, the GH43_24 gene comprises SEQ ID NO: 19 or a sequence with at least 60% sequence identity to SEQ ID NO: 19. Suitably, the GH43_24 gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 19. SEQ ID NO: 19 ATGAAGATAAACAATAAGGGCAAGGGCGCTCTTATCGCGGCAATTACCGCCGCGGCAACGCTATTGTCATGCGGG CTGGCCGCTGCAAGTGCCAGTGCGGCAGGTGTGAATTACCTGCCTACCATCGGCCAAGTGCCGACATACACCAAG TTCCAGCCCACAGCCGATCCGGGCAAGAACGCTAGCGATTACTTCCAGCCATATTGGTATGCCAAGAACGCCAAT GATAATGGCGGCACACACATCCAAGCGCACGGTGGCCAAGTGGTCAAGGTTGGCGACGCCTACTACTGGTATGGC GAAGACCGTTCTAACGGTTACGACAACAGCCCCGGTGTTCATGCTTATATGTCGACAGATCTATACAACTGGACC GATCTTGGTGTGGCGCTGCGTGCGGTGACCAGCAAATCTCAGTTGACGGATAAGAGCAATGCCGATTACGCCTAC TTCGACAAGGCCTACAACCTGACCAAGTCCGACGGCAGTGTGGACGCTGCCAAGGCCGACGCAATCTTCCCGTAC CTCAACACCAACCCCGATCAGGATGGTGATGGCGCGGTTGATTCCGTACAGGGCATTTTCGAGCGTCCGAAGATC ATCTACAACAAGAAGAACAAGCAATACGTGCTGTGGTGGCATTCCGATGGAAGCACCACGCCGGGCGGTTCCAAC TATGCACGTGCACTTGCGGGCGTGGCTGTTTCCGACAATCCGGCGGGCCCGTTCACTATGGTGGGTGCCTATCGT TTGCCTAACCAGAACAATTGGAAAGAAGCCGCAGGTAACCCCAGCTGGGGTGAGAACGGTGACAGCCGCGATATG ACTGTGTTCGTGGACCCGAAGGACGACAGTGCCTATGTACTGTATTCTTCCGAAGCCAATGCCACGCTGTACATC GCCAAGCTCAACGATGATTACACCAATGTAGTCAAGACCACGAATGTGGACCAGTCCGAGGGACAAAAGCAGTAC TCTGCTGACGGGCAGTACCCATACATTCTTGCAGACGCTACTACGGATGCCCCGGTGCGTGGCGAAGATTTCCAA ATCGTCAAACAAAATGGTTCGCTGGAAGCTCCTGCCGTATTCCAATATGACGGGCGTTACAACATCATCGCATCT GGTGCAACCGGCTGGGCCCCGAACAAGCAGACCTACTACACCGCCGACTCCATGCTGGGAAGCTGGACCCGTGGC GTGGAAAAGGACGATATCAACGAGAACACGTGGTACAACAACATGCCGGAAGGCGCGGATGGTCTGTTGTCCGTG GGCGATACCCGCGGCACCACATTCGGTTCGCAGTCGGCTAGTGTGCTCGCAGTAGACCAGGAGAAAGGTCACTTC ATCTACCTTGGTGACCGTTGGGATTCCGGTAAAGCCGATTCCACCTATGTTTGGCTGCCGCTGACCATCGGTGAG AACGGCACCATCGAAATGCACAATCCTGCTCAAGAAGGCGAGCCCGACGGTTGGGATCTGAGCTATTGGGGCAAC CATGGTAGCGCCAAGGGCAAGCTGGTCAACTGGACTGTGGAAACCGGCGATGATCTCCCGAAGACCGTGAACACG GGCGGAACCGTTACTCTGCCGGACACCGTCAACGTCAAGGAAGGCGACGATACCATTGCTACCAAGGTGACATGG AATGTGGAAGGCGGTACGGCAGTCAGCAAGTCGACCAAGGCTGCTGGTAACACCTACGCATTCAATGTGCCGGGA ACCTACACCATTACGGGCACTCTTGCCGAGAGCAGTAACTTCAATCCGGGCCGTACATTCCGTAGAACCATCGAT GTTTCCTGCTCCAACCCAATTTCCGGAAGTTGGAAGGAAGCTCATTGGAAGGGCGGCAGCGCGTGCCAGGTTTCT GCGTCCGGCGGTGCTTATGACTTCACGATTACGGACAACGCCAATCGGGGCGTCTGGACGGATCGCAACGAGGGC AGTGCGGTGTACCAGCCTGATGCCCTGGACGTGAACGAAATGCTGGAAACCACGGTCAAGCCGCTCGACTTGGGC GGTAATGGCGATCCGCGCGCCGGTCTGGTGGTCCGTAACGGTCTTACTGGCGCTAACGGCGGCAAGGGATATGCC ACGTTACTTGCCAGCCCAAGCGGCGTTTACATGCAGTACGATTCCAATGCCGATGGCTACATCGATAAGGAAACA TCGCATGTTGGTACCGGCTTCGGCGACCAAGTGCAGCTCAAGCTGGAGCGCACCTCAACCGATACTCTGAAAGGC TACTGGCGTGCTTCCGCGAACGATGAATGGCAGGATGTCGCTACGGTAACGCTGACCGGTGCGGACGTAACCGGG CTCGATGCCGGTGCTTTCGCCACGTCGAACAGCAATGCCGGCGCATTCACCGTGGCCTTCAACGGCACTGCGTTC GGTTCGCAGACTGCTGCTGTGGAGTCCATCGCGGCCAAGGGCCCTGAAGCCACTATCGCCAAGAGGCAGACGCTC GCGCATAAGGACGTGACGGTTACCGCTACGCTCACCAATGGCAAGACGCGTGTACTGGAGCCAGATGAATACACG TTGGAAGGCTTCGACACCACCAAATTGGGCGAGCAAACCGTGACGGTACGCCTTGTCACTGATTCTTCAGTAACT GCCACGCTCACCGTGACTGTGGAAAGCAACCTTGCCCGGTTGTTCTGCTCGTCCGCCGCAGCCTCGAAGTATGAG CCGGCCAGCAGCTGGGCCTCCGCTTCTACGGCCGACCTGACTTGCGACAACAATCTGAGCACCAACTGGTCGAAC TGGGGCACCGGCGACACCTCGCCGTGGCTCAGCTACACCTTCGATAAGGCATATCAGCTGGGCAAGCTCAGCGTT GCGGTGGATAAGGCCAAGGGCGAGGCCGCTCCGAAGAGCTTCACTGTATCGTACCTAGCTGAAGACAACGCCACG TGGACTGATGCCACGCTGCCGGCAGTCACTGTGAATGGTGCTGCTGGAGCCGTGACGGAAGCCGATGTGAGCGCT CTGCCCGCCACCAAGGGCATTCGCCTCAACTTCACCTACGCCGATGGCAATGACTATGCCAAGATCGCTGAAGTA CGCATCGCCGAAGGTGAAGCAACGCCAAAGCCGCAGCCGTCTAGTAACGCCAATCTTGCTGATCTGACTGTGGAT GGCAAGACGGTTGACGGATTCTCCGCGGATATCACCGAATATGCCGGTGCGCTGGCCGGAGACGCTGCTTCTTAC CCGACGGTGGAGGCGACTGCTGCTGACGCGAAGGCTACGGTGCAGGTGGAGCAGGCTTCGACCGAGAACAGCGGC GTGGCCACGGTGACTGTAACTGCTGAGGATGGCACGGCGGAAACCTACACAGTGACATTCGGCGAACTGCCTCAG TTGGCCGAGCTTGCTGTGGAAGTGACCAAGGATTCCTATCAGGTAGGCGATAAGTTCAACGCTGCCGATGTGAAG GTATCCGCCATTTACAAAGTCGGCGATACCGAAACGCTGCGCAAGCTGATTGATCCAACTGATGGTGATCTGAAG TTCACTGGCTTTGATTCTGCCACCGCAGGCACGAAGACCATCACCGTCTCTTATCGTGGCGTGAACGCGACGTTC GAAGTCACGGTCACGGCCACGGAGGTCACTCCCGGCCCTGGAGAGCAGAAGCCCGGCGATACCAACAATCCTGGC AACACTGCTAAGCCCGGTAACACTGCCACGAATAAGCCGGCTGCTAATGGCGCTGCGCCCCTTTCGAATACGGGT GTTGCCGTGGCTGCCATTGCGGTCGTGGTTGTGGTGCTGACAGCTGCGGCTGGTGCCTTGCTCGTCATCCGCAAA CGCCGCGCATAA Suitably, the GH43_24 gene may encode a protein shown as SEQ ID NO: 20 or a sequence with at least 80% sequence identity to SEQ ID NO: 20. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 20. SEQ ID NO: 20 MKINNKGKGALIAAITAAATLLSCGLAAASASAAGVNYLPTIGQVPTYTKFQPTADPGKNASDYFQPYWYAKNAN DNGGTHIQAHGGQVVKVGDAYYWYGEDRSNGYDNSPGVHAYMSTDLYNWTDLGVALRAVTSKSQLTDKSNADYAY FDKAYNLTKSDGSVDAAKADAIFPYLNTNPDQDGDGAVDSVQGIFERPKIIYNKKNKQYVLWWHSDGSTTPGGSN YARALAGVAVSDNPAGPFTMVGAYRLPNQNNWKEAAGNPSWGENGDSRDMTVFVDPKDDSAYVLYSSEANATLYI AKLNDDYTNVVKTTNVDQSEGQKQYSADGQYPYILADATTDAPVRGEDFQIVKQNGSLEAPAVFQYDGRYNIIAS GATGWAPNKQTYYTADSMLGSWTRGVEKDDINENTWYNNMPEGADGLLSVGDTRGTTFGSQSASVLAVDQEKGHF IYLGDRWDSGKADSTYVWLPLTIGENGTIEMHNPAQEGEPDGWDLSYWGNHGSAKGKLVNWTVETGDDLPKTVNT GGTVTLPDTVNVKEGDDTIATKVTWNVEGGTAVSKSTKAAGNTYAFNVPGTYTITGTLAESSNFNPGRTFRRTID VSCSNPISGSWKEAHWKGGSACQVSASGGAYDFTITDNANRGVWTDRNEGSAVYQPDALDVNEMLETTVKPLDLG GNGDPRAGLVVRNGLTGANGGKGYATLLASPSGVYMQYDSNADGYIDKETSHVGTGFGDQVQLKLERTSTDTLKG YWRASANDEWQDVATVTLTGADVTGLDAGAFATSNSNAGAFTVAFNGTAFGSQTAAVESIAAKGPEATIAKRQTL AHKDVTVTATLTNGKTRVLEPDEYTLEGFDTTKLGEQTVTVRLVTDSSVTATLTVTVESNLARLFCSSAAASKYE PASSWASASTADLTCDNNLSTNWSNWGTGDTSPWLSYTFDKAYQLGKLSVAVDKAKGEAAPKSFTVSYLAEDNAT WTDATLPAVTVNGAAGAVTEADVSALPATKGIRLNFTYADGNDYAKIAEVRIAEGEATPKPQPSSNANLADLTVD GKTVDGFSADITEYAGALAGDAASYPTVEATAADAKATVQVEQASTENSGVATVTVTAEDGTAETYTVTFGELPQ LAELAVEVTKDSYQVGDKFNAADVKVSAIYKVGDTETLRKLIDPTDGDLKFTGFDSATAGTKTITVSYRGVNATF EVTVTATEVTPGPGEQKPGDTNNPGNTAKPGNTATNKPAANGAAPLSNTGVAVAAIAVVVVVLTAAAGALLVIRK RRA Suitably, the present B. longum transitional strain comprises a glycosyl hydrolase family 127 (GH127) gene. Suitably, the GH127 gene comprises SEQ ID NO: 21 or a sequence with at least 60% sequence identity to SEQ ID NO: 21. Suitably, the GH127 gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 21. SEQ ID NO: 21 ATGAACGTTACAATCACTTCCCCGTTCTGGAAGCGGCGTCGCGACCAGATTGTCGAATCCGTCATCCCCTACCAG TGGGGCGTGATGAACGACGAAATCGACACCACAGTGCCCGACGACCCGGCCGGTAACCAGCTGGCTGACAGCAAA AGCCACGCGGTCGCCAATCTGAAGGTTGCCGCCGGCGAATTGGACGACGAATTCCACGGCATGGTGTTCCAGGAT TCCGACGTCTACAAGTGGCTTGAGGAAGCCGCTTATGCGCTGGCCTACCATCCGGATCCCGAACTCAAGGCGCTG TGCGATCGCACGGTCGATCTCATCGCCCGCGCTCAGCAGCCGGACGGCTACTTGGACACTCCGTACCAGATCAAG TCCGGCGTATGGGCCGACCGCCCGCGCTTCAGCCTGATTCAGCAAAGCCACGAGATGTATGTGATGGGTCACTAC ATCGAAGCCGCCGTCGCCTACCATCAGGTGACCGGCAACGAGCAGGCCCTTGAAGTCGCCAAGAAGATGGCCGAC TGCCTGGATGCCAACTTCGGGCCCGAAGAAGGCAAGATTCATGGCGCCGACGGCCACCCGGAAATCGAACTCGCC CTCGCCAAACTGTACGAGGAAACCGGCGAAAAGCGTTACCTGACGCTCTCCCAATACCTCATCGACGTGCGCGGC CAAGACCCTCAGTTCTACACCAAGCAGCTGAAGGCCCTGAACGGCGACAACATCTTCCCCGACCTCGGCTTCTAC AAGCCCACCTACTTCCAGGCCGCCGAACCTGTGCGCGACCAGCAGACCGCGGATGGCCACGCCGTGCGCGTCGGC TACCTGTGCACTGGTGTGGCCCATGTGGGCCGACTGCTCGGCGATCGGGGACTGATCGACACCGCCAAGCGTTTC TGGACGAACATCGTCGCCCGTCGTATGTATGTCACCGGCGCGATTGGTTCCACCCACGTGGGCGAGTCGTTCACC TACGACTATGATCTGCCGAACGACACGATGTACGGTGAGACCTGTGCTTCCGTGGCTATGAGCATGTTCGCCCAG CAGATGCTCGACCTCGAGCCCAAGGGCGAATACGCCGACGTGCTGGAGAAGGAACTGTTCAACGGTTCCATTGCC GGCATCTCGCTCGACGGCAAGCAGTACTACTACGTCAATGCACTGGAGACCACGCCTGACGGACTGGATAACCCG GACCGTCACCACGTGCTCTCCCACCGCGTCGACTGGTTCGGCTGCGCCTGCTGCCCGGCCAACATCGCCCGACTC ATCGCCTCCGTGGACCGCTACATCTACACCGAGCGCGACGGCGGCAAGACCGTGCTGAGCCACCAGTTCATCGCC AACACAGCCGAATTCGCTTCCGGCCTGACGGTCGAGCAGCGTTCGAACTTCCCGTGGGATGGCCATGTGGAATAC ACGGTGAGCCTGCCCGCCAGCGCCACTGACAGCTCGGTCCGTTTCGGACTGCGCATCCCCGGCTGGTCGCGGGGC TCCTACACGCTGACCGTGAACGGCAAGCCCGCAGTGGGTTCGCTGGAAGACGGCTTCGTATACCTTGTGGTCAAC GCCGGCGATACGTTGGAGATTGCGCTCGAGCTCGACATGTCCGTGAAGTTCGTGCGCGCCAACTCCCGCGTGCGC TCCGATGCCGGTCAGGTGGCCGTGATGCGCGGACCGCTGGTCTACTGCGCCGAACAGGTCGATAATCCCGGTGAT TTGTGGAACTATCGTCTGGCCGATGGCGTCACCGGTGCGGATGCCGCTGTGGCTTTCCAGGCCGACTTGCTGGGT GGAGTCGATACCGTTGATTTGCCGGCAGTGCGCGAGCACGCCGACGAGGATGACGCGCCGCTGTACGTGGATGCC GACGAACCGCGTGCGGGTGAGCCCGCGACGCTGCGCTTGGTGCCGTACTACTCGTGGGCCAACCGCGAGATAGGC GAGATGCGTGTCTTCCAGCGTCGATAA Suitably, the GH127 gene may encode a protein shown as SEQ ID NO: 22 or a sequence with at least 80% sequence identity to SEQ ID NO: 22. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 22. SEQ ID NO: 22 MNVTITSPFWKRRRDQIVESVIPYQWGVMNDEIDTTVPDDPAGNQLADSKSHAVANLKVAAGELDDEFHGMVFQD SDVYKWLEEAAYALAYHPDPELKALCDRTVDLIARAQQPDGYLDTPYQIKSGVWADRPRFSLIQQSHEMYVMGHY IEAAVAYHQVTGNEQALEVAKKMADCLDANFGPEEGKIHGADGHPEIELALAKLYEETGEKRYLTLSQYLIDVRG QDPQFYTKQLKALNGDNIFPDLGFYKPTYFQAAEPVRDQQTADGHAVRVGYLCTGVAHVGRLLGDRGLIDTAKRF WTNIVARRMYVTGAIGSTHVGESFTYDYDLPNDTMYGETCASVAMSMFAQQMLDLEPKGEYADVLEKELFNGSIA GISLDGKQYYYVNALETTPDGLDNPDRHHVLSHRVDWFGCACCPANIARLIASVDRYIYTERDGGKTVLSHQFIA NTAEFASGLTVEQRSNFPWDGHVEYTVSLPASATDSSVRFGLRIPGWSRGSYTLTVNGKPAVGSLEDGFVYLVVN AGDTLEIALELDMSVKFVRANSRVRSDAGQVAVMRGPLVYCAEQVDNPGDLWNYRLADGVTGADAAVAFQADLLG GVDTVDLPAVREHADEDDAPLYVDADEPRAGEPATLRLVPYYSWANREIGEMRVFQRR Suitably, the present B. longum transitional strain comprises a glycosyl hydrolase family 30_5 (GH30_5) gene. Suitably, the GH30_5 gene comprises SEQ ID NO: 23 or a sequence with at least 60% sequence identity to SEQ ID NO: 23. Suitably, the GH30_5 gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 23. SEQ ID NO: 23 ATGAAGGTACTGAGCAAATCGCTTGCTGCAATGGTTGCGGCGGCAACACTAGTGGGAGGAGGGGCGTTTGCGGTT GCCGGCACTGCGTATGCGGCTGATAACGATGCCATTACCGTGACCCCGAACCCGTGGTATGCCAACAGTTTCGAT GGCTGGGGCACCTCGCTGGCTTGGTTCGCCAACGCCACCGGCAGCCTCGGCGAGGAATCGGCCATCACCACCAAT CTCGGCGATGACGCTTCCAAGGCTAAGGCTGTGGAATACGGCAAACAGCTGCGCGAACAGTTCTACCAGTCCATC TTCGGTGATGAAGGACTGGACCTGAACATGGCCCGCTACAACGTGGGCGGCGGCAATGCCTCCGATGTTGCCTAC GGCTACCCATTCATGCGCCAAGGCGCTGCCGTGCCTGGCACGTGGAAAGATGACGCCACCGGCTCCGGCACGTAT GGCAATGGCGTAACCACCAAGCAGGCCGACAAAGACAAGCTGGCTGCGGCATTCGACCCGACTGACGACAACCAG TATGACTTCTCCAAGTCCGCCGCCCAAGACTGGTGGATTGAGCGCGGTGCCACCGGCGATAACCCTGACATCACC GACGTAGAGGCCTTCGCCAACTCCGCTCCGTGGTTCCTGACCAACAGCGGTTACGCCACTGGTGGACGTAACTCC GGTAGCAATAATCTTGCAAACCCTGAGAAATTCGCTCAGTACATGGCCAAGAACGTCGAGCACCTCGAAAGCCTT GGCGCAAACGTTGACACGGTCGAGCCGTTCAACGAGTCCGAGACCAGTTACTGGGGCACTCCGGGCGACATGGCT TCGAAGTACACCGATGAGAGCGATGACAACACCAAGCTCATTAACAACTACTGGGATAAGTACTACTCCGACAAA GATAAGTCCGTCACCCCATACGCCAACGCGCTGAAGAAGCCGCAGGAGGGTATGCATGTCAGCAACGCCCAGCAG CAGCAGACGATTACCGCACTCGCTGAGGCGCTCAAGGACAATGATGACACCATCATCGCAGCCACCGATGCCACG AACTCCGCCGACTTCGTCAAGTCGTACAACCAGTACCCGCAGGCGATCAAGGACCTTATCGGCCAGTACAACGTT CACGCCTACTCCGACAGCAACCAGATGCAGTCGCGCGATATCGCTCAGGCAGACGGCAAGAAGCTGTCGATGAGC GAGGTGGACGGCTCCTGGCAGTCTGGCTCCTACAACCCGTACGGTTTCGACAACGCGCTGGGCATGATGAGCAAG ATCAGCTCCAACGTCACCCGCCTGCAGTCCAAGGACTTCACCTTCTGGCAGGTGGTCGAGGACCTCTACAACATG CAGATGGGCTCGAATGTGAATCCGGCCGGTGAGAACACCAACTGGGGCACCGTGCTCATCGACTTCGACTGCACC GTGGCTGGCATGGACGGCAAGCTCTACTCCGAGCGCCGCGTGAACAACAACGGCGGTACCACCGATGGACTTGAA CCGTGCACGGTTATTGCAAACGCCAAGTACAACGGCGTCAAGGCCATCACCCACTTCATCCACGCGGGCGACAAG GTCATCGCCAACAACGATGAAGACAACAACATGACTGCCACCTCCGACGATGGCAAGACACAGACCGTCATCCAC CGCAACTCCGGCACCTCTGACCAGACCTTCGTCATCGACCTGTCGAAGTACGGCGAGATTGCCGACAACGCTTAC GGTGAGCTCTACCTGACCACCGAAACCTCTGCCGAAGACAAGAACGCGGGTGTCGATTCCGCCACTCCGGAAGTC TTCGCCAAGACCAGCAACGTCAAGCAAGCTGAAGGCTCTGTGATGATTGACAAGGCTGCCAAGACCGCTACGGTC ACTGTGCCCGCCCGTTCTATCGCCTCCATCCAGCTCACTGGCGTGACCGGCTACGCCAAGGATGCTGCCGTCGAG ACCGGCGACACTTACCAGCTCGTTGGTAAGCAGTCCGGCAAGGCCGTGGCTGATACCACTTCTGGTGATTCCGCG CTGTCCCTGGCCAACGTCGCTTCCGATGCCGAGAACGCCAAGAAGCAGACTTGGACCTTTACCCAGATCGAGCAG CCCGCCGACTCCGAGCGCCCTGATCTCAAGGTTTATGTGATTACTAACGCCGAAGGCAAGGTGCTGGTGTCCAAG GATGGCACGAACGCGCTTTCCAACGAAACGGTTGAGGCCGCTAAGTCCGACCCGGCTGCCAAGTGGATTCTCAAC ACTTCCGATGGTTCGACCTACCAGCTGCTCAATGCCGCGACTAAGACGAACCTCGATGTGGATAACTCTGGTACC ACAGTCGGCACGAAGGTTGGCTTGTGGCAGTCACCGAGCGGCACTTCGCCGTCCGCCAACCAGACATGGACTCTA CGCAATGTAACGCCGACCAGCCAGAAGACCGTGAACGTGCAGACCGCCGTTAACGAGAAGGCCGCGCTGCCGACC GAAGTCACGCTCTACTACACCTGGGGCGAAGGCAAGGCCACGGTTGCCAACTGGGATACTTCCAAGGTCGATGTG GCCAAGGAAGGCACCTACGAAGCCACCGCTACCGCCACCGATGTGTACGGCAACGAGTTCAATGTCGCCGCTACG GTCTACGTTGGCGCGCTCACCGTTTCCGATCCGGTATCGGCTACAGTGCTGGCCGGCACCAGTGCGAGCGAGGCG AAGGCCGCGCTTGAGGCTGCGCCGGTGTATCTGCACGTCAAGGCATCGCCTGCATTCGAGGGCGATGCGGCTAAG GTTACGTGGAACTTCGATGGGCTTGATACCAAGCTCGCCGATGCCAAGGCTGGCGACAACATTGCCGTGACCGGT ACTTACCAGCTGGACGACGCGACCACGATTGCGCTGAAGGGCGCGATCTATGTCACCGCCGCCACGCCTGAGAAT GTGGCCGACACTGCTTCCAGCCTGACCGTGACCAACCAGCAGACGGAATACAGCAAGGGCGATCAGTGGAAGAAG CTCACCGATGGTGACACGTCAGCTGAAGCCTGGGTGACGTGGAACTCTGCTGGTGACTATTCCGCCAGCCCGACC GCCACGATTGACTTCGGCTCTGAGTGTGAGCTTAGCAGCGTGACCATTACGTATGGTGACAAGGCTCCGGCTTCC GCCAAGGCCGAGTACACCACTGATGGCGAGACGTGGATGCAATTCGGTAGCGATGTTAAGCCTGCCGCAGGCCAG ACGGTGACGTTCAAGGCCGATAAGGGCACAGTGAATGCCACGAAGGTGCGCATTGTGAACACCGTGAACAACGAC TACATGAACGCCACCGAAATTCAGGCATTCGTGACGCCGGTTCAGGGTGCTGCGAAGAACATCGCCGCGGCCTCT GGCACGAACTTCTCGGTGAACTTCCAGGAGGGTGCCTCCGCTTCCAAGGCCATCGATGGTGACACTACGTCAAAG GGTTGGTCCACTTGGGCTTCCACCGCCTCGACGGTGGACCCGGTCGCCACGTTCACCTTCGACGAAGCTCAGACC ATCACCGAAGTGAAGACCTTCTTCTACTACGATGGTCGTGCGTCTTGGCCGAAGAGCCAGACGCTGGAATACCAG GATGAGGCTGGCGAATGGCATGGAGTCGGTACCAAGGATGGCTGGAAGATACAGGCCGGCGATGCCGGCTCTGGC TCCGACGGCATCACCGCCGCCGACACCCCGACCGTTGACTTCGTGCTCGGCACCCCGGTAAAGGCCAAGGCCATC CGCCTGACTAACACATTGCAGGACACCAAGGTGTACATCAACGTGGCTGAGATCCAGGTGTTCGCACAAGACAGC ACGGTACTCACCCCGCAGCCAGCATCCGATGCCACGCTGGGCGACCTGCGTCTTGACGGCGAAACCGTTGAAGGC TTCGACCCGGCCAAGACCGACTACACGGTTGATCTGCCGGTCGACGCCGAGGCAAACCCGGTGCTGCAGGCCTTC GCCACCGACAATGCCGCCGCCGTCAAGGTGACTGGCGACGCGGTTGAGAACGGCCAGCTTGGCGGCAAGGCCGCC ATTACGGTGACCTCAGCCGACGAGTCTGAGACGAAGACCTACACGGTGACCTTCAACGCCTTCACTTTGGCTTCG CTCAAGGTGATCGGACCCACGAAGACCGAGTACGCCATCGGCGACAAGCTCGATACCGCCGGTCTGAAGGTGACT GCCGTCTACCAGAGTGGCGACAAGACCAAGGAAGTGCCGGTCGCTCTTGACGACCCGCAGCTTGCGATTGGCTCG TTCGACTCCACCACCGCAGGCAAGAAGGCGATTACCGTCTCCTACCGTGGTGTGACCGCGACCTTCAACGTCACG GTCAAGGCCAACGCAGTCGCCCCTGGCCCTGAAGAACAGAAGCCCGGCAACACCAACAAGCCCGGTGCCACCGGC AGCGGCAACAAGAACACGGTGGCCAACACCGGTTCCAGTGTTGCCGCCATCGCTGGCGCTGTCGCTCTGCTGGCC GCTGCCGCGGGTGCACTGTTCATGCTGCGCAAGCGTGCATAG Suitably, the GH30_5 gene may encode a protein shown as SEQ ID NO: 24 or a sequence with at least 80% sequence identity to SEQ ID NO: 24. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 24. SEQ ID NO: 24 MKVLSKSLAAMVAAATLVGGGAFAVAGTAYAADNDAITVTPNPWYANSFDGWGTSLAWFANATGSLGEESAITTN LGDDASKAKAVEYGKQLREQFYQSIFGDEGLDLNMARYNVGGGNASDVAYGYPFMRQGAAVPGTWKDDATGSGTY GNGVTTKQADKDKLAAAFDPTDDNQYDFSKSAAQDWWIERGATGDNPDITDVEAFANSAPWFLTNSGYATGGRNS GSNNLANPEKFAQYMAKNVEHLESLGANVDTVEPFNESETSYWGTPGDMASKYTDESDDNTKLINNYWDKYYSDK DKSVTPYANALKKPQEGMHVSNAQQQQTITALAEALKDNDDTIIAATDATNSADFVKSYNQYPQAIKDLIGQYNV HAYSDSNQMQSRDIAQADGKKLSMSEVDGSWQSGSYNPYGFDNALGMMSKISSNVTRLQSKDFTFWQVVEDLYNM QMGSNVNPAGENTNWGTVLIDFDCTVAGMDGKLYSERRVNNNGGTTDGLEPCTVIANAKYNGVKAITHFIHAGDK VIANNDEDNNMTATSDDGKTQTVIHRNSGTSDQTFVIDLSKYGEIADNAYGELYLTTETSAEDKNAGVDSATPEV FAKTSNVKQAEGSVMIDKAAKTATVTVPARSIASIQLTGVTGYAKDAAVETGDTYQLVGKQSGKAVADTTSGDSA LSLANVASDAENAKKQTWTFTQIEQPADSERPDLKVYVITNAEGKVLVSKDGTNALSNETVEAAKSDPAAKWILN TSDGSTYQLLNAATKTNLDVDNSGTTVGTKVGLWQSPSGTSPSANQTWTLRNVTPTSQKTVNVQTAVNEKAALPT EVTLYYTWGEGKATVANWDTSKVDVAKEGTYEATATATDVYGNEFNVAATVYVGALTVSDPVSATVLAGTSASEA KAALEAAPVYLHVKASPAFEGDAAKVTWNFDGLDTKLADAKAGDNIAVTGTYQLDDATTIALKGAIYVTAATPEN VADTASSLTVTNQQTEYSKGDQWKKLTDGDTSAEAWVTWNSAGDYSASPTATIDFGSECELSSVTITYGDKAPAS AKAEYTTDGETWMQFGSDVKPAAGQTVTFKADKGTVNATKVRIVNTVNNDYMNATEIQAFVTPVQGAAKNIAAAS GTNFSVNFQEGASASKAIDGDTTSKGWSTWASTASTVDPVATFTFDEAQTITEVKTFFYYDGRASWPKSQTLEYQ DEAGEWHGVGTKDGWKIQAGDAGSGSDGITAADTPTVDFVLGTPVKAKAIRLTNTLQDTKVYINVAEIQVFAQDS TVLTPQPASDATLGDLRLDGETVEGFDPAKTDYTVDLPVDAEANPVLQAFATDNAAAVKVTGDAVENGQLGGKAA ITVTSADESETKTYTVTFNAFTLASLKVIGPTKTEYAIGDKLDTAGLKVTAVYQSGDKTKEVPVALDDPQLAIGS FDSTTAGKKAITVSYRGVTATFNVTVKANAVAPGPEEQKPGNTNKPGATGSGNKNTVANTGSSVAAIAGAVALLA AAAGALFMLRKRA Suitably, the present B. longum transitional strain comprises a glycosyl hydrolase family 43_32 (GH42_32) gene. Suitably, the GH42_32 gene comprises SEQ ID NO: 25 or a sequence with at least 60% sequence identity to SEQ ID NO: 25. Suitably, the GH42_32 gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 25. SEQ ID NO: 25 ATGACCGCAACCATCAGCAACGGTGTATCCGCCAGCTACAGCCCTGCGGAAGACGAGCTCGGCGCAGCTGACCCC ACCGCCTTGCTTGCCGAATCTGGCGATTTGAAGCCGCTGGCCGAACGCACTTATACGAATCCGGTTCCATATGCG GACGGTAAGTCCCATACCGCGCCCGACCCGTTCGTGCTCAAATACCGCGACCTCTACTACTGCTATGCCACCGAC GAGCACGGCATTCTGGTCTCCACCTCACCGGACATGGTGCACTGGACCTCACATGGATTCTGCTACACCGAAGCC GGACGCAGAAACTTCTGGGCCCCATCGGTGATTCTCATCAACGGCGTCTTTCACATGTACTTCTCGAATATGCCG GCCGAGGAGACCGACACCCACACGGAAATCATGCGTGTGGCCGTGAGCGAGGATCCGCTCGGCCCGTTCGAAAAG AAAGCGGAGCTGTTCAACACCTTCGCCATCGACTCCCAAGTGGTCTATGGCGATGACGGCCAGTTGTACTTGCTT TACGCCGACAATCAGGTCACCGGCCTGAGCGATGACCGGCCCGGAACCTCCGTGATGATCGATCGCCTTGTGACC CCGTATTCGCGTGAGAACAAACCGCGCCCGCTCATCGTGCCCACCATGGACGAGGAGATCTTTGCCCGCAACCGT TTCGGCGATGGCCGCGACTGGCACACCGTAGAAGGCGCCACATACTTCGCCTACCGTGACCGCGCGTTCATCACC TACTCGGCCAACGCCTACGAGCATGAGGACTACTTCGTCGGATACTCGTACGCACAGCTGCCGAATAAGCAGGCC GACGCCCACATCGATCAGCTCGATTGGACGAAACAGCTCAACGAGAACCGCTTCGATCCGCTGCTTATCCGCAGC CCAAAGGTTGAAGGCACGGGCCACAACTCCATAGTCAAAGCGCCCAATGCCGTTGATGACTGGATTGTCTACCAC GGCCGTAACGCCGATGACGAGCTGTATGTGGGCACCGAACAGCGCGTAATGCGCATCGACCCGCTGTACTACGCC GAAGGAGGGCTCGACACCCCAGGACCTACCGCCGCCGCTCAAAGCGCACCGCTGTATGGCACTGTGCATGATGAT TTTGCGGATGGCCTGAACGCCGGATGGTCGGTTATTTCCGGTGCGGCCCACACCGAATCCGATGTGGACGGTCAC GCGCTTGTTGCCGACGAATCCAGTGTATTCATCGCTGTGTCGGGCAAATCGTCCGCAACCCAAGTGATTGACGTC TGGGCCAAAGCTCCCGTCACCCCACTGGGCGCACGATTCGGTATCGTGGTGCGGTACCAGGATGCCAACAACCTC ACCAAACTCGAGGTGGATGCTGGCCGTCAGGTAATTAGCGTGGTCGATGTGATCGGCGGCGTTGCCTCCGAACGC GTGACCAATGCCGACCTCCATGACTTCGATTCCCATGCCTGGCATGAGTACCGGCTTGAGCGCCGCTACTGCAGG CTGGAGATCCGCATTGATGGCCGTTTCGCCGCGTCCTGCACCATCAGTGATAAGCCCGGTCGGGCGGGATTGTTC TCGTTGCGAACGGGGGCCGCGTTCAGCGCATATGCGGCCACTGAACATGTGAATCTGTGGGGTGCCGGATTGCGG GATCTCGGTCGAGAATTGCATGCTGACCGCCGACTCGTCATCGACGGCGGCGTGAGGTCCAGCGGCGTGTGTCCG GTAACACTCGAACTGGCATACCCGCTGGTCAGCAACCGTTTCGTCCTTGATTTCGCTGGGCAGACGAGCCGTGGG CAGGCGCTGTTGTCTCTTGGCGAATACCGTTTGTCCGGCACGGCATCATCCGTGGAGTTCATGCGCAACGGCAAG TCTCTGCCTTCCACCCCGGAGCCGGCCAGGCTGCGTGTCTTTGAAGACAACGTCCGCCGTGACCGTTCGGGCCGA GCCGTGCTCACCATCCGTATCGAAGCTCTGAACGGCACGATGCGACTGCACCTACGTGGCAAAACCTGGCAGGTG CCGTTTGCGGACAATGCGGCCCGTGCCCGTATCACTCTTGATCGCGCATCCCTGACCGGATACGAGAGGACATCG CTGGAATCCAGCATCGAGGAAAGGAGTGCGTCCGGCAATTGA Suitably, the GH42_32 gene may encode a protein shown as SEQ ID NO: 26 or a sequence with at least 80% sequence identity to SEQ ID NO: 26. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 26. SEQ ID NO: 26 MTATISNGVSASYSPAEDELGAADPTALLAESGDLKPLAERTYTNPVPYADGKSHTAPDPFVLKYRDLYYCYATD EHGILVSTSPDMVHWTSHGFCYTEAGRRNFWAPSVILINGVFHMYFSNMPAEETDTHTEIMRVAVSEDPLGPFEK KAELFNTFAIDSQVVYGDDGQLYLLYADNQVTGLSDDRPGTSVMIDRLVTPYSRENKPRPLIVPTMDEEIFARNR FGDGRDWHTVEGATYFAYRDRAFITYSANAYEHEDYFVGYSYAQLPNKQADAHIDQLDWTKQLNENRFDPLLIRS PKVEGTGHNSIVKAPNAVDDWIVYHGRNADDELYVGTEQRVMRIDPLYYAEGGLDTPGPTAAAQSAPLYGTVHDD FADGLNAGWSVISGAAHTESDVDGHALVADESSVFIAVSGKSSATQVIDVWAKAPVTPLGARFGIVVRYQDANNL TKLEVDAGRQVISVVDVIGGVASERVTNADLHDFDSHAWHEYRLERRYCRLEIRIDGRFAASCTISDKPGRAGLF SLRTGAAFSAYAATEHVNLWGAGLRDLGRELHADRRLVIDGGVRSSGVCPVTLELAYPLVSNRFVLDFAGQTSRG QALLSLGEYRLSGTASSVEFMRNGKSLPSTPEPARLRVFEDNVRRDRSGRAVLTIRIEALNGTMRLHLRGKTWQV PFADNAARARITLDRASLTGYERTSLESSIEERSASGN Suitably, the B. longum transitional strain comprises one or more genes selected from a GH43_24, GH127, GH30_5, and GH 43_32 gene as defined herein. Suitably, the B. longum transitional strain comprises a GH43_17 gene and one or more selected from a GH43_24, GH127, GH30_5, and GH 43_32 gene as defined herein. Suitably, the B. longum transitional strain comprises a GH43_17, GH43_24, GH127, GH30_5, and GH 43_32 gene as defined herein. Suitably, the B. longum transitional strain comprises a GH43_17, GH43_22, GH43_27, GH43_29, GH121, GH43_24, GH127, GH30_5, and GH 43_32 gene as defined herein. Suitably, the B. longum transitional strain comprises a GH43_17, GH43_22, GH43_27, GH43_29, GH121, GH43_24, GH127, GH30_5, GH 43_32, as defined herein. GH43_17 gene cluster Suitably, the B. longum transitional strain may comprise one or more genes encoding for a family 31 glucosidase (GH31), an ABC transporter, a Lac-I type regulator, a MFS transporter and/or an AraC family transcriptional regulator. Suitably, the present B. longum transitional strain comprises a glycosyl hydrolase family 31 (GH31) gene. Suitably, the GH31 gene comprises SEQ ID NO: 27 or a sequence with at least 60% sequence identity to SEQ ID NO: 27. Suitably, the GH31 gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 27. SEQ ID NO: 27 ATGACAACTTCATTCACCATCGACGGCAACGCCCTGATCTGGACCGGGGACGGCGAAACCCTGCGCATCGAACCT TGGGAAGAGAACAGCGTACGTGTACGCGCCACCCGCAACCGTGGCTTCGGCCCGGTCGATTGGGCGCTTCTGGAA CCGAAGAATGAATCCGGCCGTGTCGCAGACATCGCCGTCGGCGAGGACGGCGAACACGCCAGCCTGACCAACGGC AGCATCACCGTTAAAGCGGATTCGAATCATGCTCCATTGCTGTCTGCCGGATATGAAACCTTCCGGTGTGACCTG AGCTTCTGGAACGCCGAAGGCGAACTCCTGTTCCGCGAATATCCACAAGGTGGGTCGCTTTTGCTCAAGGCGCGT GACTACACTCCGGTGTCCGGTGAAAGCTTCGCCGTGACCACGTCTTTCAGCGCCGATCCCAAAGAACGGCTGTAT GGCATGGGCGAATACCAACAGGACGTGCTTGACCTCAAAGGCTCCACCTTTGAACTTGCGCACCGTAATTCCCAA GCCTCCGTGCCGTTCGTCGTCTCCTCCAAGGGGTACGGCTTCCTGTGGCACAATCCGGCTATTGGCCGCGCCACT TTTGGACGCAACCGAACCGAATGGGCGGCTCAGTCCACTGACCAGATTGACTACTGGGTCACCGCCGGTGACTCC TACGCGCAGATCGAATCGCAATATGCCGACGCCACCGGACATGCGCCAGTCATGCCTGAATGGGGTATGGGCTTC TGGCAGTGCAAGCTGCGTTACTGGAACCAGGAACAATTGCTTGACGTGGCCCGAGGCTTCAAATCCCGGAACATC CCGCTAGACCTCATCGTCATTGACTTCTTTCACTGGCCTCATTTGGGCGACTATAAGTTCGAGGACGAATTCTGG CCTGATCCCGAGGCCATGGTCGCCGAGCTCAACAGCATGGGCGTCAAGCTCATGGTGTCTGTGTGGCCGCAGGTC TCGGTCTCATCCGAGAACTTCGTGGAGATGAAGCGCAACAACTATCTGGTAAGCGCTGAAGCTGGGCTCAATCTT GACATGATGTTCGAAGAGCCGTGCGTCAACTATGATCCCACCAACCCGGGAGCTCGCAAATTTGTGTGGGACAAG TGCAAGGCCAACTATTGGGACAAGGGCGTGCGCGCCTTCTGGCTGGATGAGGCCGAACCCGAATATGGTGTCTAC GATTTTCGCAACTACCGCTACCACATGGGCAGCGACCTCAACGTGGGTAACGTCTATCCGCAGGCTTACAACCGC GGATTCTACGAGGGGCAGATAGAAGCCGGCATGGAAGGCGAGATCGTTAACCTGACTCGATGTGCGTGGGCTGGA TCTCAACGTTACGGATCGTTGGTCTGGTCTGGAGACGTTGGCTCCACATTCGCCGATCTGAAATCGCAGATTACC TGTGCTATTCACATGGGTATGGCTGGCATCCCTTGGTTCACTACAGACATGGGCGGCTTCCATGATGGGGTGATC GATTCGGATTCATTCAAGGAGCTGCTGGCCCGCTGGTGCGCGTTCTCCTGCTTCCTGCCCGTCATGCGCAACCAT GGTGACCGCAGCCTGGGGGAGTCGACCGGCAAGCAAACCATCACCAAGGCAACCGGTGAGCACCGTTCGCCTTCG GGCGCGGACAACGAGCCATGGAGCTATGGCCCTGAAATGGAGTCCATATTCCGTAAATACATCGCCGTGCGCGAG GTCATGCGCCCGTATACCCGTGAACTGTTCCAGTCTGCCCATGAGCAGGGTCAGCCGTTGGTGCGAGGACTGTTC TACGAGTTTCCGACCGATGAACACGTGGCCGACATTGCGGACGAATACCTGTACGGTCCTGACATTCTTGTGGCT CCCGTAGTCGAGGCCGGTGCTGCTTCCCGTAGCGTCTACCTTCCTGGCGATGAGACGACCACTTGGACTGATTTG CGAGACGGTGCCGTATACGCGGGTGGGCAGAGCATCGAGTCGTCTGCAGCAATCGACACGGTCCCTGCCTTTGCG CGAGATGGTCGGGACCATGGTTTGATTGGTCTGTTGTAG Suitably, the GH31 gene may encode a protein shown as SEQ ID NO: 28 or a sequence with at least 80% sequence identity to SEQ ID NO: 28. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 28. SEQ ID NO: 28 MTTSFTIDGNALIWTGDGETLRIEPWEENSVRVRATRNRGFGPVDWALLEPKNESGRVADIAVGEDGEHASLTNG SITVKADSNHAPLLSAGYETFRCDLSFWNAEGELLFREYPQGGSLLLKARDYTPVSGESFAVTTSFSADPKERLY GMGEYQQDVLDLKGSTFELAHRNSQASVPFVVSSKGYGFLWHNPAIGRATFGRNRTEWAAQSTDQIDYWVTAGDS YAQIESQYADATGHAPVMPEWGMGFWQCKLRYWNQEQLLDVARGFKSRNIPLDLIVIDFFHWPHLGDYKFEDEFW PDPEAMVAELNSMGVKLMVSVWPQVSVSSENFVEMKRNNYLVSAEAGLNLDMMFEEPCVNYDPTNPGARKFVWDK CKANYWDKGVRAFWLDEAEPEYGVYDFRNYRYHMGSDLNVGNVYPQAYNRGFYEGQIEAGMEGEIVNLTRCAWAG SQRYGSLVWSGDVGSTFADLKSQITCAIHMGMAGIPWFTTDMGGFHDGVIDSDSFKELLARWCAFSCFLPVMRNH GDRSLGESTGKQTITKATGEHRSPSGADNEPWSYGPEMESIFRKYIAVREVMRPYTRELFQSAHEQGQPLVRGLF YEFPTDEHVADIADEYLYGPDILVAPVVEAGAASRSVYLPGDETTTWTDLRDGAVYAGGQSIESSAAIDTVPAFA RDGRDHGLIGLL Suitably, the present B. longum transitional strain comprises one or more ABC transporter genes. Suitably, the ABC transporter genes comprise SEQ ID NO: 29-31 or sequences with at least 60% sequence identity to SEQ ID NO: 29-31. Suitably, the ABC transporter gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 29-31. Suitably, the present B. longum transitional strain comprises a gene with at least 60% sequence identity to SEQ ID NO: 29, a gene with at least 60% sequence identity to SEQ ID NO: 30 and a gene with at least 60% sequence identity to SEQ ID NO: 31. SEQ ID NO: 29 ATGACGCATCGTAGCACCTGGTGGAAAACCGCTCTCGGCATCATATTGACGCTCATCATGATGTTTCCTGTCTAC TGGATGATCAACATCTCGTTCACTGGTAAGGCATCCATTCGTTCCGGCGACCTGTGGCCCAAGGATTTCACCTTT GACAACTACGCCCGCGTAATCGCCGACCAAATGCCCTATCTGGGCACTTCCATCCTCGTAGCGGTATGCTGCGTG ATTCTAACGCTGGTCATCGCACTGCCTGCCGCCTACGCACTGGCTTTGCTGCGCTGTCCAGGCAGCGGCGCGCTC AGCTTCCTGCTCATCGTGGCTCAGATGATTCCCGCCGTCGTGATGTCGCTCGGCTTCTACGAGATTTATAACAAC ATTGGTCTGCTCGATACGTTGCCCGGCCTGATCCTCGCCGACTCGACCATTGCGGTGCCGTTCGCGGTCATGCTC CTGACTTCTTTCATGGCCGGCATCCCGCGGTCCCTGCTTGAGGCCGCCGAAGTGGATGGAGCCTCACGTACCCGT CGCTTCTTTTCCATTGTCATCCCGTTATCGCGCAATTCGATCGTGACCGTCTCCCTGTTCGCTTTCCTATGGTCT TGGAGCGACTTCCTGTTCGCTTCCACCCTTGACTCCGGCGGCGGCAAGATGCGCCCGATCACTATGGGTCTGTAC AACTATATCGGTGCGCAGACCCAGGAATGGGGGCCGATGATGGCCACCGCAGTGCTTGCATCCATTCCCGCGACC ATCCTGCTTGTCTTCGCCCAGAAGTACGTCGCCGCAGGCGTGACCGCCGGTGCTGTTAAGGACTAA SEQ ID NO: 30 ATGACAGCCTCAACAACAAGCCCCGTTCGCCGGGCAAAGTCCGGCACTCCGGTCCGGGCCAAACTGGCCATCGCC GGATTCATTGCCCCACTGATTATCTACTTGGTAATCTTTTACGCGTTCCCGCTCATCCAGAACGTGTCAATGAGC CTGCACCGATACACGCGACGAACCTTCGTTACCGGAGATGCGCTGTTCGTGGGTCTCGACATCTACAAGGAAGTC ATTTCCTCCGTGGAGTTCTGGCCGGTTGTGGGGCAGACCTTCGTGTTCGTGGTCGTCTCGCTGATATTCCAATAT GTAATCGGCTTGGCCCTGGCGGTGTTCTTCAACGATAACTTCAAGCTCTCTGGTGTGCTGCGCGGCATCATGCTG GTTCCGTGGCTGTTGCCGCTGATTGTTTCTGGAACCGTCTGGCAGTGGATGATGGACCCTGACTCCGGCATCCTC AACATGTTCCTCGGTCTGTTTGACATCGAACCCATCTGGTGGCTCCAGGCGGATAACTCGCTGTGGGCCGTCATC ATCGCCAACATCTGGCTGGGAATCCCCTTCAACCTCGTGATCCTGTATTCCGGCCTACAGAACATCAGCGGCGAC CTGTATGAAGCCGCCTCCCTCGATGGCTGCAACGCCTGGCAGCGCTTCTGGAAGATCACCTTCCCTCTCCTGAAG CCCGTCACTTCGATCACCCTGTTGCTCGGCTTCGTCTATACATTGAAGGTCGTTGACGTGATCTGGATGATGTCC CAGGGAACCGGCACCTCGCGTACCCTCGCCACCTGGGCCTATTCGATGGCATTTGGCAAGGGAACTTCAATGACT ATCAAATACTCGGAGGCTTCGGTGCTCGGCACGATTCTCATCATCGTGGCGTTGATTTTCGGACTGATTTACCTG CGGGTCCAGAAGACCCAGGAAACCTGCTAA SEQ ID NO: 31 ATGAAGTCCAATACCGCTCTTAAGATAACCGCCGCATTATGCTCCTGCGCCATGCTTGTCGGCGTCAGCGCCTGT GGTTCGAGCAACAGCACCACGGATGATAAGGTGATCGAATGGTGGGATGACTGGACCCGCCACGAGGATGGCTCC GAGTTCGACAAACTGGTCAAGGCGTGTGCGCCCGAAGGCTACACAATTGAGCGCCAAGCCATCGCCACTTCCGAC CTGCTCAACAACCTCACCACCGCAATCAAGGAAGACAATGGCCCGGATGTTGCGGTCATCGACAACCCGATGATT CCGTCCGCCGTCGATGCGGGTTTGGTTGCTGGTTCCGACGAAACTGGTCTTGACGTTTCTGCCTGGGATGAGAAC CTTGAGGCTCCGGGCGTAGTGGACGGCCAGGCATATGGCGTGCCGCTGGGCGGATCCAACACGTTGGGTCTTATG TACAACCCCACCATCATTGAGGCAGCCGGTGTGGATGTATCCACCATCACCGATTGGGATTCGCTCAACGCGGCC ATCAAGAAGGTCGTTGACGCCGGATACAAGGGCATTACGTTCTCGGGCATCTCGGGTGAGGAAGGCGTCTTCCAG TTCCTGCCTTGGTTCTGGGGCGCAGGTGGTGATCTGTCCAAGCTTGACTCCCAGGCGCAGAAGGACGCCGAAGAC CTGCTTTCCGGGTGGATCAGCAAGGGATGGGCTCCCAAGTCCGCCACGACCAACACCCAGTCGGCCTCCTGGGAT CTGTTCCTGGCTGGCGACTACGGATTTGCTGAAATCGGCACCTGGATGCAGTCCGAGGCAGACGAGGCCGGAGCC AAACTTATTCCGATCCCCGCAAAGGATGGCGGCGTGGCCACCGTGCCGACCGGTGGCGAGTTCGCCATGGTCGCC TACCACAAGAAGGATGCGGAATCCCACTACAAGCTCGCCAATCAGGTTATCGAATGTCTTTCCGAGGACGAGACT CTGCTTAAGGTAAGCAACGCTCTGAGCAACCTCGCTGCCAAGAAGGCCGTGCGTGCCGAGCAGCTCGCGGCTAGC GACGGCTTGGCTCAGTGGAAGGAATCCATCGAGAACGCCGCCGGCCGTACCTCCGACTTGGGTCTCAAATACGAG GAAGCCTCCGCAAGCATCTCCGAATCCCTGCTGGCGGCCCTTAACGCGGCTTGA Suitably, the ABC transporter genes may encode a proteins shown as SEQ ID NO: 32-34 or polypeptide with at least 80% sequence identity to SEQ ID NO: 32-34. Suitably, the gene may encode a polypeptide with at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 32. Suitably, the gene may encode a polypeptide with at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 33. Suitably, the gene may encode a polypeptide with at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 34. SEQ ID NO: 32 MTHRSTWWKTALGIILTLIMMFPVYWMINISFTGKASIRSGDLWPKDFTFDNYARVIADQMPYLGTSILVAVCCV ILTLVIALPAAYALALLRCPGSGALSFLLIVAQMIPAVVMSLGFYEIYNNIGLLDTLPGLILADSTIAVPFAVML LTSFMAGIPRSLLEAAEVDGASRTRRFFSIVIPLSRNSIVTVSLFAFLWSWSDFLFASTLDSGGGKMRPITMGLY NYIGAQTQEWGPMMATAVLASIPATILLVFAQKYVAAGVTAGAVKD SEQ ID NO: 33 MTASTTSPVRRAKSGTPVRAKLAIAGFIAPLIIYLVIFYAFPLIQNVSMSLHRYTRRTFVTGDALFVGLDIYKEV ISSVEFWPVVGQTFVFVVVSLIFQYVIGLALAVFFNDNFKLSGVLRGIMLVPWLLPLIVSGTVWQWMMDPDSGIL NMFLGLFDIEPIWWLQADNSLWAVIIANIWLGIPFNLVILYSGLQNISGDLYEAASLDGCNAWQRFWKITFPLLK PVTSITLLLGFVYTLKVVDVIWMMSQGTGTSRTLATWAYSMAFGKGTSMTIKYSEASVLGTILIIVALIFGLIYL RVQKTQETC SEQ ID NO: 34 MKSNTALKITAALCSCAMLVGVSACGSSNSTTDDKVIEWWDDWTRHEDGSEFDKLVKACAPEGYTIERQAIATSD LLNNLTTAIKEDNGPDVAVIDNPMIPSAVDAGLVAGSDETGLDVSAWDENLEAPGVVDGQAYGVPLGGSNTLGLM YNPTIIEAAGVDVSTITDWDSLNAAIKKVVDAGYKGITFSGISGEEGVFQFLPWFWGAGGDLSKLDSQAQKDAED LLSGWISKGWAPKSATTNTQSASWDLFLAGDYGFAEIGTWMQSEADEAGAKLIPIPAKDGGVATVPTGGEFAMVA YHKKDAESHYKLANQVIECLSEDETLLKVSNALSNLAAKKAVRAEQLAASDGLAQWKESIENAAGRTSDLGLKYE EASASISESLLAALNAA Suitably, the present B. longum transitional strain comprises a Lac-I type regulator gene. Suitably, the Lac-I type regulator gene comprises SEQ ID NO: 35 or a sequence with at least 60% sequence identity to SEQ ID NO: 35. Suitably, the Lac-I type regulator gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 35. SEQ ID NO: 35 ATGGTGACCATCAACGACGTGGCGCGGGAGGCAGGAGTCTCCAAAACCACGGTCTCATTCGTGCTTTCGGGCTCG CGCCCCGTTGCTGCAGCCACCGAACAACGTATCCGTGAGGCAATGGACAGACTCGGCTATACCGTCAATCATGCC GCCCGCAGCTTGTCCACTTCGAAGACCATGACCATAGCCGTGGTGACCAGCAACCGGCAGGACGCCTACTTTGAC ATTGCCCGTGGCACATACATCAACGGCTTATCCCGAGCAGCCGCCGAAACCGGCTACGACATGCTCATCACTAAC GATCCAGACGGCTCCGCTACGGAGAACGCCTGCCAATCACACAAGGCGGATGGGCTGGTTTTTTTAGACGTCAGG CAGAACGATCCGCGTGTGCCGATTGCCGCTGAATCCGGCATTCCAACAGTCTCGCTAGGAGTCCCAGTCAATCCA ATGAATCTTGATGTGGTCGACACCGACTTCACGGACATGGCGGCCTCGACCATGCGTACACTGCACGATGCCGGA CACCGCCGCGTCAGCGTCATCACGCTCAGTAGCCGGGTGATTGCCGAACAACTCAACGACACCGCTCGATTCCTC AGGGAAATCGAACGTTCCGGAGAACGACTTGGCATGCATGCCACTATCCGACATTGCTCTACAAGGCCCGGAATC ATCGACACAGACATCGCTCGCATTCTTGACGGTCGAGGTGAGGACACCGCATTCGTCATCCATAATGAATCGGCC GTATTGGTGTTCAGACGGGCAGTGGAACATCGCGGACTGCGCATCCCCGAGGATATCTCCGTCATCGCCATCAAT GAAAAGCAGATGTCGGACGCTCTGTATCTGCCATATTCCGCCTACGAAAACGACGTGGAACTGGTCACCCAATCT GCCGTCAATACGCTTGTGGACCGTATCGAACATCCCGAGCTGACGCCGACACGAACGTTGATCAAGGCCTCGTAC ATAGATCGAGACTCCGTGGCCAATATCTGA Suitably, the Lac-I type regulator gene may encode a protein shown as SEQ ID NO: 36 or a sequence with at least 80% sequence identity to SEQ ID NO: 36. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 36. SEQ ID NO: 36 MVTINDVAREAGVSKTTVSFVLSGSRPVAAATEQRIREAMDRLGYTVNHAARSLSTSKTMTIAVVTSN RQDAYFDIARGTYINGLSRAAAETGYDMLITNDPDGSATENACQSHKADGLVFLDVRQNDPRVPIAAE SGIPTVSLGVPVNPMNLDVVDTDFTDMAASTMRTLHDAGHRRVSVITLSSRVIAEQLNDTARFLREIE RSGERLGMHATIRHCSTRPGIIDTDIARILDGRGEDTAFVIHNESAVLVFRRAVEHRGLRIPEDISVI AINEKQMSDALYLPYSAYENDVELVTQSAVNTLVDRIEHPELTPTRTLIKASYIDRDSVANI Suitably, the present B. longum transitional strain comprises a facilitator superfamily (MFS) gene. Suitably, the MFS gene comprises SEQ ID NO: 37 or a sequence with at least 60% sequence identity to SEQ ID NO: 37. Suitably, the MFS gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 37. SEQ ID NO: 37 ATCGCCGAGTTCCATTACGCTATCGGGCATTTTCATTGTGCCGGTCATCGGATTGGTTGCTCAGGCATTCCCGGA CAGCTCGCTCTCCAGCGTGCAGATGATTGTTTCGGCATCACTCTGACCGCACTGGTTGGCGCTTGGCTGACCGGC AAACTCGCCAGCATTCTATCCCGGAAGACCGTGGCACTGATTGGTGCAGGCGGCATGCTGCTGTTCGGTCTGCTG CCGTACTTCGTGCATTCCAGTCTGGCTGCAGTCATCGCGTTTTCCGCGTTGATGGGCGTATGCCTAGGCTTTATC AACAACGTGCTGCCTACTTTGATCTCCGTGCACTACGAGGGCGATGAGCGACAGTCGATTATGGGTCAGCAGGTT GCCGTGGCCAGCATCGGTGCGATGGTGTTCATGACCGTGGCCGGCAAACTCGCCACCGCACAGTGGTATCACGCC TACCTCATCTACTTGTTCGCCGCCGTGGTGCTGGTGGTCTGCGCATTCACGCTGCCCACCAAGAATGGTGAGACG GACGAAGCCGGCCGGATTCAGGGAACGGGGCCTTCCGCGTCGATTCGCGAGGTTATGACCGGCAAACTGTGGTTC TTGGTTGTTGCCGGCTTCTTCTTCCTTCTGGCGAACAATGCCTACAGCAACAACTTGTCCCTGTTGGTCGAGCAG CGCGGCTTGGGCGATGCCGGAACCGCTGGACTGATTTCCACCATCGGACAGTTCGGCGGACTGCTGGCTGGTTTG TGCGTCGGTCTTATGGTCCGATTCGTGAAGAACCATTTGCTGATGGTCGGCTTCATTGTCGAGGGCCTGTCTTTG CTGCTGCTTGGCTGCTCGGCCAGCCTGCCACTGCTCATCATCGGCAGTTTCTTTGCCGGAGCCGGCCTGAGCATC TACTATGCGCAGGCGCCATTCCTCGTCACCGTCATCGAAAAGCCCTACCTCATCCCGCTGGGCATTGCTGCCATG ACCACGGCCAACGCACTGGGCGGATTTGCCAGCCCTGTGCTCGTCAACGCGATTAACGGACTGTTTGGTTCGCAC GCGGCCGGCGCGATGTTCATCGGTGCCGCGATTGCTCTGGCCGGAGCGGTGGCTCTCGGTGTGAGCGGATTCCAA AAGAAGTGCCTCGAAAGCGCGAAGTGA Suitably, the MFS gene may encode a protein shown as SEQ ID NO: 38 or a sequence with at least 80% sequence identity to SEQ ID NO: 38. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 38. SEQ ID NO: 38 MAEFHYAIGHFHCAGHRIGCSGIPGQLALQRADDCFGITLTALVGAWLTGKLASILSRKTVALIGAGGMLLFGLL PYFVHSSLAAVIAFSALMGVCLGFINNVLPTLISVHYEGDERQSIMGQQVAVASIGAMVFMTVAGKLATAQWYHA YLIYLFAAVVLVVCAFTLPTKNGETDEAGRIQGTGPSASIREVMTGKLWFLVVAGFFFLLANNAYSNNLSLLVEQ RGLGDAGTAGLISTIGQFGGLLAGLCVGLMVRFVKNHLLMVGFIVEGLSLLLLGCSASLPLLIIGSFFAGAGLSI YYAQAPFLVTVIEKPYLIPLGIAAMTTANALGGFASPVLVNAINGLFGSHAAGAMFIGAAIALAGAVALGVSGFQ KKCLESAK Suitably, the present B. longum transitional strain comprises an AraC family transcriptional regulator gene. Suitably, the AraC gene comprises SEQ ID NO: 39 or a sequence with at least 60% sequence identity to SEQ ID NO: 39. Suitably, the AraC gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 39. SEQ ID NO: 39 ATGGAGCGCGATGCTTTCCGGCTGCCGGGCCTCACCGCCGGCGATGACAACCAGTATGCCGATCACACGCTCACC GGCATGGCAGCCGATGCGGCGAACGTCATAGCCGCAGGCGGTCCCGCCCCGCTGACTAGCTTCGGCACTGTCGCT CAAGCCGCCCATCTCAATCCAGATGACGGCTTCGGCATCATTGGCCATGATCTTGCACACCCATCGCACCTACAC CGGCATGACTATATGGAAATCACGCACGCCATCGCCGGTACGGTACTGGTCTGGGTCGAAGGAGAGACCAACGTG CTGACACAGGGCGGCACCATACTCATCAAGCCTGGAGCCCGTCATCTCATCTCCCCCATCATCGAATACGGGCAA ACACCACACGAGGCGGACATCCTGATTAAACCCGAGCTCATCAGGCAATGCCGCATTCCGATTCTGGAAGCAGCC GGCGCCGACCGGATGTTCATTAGCTGGCTTGACGATGACCGGCAGACCCACTGCCTGCTGGCAGCCGGCAAGCAC CACGCCGGCGAGGCCGCTATCAGCCGCATGTTCATCGCCTACTGCATCAACGCAACCTACAGGCCAGACTTCACC GTCATCGGCAACCTGCTCGAGCTGTTCCACGAAACGTCCCGAGTCTTGGAACACCAGCCACGTACCGATCCGCTG ATCGCCGCCATCATCGAAACCATCACGGCAGATCCCGCCACGGCCCACAACCAGGCCATAGCGGACACACTTGGA TACAGCGTGGGATATCTGTCCCGGTACGCGCGCAAGCACAGCGGGCACACACTCGGCCAACTCATCAACGAGGAA AGGCTCCGACTCGGCGCCGAACTGCTCGTCACCACCGACGACACCATTGCCGAAATCACCCGAACCATTGGCTAC GAAAGTCCAGCCTATTTCCATAAACTCTTCCGCAGCCGCTACCTCATTACCCCCGACCGCTACCGCAACGACTTC CGTATCGCATTACGTTGCGGATGA Suitably, the AraC gene may encode a protein shown as SEQ ID NO: 40 or a sequence with at least 80% sequence identity to SEQ ID NO: 40. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 40. SEQ ID NO: 40 MERDAFRLPGLTAGDDNQYADHTLTGMAADAANVIAAGGPAPLTSFGTVAQAAHLNPDDGFGIIGHDLAHPSHLH RHDYMEITHAIAGTVLVWVEGETNVLTQGGTILIKPGARHLISPIIEYGQTPHEADILIKPELIRQCRIPILEAA GADRMFISWLDDDRQTHCLLAAGKHHAGEAAISRMFIAYCINATYRPDFTVIGNLLELFHETSRVLEHQPRTDPL IAAIIETITADPATAHNQAIADTLGYSVGYLSRYARKHSGHTLGQLINEERLRLGAELLVTTDDTIAEITRTIGY ESPAYFHKLFRSRYLITPDRYRNDFRIALRCG Suitably, the B. longum transitional strain comprises a MFS transporter and an AraC family transcriptional regulator gene. Suitably, the B. longum transitional strain comprises a GH43_17, a MFS transporter and an AraC family transcriptional regulator gene. Suitably, the GH43_17, MFS transporter and AraC family transcriptional regulator genes are comprised in a gene cluster.. As used herein, a ‘gene cluster’ may refer to a group of genes that are located next to each other in a chromosome. Suitably, the B. longum transitional strain comprises each of a GH31, an ABC transporter, a Lac-I type regulator, a MFS transporter and/or an AraC family transcriptional regulator gene. Suitably, the B. longum transitional strain comprises a GH43_17, a MFS transporter, an AraC, a GH31, an ABC transporter, and a Lac-I type regulator gene. Suitably, the GH43_17, MFS transporter, AraC family transcriptional regulator, GH31, ABC transporter, and Lac-I type regulator genes are comprised in aa gene cluster as described above. Suitably, the B. longum transitional strain further comprises a xylulose kinase gene and/or a xylose isomerase gene. Suitably, the xylulose kinase gene and/or xylose isomerase genes are comprised in a gene cluster as defined above. Suitably, the xylulose kinase gene comprises SEQ ID NO: 41 or a sequence with at least 60% sequence identity to SEQ ID NO: 41. Suitably, the xylulose kinase gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 41. SEQ ID NO: 41 ATGACGAGAGTACTGGTTGCCGGCGTAGATACGTCAACTCAATCAACAAAGGTCCGCATTACGGACGC CGCCACCGGCGAACAGGTTCGGTTCGGGCAGGCCAAGCACCCGGATGGCACCTCGGTCAACCCGGAAT TCTGGTGGGAGGCCTTCACCAAGGCCGCCGAGCAGGCCGGCGGGCTTGACGATGTCGCGGCCCTCGCG GTTGGCGGCCAGCAGCATGGCATGGTCATTCTCGACAAGCAGGGCAACGTGATTCGCGATGCGATGCT CTGGAATGACACCAGTTCCGCCCCGCAGGCCGCCGCCCTGATCGACAAGCTCGGTGCAACTCCGGCCG AGGGCGACGAACCGGACGACGTGACCGCCCGCGGCAAGCAGCGCTGGGTCAAGGCCGTCGGGTCCTCC CCCGTCGCTTCCTACACGCTGACCAAGGTGGCGTGGGTGGCCGAGAACGAGCCTGAGAACGCCAAGAA GATTGCCGCCGTCTGTCTGCCGCACGATTGGCTGAGCTGGCGTATCGCCGGCTATGGCCCGGTGGCCG AGGGCGAGGACGCTCATCTCGAAGCCCTGTTCACCGACCGTTCCGACGCTTCCGGCACCATTTACTAC GATGCCGCGCATGACGAGTACCGCCGCGATCTCATCGCCATGGTGCTGACCCCCGCCGAGGGCGAGGA AGCCGCCAAGGCCCACGCCGACGCCATTGTGCTGCCCACCGTGCTGGGCCCGCATGAGGCAGCCGCCG TCAAGGCCGACCCCGCCATTGCCGGCAAGGACGTTGAAGGCGGCTGCATCATCGGCCCCGGCGGCGGA GACAATGCCATGGCCTCGCTGGGCCTCGGCATGGCCGTGGGCGATGTGTCCGTATCGCTCGGCACCTC CGGCGTGGCCGCGGCCATCGCTGAAAACCCGGTGTACGACCTGACCGGAGCGATTTCTGGCTTTGCCG ACTGCACCGGTCATTATCTGCCGCTTGCCTGCACCATCAACGGTTCGCGCATTCTGGACGCCGGTCGC GCCGCCCTTGGCGTGGACTACGACGAGCTGGCCGAACTGGCCTTTAAGGCCGAGCCGGGTGCCGGCGG CATCACCCTGGTGCCGTACTTCGACGGCGAGCGTACGCCGAACCGTCCGGACGCCACCGCCTCGCTGA CTGGCCTGACCCTGCACAACACCACCAAGGAGAATCTGGCTCGTGCGTTCGTCGAAGGCCTGCTGTGT TCCCAGCGCGACTGCCTCGAGCTGATTCGTTCGCTGGGTGCCGAGATCAACCGCATCCTGCTCATTGG CGGTGGCGCGAAGTCCGTGGCCATCCGCACGCTGGCCCCCTCAATCCTCGGCATGGACGTGACCCGTC CGGCCACCGACGAATATGTGGCCATCGGCGCCGCCCGTCAGGCCGCCTGGGTGCTGTCCGGCGAGGCC GAACCGCTGACCTGGCAACTCACCATCGAGGGCGTGGAGACCGGCGAGCCCACCGAAGCCGTGTACGA GGCATACGCCAAGGCGCGCGGCTGA Suitably, the xylulose kinase gene may encode a protein shown as SEQ ID NO: 42 or a sequence with at least 80% sequence identity to SEQ ID NO: 42. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 42. SEQ ID NO: 42 MTRVLVAGVDTSTQSTKVRITDAATGEQVRFGQAKHPDGTSVNPEFWWEAFTKAAEQAGGLDDVAALAVGGQQHG MVILDKQGNVIRDAMLWNDTSSAPQAAALIDKLGATPAEGDEPDDVTARGKQRWVKAVGSSPVASYTLTKVAWVA ENEPENAKKIAAVCLPHDWLSWRIAGYGPVAEGEDAHLEALFTDRSDASGTIYYDAAHDEYRRDLIAMVLTPAEG EEAAKAHADAIVLPTVLGPHEAAAVKADPAIAGKDVEGGCIIGPGGGDNAMASLGLGMAVGDVSVSLGTSGVAAA IAENPVYDLTGAISGFADCTGHYLPLACTINGSRILDAGRAALGVDYDELAELAFKAEPGAGGITLVPYFDGERT PNRPDATASLTGLTLHNTTKENLARAFVEGLLCSQRDCLELIRSLGAEINRILLIGGGAKSVAIRTLAPSILGMD VTRPATDEYVAIGAARQAAWVLSGEAEPLTWQLTIEGVETGEPTEAVYEAYAKARG Suitably, the xylose isomerase gene comprises SEQ ID NO: 43 or a sequence with at least 60% sequence identity to SEQ ID NO: 43. Suitably, the xylose isomerase gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 43. SEQ ID NO: 43 ATGGGTCTGTGGGATGTTGACAAGATCGAGTACGTCGGCCGCGCCAAAGGACCGAAGGAAGACTTCGCCTTCCAT TACTACGATGCCGACAAGGTCGTTGCCGGCAAGAAGATGAAGGATTGGCTGCGCTTCGGCGTTGCTTGGTGGCAC ACCTTCAACCAGGAACTGGTTGATCCGTTCGGCACCGGCACCGCGCACCGCCCGTACTACAAGTACACCGATCCG ATGGACCAGGCTCTGGCCAAGGTCGACTACGCCTTCGAGCTGTTCCAGAAGCTGGGCGTCGAGTACTTCTGCTTC CACGATCGTGACATCGCCCCCGAAGGCGACACCCTGCGCGAGACCAACGCCAACCTCGACAAGGTCGTTGACAAG ATCGACGAGAATATGAAGTCCACCGGTGTCAAGCTGCTGTGGAACACCTCCTCCCTGTTCACCAACCCGCGCTTC GTGTCCGGCGCCGCCACTTCTCCGTTCGCCGACATCTACGCCTACGCCGGTGGCCAGCTCAAGAAGAGCTTGGAG ATCGGCAAGCGCCTGGGCGCCGAGAACTACGTGTTCTGGGGTGGCCGCGAAGGCTACGAGAACCTGTGGAACACC GAGATGAAGCGCGAGACCGACCACATCGCCAAGTTCTTCCACATGTGCGCAGATTACGCCAAGGAAATCGGCTTT GAGGCCCAGTTCCTGATCGAGCCGAAGCCGAAGGAGCCGACGCTGCACCAGTACGACTTCGATGCCGCCACCGCC ATCGAGTTCCTGCGCAACCACGACCTGACCGACGTCTTCAAGCTGAACTTGGAAGGCAACCACGCCAACCTGGCC GGCCACACCTACCAGCACGAGATCCGCGTGGCCCGCGAGTCCGGCTTCCTCGGTTCCCTCGACGCCAACCAGGGC GACAAGCTCATCGGCTGGGATATGGACGAGTTCCCGACCGATCTGTACGAGACCGTCGCCGTCATGTGGGAAGTC CTGCAGGCCGGCTCCATCGGACCTCACGGTGGTCTGAACTTCGACGCCAAGCCGCGCCGTACCTCCTTCTACGAG GAGGACCTGTTCCGCTCCCACATCGCCGGCATGGATGCCTACGCCGCCGGCCTGCTGGTTGCCGACAAGATGAAC CAGGACGGCTTCATCCAGAATCTTCAGGCCGAGCGCTACAGCTCCTACGACTCCGGCATCGGCAAGGACATCGAC GAGGGCAACGTCACCTTGGCCGACCTCGAAGCCTACAGCCTCGACAAGCCGCAGTCCGAGCTCATCGCCGCCACC AAGTCCGATCACCTCGAGTCCGTCAAGGCCACCATCAACAACTACATCATTGATGCCCTGGCTGAGGTCGAGTGA Suitably, the xylulose isomerase gene may encode a protein shown as SEQ ID NO: 44 or a sequence with at least 80% sequence identity to SEQ ID NO: 44. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 44. SEQ ID NO: 44 MGLWDVDKIEYVGRAKGPKEDFAFHYYDADKVVAGKKMKDWLRFGVAWWHTFNQELVDPFGTGTAHRPYYKYTDP MDQALAKVDYAFELFQKLGVEYFCFHDRDIAPEGDTLRETNANLDKVVDKIDENMKSTGVKLLWNTSSLFTNPRF VSGAATSPFADIYAYAGGQLKKSLEIGKRLGAENYVFWGGREGYENLWNTEMKRETDHIAKFFHMCADYAKEIGF EAQFLIEPKPKEPTLHQYDFDAATAIEFLRNHDLTDVFKLNLEGNHANLAGHTYQHEIRVARESGFLGSLDANQG DKLIGWDMDEFPTDLYETVAVMWEVLQAGSIGPHGGLNFDAKPRRTSFYEEDLFRSHIAGMDAYAAGLLVADKMN QDGFIQNLQAERYSSYDSGIGKDIDEGNVTLADLEAYSLDKPQSELIAATKSDHLESVKATINNYIIDALAEVE Human milk oligosaccharide (HMO) Suitably, the present B. longum transitional strain preferentially utilizes 3- fucosyllactose (3- FL) compared to other B. longum transitional strainsas demonstrated by a better growth, for example as shown in the present Examples. Suitably, the present B. longum transitional strain may have a growth rate of at least 0.6 k when cultured in the presence of 3-FL. Suitably, the present B. longum transitional strain may have a growth rate of at least 0.7 k, at least 0.8 k or at least 0.9 k when cultured in the presence of 3-FL. Growth rate may be calculated by culturing a bacterium on a given substrate, or mixture of substrates, for a period of time and modelling the growth curve using a logistic growth model, to obtain the relative growth rate k. An illustrative method for determining growth rate is provided in the present Examples. Without wishing to be bound by theory, preferential growth on 3-FL is considered to be advantageous as levels of 3-FL rise in human breastmilk during the weaning period. Preferentially growth on 3-FL indicates that the present B. longum transitional strain may be particularly adapted to survive and grow in the microbiome during the weaning phase. uitably, the present B. longum transitional strain comprises a glycosyl hydrolase family 25 (GH25) gene. Suitably, the GH25 gene comprises SEQ ID NO: 45 or a sequence with at least 60% sequence identity to SEQ ID NO: 45. Suitably, the GH25 gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 45. SEQ ID NO: 45 ATGAGCAATCCAACAAATGATGGTATCAACTTGAATTACCTCGCAAACGTGCGTCCCTCGTCGCGACAGCTTGTC TGGCAGCGTATGGAGATGTATGCCTTCATACACTTCGGCATGAATACCATGACAGACAGGGAATGGGGTCTTGGG CATGAGGATCCGGCGCTGTTCGATCCACAGAATGTAGATGTGGAACAGTGGATGGATGCGCTGGTGGCTGGTGGA ATGACTGGTGTCATCTTGACGTGCAAGCATCATGATGGATTCTGCCTGTGGCCATCGCGTTACACGCAGCATACC GTTGCCGCCTCGCCGTGGAGGGACGGAAAAGGGGATCTCGTTCGTGAGGTCAGTGAGTCCGCCAGACGTCATGGA CTGAAGTTCGGCGTATACCTGTCTCCGTGGGATCGAACCGAAGAATCCTATGGCAAAGGCAAGGCATATGACGAT TTCTACGTCGGACAATTGACTGAGTTGCTCACCCAGTACGGACCGATTTTCTCCGTATGGCTGGATGGTGCCAAT GGTGAGGGCAAGAACGGCAAGACTCAGTATTACGACTGGGATCGTTACTACAACGTCATTCGTTCGCTTCAACCC AATGCGGTGATATCCGTATGCGGTCCCGACGTTCGCTGGGCTGGAAATGAAGCCGGACATGTACGTGACAACGAA TGGAGTGTCGTGCCCCGACGACTGCGTTCGGCGGAACTGACTATGGAAAATTCACAGCAGGAGGACGATGCGTCC TTTGCTTCTACGGTTCGCTCTCAAGATGACGACCTTGGAAGTCGTGAGGCGGTTTCCGGATACGGGGATGACGTC TGTTGGTACCCAGCTGAGGTCGATACCTCCATTCGCCCTGGATGGTTCTATCACAAGTATGAAGACGACAAGGTC ATGAGCGCAGATCAGCTTTTTGACCTCTGGCTTTCCGCAGTCGGCGGTAATTCGTCTCTTCTGCTCAATATTCCT CCGTCTCCAGAAGGACTGTTCGCAGAACCGGATGTGGAGTCGCTCAAGGGGCTGGGAAGCCGTATCAATGAATTC CGCAAAGCATTGGCTTCGTCTTGTTGCGAGGTCAAGACCAGCAGCGCGGACGAAACTGCAATGCGACTTCTCGAT GGGAATCAGGACACGTATTGGTCTCCTGATGCCAATGACGTGGCCCCTGCCGTCACGCTCACTTTCCCGCAGCTG ACGACGATCAATGCCGTTGTGGTTGAAGAGGCCATAGAGTATGGGCAGCGCATTGAACATATGCGCGTTACTGGT GTGCTATCTGATGGTACTGAGTGTGTACTCGGCCAGTTCGGCACAGTGGGATACCGCAGGATACTCCGCTTCGAC GATGTCGAAGTATCTTCGGTTACCCTACATGTGGATGATTCAAGGTTCACGCCAATGATCAGCCGTGCAGCTGCG GTGCGGATATAA Suitably, the GH25 gene may encode a protein shown as SEQ ID NO: 46 or a sequence with at least 80% sequence identity to SEQ ID NO: 46. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 46. SEQ ID NO: 46 MSNPTNDGINLNYLANVRPSSRQLVWQRMEMYAFIHFGMNTMTDREWGLGHEDPALFDPQNVDVEQWMDALVAGG MTGVILTCKHHDGFCLWPSRYTQHTVAASPWRDGKGDLVREVSESARRHGLKFGVYLSPWDRTEESYGKGKAYDD FYVGQLTELLTQYGPIFSVWLDGANGEGKNGKTQYYDWDRYYNVIRSLQPNAVISVCGPDVRWAGNEAGHVRDNE WSVVPRRLRSAELTMENSQQEDDASFASTVRSQDDDLGSREAVSGYGDDVCWYPAEVDTSIRPGWFYHKYEDDKV MSADQLFDLWLSAVGGNSSLLLNIPPSPEGLFAEPDVESLKGLGSRINEFRKALASSCCEVKTSSADETAMRLLD GNQDTYWSPDANDVAPAVTLTFPQLTTINAVVVEEAIEYGQRIEHMRVTGVLSDGTECVLGQFGTVGYRRILRFD DVEVSSVTLHVDDSRFTPMISRAAAVRI Suitably, the present B. longum transitional strain comprises a glycosyl hydrolase family 95 (GH95) gene. Suitably, the GH95 gene comprises SEQ ID NO: 47 or a sequence with at least 60% sequence identity to SEQ ID NO: 47. Suitably, the GH95 gene comprises a sequence with at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 47. SEQ ID NO: 47 ATGAAACTCACATTCGATGGAATCTCTTCGTGCTGGGAAGAAGGCATCCCGCTCGGCAACGGACGCATGGGAGCG GTCCTGTGTTCCGAACCGGAAACCGACGTGCTGTATCTCAACGACGACACCCTTTGGTCAGGATATCCACACGCG GAAACCTCGCCGGTGACGCCGGAGATTGTGGCCAAGGCACGCCAGGCGTCGTTGCAGGACGACTACACCGCCGCC ACGCGAATCATCAAGGAAGCCACACTGCAGGAAAAGGACGAACAGATTTACGAGCCATTCGGAACGGCCCGTATT CAGTACTCGACCCCTGCAGACGGCCGTGAGAGCATGAAACGCCAGCTGGATCTTGCAAGGGCGCTCGCCGGTGAA ACATTCCAGATGGGTGATGCCAACGTTCATGTCGACGCATGGTGCAGCGAGCCTGATGACCTGTTGGTCTACAGG ATGTCATCGGATGCGCCGGTTGATGTGAACATCAGTGTCGCCGGCACTTTCCTCAAACAATCGCGCGCCTCGTTG GAAACGGTATCCGACGGTCATCGGGCCACACTCGTCGTCATGGGCCGGATGCCTGGACTCAACATCGGGCTCCTC CCTCATCCTTCCGAACATCCTTGGGAAGATGAGCAGGACGGAACCGGAATGGCGTACGCCGGTGCGTTCTCCCTT ACCGTCACAGGTGGCGACATCAATGTGGACGACAACAGTCTGCAATGTTCGCACATCACCGGATTATCGCTCCGC TTCCGCAGTATGAGCGGATTCAAGGGAAGCGACCAGCAGCCGGAACGAAGCATGACGGTTATCGCCGACCATCTG GAGAAAACCATCGACGAGTGGTCGACCGACCTGCAGACCATGCTCGACCGCCATATCGCGGACTACCGCAGATAT TTCGACAGGGTGGCCATCCATCTCGGTTCAGCCCATGATGACGATACGGAACTACCGTTCTCGGCGATCCTTCGC TCGGATGAGAACAAAGAACCGCATCGTCTGGAGATGCTGGCGGAGGCAATGTTCGATTTCGGCCGGTATATGCTT ATCTCCTCGTCCAGGCCACACACCCAGCCGGCGAATCTGCAGGGGATTTGGAACCATAAGGACTTCCCAAACTGG TACAGCGCCTACACGACGAACATCAACGTCGAGATGAACTATTGGATGACCGGCCCCTGCGCGCTCAAGGAGCTC ATCGAGCCGCTCGTCTCCATGAATGAGGAGCTGCTGGCACCGGGGCACGATGCCGCTGACAGGATTCTCGGCTGC CGAGGATCGGCTGTCTTCCATAATGTCGATCTCTGGCGTAGGGCCCTTCCTGCGAACGGCGATCCGATGTGGGCG TTCTGGCCGTTCGGCCAGGCATGGATGTGCCGGAACCTGTTCGATGAATATCTGTTCAACCAGGATGCATCGTAC CTGGCCCGCATCTGGCCGATCATGCGGGACAACGCGCGATTCTGCATGGATTTCCTATCGGAGACAGAGCATGGG CTGGCCCCGTCCCCTGCAACATCACCGGAGAACTGTTTCCTGGTGAACGGAGAACCGGTATCCGTTGCGCAAAGC AGTGAGAATGCCACGGCCATCGTGCGTAATCTGCTTGATGATTTGATTCAGGCTTCTCACGATCTGGAAAACCTT GACGAAGAGGACAGAAATCTGGTCCGTGAAGCGGAATCCGTCCGTTCCCAACTGGCTGAAACGCGATTGGGAGCT GATGGAAGAGTCCTTGAATGGAACGACGAATTCATCGAATCCGATCCACAGCACCGCCATCTGTCCCACCTTTAC GAACTGCATCCTGGTGCAGGCATCACGTCTAAGACTCCGCGTCTGGAGGAAGCCGCGAGAAAATCCCTCGAAGTG CGTGGCGATGATGGTTCCGGTTGGAGCATCGTATGGCGCATGATCATGTGGGCACGTCTGCGTGATGCGGAACAC GCCAAACGAATCATAGGCATGTTCCTACGGCCGGTGGATGCGAACGCTGAAACCAATCTGCTGGGCGGAGGAGTG TACGACAGCGGATTATGCGCCCACCCGCCGTTCCAGATCGACGGGAACCTTGGATTCCCGGCGGCCTTGTCGGAG ATGCTCGTCCAAAGCCACGATGGCTGGATTCGCGTTCTTCCGGCCCTGCCGGAGGATTGGCATGAGGGAAGCTTC CATGCGCTCCGCGCAAGAGGTGGAATCCAAGTGGATGCGACCTGGACGGATCAGACAGTGGAATATACGTTGCGC TGTTCGAAGCCCACGGAGATTACGCTGAACGTTCTGGGGACTGATATGGGACGTGTCGCATTGTCTCCGGATAAG CCATTCAAGGGAACCATCCGGCGTTAA Suitably, the GH95 gene may encode a protein shown as SEQ ID NO: 48 or a sequence with at least 80% sequence identity to SEQ ID NO: 48. Suitably, the protein may comprise a sequence with at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to SEQ ID NO: 48. SEQ ID NO: 48 MKLTFDGISSCWEEGIPLGNGRMGAVLCSEPETDVLYLNDDTLWSGYPHAETSPVTPEIVAKARQASLQDDYTAA TRIIKEATLQEKDEQIYEPFGTARIQYSTPADGRESMKRQLDLARALAGETFQMGDANVHVDAWCSEPDDLLVYR MSSDAPVDVNISVAGTFLKQSRASLETVSDGHRATLVVMGRMPGLNIGLLPHPSEHPWEDEQDGTGMAYAGAFSL TVTGGDINVDDNSLQCSHITGLSLRFRSMSGFKGSDQQPERSMTVIADHLEKTIDEWSTDLQTMLDRHIADYRRY FDRVAIHLGSAHDDDTELPFSAILRSDENKEPHRLEMLAEAMFDFGRYMLISSSRPHTQPANLQGIWNHKDFPNW YSAYTTNINVEMNYWMTGPCALKELIEPLVSMNEELLAPGHDAADRILGCRGSAVFHNVDLWRRALPANGDPMWA FWPFGQAWMCRNLFDEYLFNQDASYLARIWPIMRDNARFCMDFLSETEHGLAPSPATSPENCFLVNGEPVSVAQS SENATAIVRNLLDDLIQASHDLENLDEEDRNLVREAESVRSQLAETRLGADGRVLEWNDEFIESDPQHRHLSHLY ELHPGAGITSKTPRLEEAARKSLEVRGDDGSGWSIVWRMIMWARLRDAEHAKRIIGMFLRPVDANAETNLLGGGV YDSGLCAHPPFQIDGNLGFPAALSEMLVQSHDGWIRVLPALPEDWHEGSFHALRARGGIQVDATWTDQTVEYTLR CSKPTEITLNVLGTDMGRVALSPDKPFKGTIRR Suitably, the present B. longum transitional strain may comprise a GH25 and a GH95 gene as defined herein. EMBODIMENTS The present invention provides the embodiments according to the following numbered clauses: 1. A Bifidobacterium longum transitional microorganism strain deposited with Collection nationale de cultures de micro-organismes (CNCM) under deposit number CNCM I-5942 or a B. longum transitional strain having an identifying characteristic of the B. longum transitional strain deposited under deposit number CNCM I-5942. 2. A B. longum transitional microorganism strain which has an Average Nucleotide Identity (ANI) of at least 99% to a B. longum strain deposited with the CNCM under deposit number CNCM I-5942. 3. A B. longum transitional strain according to clause 1 which has an ANI of at least 98.1% to a B. longum transitional strain deposited under deposit number CNCM I-5942. 4. A B. longum transitional strain according to any preceding clause wherein the B. longum transitional strain is not resistant to any one of tetracycline and erythromycin. 5. A B. longum transitional strain according to any preceding clause wherein the B. longum transitional strain is not resistant to any one of tetracycline, erythromycin, clindamycin and ampicillin. 6. A B. longum transitional strain according to any preceding clause wherein the B. longum transitional strain is not resistant to any of tetracycline, erythromycin, clindamycin, ampicillin, gentamycin, streptomycin, chloramphenicol and vancomycin. 7. A B. longum transitional strain according to any preceding clause wherein: (i) lack of resistance to tetracycline is due to absence of a tetracycline resistance gene, suitably a tetW gene which encodes a protein with at least 80% sequence identity to SEQ ID NO: 1 and/or a tetQ which encodes a protein with at least 80% sequence identity to SEQ ID NO: 2; (ii) lack of resistance to erythromycin is due to absence of a erythromycin resistance gene, suitably a Erm49 gene which encodes a protein with at least 80% sequence identity to SEQ ID NO: 3; (iii) lack of resistance to erythromycin and/or clindamycin is due to absence of a corresponding resistance gene, suitably a Erm(X) gene which encodes a protein with at least 80% sequence identity to SEQ ID NO: 4; and/or (iv) lack of resistance to chloramphenicol is due to absence of a chloramphenicol resistance gene, suitably a CrmX gene which encodes a protein with at least 80% sequence identity to SEQ ID NO: 6. 8. A B. longum transitional strain according to any preceding clause wherein the B. Longum transitional strain comprises a glycosyl hydrolase family 43_17 (GH43_17) gene; suitably wherein the GH43_17 gene comprises SEQ ID NO: 7 or a sequence with at least 60% sequence identity to SEQ ID NO: 7. 9. A B. longum transitional strain according to any preceding clause, which further comprises a major facilitator superfamily (MFS) gene; suitably wherein the MFS gene comprises SEQ ID NO: 37 or a sequence with at least 60% sequence identity to SEQ ID NO: 37. 10. A B. longum transitional strain according to any preceding clause, which further comprises an AraC gene; suitably wherein the AraC gene comprises SEQ ID NO: 39 or a sequence with at least 60% sequence identity to SEQ ID NO: 39. 11. A B. longum transitional strain according to clause 10, wherein the GH43_17, MFS and AraC genes are comprised in a gene cluster. 12. A B. longum transitional strain according to any of clauses 8 to 11, wherein the B. longum transitional strain further comprises one or more of a GH31 gene, and a LacI gene; preferably further comprising a xylulose kinase gene and a xylose isomerase gene. 13. A B. longum transitional strain according clause 12, wherein the GH43_17, MFS, AraC, GH31, and LacI genes are comprised in a gene cluster; preferably wherein the GH43_17, MFS, AraC, GH31, LacI, xylulose kinase and xylose isomerase genes are comprised in a gene cluster. 14. A B. longum transitional strain according to any preceding clause, which further comprises one or more genes encoding for one or more glycoside hydrolases selected from GH43_17, GH43_22, GH43_27, GH43_29, GH121, GH43_24, GH127, GH30_5, GH 43_32 and GH30. 15. A B. longum transitional strain according to any preceding clause, which further comprises GH29 and GH95 genes. 16. A B. Longum transitional strain according to any preceding clause wherein the B. Longum transitional strain preferentially utilizes 3-fucosyllactose (3-FL). 17. A B. Longum transitional strain according to any preceding clause wherein the B. longum transitional strain has a growth rate of at least 0.6 k when cultured in the presence of 3-FL. 18. A composition comprising a B. longum transitional strain according to any preceding clause; preferably wherein the composition is a probiotic composition. 19. A composition comprising a B. longum transitional strain according to any preceding clause and at least one further probiotic and/or prebiotic. 20. Use of a B. longum transitional strain or a composition according to any preceding clause as a dietary supplement; suitably wherein the B. longum transitional strain or composition is administered to a subject in combination with a fiber containing diet or fiber containing foodstuffs. 21. Use of a B. longum transitional strain or a composition according to any of clauses 1 to 19 to promote and/or assist the metabolism of a fiber containing diet or fiber containing foodstuffs by a subject. 22. A method for promoting and/or assisting the metabolism of a fiber containing diet or fiber containing foodstuffs by a subject; the method comprising administering a B. longum transitional strain or a composition according to any of clauses 1 to 19 to the subject. 23. Use of a B. longum transitional strain or a composition according to any of clauses 1 to 19 to promote and/or assist the transition from a milk-based diet to solid food in an infant and/or in a young child. 24. A method of promoting and/or assisting the transition from a milk-based diet to solid food in an infant and/or in a young child, the method comprising administering to the infant and/or to the young child a B. longum transitional strain or a composition according to any of clauses 1 to 19. 25. The use according to any of clauses 20, 21 or 23 or the method according to clause 22 or 24, wherein the B. longum transitional strain is administered in combination with a prebiotic. 26. The composition according to clause 19 or the use or method according to clause 25, wherein the prebiotic is a fibre and/or a human milk oligosaccharide (HMO); suitably wherein the HMO is 3-FL. EXAMPLES The invention is further described with reference to the following examples. It will be appreciated that the invention as claimed is not intended to be limited in any way by these examples. Example 1 – Isolation and phylogenetic identity of NCC 5025 strain The B. longum transitional strain NCC 5025 was isolated at Nestlé Research from the feces of a weaning infant aged (between 6 to 12 months old). It was obtained from stool samples by cultivation on Eugon Tomato agar, followed by preliminary identification using MALDI-ToF MS (Biotyper, Bruker Scientific Instruments, Billerica, USA) and confirmed by sequencing. The isolate was deposited in the Nestlé Culture Collection (Nestlé Research, Lausanne, Switzerland) under NCC 5025 and was further deposited at the “Collection Nationale de Culture Microorganismes” (CNCM, Paris, France) under CNCM I-5942. PacBio sequencing of NCC 5025 was performed according to supplier’s recommendations. The sequencing data was further assembled using the Hierarchical Genome Assembly Process (HGAP4) de novo assembly analysis application available through the SMRT Link portal (Pacific Biosciences, Menlo Park, USA). Obtained sequences were compared to publicly available B. longum genomes by Average Nucleotide Identity (ANI) computed using OrthoANIu v1.2 (Yoon et al., 2017). The generated matrix of pairwise genome similarities was further used to build a UPGMA phylogenetic tree using the BioNumerics software (v8.0, bioMérieux SA, Marcy l’Etoile, France). Analysis revealed that the NCC 5025 belongs to the B. longum transitional group as it clustered with others strains of this putative newly described subspecies (Vatanen et al.;Cell; 2022 Nov 10;185(23):4280-4297.e12) . Phylogenetically, NCC 5025 lies in between strains isolated from China (e.g. JDM301; CMCC P001) and strains isolated from Bangladesh (NCC 5000-NCC5004), sharing an Average Nucleotide Identity (ANI) of 98.4% with this latter group of strains (see Figure 1). Example 2 – Antibiotic Resistance Profiling Phenotypic antibiotic testing of B. longum transitional strains was performed according to the recommendations made by EFSA (EFSA J 16, e05206, doi:10.2903/j.efsa.2018.5206 (2018)) following the official method ISO 10932. As required in the ISO method 10932 B. longum ATCC 15707 was used as internal control. Minimal Inhibitory Concentration (MICs) obtained for this control strain were within the range determined for this strain (see Annex of the ISO method). Obtained MICs were compared to the EFSA applicable thresholds (EFSA Journal 2012 Guidance on the assessment of bacterial susceptibility to antimicrobials of human and veterinary importance) determining the sensitivity or resistance phenotype to the list of relevant antibiotic. MICs obtained for B. longum transitional NCC 5000, 5001, 5002, 5003, 5004 and 5025 are depicted in Error! Reference source not found.Table 1. Results showed that most of the strains were considered resistant to several antibiotic considered of importance for EFSA. B. longum transitional NCC 5000 and NCC 5001 are considered resistant to erythromycin and clindamycin. NCC 5003 is considered resistant to tetracycline, erythromycin and clindamycin. NCC 5004 is considered resistant to tetracycline, erythromycin, clindamycin and ampicillin. As well, B. longum transitional NCC 5002 showed a resistance for tetracycline. B. longum transitional NCC 5025 was the only strain sensitive to all antibiotics considered relevant by EFSA, namely gentamycin, streptomycin, tetracyclin, erythromycin, clindamycin, ampicillin and vancomycin. Table 1 - Minimal Inhibitory Concentrations (MIC) results obtained on all B. longum transitional strains using the microdilution method. The table depicts the results for all antibiotics considered relevant by EFSA. ge s e c c a v n tr t a e t e p tr a r y l t in h m a d l o p nc m t o c h a r a c i o m yc r om m m il i m yci n yc li n y yc p n y h c in ci n i n en n i ciol EFSA cut-off µg/ml 64 128 8 1 1 4 2 2 NCC 5000 23.06.21 MIC (µg/ml) 16 4 1 > 8 > 16 2 0,5 1 S / R S S S R R S S S NCC5001 04.06.21 MIC (µg/ml) 16 32 32 > 8 > 16 2 1 1 S / R S S R R R S S S NCC5002 04.06.21 MIC (µg/ml) 8 16 32 0,5 0,25 1 1 1 S / R S S R S S S S S NCC5003 04.06.21 MIC (µg/ml) 32 64 16 > 8 > 16 1 2 0,5 S / R S S R R R S S S NCC 5004 23.06.21 MIC (µg/ml) 8 16 32 > 8 > 16 2 16 1 S / R S S R R R S R S NCC 5025 MIC (µg/ml) 8 4 1 0,032 0,03 2 0,25 0,5 S / R S S S S S S S S Example 3 - Carbohydrate Active Enzyme (CaZy) profiling Strains of B. longum transitional were annotated to CAZymes combining dbCAN3 (Yin et al., 2012; Zhang et al., 2018) tools and databases HMMdb (v10) and DIAMOND (v 2.0.14). Query sequences with > 0.50 coverage and e-value < 1e-15 were annotated with HMMER according to the dbCAN CAZyme domain HMM database. DIAMOND was also used to annotate query sequences with hits in the CAZy database (Lombard et al., 2014) (http://www.cazy.org/) with > 0.90 identity, and e-value < 1e-100. HMMER annotation was prioritized and used in instances of mismatched CAZyme annotations of query sequences between HMMER and DIAMOND tools. Only CAZyme families and subfamilies encoding Glycoside Hydrolases (GHs) and Polysaccharide Lyases (PLs) were used for comparative analyses of B. longum clades. All genes predicted as CAZymes by dbCAN3 were further analysed for the putative extracellular activity. To this end, signal peptides were predicted using DeepSig (Savojardo et al; Bioinformatics, 34(10), 2018, 1690–1696), a Deep Convolutional Neural Network trained on the well-known SignalP (v4.0) (Petersen et al.; Nat Methods; 2011 Sep 29;8(10):785-6). and tested on UniproKB. The network takes the N-terminus of the input sequence with a threshold of 21 residues. The input is then forwarded to the feature extraction module, to then output a binary output (absence, presence) for the prediction of signal peptides. The analysis revealed that NCC 5025 harbors a unique enzyme setup compared to other genomes in the B. longum transitional clade. In particular, it is the only strain to have a glycosyl hydrolase (GH) family 43 subfamily 17 (GH43_17), that encodes for an enzyme with both α- L-arabinofuranosidase (EC 3.2.1.55) and endo-β-1,4-xylanase (EC 3.2.1.8) activities, with capacity to breakdown complex carbohydrates like arabinan, arabinogalactan, and arabinoxylan. To date, the only characterized enzymatic activity of GH43_17 come from Bacteroides intestinalis (Pereira et al.; Nat Commun. 2021 Jan; 12(1):459.) and Caldicellulosiruptor owensensis (Helbert et al; 2019; 116(13); 6063-6068). Altogether, amongst B. longum transitional, NCC 5025 possesses a unique CAZyme profile. Its genome encodes five different CAZymes that target arabinans (GH43_22, GH43_27, GH43_29, GH121, and the exclusive GH43_17), compared to UCD399 and BSM11-5, which encode four and the rest of the B. longum transitional genomes which encode either three or fewer of these CAZymes (Figure 2). In addition, four of the five arabinan-degrading CAZymes present in NCC 5025 have a signal peptide, which grants this bacterium an advantage as a primary degrader of complex structures of arabinan when present in high molecular weight, usually in the diet (Figure 2). B. longum transitional NCC5025 also encodes five different CAZymes that target arabinogalactans (GH43_24, GH127, GH30_5, GH43_32, and GH43_17), two of which have signal peptides. Additionally, NCC5025 contains three genes that encode an inulin-degrading CAZyme (GH32), similar to NCC5000 and UCD399. The other B. longum transitional possess two or less number of genes that encode GH32, which grants them less efficiency to utilize inulin from the environment (Figure 2). B. longum transitional NCC 5025 contains as well several enzymes implicated in the degradation and metabolization of Human Milk Oligosaccharides (HMO). It contains a GH20 (lacto-N-biosidase) enzyme and a GH112 (lacto-N-biose phosphorylase) and several GH42 (β-galactosidase), implicated in the degradation and metabolization of Lacto-N-tetraose (LNT) and its subcomponents. The strain also possess a GH29 and a GH95 (fucosidases) encoding genes which are implicated in the degradation and metabolization of fucosylated human milk oligo-saccharides, such as 2’FL, 3’FL or diFL. Taken together, B. longum transitional NCC 5025 can serve as a primary degrader of arabinan, arabinogalactans and inulin thanks to their unique CAZyme repertoire, including the exclusive presence of GH43_17. Carbohydrate blends that contain arabinan in combination with arabinogalactans, inulin or fucosylated HMOs, etc., may grant NCC 5025 advantage for growing and producing beneficial metabolites. Example 4 - GH43_17 encoding gene cluster of NCC 5025 By aligning all available genomes of B. longum transitional using the BioNumerics software (v8.0, bioMérieux SA, Marcy l’Etoile, France), it was determined that the GH43_17 gene of NCC 5025 was located in a genetic region unique to that strain. This unique region contains a family 31 glucosidase (GH31; NCC5025_001581), followed by an ABC transporter (NCC5025_001580-001578), a Lac-I type regulator (NCC5025_001577), a GH43_17 enzyme (NCC5025_001576), a MFS transporter (NCC5025_001575) and an AraC family transcriptional regulator (NCC5025_001574) (see Figure 3 and Table 2). Table 2 - Summary of the genes found in the GH43_17 encoding region of NCC 5025. Genome annotation was performed with the PGAP annotation pipeline available at NCBI. LENGTH ANNOTATION NCC5025_001584 xylulose kinase NCC5025_001583 hypothetical protein NCC5025_001582 hypothetical protein NCC5025_001581 family 31 glucosidase NCC5025_001580 carbohydrate ABC transporter permease NCC5025_001579 sugar ABC transporter permease 1179 extracellular solute-binding protein 1005 LacI family transcriptional regulator 876 glycoside hydrolase family 43 protein 1152 MFS transporter 999 AraC family transcriptional regulator _ 1350 xylose isomerase Further BLASTn analysis of all the genes contained in this region using the BioNumerics software (v8.0, bioMérieux SA, Marcy l’Etoile, France) revealed that the Lac-I type regulator (CDS_000417), the GH43_17 enzyme (CDS_000418), the MFS transporter (CDS_000419) and the AraC family transcriptional regulator (CDS_000420) had no homologues in other strains of B. l. subsp juvenis. Homologues with relatively low degree of similarity (max 80% coverage / 60% identity) to the family 31 glucosidase (GH31; CDS000413) and the ABC transporter (CDS_000414-00416) encoding genes were found in the three closely related isolates JDM301, BXY01 and CMCC P001. Example 5 - NCC 5025 has a high growth rate on 3-FL B. longum transitional strains were retrieved from the Nestlé Culture Collection and were reactivated from a freeze-dried stock, using two successive culturing steps (16h, 37°C, anaerobiosis) in MRS supplemented with 0.05 % cysteine (MRSc). Reactivated cultures were then centrifuged, washed and resuspended in 1 volume of PBS. Washed cells were used to inoculate MRS based medium without a carbon source (MRSc-C) (10 g L-1 of bacto proteose peptone n°3, 5 g L-1 bacto yeast extract, 1 g L-1 Tween 80, 2 g L-1 di-ammonium hydrogen citrate, 5 g L-1 sodium acetate, 0.1 g L-1 magnesium sulphate, 0.05 g L-1 manganese sulfate, 2 g L-1 di-sodium phosphate, 0.5 g L-1 cysteine) in which 3-FL was added as unique carbon source and at a final concentration of 0.5%. Growth was then performed in a 96 well microplate, with a volume of 200 µl per well. Incubation was performed in anaerobiosis for 46h, and optical density was measured over this period in a spectrophotometer at 580 nm. The growth curve was then modelled using a logistic growth model, to obtain the relative growth rate k for each variant. Amongst all B. longum transitional strains tested, NCC 5025 has the highest growth rate on 3FL, indicating that this strain is the best adapted to this substrate (see Figure 4). It has been shown that 3-FL is the human milk oligosaccharide that shows the greatest increase in the human breast milk during the period of transition between milk-based diet and solid food (Plows, J.F., et al., Longitudinal Changes in Human Milk Oligosaccharides (HMOs) Over the Course of 24 Months of Lactation. J Nutr, 2021.151(4): p.876-882), hence these results show an advantage of NCC 5025 for an application during this period. Example 6 – growth of NCC 5025 on high molecular weight food fibers The inventors tested if the NCC 5025 strain had the capacity to grow on related high molecular weight fibers. For that purpose, selected B. longum transitional strains (NCC 5002, NCC 5004, NCC 5025, respectively) were grown on the above mentioned MRSc medium without sugar, to which 5 g/L% of arabinan (arabinan from Sugar-beet pulp from Megazyme) or Inulin (Orafti HSI from Beneo,) was added. Growth assays were performed in a BioLector XT microbioreactor system (m2p-labs GmbH, Baesweiler, Germany), using 48 flowerplate inserted in an anaerobic chamber for 50h (2ml volume per well, agitation at 600 rpm, CO2 atmosphere, 37°C). Growth was followed over time by continuous measurement of the scattered light at 620 nm. Surprisingly, results demonstrated that amongst the tested strains, B. longum transitional NCC 5025 had a particular ability to grow on inulin (average size of DP6-8, Tsatsaragkou et al.; Foods 2021, 10(5), 951) and high molecular weight arabinan. As compared to other B. longum transitional NCC 5002 and NCC 5004, B. longum transitional NCC 5025 grew faster (faster doubling time) and to a higher final yield. On the high molecular weight arabinan, amongst all tested strains, the NCC 5025 strain was the only to grow (see Figure 5). Conclusions The data provided demonstrate that: a) B. longum transitional NCC 5025 is clearly distinguished from previously isolated B. l. juvenis strains, and shares 98.4% ANI to the strains previously isolated from Bangladeshi infants (Vatanen et al.2022; as above); b) This is the only B. longum transitional strain to date to be free of antibiotic resistance to the set of antibiotics considered relevant by EFSA; c) B. longum transitional NCC 5025 has a unique Carbohydrate Active EnZyme (CaZy) profile, including the presence of a GH43 subfamily 17 enzyme, that was not characterized to date in the B. longum species. d) B. longum transitional NCC 5025 grows particularly well on 3-FL; e) B. longum transitional NCC 5025 grows the well on a set of food derived fibers (e.g. inulin and arabinan). Overall, the data suggest that this strain is particularly adapted to the weaning period and may perform in this environment better than other B. longum transitional strains. As well, our data suggest that on a diet containing food derived fiber (e.g. in adulthood), this strain may as well perform better than other B. longum transitional strains. Although the invention has been described by way of example, it should be appreciated that variations and modifications may be made without departing from the scope of the invention as defined in the claims. Furthermore, where known equivalents exist to specific features, such equivalents are incorporated as if specifically referred in this specification.
CLAIMS 1. A Bifidobacterium longum transitional microorganism strain deposited with Collection nationale de cultures de micro-organismes (CNCM) under deposit number CNCM I-5942 or a B. longum transitional strain having an identifying characteristic of the B. longum transitional strain deposited under deposit number CNCM I-5942. 2. A B. longum transitional microorganism strain which has an Average Nucleotide Identity (ANI) of at least 99% to a B. longum strain deposited with the CNCM under deposit number CNCM I-5942. 3. A B. longum transitional strain according to claim 1 which has an ANI of at least 98.1% to a B. longum transitional strain deposited under deposit number CNCM I-5942. 4. A B. longum transitional strain according to any preceding claim wherein the B. longum transitional strain is not resistant to any one of tetracycline, erythromycin, clindamycin and ampicillin; preferably wherein the B. longum transitional strain is not resistant to any of tetracycline, erythromycin, clindamycin, ampicillin, gentamycin, streptomycin, chloramphenicol and vancomycin. 5. A B. longum transitional strain according to any preceding claim wherein the B. Longum transitional strain comprises a glycosyl hydrolase family 43_17 (GH43_17) gene; suitably wherein the GH43_17 gene comprises SEQ ID NO: 7 or a sequence with at least 60% sequence identity to SEQ ID NO: 7. 6. A B. longum transitional strain according to any preceding claim, which further comprises a major facilitator superfamily (MFS) gene; suitably wherein the MFS gene comprises SEQ ID NO: 37 or a sequence with at least 60% sequence identity to SEQ ID NO: 39 and/or an AraC gene; suitably wherein the AraC gene comprises SEQ ID NO: 39 or a sequence with at least 60% sequence identity to SEQ ID NO: 39; preferably wherein the GH43_17, MFS and AraC genes are comprised in a gene cluster. 7. A B. longum transitional strain according to claim 6, wherein the B. longum transitional strain further comprises one or more of a GH31 gene and a LacI gene; preferably wherein the B. longum transitional strain further comprises a xylulose kinase gene and a xylose isomerase gene; and further preferably wherein the GH43_17, MFS, AraC, GH31, LacI, xylulose kinase and xylose isomerase genes are comprised in a gene cluster. 8. A B. longum transitional strain according to any preceding claim, which further comprises one or more genes encoding for one or more glycoside hydrolases selected from

Claims

GH43_17, GH43_22, GH43_27, GH43_29, GH121, GH43_24, GH127, GH30_5, GH 43_32 and GH30. 9. A B. Longum transitional strain according to any preceding claim wherein the B. Longum transitional strain preferentially utilizes 3-fucosyllactose (3-FL); preferably wherein the B. longum transitional strain has a growth rate of at least 0.6 k when cultured in the presence of 3-FL. 10. A probiotic composition comprising a B. longum transitional strain according to any preceding claim. 11. A composition comprising a B. longum transitional strain according to any preceding claim and at least one further probiotic and/or prebiotic. 12. Use of a B. longum transitional strain or a composition according to any preceding claim as a dietary supplement; suitably wherein the B. longum transitional strain or composition is administered to a subject in combination with a fiber containing diet or fiber containing foodstuffs. 13. Use of a B. longum transitional strain or a composition according to any of claims 1 to 9 to promote and/or assist the metabolism of a fiber containing diet or fiber containing foodstuffs by a subject. 14. Use of a B. longum transitional strain or a composition according to any of claims 1 to 9 to promote and/or assist the transition from a milk-based diet to solid food in an infant and/or in a young child.
ABSTRACT BIFIDOBACTERIUM LONGUM TRANSITIONAL MICROORGANISM The present invention relates to a Bifidobacterium longum transitional microorganism strain deposited with CNCM under number CNCM I-5942 or a B. Longum transitional strain having an identifying characteristic of the B. Longum transitional strain deposited under deposit number CNCM I-5942.
EP24733105.1A 2023-06-02 2024-05-31 Bifidobacterium longum transitional microorganism Pending EP4720255A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP23177101 2023-06-02
PCT/EP2024/065005 WO2024246267A1 (en) 2023-06-02 2024-05-31 Bifidobacterium longum transitional microorganism

Publications (1)

Publication Number Publication Date
EP4720255A1 true EP4720255A1 (en) 2026-04-08

Family

ID=86688647

Family Applications (1)

Application Number Title Priority Date Filing Date
EP24733105.1A Pending EP4720255A1 (en) 2023-06-02 2024-05-31 Bifidobacterium longum transitional microorganism

Country Status (8)

Country Link
EP (1) EP4720255A1 (en)
KR (1) KR20260022302A (en)
CN (1) CN121488028A (en)
AU (1) AU2024279312A1 (en)
CL (1) CL2025003779A1 (en)
MX (1) MX2025014170A (en)
TW (1) TW202513791A (en)
WO (1) WO2024246267A1 (en)

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4362709A1 (en) 2021-06-29 2024-05-08 The Broad Institute, Inc. Bifidobacterium longum transitional microorganisms, compositions and uses thereof
AU2022307441A1 (en) * 2021-07-09 2024-01-25 Société des Produits Nestlé S.A. Uses of bifidobacterium longum transitional microorganism

Also Published As

Publication number Publication date
AU2024279312A1 (en) 2025-11-20
WO2024246267A1 (en) 2024-12-05
KR20260022302A (en) 2026-02-19
CL2025003779A1 (en) 2026-01-09
TW202513791A (en) 2025-04-01
CN121488028A (en) 2026-02-06
MX2025014170A (en) 2026-03-02

Similar Documents

Publication Publication Date Title
Wong et al. Insights into the reason of Human-Residential Bifidobacteria (HRB) being the natural inhabitants of the human gut and their potential health-promoting benefits
Lordan et al. Linking human milk oligosaccharide metabolism and early life gut microbiota: bifidobacteria and beyond
Pokusaeva et al. Carbohydrate metabolism in Bifidobacteria
CN107847509B (en) Nutritional composition with 2FL and LNnT
Goh et al. Genetic mechanisms of prebiotic oligosaccharide metabolism in probiotic microbes
Sela et al. Nursing our microbiota: molecular linkages between bifidobacteria and milk oligosaccharides
US20200216508A1 (en) Therapeutic use of mucin glycans
US20240306694A1 (en) Uses of bifidobacterium longum transitional microorganism
Bondue et al. Genome of bifidobacteria and carbohydrate metabolism
AU2023224376A1 (en) Uses of bifidobacterium longum microorganisms having the capacity to degrade both hmo and plant-derived glycans
TW202408553A (en) Uses of bifidobacterium longum transitional microorganism
US8795746B2 (en) Therapeutic use of mucin glycans
US20260083785A1 (en) Uses of bifidobacterium longum transitional microorganism
US20250312388A1 (en) Bifidobacterium infantis formulations
WO2025201672A1 (en) Mixture of hmos and bifidobacterium longum transitional microorganism
AU2024279312A1 (en) Bifidobacterium longum transitional microorganism
Levantovsky et al. Nutritional requirements of bifidobacteria
CN118804689A (en) Use of Bifidobacterium longum microorganisms having the ability to degrade both HMO and polysaccharides derived from plants
WO2025149453A1 (en) Uses of bifidobacterium longum transitional microorganism
TW202529786A (en) Mixture of hmos and bifidobacterium longum transitional microorganism
WO2025190541A1 (en) Promoting butyrate-producing bacteria in the gut microbiome
WO2025190540A1 (en) Promoting butyrate-producing bacteria in the gut microbiome
Mazzola The role of bifidobacteria in newborn health and the intestinal microbial balance

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20260102

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR