EP4712996A1 - Hip/pap protein or a derivative thereof for treating a cognitive disorder associated with anxiety disorder - Google Patents

Hip/pap protein or a derivative thereof for treating a cognitive disorder associated with anxiety disorder

Info

Publication number
EP4712996A1
EP4712996A1 EP24728149.6A EP24728149A EP4712996A1 EP 4712996 A1 EP4712996 A1 EP 4712996A1 EP 24728149 A EP24728149 A EP 24728149A EP 4712996 A1 EP4712996 A1 EP 4712996A1
Authority
EP
European Patent Office
Prior art keywords
disorder
hip
derivative
pap
cognitive
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP24728149.6A
Other languages
German (de)
French (fr)
Inventor
Christophe MAGNAN
Céline CRUCIANI-GUGLIELMACCI
Gilles Amouyal
Christian Brechot
Paul Amouyal
Kevin Nash
Aurélie JOLY AMADO
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Healthy Aging Co
University of South Florida
University of South Florida St Petersburg
Original Assignee
Healthy Aging Co
University of South Florida
University of South Florida St Petersburg
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from EP23305788.4A external-priority patent/EP4464330A1/en
Application filed by Healthy Aging Co, University of South Florida, University of South Florida St Petersburg filed Critical Healthy Aging Co
Publication of EP4712996A1 publication Critical patent/EP4712996A1/en
Pending legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/22Anxiolytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/05Animals comprising random inserted nucleic acids (transgenic)
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/05Animals comprising random inserted nucleic acids (transgenic)
    • A01K2217/052Animals comprising random inserted nucleic acids (transgenic) inducing gain of function
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biomedical Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • Epidemiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Molecular Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Biochemistry (AREA)
  • Plant Pathology (AREA)
  • Virology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

The present invention relates to the use of the HIP/PAP protein, or a derivative thereof, in the treatment and prevention, and in particular in the treatment, of a cognitive disorder associated with anxiety disorder(s) in an individual in need thereof, as well as for improving cognition in an individual affected by a neurological disorder associated with anxiety disorder(s) or for alleviating cognitive deficit in an individual affected by a disorder selected from the group consisting of Obsessive-compulsive disorder, Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington's disease (HD), Parkinson's disease, bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars-cov-2 infection, and also in the prevention and/or treatment of diet induced cognitive and anxiety deficits in an individual in need thereof, and in particular high fat diet induced cognitive and anxiety deficits.

Description

HIP/PAP PROTEIN OR A DERIVATIVE THEREOF FOR TREATING A COGNITIVE DISORDER ASSOCIATED WITH ANXIETY DISORDER
Field of the invention
The present invention relates to the use of the HIP/PAP protein, or a derivative thereof, in the treatment and prevention, and in particular in the treatment, of a cognitive disorder associated with anxiety disorder(s) in an individual in need thereof, as well as for improving cognition in an individual affected by a neurological disorder associated with anxiety disorder(s) or for alleviating cognitive deficit in an individual affected by particular cognitive disorders associated with anxiety disorder(s) as described below.
Prior art
While occasional anxiety is a normal part of life, anxiety disorders involve more than temporary worry or fear. For people with an anxiety disorder, the anxiety does not go away and can get worse over time with symptoms interfering with daily activities such as job performance, schoolwork, and relationships. These symptoms need to be distinguished from normal anxiety and fear, which are healthy emotional reactions to daily stressors related to interpersonal, social, educational, and vocational demands. Anxiety disorders can manifest as an increased anxiety levels (feeling nervous, restless or tense, having a sense of impending danger, panic or doom, having difficulty controlling worry, having difficulty taking risks or decisions) or decreased anxiety levels also known as behavioral disinhibition and externalizing disorders (have a tendency to show high approach, absence of restraint, inappropriate laughter, disinhibition of speech and action in situations of novelty, high novelty seeking, and low harm avoidance high novelty - and sensation-seeking personality, poor impulse control, and proclivity to engage in risky behaviors - N. R. Marmorstein, J Anxiety Disord. 2007;21(3):420- 32; J T Nigg, Psychol Bull. 2000 Mar;126(2):220-46; Dina R Hirshfeld-Becker et al., Biol Psychiatry. 2003 Jun 1 ;53 (11): 985-99) or a combination of both (N. R. Marmorstein, J Anxiety Disord. 2007;21(3):420-32; Audra K Langley et al., Eur Child Adolesc Psychiatry. 2010 Aug; 19(8): 637-45; B Wanner et al., Psychol Med. 2012 Nov;42(l l):2373-82; Joan P Yoo et al., Am J Orthopsychiatry. 2009 Oct;79(4):532-40), especially in young adults. In certain instances, behavioral dishinibition can be a precursor of anxiety disorder showing the intricate relationship of both type of disorders (Dina R Hirshfeld-Becker et al., Biol Psychiatry. 2003 Jun 1;53(11):985-99). Mood and anxiety disorders are characterized by a variety of neuroendocrine, neurotransmitter, and neuroanatomical disruptions. Identifying the most functionally relevant differences is complicated by the high degree of interconnectivity between neurotransmitter- and neuropeptide-containing circuits in limbic, brain stem, and higher cortical brain areas. Therefore, both high anxiety levels and low anxiety levels could share the same mechanism i.e imbalance of neurotransmitter signaling (Elizabeth I Martin et al., Psychiatr Clin North Am. 2009 Sep;32(3):549-75).
In the Region of the Americas, it was estimated in 2015 that more than 58 million people were suffering from anxiety disorders representing 7.7% in the female population, and 3.6% of the male population. Anxiety disorders are actually more prevalent than any other mental health disorder, composing the majority of lifetime mental health disorders worldwide (Kessler et al., Epidemiol Psichiatr Soc . 2009 Jan-Mar;18(l):23-33).
Anxiety disorders (including externalizing disorders) are often associated with cognitive disorders, either as a primary or as a secondary symptom.
An example of a cognitive disorder in which anxiety disorders are primary symptoms is obsessive-compulsive disorder, featuring a pattern of unwanted thoughts and fears, obsessions, that lead to do repetitive behaviors or mental acts, or compulsions, meant to reduce anxiety related to the obsessions (Anu E Castaneda et al., J Affect Disord. 2008 Feb; 106(1- 2): 1-27; Ashwini Vishwanathan, Indian J Psychol Med. 2022 Nov;44(6):558-566). Cognitive dysfunction (decreased learning and working memory) has also been evidenced in externalizing disorders and behavioral disinhibition disorders of anxiety disorders as seen in bipolar disorder, as well as substance and alcohol abuse (Michael J Endres et al., J Abnorm Psychol. 2011 May;120(2):336-51).
Anxiety symptoms may alternatively be secondary to other disorders, and in particular may be secondary in several cognitive disorders. In these cognitive disorders, the alteration of the cognitive functions, in particular when associated with a light to severe memory loss, leads to an alteration of the normal response to anxiogenic situations and thus to anxiety disorders.
Not all cognitive disorders are associated with anxiety disorders. For example, can be cited some levels of mild cognitive impairments, normal pressure hydrocephalus or neurological disorders related cognitive dysfunction. Depending on the considered cognitive disorder, or even depending on the stage of the considered cognitive disorder, the alteration of the normal response to an anxiogenic situation can either materialize by an increase or a decrease in anxiety -like behaviors.
Both share a common mechanism which comprises an imbalance in neurotransmission in the areas that control mood and anxiety.
Therefore, there is an increasing need for novel actives able to prevent and/or treat a cognitive disorder associated with anxiety disorder(s) in an individual in need thereof.
Moreover, there is an escalating need for the prevention of an alteration of the emotional reactions of an individual to stressors, in particular in an individual affected by a cognitive disorder which is expected to induce the development of (an) anxiety disorder(s).
There is indeed a need for novel actives able to restore healthy emotional reactions to stressors, in particular in an individual affected by a cognitive disorder associated with an anxiety disorder.
There is also a need for novel actives able to restore a physiological level of anxiety in an individual, in particular in an individual affected by a cognitive disorder associated with an anxiety disorder.
There is also a need for novel actives able to improve the memory of an individual affected by a cognitive disorder associated with anxiety disorder(s).
There is accordingly an increasing need for novel actives able to improve cognition in an individual affected by a neurological disorder associated with anxiety disorder(s), selected from the group consisting of Autism spectrum disorder, Angelman syndrome, Down’s syndrome and other neurologic disorder-related cognitive impairments, such as Chronic meningitis, autoimmune encephalitis or neurosarcoidosis.
There is also a need for novel actives able to alleviate cognitive deficit in an individual affected by a disorder selected from the group consisting of Obsessive-compulsive disorder, Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington’s disease (HD), Parkinson’s disease (PD), bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars-cov-2 infection.
The present invention provides a solution to these problems. Summary of the invention
The applicant has demonstrated that, surprisingly, the HIP/PAP protein, or a derivative thereof, makes it possible to improve the memory in a mouse model of cognitive disorders associated with anxiety. The HIP/PAP protein, or a derivative thereof, is also able to rescue cognitive deficits and more particularly to restore a normal anxiety like behavior in response to an anxiogenic situation in this model as well as in a High Fat Diet (HFD) model.
Without wishing to be bound by any theory, the inventors hypothesize that HIP/PAP can restore neurotransmitter homeostasis by direct or indirect action (on gabaergic and glutamatergic systems). Indeed, the results of the enclosed examples indicate a restoration of physiological levels of anxiety (to the level of controls) in the mice treated with HIP/PAP.
Moreover, the inventors have surprisingly demonstrated both the ability to prevent the alteration of cognition and the ability to improve cognition of individuals presenting an alteration of cognition following the administration of the HIP/PAP protein, or a derivative thereof.
The HIP/PAP protein may therefore advantageously be used for:
- treating and/or preventing, in particular treating, a cognitive disorder associated with anxiety disorder(s) in an individual in need thereof; in particular treating and/or preventing, in particular treating, a cognitive disorder associated with an externalizing disorder, the cognitive disorder being in particular selected from the group consisting of bipolar disorder, substance abuse, attention deficit disorders and psychotic disorders;
- improving cognition in an individual affected by a neurological disorder associated with anxiety disorder(s), more particularly selected from the group consisting of Autism spectrum disorder, Angelman syndrome, Down’s syndrome and other neurologic disorder-related cognitive impairments, such as Chronic meningitis, autoimmune encephalitis or neuro sarcoidosis,' and
- alleviating cognitive deficit in an individual affected by a disorder selected from the group consisting of Obsessive-compulsive disorder, Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington’s disease (HD), Parkinson’s disease (PD), bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars-cov-2 infection.
The present invention accordingly relates to the following items: Item 1: A HIP/PAP protein, or a derivative thereof, for its use in treating and/or preventing, in particular treating, a cognitive disorder associated with anxiety disorder(s) in an individual in need thereof.
Item 2: The HIP/PAP protein, or a derivative thereof, for use according to item 1 in which the anxiety disorder(s) associated with the cognitive disorder is:
(i) a primary symptom, such as in Obsessive-compulsive disorder, and/or
(ii) a secondary symptom, such as in a neurodegenerative disease selected in the group consisting of Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington’s disease (HD), Parkinson’s disease, bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars-cov-2 infection.
Item 3: A HIP/PAP protein, or a derivative thereof, for use in improving cognition in an individual affected by a neurological disorder associated with anxiety disorder(s), selected from the group consisting of Autism spectrum disorder, Angelman syndrome, Down’s syndrome and other neurologic disorder-related cognitive impairments, such as Chronic meningitis, autoimmune encephalitis or neurosarcoidosis.
Item 4: A HIP/PAP protein, or a derivative thereof, for use in alleviating cognitive deficit in an individual affected by a disorder selected from the group consisting of Obsessive- compulsive disorder, Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington’s disease (HD), Parkinson’s disease, bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars-cov-2 infection.
Item 5: The HIP/PAP protein, or a derivative thereof, for use according to any one of items 1 to 4, wherein the anxiety disorder is an externalizing disorder and, in particular, the cognitive disorder is selected from the group consisting of bipolar disorder, substance abuse, attention deficit disorders and psychotic disorders.
Item 6: A HIP/PAP protein, or a derivative thereof, for use in the prevention and/or treatment of diet induced cognitive and anxiety deficits in an individual in need thereof, and in particular high fat diet induced cognitive and anxiety deficits.
Item 7 : The HIP/PAP protein, or a derivative thereof, for use according to any one of items 1 to 6, wherein the individual is a mammal, in particular a human being.
Item 8: The HIP/PAP protein, or a derivative thereof, for use according to any one of items 1 to 7, wherein the HIP/PAP protein comprises an amino acid sequence selected from the group consisting of sequences set forth as SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, and is in particular the sequence set forth as SEQ ID NO: 4.
Item 9: The HIP/PAP protein, or a derivative thereof, for use according to any one of items 1 to 8, wherein said derivative comprises an amino acid sequence having a sequence identity of at least 80% with the amino acid sequence selected from the group consisting of sequences SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4 and a biological activity of the same nature as the amino acid sequence selected from the group consisting of sequences SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, and more particularly a sequence identity of at least 80% with the amino acid sequence set forth as SEQ ID NO: 4 and a biological activity of the same nature as the amino acid sequence set forth as SEQ ID NO: 4.
Item 10: The HIP/PAP protein, or a derivative thereof, for use according to any one of items 1 to 9, wherein the HIP/PAP protein, or a derivative thereof, is in a composition comprising a physiologically acceptable medium.
Item 11: The HIP/PAP protein, or a derivative thereof, for use according to item 10, wherein the composition is for oral, sublingual, subcutaneous, intramuscular, intravenous, topical, local, intratracheal, intranasal or rectal administration.
Item 12: The HIP/PAP protein, or a derivative thereof, for use according to item 10 or 11, wherein the composition is for oral, subcutaneous, intravenous, topical or local administration.
Item 13: The HIP/PAP protein, or a derivative thereof, for use according to any one of items 10 to 12, wherein the composition further comprises at least one agent known for being useful in the prevention and/or treatment of a cognitive deficit, such has for example an agent selected from the group consisting of Cholinesterase inhibitors, such as donepezil, rivastigmine or galantamine; Glutamate regulators; such as memantine; cholinesterase inhibitors, in particular in combination with glutamate regulators, such as the combination of donepezil and memantine; Methylphenidate; Amphetamine; Atomoxetine; AMPA-R agonists; “Alpha? nicotinic agonists”; Guanfacine; Bupropion; Vortioxetine and D-cycloserine.
Item 14: The HIP/PAP protein, or a derivative thereof, for use according to any one of items 10 to 13, wherein the composition further comprises at least one agent known for being useful in the prevention and/or treatment of an anxiety disorder, in particular selected from the group consisting of selective serotonin reuptake inhibitors, serotonin-norepinephrine reuptake inhibitors, tricyclic antidepressants, calcium modulators, azapirone, reversible inhibitors of monoamine oxidase A, agomelatine, quetiapine and vortioxetine, and more particularly selected from the group consisting of citalopram, escitalopram, fluoxetine, fluvoxamine, paroxetine, sertraline, duloxetine, venlafaxine, clomipramine, pregabalin, buspirone, moclobemide, agomelatine, quetiapine and vortioxetine.
Item 15: The HIP/PAP protein, or a derivative thereof, for use according to item 14, wherein the cognitive disorder associated with anxiety disorder(s) is selected from the group consisting of Obsessive-compulsive disorder, Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington’s disease (HD), Parkinson’s disease, bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars-cov-2 infection.
Item 16: The HIP/PAP protein, or a derivative thereof, for use according to any one of items 10 to 15, wherein the composition further comprises at least one agent known for being useful in alleviating the symptoms associated with a disorder selected from the group consisting of Autism spectrum disorder, Angelman syndrome, Down’s syndrome and other neurologic disorder-related cognitive impairments, such as Chronic meningitis, autoimmune encephalitis or neurosarcoidosis, in particular selected from the group consisting of an anti-seizure medication; amino acid supplements; antifungals; corticosteroids, such as prednisone; and immunosuppressants, such as methotrexate or azathioprine.
BRIEF DESCRIPTION OF THE FIGURES
Figure 1 A represents the locomotor activity, in particular the distance travelled in Open Field) of various groups of mice: from left to right on the abscissa: normal control mice (Ntg - n=10); APP/PS1 mice treated with an rAAV9-empty capsid (Tg Veh - control group - n=8); or APP/PS1 mice treated with rAAV9-hHIP/PAP (Tg HIP/PAP - n=8).
Ordinate: Total distance traveled (m)
Figure IB represents the Time Immobile in Open Field of various groups of mice: from left to right on the abscissa: normal control mice (Ntg - n=10); APP/PS1 mice treated with an rAAV9-empty capsid (Tg Veh - control group - n=8); or APP/PS1 mice treated with rAAV9-hHIP/PAP (Tg HIP/PAP - n=8).
Ordinate: Total time immobile (seconds) Figure 2 represents the results of a Novel object recognition test performed on various groups of mice: from left to right on the abscissa: normal control mice (Ntg - n=10); APP/PS1 mice treated with an rAAV9-empty capsid (Tg Veh - control group - n=8); or APP/PS1 mice treated with rAAV9-hHIP/PAP (Tg HIP/PAP - n=8).
Each group showing results in the presence of a familiar object (left) or of a novel object (right).
Ordinate: Time with objects (seconds).
Two-way ANOVA was performed, followed by Tukey’s Multiple Comparisons post hoc test, set at a significance of p < 0.05. Data were analyzed using GraphPad Prism version 9 (GraphPad Software, San Diego California UDA, www.Graphpad.com).
Figures 3A and 3B represent the results of a Radial arm water maze experiment performed on various groups of mice: normal control mice (Ntg - n=10); APP/PS1 mice treated with an rAAV9-empty capsid (Tg Veh - control group - n=8); or APP/PS1 mice treated with rAAV9-hHIP/PAP (Tg HIP/PAP - n=8).
Figure 3A represents the number of errors for blocks of 3 consecutive trials averaged for each group of mice by the end of the test for a total of 15 trials during day 1 (blocks 1 to 5) and 15 trials during day 2 (blocks 6 to 10), from left to right: Ntg; Tg Veh, Tg HIP/PAP.
Ordinate: Number of errors
Figure 3B represents the sum of the total number of errors made by the mice in each group (Ntg “• * ; Tg Veh Tg HIP/PAP -A-) during day 2 (blocks 5 to 10).
Ordinate: Number of errors
For blocks of errors over the 2 days (Fig 3A), two-way ANOVA with repeated measures was performed, followed by Tukey’s Multiple Comparisons post hoc test, set at a significance of p < 0.05. For total number of errors during day 2 (Fig 3B), one-way ANOVA was performed, followed by Tukey’s Multiple Comparisons post hoc test, set at a significance of p < 0.05. Data were analyzed using GraphPad Prism version 9 (GraphPad Software, San Diego California UDA, www.Graphpad.com).
Figures 4A and 4B represent the results of a reversal trial of the Radial arm water maze experiment performed on various groups of mice: normal control mice (Ntg - n=10); APP/PS1 mice treated with an rAAV9-empty capsid (Tg Veh - control group - n=8); or APP/PS1 mice treated with rAAV9-hHIP/PAP (Tg HIP/PAP - n=8).
Figure 4A represents the number of errors made by the mice of each group (Ntg -• * ; Tg Veh "O-; Tg HIP/PAP “*-) as blocks of 3 consecutive trials averaged for each group of mice by the end of the day for a total of 15 trials.
Ordinate: block 1 to 5 (from left to right).
Figure 4B represents the combined number of errors made by each group of mice on all the trials (from left to right: Ntg; Tg Veh, Tg HIP/PAP).
For blocks of errors (Fig 4A), two-way ANOVA with repeated measures was performed, followed by Tukey’s Multiple Comparisons post hoc test, set at a significance of p < 0.05. For total number of errors (Fig 4B), one-way ANOVA was performed, followed by Tukey’s Multiple Comparisons post hoc test, set at a significance of p < 0.05. Data were analyzed using GraphPad Prism version 9 (GraphPad Software, San Diego California UDA, www.Graphpad.com).
Figure 5 represents the anxiety like behavior of each group of mice detailed above evaluated by measurements of duration in open versus closed arms of an elevated plus maze (EPM), Fig 5 A, and a comparison of duration in closed arms only between the different groups (Fig5B).
From left to right on the abscissa: normal control mice (Ntg - n=10); APP/PS1 mice treated with an rAAV9-empty capsid (Tg Veh - control group - n=8); or APP/PS1 mice treated with rAAV9-hHIP/PAP (Tg HIP/PAP - n=8).
Each group showing results in open arms (left) or closed arms (right).
Ordinate: number of entries.
Figure 6 A represents a construct of recombinant adeno associated virus serotype 9 (rAAV9) to overexpress human HIP/PAP tagged with hemagglutinin (HA)-tag.
Figure 6B represents the result of immunohistochemistry with anti -HA in the hippocampus of APP/PS1 mice injected with an rAAV9-empty capsid after 6 months of expression. Figure 6C represents the result of immunohistochemistry with anti-HA in the hippocampus of APP/PS1 mice injected with an rAAV9-HIP/PAP capsid after 6 months of expression.
Figure 6D represents the level of human HIP/PAP in the cortex of APP/PS1 mice injected with rAAV9-HIP/PAP measured by ELISA 6 months after injection. HA is Human influenza hemagglutinin. Scale: 100pm, scale of insert: 30 pm.
Abscissa : Cortex ; Ordinate : HIP/PAP concentration (pg/mg).
Figures 7A and 7B represent micrograph representation of Congo red stain in the APP/PS1 mice groups treated with rAAV9-empty capsid (Fig 8 A) or rAAV9-HIP/PAP (Fig 8B) for 6 months. Scale: 100pm.
Figure 7C represents the quantification of percentage of area stained for congo red in anterior cortex (ACX), hippocampus (HPC) and posterior cortex (PCX) using nearcyte software analysis for the two above mentioned groups of mice: APP/PS1 mice groups treated with rAAV9-empty capsid or rAAV9-HIP/PAP for 6 months.
Ordinate : Positive area stained (ratio).
Abscissa : from left to right : ACX, HPC and PCX. For each one, from left to right : mice group treated with rAAV9-empty capsid (APP/PS1 Empty) and mice group treated with rAAV9-HIP/PAP (APP/PS1 HIP/PAP).
Data are presented as mean ± SEM.
Figure 7D represents the quantification of amyloid beta levels in ACX and HPC quantified with ELISA for the two above mentioned groups of mice: APP/PS1 mice groups treated with rAAV9-empty capsid or rAAV9-HIP/PAP for 6 months.
Ordinate : Concentration (ng/mL).
Abscissa : from left to right : ACX and HPC. For each one, from left to right : mice group treated with rAAV9-empty capsid (APP/PS1 Empty) and mice group treated with rAAV9-HIP/PAP (APP/PS1 HIP/PAP).
Data are presented as mean ± SEM. Figure 8 represents a Western Blot analysis with micrograph of the blot (Figure 8A) and analysis of band densitometry quantification of Catalase (Figure 8B), Heme oxygenase 1 (Ho-1) (Figure 8C) and Superoxide dismutase (SOD-1) (Figure 8D) in the hippocampus of APP/PS1 mice treated with rAAV9-empty capsid (APPPS1 empty) or rAAV9-HIP/PAP (APPPS1 HIP/PAP), and non-transgenic controls (Ntg). N=6-10. Data are presented as mean ± SEM. *p <0.05, **p <0.01. One-way ANOVA used followed by Tukey’s Multiple Comparisons post hoc test. Outliers removed according to grubb’s test with prism.
Ordinates for 8B to 8D : Ratio to total protein
Abscissa for 8B to 8D : Ntg, APPPS1 Empty and APPPS1 HIP/PAP.
Figure 9A represents the concentration of HIP/PAP in plasma and brain samples following subcutaneous administration of rHIP/PAP (or ALF5755) in mice (n=7) via pump Alzet for 28 days.
Left Ordinate : concentration (mg/mL)
Right Ordinate : concentration (pg/mL)
Figure 9B represents IVIS (In Vivo Imaging System) imaging of non-transgenic mice 30 min following intravenous injection with 250 pg of Bovin serum albumin (BSA) (top) or rHIP/PAP (bottom) labeled with vivotag 680XL (Revvity, Hopkinton, MA, USA).
Figures 9C and 9D represent the concentration of HIP/PAP in plasma samples (Figure 9C) and in brain samples (Figure 9D) 1 month after intravenous (heart, Fig 9C, n=3) or intramuscular (hind limb, Fig 9D, n=2) injection of rAAV9-HIP/PAP 2xl013 vg in the above mentioned mice.
Figure 10A represents body weight followup over 10 weeks of non-transgenic mice under control diet (Ntg CD, n=6) or High fat diet (Ntg HFD, n=5) or under high fat diet treated with rAAV9-HIP/PAP (Ntg HFD HIP/PAP n=4).
Ordinate : Body weight (% basal)
Abscissa : time (weeks from 0 to 10)
Figure 10B represents the time spent in open arms “o” versus closed arms “c” during elevated plus maze (EPM) test. Data are presented as mean ± SEM. *p<0.05, **p<0.01, ***p<0.001. One-way, two-way ANOVA or repeated measure ANOVA was used where appropriate followed by Tukey’s Multiple Comparisons post hoc test.
Ordinate : Time spent in arms (s)
Abscissa : from left to right: non transgenic mice under control diet (Ntg CD), non transgenic mice under HFD (Ntg HF) and non transgenic mice under HFD and treated with rAAV9-HIP/PAP (Ntg HFD HIP/PAP). For each group, the left part represents the results in closed arms, and the right part represents the results in open arms.
Detailed description of the invention
Definitions
In the context of the present invention, the terms “prevent”, “prevention” and “preventing” denote the reduction to a lesser degree of the risk or of the probability of occurrence of a given phenomenon, that is to say, in the present invention, the prevention of a cognitive disorder associated with anxiety, in particular of complications selected from the group consisting of diabetic foot ulcer, foot infection and amputations. The terms “prevent”, “prevention” and “preventing” also include preventing the aggravation, reducing the rate of progression or preventing recurrence of the said given phenomenon.
As used herein, the terms “treating”, “treatment” or “treat” include alleviation of the symptoms associated with a specific disorder or condition and/or elimination of said symptoms, that is to say, in the present invention, the treatment of a cognitive disorder associated with anxiety.
A “cognitive disorder” is any disorder that significantly impairs the cognitive function of an individual to the point where normal functioning in society is impossible without treatment. Problems with a person’s ability to think, learn, remember, use judgement, and make decisions. Cognitive disorder signs vary according to the particular disorder, but some common signs and symptoms overlap in most disorders. Some of the most common signs of cognitive disorder include: confusion, poor motor coordination, identity confusion, impaired judgment, memory loss (loss of short-term or long-term memory), trouble concentrating, completing tasks, understanding, remembering, following instructions, and solving problems. Other common signs may include changes in mood or behavior, loss of motivation, and being unaware of surroundings. Cognitive impairment may be mild or severe. Some cognitive disorders develop in stages and symptoms increase in severity the further the disease progresses. Cognitive instability comes with both short- and long-term effects. Some common short-term effects include ability to think and reason, memory loss, a state of confusion and a lack of coordination. Long-term effects include the increasing loss of declarative memory, such as forgetting names and significant faces, and a general lack of emotional stability and control over one’s actions, as well as dementia (altered mental status and level of consciousness, shift in attention, mood swings, violent or unordinary behaviors, and hallucinations). According to the present invention, a cognitive disorder of interest is a cognitive disorder associated with anxiety disorder(s). By “cognitive disorder associated with anxiety disorder(s)" , it is meant that the considered individual is affected by both at least one cognitive disorder and at least one anxiety disorder, said anxiety disorder being a primary or secondary symptom of the cognitive disorder. The terms “primary symptom” are used to describe a condition that’s not caused by a different medical condition. The terms “secondary symptom” mean it is a consequence of another condition. Accordingly, according to the present invention, the terms “cognitive disorder associated with anxiety disorder(s) ” include both the cognitive disorders which are a consequence of anxiety disorder(s) and cognitive disorders that led to the development of an anxiety disorder.
The diagnostic of cognitive disorders can be performed using different methods, amongst which, the Mini Mental Status Exam (MMSE), Montreal Cognitive Assessment (MoCA), Mini-Cog, and Cognitive Assessment Method (CAM), Glasgow Coma Score (GCS), Richmond Agitation and Sedation Scale (RASS) (Kelvin K F Tsoi et al., JAMA Intern Med. 2015 Sep; 175(9): 1450-8).
An “anxiety disorder” has been thoroughly defined above. Although feeling anxious from time to time is a common experience, anxiety disorders are different from typical or temporary feelings of worry or fear. Anxiety disorders can take different forms, including increased anxiety levels which can cause feelings of nervousness, restlessness, and impending danger, as well as difficulty controlling worry and making decisions. Alternatively, anxiety disorders can manifest as decreased anxiety levels, which can result in behavioral disinhibition and externalizing disorders. These disorders are characterized by a tendency to exhibit high approach, lack of restraint, inappropriate laughter, and disinhibition of speech and action in new situations. They may also involve high novelty-seeking, low harm avoidance, poor impulse control, and a proclivity for engaging in risky behaviors. In some cases, behavioral disinhibition may even be a precursor to anxiety disorders. Both mood and anxiety disorders are complex conditions involving disruptions to neuroendocrine, neurotransmitter, and neuroanatomical systems. Identifying the differences between these disorders can be difficult due to the complex interactions between different neural circuits in the brain. Nonetheless, both high and low anxiety levels may stem from a similar underlying cause, namely an imbalance in neurotransmitter signaling.
The diagnostic of anxiety disorder(s) can be performed using questionnaire such as the State-Trait Anxiety Inventory (STAI), the Generalized Anxiety Disorder 7 (GAD-7), the Beck Anxiety Inventory (BAI), the Zung Self-Rating Anxiety Scale, and the Taylor Manifest Anxiety Scale (Matthias Rose and Janine Devine, Dialogues Clin Neurosci. 2014 Jun; 16(2): 197-211). The diagnosis of anxiety disorders is made by symptoms, triggers, and a person’s personal and family histories. There are no objective biomarkers or laboratory tests that can diagnose anxiety.
The terms " substance abuse” refer to the excessive and persistent use of a substance, such as alcohol or drugs, despite the negative consequences it may have on one’s physical, psychological, or social well-being. Substance abuse can lead to addiction, which is a chronic and relapsing condition characterized by compulsive drug-seeking behavior and drug use despite harmful consequences. The diagnosis of substance abuse is usually based on criteria such as tolerance (the need for increased amounts of the substance to achieve the desired effect), withdrawal symptoms, continued use despite negative consequences, and unsuccessful attempts to quit or cut down use. It’s worth noting that the definition of substance abuse may vary depending on the substance in question and the context in which it is used.
“Attention deficit disorders” (ADD), which comprises attention deficit hyperactivity disorder (ADHD), are medical conditions that are characterized by symptoms of inattention, hyperactivity, and impulsivity. Inattention symptoms may include difficulty paying attention, forgetfulness, poor organization, and distractibility. Hyperactivity symptoms may include fidgeting, restlessness, difficulty sitting still, and excessive talking. Impulsivity symptoms may include acting without thinking, interrupting others, and difficulty waiting for one’s turn. The diagnosis of ADD/ ADHD is usually based on a combination of symptoms, duration, and impairment in functioning, as well as ruling out other possible medical or psychological conditions that may be causing similar symptoms.
Psychotic disorders are a group of mental illnesses that are characterized by a loss of contact with reality, which may include symptoms such as delusions, hallucinations, disordered thinking, and abnormal behaviors. Delusions are fixed beliefs that are not based in reality and are often bizarre or paranoid in nature. Hallucinations are sensory experiences that are not based on external stimuli, such as hearing voices or seeing things that are not there. Disordered thinking may include difficulty with logical thinking, speech that is difficult to follow, and jumping between unrelated topics. Abnormal behaviors may include odd mannerisms or movements, lack of emotional expression, and social withdrawal.
Psychotic disorders can have a significant impact on a person’s ability to function in daily life and can range from mild to severe in severity. The most common psychotic disorders are schizophrenia, schizoaffective disorder, and delusional disorder.
“Cholinesterase inhibitors” are chemicals that prevent the breakdown of the neurotransmitter acetylcholine. Examples of cholinesterase inhibitors are donepezil, rivastigmine and galantamine. “Glutamate regulators” are chemicals that regulate the activity of the chemical messenger glutamate which is responsible for helping the brain process information. Such regulators are known for improving memory, attention, reason, language, and ability to perform simple tasks. An example of glutamate regulator is Memantine. “NMDA- R antagonists” are chemicals which can non- selectively decrease NMDA-Rs abnormal activity.
“Alpha? nicotinic agonists” are chemicals which are implemented for the normalization of attentional dysfunctions. Examples of such agonists can for example be clozapine or 3-2,4 dimethoxybenzylidene anabaseine (DMXBA). Other examples of Alpha? nicotinic agonists are known, as illustrated for example in Laura F Martin et al., Psychopharmacology (Berl). 2004 Jun;174(l):54-64 which is incorporated by reference.
“Selective serotonin reuptake inhibitors” are particularly known for being the most commonly prescribed antidepressants. Examples of such inhibitors can for example be citalopram, escitalopram, fluoxetine, fluvoxamine, paroxetine or sertraline.
“Serotonin-norepinephrine reuptake inhibitors” are a family of antidepressants that inhibit the reuptake of both serotonin and norepinephrine. Examples of such inhibitors are duloxetine and venlafaxine.
“Calcium modulator”, also termed calcium channel modulators, of which the gabapentinoids are by far the most prominently prescribed, inhibit pain signals propagated by voltage-gated calcium channels situated at the central nerve terminal. Pregabalin may for example be cited as example of such modulator.
“Reversible inhibitors of monoamine oxidase A (RIMA)” inhibit the breakdown of three major neurotransmitters, serotonin, norepinephrine and dopamine, offering a multineurotransmitter strategy for in particular the treatment of depression. Moclobemide may for example be cited as example of such chemical. “Anti-seizure medication” is a type of drug that is used to prevent or treat seizures or convulsions by controlling abnormal electrical activity in the brain. Anti-seizure medications are used to treat epilepsy and other seizure disorders. They are also used to treat medical conditions, such as bipolar disorder, nerve pain, migraine headaches, fibromyalgia, and restless leg syndrome.
“Antifungals” are medicines that kill or stop the growth of fungi (the plural of fungus) that cause infections. They are also called antimycotic agents.
“Corticosteroids”, often known as steroids, are an anti-inflammatory medicine. As costicosteroid, Prednisone can for example be cited.
“Immunosuppressants”, or immunosuppressive drugs, are key therapeutic tools that inhibit or prevent activity of the immune system. Can for example be cited as immunosuppressants methotrexate and azathioprine.
By “normal response to an anxiogenic situation”, it is meant a physiological and psychological response that is appropriate and proportionate to the perceived level of threat or stress in an anxiogenic situation.
The terms “anxiogenic situation” refers to any situation or circumstance that is likely to provoke or increase anxiety in an individual. These situations may include, but are not limited to, public speaking, confrontations, social situations, uncertainty about the future, or situations that involve a potential threat to one’s safety or well-being. Overall, anxiogenic situations are those that tend to elicit anxiety or fear in individuals.
The term “physiologically acceptable medium" is intended to denote a medium which is compatible with the body of the individual to whom said composition must be administered. It is, for example, a non-toxic solvent such as water. In particular, said medium is compatible with oral, sublingual, subcutaneous, intramuscular, intravenous, topical, local, intratracheal, intranasal or rectal administration, and more particularly with oral, subcutaneous, intravenous, topical or local administration.
The terms “sequence homology'1'1 or “sequence identity” or “homology” or “identity” are used interchangeably herein. For the purpose of the invention, it is defined here that in order to determine the percentage of sequence homology or sequence identity of two amino acid sequences or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes. In order to optimize the alignment between the two sequences, gaps may be introduced in any of the two sequences that are compared. Such alignment can be carried out over the full length of the sequences being compared. Alternatively, the alignment may be carried out over a shorter length, for example over about 20, about 50, about 100 or more nucleic acids/based or amino acids. The sequence identity is the percentage of identical matches between the two sequences over the reported aligned region. A comparison of sequences and determination of percentage of sequence identity between two sequences can be accomplished using a mathematical algorithm. The skilled person will be aware of the fact that several different computer programs are available to align two sequences and determine the identity between two sequences (Kruskal, J. B. (1983) An overview of sequence comparison In D. Sankoff and J. B. Kruskal, (ed.), Time warps, string edits and macromolecules: the theory and practice of sequence comparison, pp. 1-44 Addison Wesley).
The percent sequence identity between two amino acid sequences or between two nucleotide sequences may be determined using the Needleman and Wunsch algorithm for the alignment of two sequences. (Needleman, S. B. and Wunsch, C. D. (1970) J. Mol. Biol. 48, 443-453). Both amino acid sequences and nucleotide sequences can be aligned by the algorithm. The Needleman-Wunsch algorithm has been implemented in the computer program NEEDLE.
For the purpose of the invention, the NEEDLE program from the EMBOSS package was used (version 2.8.0 or higher, EMBOSS: The European Molecular Biology Open Software Suite (2000) Rice, P. LongdenJ. And Bleasby,A. Trends in Genetics 16, (6) pp276 — 277, http://emboss.bioinformatics.nl/). For protein sequences EBLOSUM62 is used for the substitution matrix. For nucleotide sequence, EDNAFULL is used. The optional parameters used are a gap opening penalty of 10 and a gap extension penalty of 0.5. No end gap penalty is added. In the Output section, Yes has been indicated in response to the question “Brief identity and similarity” and “SRS pairwise” indicated as Output alignment format.
After alignment by the program NEEDLE as described above the percentage of sequence identity between a query sequence and a sequence of the invention is calculated as follows: Number of corresponding positions in the alignment showing an identical amino acid or identical nucleotide in both sequences divided by the total length of the alignment after subtraction of the total number of gaps in the alignment. The identity defined as herein can be obtained from NEEDLE by using the NOBRIEF option and is labeled in the output of the program as “longest-identity”. The similarity of nucleotide and amino acid sequences, i.e. the percentage of sequence identity, can be determined via sequence alignments using several other art-known algorithms, preferably with the mathematical algorithm of Karlin and Altschul (Karlin & Altschul (1993) Proc. Natl. Acad. Sci. USA 90: 5873-5877), with hmmalign (HMMER package, http://hmmer.wustl.edu/) or with the CLUSTAL algorithm (Thompson, J. D., Higgins, D. G. & Gibson, T. J. (1994) Nucleic Acids Res. 22, 4673-80) available e.g. on https://www.ebi.ac.uk/Tools/msa/clustalo/ or the GAP program (mathematical algorithm of the University of Iowa) or the mathematical algorithm of Myers and Miller (1989 - Cabios 4: 11- 17) or Clone Manager 9. Preferred parameters used are the default parameters as they are set on https://www.ebi.ac.uk/Tools/msa/clustalo/.
The grade of sequence identity (sequence matching) may be calculated using e.g. BLAST, BLAT or BlastZ (or BlastX). A similar algorithm is incorporated into the BLASTN and BLASTP programs of Altschul et al (1990) J. Mol. Biol. 215, 403-410. BLAST polynucleotide searches are performed with the BLASTN program, score = 100, word length = 12, to obtain polynucleotide sequences that are homologous to those nucleic acids which encode the relevant protein.
BLAST protein searches are performed with the BLASTP program, score = 50, word length = 3, to obtain amino acid sequences homologous to the SHC polypeptide. To obtain gapped alignments for comparative purposes, Gapped BLAST is utilized as described in Altschul et al (1997) Nucleic Acids Res. 25, 3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs are used. Sequence matching analysis may be supplemented by established homology mapping techniques like Shuffle-LAGAN (Brudno M., Bioinformatics 2003b, 19 Suppl 1 : 154-162) or Markov random fields. When percentages of sequence identity are referred to in the present application, these percentages are calculated in relation to the full length of the longer sequence, if not specifically indicated otherwise.
In particular embodiments, % identity between two sequences is determined using CLUSTAL O (version 1.2.4).
As used herein, the term ''polypeptide ” refers to a molecule comprising amino acid residues linked by peptide bonds and containing more than five amino acid residues. The amino acids are identified by either the single-letter or three-letter designations. The term “protein” as used herein is synonymous with the term ''polypeptide ” and may also refer to two or more polypeptides. Thus, the terms “protein”, “peptide” and “polypeptide” can be used interchangeably. Polypeptides may optionally be modified (e.g., glycosylated, phosphorylated, acylated, farnesylated, prenylated, sulfonated, and the like) to add functionality.
HIP/PAP protein and derivative thereof implemented according to the invention
The HIP/PAP protein is known for its anti-apoptotic and mitogenic activity on hepatic cells (US 13/032,521, WO 2004/112824, Simon et al., FASEB J. 2003 Aug;17(l l): 1441-50).
It has also been shown that a 15-amino acid peptide, derived from the Reg Illa family (HIP/PAP), the HIP (Human prolslet Peptide) peptide, has a regenerating activity on pancreatic islets and thus stimulates insulin production (US 2010/0093605).
The HIP/PAP protein according to the invention can comprise an amino acid sequence selected from the group consisting of sequences set forth as SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, in particular the sequence set forth as SEQ ID NO: 4.
The amino acid sequence SEQ ID NO: 1 corresponds to the HIP/PAP protein of sequence SEQ ID NO: 4, from which the N-terminal 26-amino acid signal peptide of said protein has been deleted.
In a particular embodiment, the HIP/PAP protein according to the invention comprises, or consists of, the amino acid sequence set forth as SEQ ID NO: 4.
In a particular embodiment, the HIP/PAP protein according to the invention comprises, or consists of, the amino acid sequence set forth as SEQ ID NO: 1.
The amino acid sequence SEQ ID NO: 2 corresponds to the short form of the HIP/PAP protein and, compared with the amino acid sequence SEQ ID NO: 1, has had the 11- amino acid propeptide in the N-terminal position deleted.
In a particular embodiment, the HIP/PAP protein according to the invention comprises, or consists of, the amino acid sequence set forth as SEQ ID NO: 2.
The sequence SEQ ID NO: 3 corresponds to the sequence SEQ ID NO: 1, to which a methionine has been added in the N-terminal position. The HIP/PAP derivative of sequence SEQ ID NO: 3 is also called rcHIP/PAP or ALF5755. This derivative may in particular be produced recombinantly in E.Coli cells. The 12-amino acid N-terminal propeptide (propeptide of 11 amino acids plus the additional methionine) may be cleaved, in order to obtain the short form of the HIP/PAP protein (SEQ ID NO: 2). In a particular embodiment, the HIP/PAP protein according to the invention comprises, or consists of, the amino acid sequence set forth as SEQ ID NO: 3.
According to the invention, the short or long forms of the HIP/PAP protein or of the derivatives thereof may be used indifferently.
A derivative of the HIP/PAP protein according to the invention designates a biologically active derived form of a HIP/PAP protein of any one of sequences SEQ ID No. 1 to 4. The terms “biologically active'' mean that the derivative of the HIP/PAP protein have the same biological activity as the HIP/PAP protein of any one of sequences SEQ ID No. 1 to 4.
A derivative of the HIP/PAP protein according to the invention comprises, or consists in, an amino acid sequence having a sequence identity of at least 80% with the amino acid sequence selected from the group consisting of sequences SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, in particular SEQ ID NO: 4, and a biological activity of the same nature as the amino acid sequence selected from the group consisting of sequences SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, in particular SEQ ID NO: 4.
A biological activity of the same nature as the HIP/PAP protein according to the present invention is as described previously, i.e. the capacity to treat and/or prevent peripheral neuropathy in an individual, in particular a diabetic peripheral neuropathy, and to accordingly prevent a complication of peripheral neuropathy in an individual, in particular a complication as detailed elsewhere in the present text.
As described herein, an amino acid sequence having at least 80% amino acid identity with a reference amino acid sequence encompasses amino acid sequences having at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% amino acid identity with the said reference amino acid sequence, and also a biological activity of the same nature as the said reference amino acid sequence.
In certain embodiments, the HIP/PAP protein, or a derivative thereof, may be associated or combined by noncovalent bonds with non-HIP/PAP portions. For example, the HIP/PAP protein or a derivative thereof could be associated with a liposome particle. Depending on the type of liposome, or on the production process, the HIP/PAP protein, or the derivative thereof, may be associated at the surface of the liposome or encapsulated inside said liposome.
The HIP/PAP protein, or a derivative thereof, may also be associated with non- HIP/PAP portions by covalent bonds. Such non-HIP/PAP portions may be selected from protein or non-protein compounds, for example polyethylene glycol, thus forming a pegylated HIP/PAP derivative.
A derivative of the HIP/PAP protein according to the invention also comprises the derivatives which become biologically active only when they are administered to the patient.
Finally, the derivatives of the HIP/PAP protein also comprise chimeric proteins or fusion proteins. Such proteins are fused with non-HIP/PAP polypeptides. The latter may be fused with the N- or C-terminal part. Typically, the HIP/PAP protein or a derivative thereof may be fused with the GST sequence at the level of their C-terminal part, in order to facilitate the purification of the recombinant proteins.
In certain embodiments of the invention, the HIP/PAP protein, or a derivative thereof, according to the invention is produced recombinantly in bacterial or animal cells, including insect and mammalian cells, according to techniques known to those skilled in the art.
In other embodiments, the HIP/PAP protein, or a derivative thereof, according to the invention may be isolated from a cell or from a tissue by known purification techniques.
The HIP/PAP protein and the derivatives thereof may also be produced by chemical synthesis.
In the text, the terms ‘’‘’HIP/PAP protein" cover the HIP/PAP protein in itself, and also the derivatives thereof as described above.
Compositions implemented according to the invention
The invention also relates to the implementation of the HIP/PAP protein, or a derivative thereof, as defined previously in a composition comprising a physiologically acceptable medium.
The physiologically acceptable medium, previously defined in the present text, may be chosen, according to the pharmaceutical form and the mode of administration desired, from the usual excipients which are known to those skilled in the art (see Remington’s Pharmaceutical Sciences, 16th edition, Osol, A ed., 1980).
By way of example, compositions implemented according to the invention may comprise, according to the therapeutic indications and the HIP/PAP protein or the derivative thereof: a) the HIP/PAP protein or a derivative thereof; and b) a buffer capable of maintaining the pH in a maximum stability range, preferentially from 1 to 9, more particularly from 4 to 8 and even more particularly from 6 to 7.5; and/or c) a detergent or a surfactant which stabilizes the protein or the polypeptide against the aggregation induced by stirring; and/or d) an isotonic; and/or e) a preservative, chosen for example from the group consisting of phenols, benzyl alcohols, benzothelium halides, and chlorides; and/or f) water.
If the detergent or the surfactant used is nonionic, it may be chosen from polysorbates, PLURONIC TM, polyethylene glycol (PEG) or poloxamers.
An isotonic will make it possible to maintain the isotonicity of the composition and will typically include polyalcohols such as glycerol, erythritol, arabitol, xylitol, sorbitol or mannitol, used alone or in combination. Alternatively, sodium chloride and/or any other inorganic salt may be used as isotonic.
The buffer may be, for example, acetate, citrate, succinate, a phosphate buffer or any other inorganic buffer, depending on the desired pH.
The preservatives of phenol, benzyl alcohol, benzothelium halide and chloride type are known antimicrobial agents. Typical preservatives comprise octadecyldimethylbenzylammonium chloride, hexamethonium chloride, benzalkonium chloride, phenol, butyl or benzyl alcohols, alkyl parabens, such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3 -pentanol and m-cresol.
Additional excipients may also comprise antioxidants, such as ascorbic acid and methionine, chelating agents, such as EDTA, sugars, such as sucrose, mannitol, trehalose or sorbitol, etc.
The HIP/PAP protein, or the derivative thereof, according to the invention may be in the form of a pharmaceutically acceptable salt. This is intended to mean salts prepared from pharmaceutically acceptable non-toxic acids or pharmaceutically acceptable non-toxic bases, including organic and inorganic salts and acids. By way of example, mention may be made of alkali metal salts (sodium and potassium salts), alkaline-earth metal salts (calcium and magnesium salts), ammonium salts, salts of organic bases (pyridine or tri ethylamine salts), salts of inorganic acids (hydrochloride, sulfate, nitrate) and salts of organic acids (acetate, oxalate, p-toluenesulfonate). A composition implemented according to the invention may be for oral, sublingual, subcutaneous, intramuscular, intravenous, topical, local, intratracheal, intranasal or rectal administration, and in particular for oral, subcutaneous, intravenous, topical or local administration.
According to one preferred embodiment, the HIP/PAP protein is administered in an effective amount, i.e. the amount required to obtain the expected effects of the invention. Such an amount of HIP/PAP protein will be determined, generally empirically, according to the subject to be treated and to his pathological condition. The effective amount will also depend on the mode of administration envisioned. The adjustments required to determine the effective amount for obtaining the maximum therapeutic effect correspond to techniques that are routine for the clinician.
An effective amount of the HIP/PAP protein or of a derivative thereof may for example be between 0.1 pg/day/kg of body weight and 100 mg/day/kg of body weight of the individual to which it must be administered. Although in certain embodiments an effective amount of the HIP/PAP protein, or derivative thereof, may reach more than 10 mg/kg, an effective amount of the HIP/PAP protein, or derivative thereof, according to the present invention is generally less than 5 mg/kg of body weight, which includes amounts less than 4.5 mg/kg, 4 mg/kg, 3.5 mg/kg, 3 mg/kg, 2.5 mg/kg or 2000 pg/kg. More particularly, an effective amount of the HIP/PAP protein, or derivative thereof, according to the present invention comprises amounts of at least 1 pg/kg, 2 pg/kg, 3 pg/kg, 4 pg/kg, 5 pg/kg, 6 pg/kg, 7 pg/kg, 8 pg/kg, 9 pg/kg, 10 pg/kg, 15 pg/kg, 20 pg/kg, 25 pg/kg, 30 pg/kg, 40 pg/kg, 50 pg/kg, 60 pg/kg, 70 pg/kg, 80 pg/kg, 90 pg/kg, 100 pg/kg, 150 pg/kg, 200 pg/kg, 250 pg/kg, 300 pg/kg, 350 pg/kg, 400 pg/kg, 450 pg/kg, 500 pg/kg, 600 pg/kg, 700 pg/kg, 800 pg/kg, 900 pg/kg, 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg or more with respect to body weight of the individual to which it is or must be administered.
According to particular embodiments, the HIP/PAP protein, or derivative thereof, is administered according to a dosage of between 10 and 5000 pg/kg, preferentially between 100 and 2000 pg/kg with respect to body weight.
In the compositions implemented according to the present invention for oral, sublingual, subcutaneous, intramuscular, intravenous, topical, local, intratracheal or intranasal or rectal administration, the active ingredient (the HIP/PAP protein or a derivative thereof) may be administered in unit administration form as a mixture with pharmaceutical excipients. When the composition is for oral administration, said composition may be chosen from the group consisting of a food product, a beverage, a pharmaceutical product, a nutraceutical, a food additive, a food supplement and a milk product.
The preferred modes of administration are the oral, subcutaneous, intravenous, topical or local routes, and more particularly the subcutaneous, intravenous, topical or local routes.
The administration of a compound or composition of the invention may for example be performed through the use of a sheath, a patch, a pad, a compress, a bandage, a tape, a gauzebased dressing, a woven or non-woven sponge or a syringe.
The HIP/PAP protein, or a derivative thereof, may be sterilized prior to the in vivo administration. The sterilization may be obtained by filtration on sterile filtration membranes, before or after the lyophilization or the reconstitution. The systemically administered HIP/PAP protein, or derivative thereof, may advantageously be lyophilized or stored in solution. In lyophilized form, the HIP/PAP protein, or derivative thereof, may be generally formulated in combination with excipients which enable reconstitution with an appropriate diluent, at the time of use.
The HIP/PAP protein, or a derivative thereof, may be administered daily in one intake or in a fractionated manner (for example from 2 to 3 times per day) until the desired therapeutic effect is obtained. It may also be administered chronically.
The HIP/PAP protein, or a derivative thereof, may also be administered in the form of a course, for example courses ranging from 15 days to 3 months, optionally repeated from 1 to 6 times at determined doses and time intervals.
The HIP/PAP protein, or a derivative thereof, according to the invention may also be combined in the context of a polytherapy with agents known for treating and/or preventing a cognitive deficit. Such additional agents known for being useful in the prevention and/or treatment of a cognitive deficit are known by the skilled person in the art and may in particular be selected from the group consisting of an agent selected from the group consisting of Cholinesterase inhibitors, such as donepezil, rivastigmine or galantamine; Glutamate regulators; such as memantine; cholinesterase inhibitors, in particular in combination with glutamate regulators, such as the combination of donepezil and memantine; Methylphenidate; Amphetamine; Atomoxetine; AMPA-R agonists; “Alpha? nicotinic agonists”; Guanfacine; Bupropion; Vortioxetine and D-cycloserine. The HIP/PAP protein, or a derivative thereof, according to the invention may also be combined in the context of a polytherapy with agents known for treating and/or preventing an anxiety disorder. Such additional agents known for being useful in the prevention and/or treatment of an anxiety disorder are known by the skilled person in the art and may in particular be selected from the group consisting of selective serotonin reuptake inhibitors, serotoninnorepinephrine reuptake inhibitors, tricyclic antidepressants, calcium modulators, azapirone, reversible inhibitors of monoamine oxidase A, agomelatine, quetiapine and vortioxetine, and more particularly selected from the group consisting of citalopram, escitalopram, fluoxetine, fluvoxamine, paroxetine, sertraline, duloxetine, venlafaxine, clomipramine, pregabalin, buspirone, moclobemide, agomelatine, quetiapine and vortioxetine.
A composition implemented according to the invention may accordingly comprise, in addition to the HIP/PAP protein, or a derivative thereof, according to the invention, at least an agent known for being useful in the prevention and/or treatment of a cognitive deficit and at least an agent known for being useful in the prevention and/or treatment of an anxiety disorder, which includes the case where one agent plays both roles, i.e. is known for being useful in the prevention and/or treatment of a cognitive deficit and of an anxiety disorder, such as votioxetine for example.
By administered in combination with, it means that the HIP/PAP protein, a derivative thereof, or a composition comprising it according to the invention can be administered simultaneously or sequentially compared to the other agents or compounds. When they are in separate compositions, the composition comprising the HIP/PAP protein, a derivative thereof, according to the invention and the composition comprising the at least one additional agent can be administered through the same route or through different routes.
The HIP/PAP protein, or a derivative thereof, according to the invention and the at least one additional agent can be administered in the same composition or in separate compositions.
By simultaneously, it is understood that the compositions can be administered at the same moment or up to the same day or couple of days.
By sequentially, it is understood that the compositions can be administered with at least several days, for example at least two days of difference. Implementation of the HIP/PAP protein and/or of a derivative thereof
As previously mentioned, a HIP/PAP protein, of a derivative thereof, as well as a composition comprising it, are for use in:
- the treatment and/or prevention, in particular the treatment, of a cognitive disorder associated with anxiety disorder(s) in an individual in need thereof; and/or in particular the treatment and/or prevention, in particular the treatment, of a cognitive disorder associated with an externalizing disorder, the cognitive disorder being in particular selected from the group consisting of bipolar disorder, substance abuse, attention deficit disorders and psychotic disorders; and/or
- restoring a physiological level of anxiety in an individual, in particular in an individual affected by a cognitive disorder associated with an anxiety disorder; and/or
- improving cognition in an individual affected by a neurological disorder associated with anxiety disorder(s), selected from the group consisting of Autism spectrum disorder, Angelman syndrome, Down’s syndrome and other neurologic disorder-related cognitive impairments, such as Chronic meningitis, autoimmune encephalitis or neurosarcoidosis,'
- alleviating cognitive deficit in an individual affected by a disorder selected from the group consisting of Obsessive-compulsive disorder, Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington’s disease (HD), Parkinson’s disease (PD), bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars-cov-2 infection; and/or
- the treatment and/or the prevention of diet induced cognitive and anxiety deficits in an individual in need thereof, and in particular high fat diet induced cognitive and anxiety deficits.
Environmental factors such as diet have indeed been shown to impact neurobiology and cognitive function with effects on healthy brain aging (Evans et al., 2022, Front Pharmacol. 13, 1030609 ; Gonzalez Olmo et al., 2021, Nutrients. 13; Spencer et al., 2019, Neurobiol Aging. 74, 121-134; Wieckowska-Gacek et al., 2021, Ageing Res Rev. 70, 101397). Consumption of high-fat diet has been associated with obesity, insulin resistance, diabetes, age-related cognitive impairment, and neurodegenerative disorders (Buckman et al., 2014, Brain Behav Immun. 35, 33-42; Sanchez et al., 2018, Int J Mol Sci. 19(2): 533). Mechanisms through which HFD impacts brain function are not well established, although neuroimmune signaling is likely a contributing factor (Butler, 2021, Brain Behav Immun Health. 16, 100298).
Acute exposure to a HFD, as short as three days, has been shown to induce neuroinflammation and impair memory consolidation in aged rats (Spencer et al., 2019, Neurobiol Aging. 74, 121-134). HFD has also been shown to increase anxiety-related behavior and impair learning and memory in young mice (Gainey et al., 2016, Front Behav Neurosci. 10, 156.). Diet-induced obesity following chronic HFD administration contributes to a systemic inflammatory environment, which may impact neuroinflammation, neurobiology, and cognitive function (Buckman et al., 2014, Brain Behav Immun. 35, 33-42; Butler, 2021, Brain Behav Immun Health. 16, 100298).
As previously indicated, the anxiety disorder(s) associated with the cognitive disorder may in particular be:
(i) a primary symptom, such as in Obsessive-compulsive disorder, and/or
(ii) a secondary symptom, such as in a neurodegenerative disease selected in the group consisting of Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington’s disease (HD), Parkinson’s disease (PD), bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars-cov-2 infection.
An individual to which the HIP/PAP protein, a derivative thereof, or a composition for use according to the invention, is administered may be a mammal and in particular a human being.
The HIP/PAP protein, a derivative thereof, or a composition for use according to the invention, may be administered in combination with standards of medical care for a cognitive deficit and/or for an anxiety disorder.
Accordingly, the HIP/PAP protein, a derivative thereof, or a composition for use according to the invention, may be administered to the individual in need thereof together with at least one agent known for being useful in the prevention and/or treatment of a cognitive deficit, such has for example an agent selected from the group consisting of Cholinesterase inhibitors, such as donepezil, rivastigmine or galantamine; Glutamate regulators; such as memantine; cholinesterase inhibitors, in particular in combination with glutamate regulators, such as the combination of donepezil and memantine; Methylphenidate; Amphetamine; Atomoxetine; AMPA-R agonists; “Alpha? nicotinic agonists”; Guanfacine; Bupropion; Vortioxetine and D-cycloserine.
Alternatively, or additionally, the HIP/PAP protein, a derivative thereof, or a composition for use according to the invention, may be administered to the individual in need thereof together with at least one agent known for being useful in the prevention and/or treatment of an anxiety disorder, in particular selected from the group consisting of selective serotonin reuptake inhibitors, serotonin-norepinephrine reuptake inhibitors, tricyclic antidepressants, calcium modulators, azapirone, reversible inhibitors of monoamine oxidase A, agomelatine, quetiapine and vortioxetine, and more particularly selected from the group consisting of citalopram, escitalopram, fluoxetine, fluvoxamine, paroxetine, sertraline, duloxetine, venlafaxine, clomipramine, pregabalin, buspirone, moclobemide, agomelatine, quetiapine and vortioxetine.
When such an agent known for being useful in the prevention and/or treatment of an anxiety disorder is implemented with the HIP/PAP protein, a derivative thereof, or a composition for use according to the invention in a patient in need thereof, the cognitive disorder associated with anxiety disorder(s) may particularly be more selected from the group consisting of Obsessive-compulsive disorder, Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington’s disease (HD), Parkinson’s disease (PD), bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars- cov-2 infection.
The HIP/PAP protein, a derivative thereof, or a composition for use according to the invention, may more particularly be administered together with at least one agent known for being useful in alleviating the symptoms associated with a disorder selected from the group consisting of Autism spectrum disorder, Angelman syndrome, Down’s syndrome and other neurologic disorder-related cognitive impairments, such as Chronic meningitis, autoimmune encephalitis or neurosarcoidosis, in particular selected from the group consisting of an antiseizure medication; amino acid supplements; antifungals; corticosteroids, such as prednisone; and immunosuppressants, such as methotrexate or azathioprine. In particular, a composition for use according to the invention may further comprise at least one agent known for being useful in alleviating the symptoms associated with a disorder selected from the group consisting of Autism spectrum disorder, Angelman syndrome, Down’s syndrome and other neurologic disorder-related cognitive impairments, such as Chronic meningitis, autoimmune encephalitis or neurosarcoidosis, in particular selected from the group consisting of an anti-seizure medication; amino acid supplements; antifungals; corticosteroids, such as prednisone; and immunosuppressants, such as methotrexate or azathioprine.
The present invention also relates to a method for treating and/or preventing, in particular treating, a cognitive disorder associated with anxiety disorder(s) in an individual in need thereof, comprising administering to the said individual a HIP/PAP protein, a derivative thereof, or a composition comprising it.
The present invention also relates to a method for improving cognition in an individual affected by a neurological disorder associated with anxiety disorder(s), the neurological disorder associated with anxiety disorder(s) being selected from the group consisting of Autism spectrum disorder, Angelman syndrome, Down’s syndrome and other neurologic disorder-related cognitive impairments, such as Chronic meningitis, autoimmune encephalitis or neurosarcoidosis, comprising administering to the said individual a HIP/PAP protein, a derivative thereof, or a composition comprising it.
The present invention also relates to a method for alleviating cognitive deficit in an individual affected by a disorder selected from the group consisting of Obsessive-compulsive disorder, Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington’s disease (HD), Parkinson’s disease, bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars-cov-2 infection, comprising administering to the said individual a HIP/PAP protein, a derivative thereof, or a composition comprising it.
The present invention also relates to a method for treating and/or preventing diet induced cognitive and anxiety deficits in an individual in need thereof, comprising administering to the said individual a HIP/PAP protein, a derivative thereof, or a composition comprising it, according to the invention.
The present invention moreover relates to the use of a HIP/PAP protein, a derivative thereof, or a composition comprising it, for treating and/or preventing, in particular treating, a cognitive disorder associated with anxiety disorder(s) in an individual in need thereof.
The present invention moreover relates to the use of a HIP/PAP protein, a derivative thereof, or a composition comprising it, for improving cognition in an individual affected by a neurological disorder associated with anxiety disorder(s), the neurological disorder associated with anxiety disorder(s) being selected from the group consisting of Autism spectrum disorder, Angelman syndrome, Down’s syndrome and other neurologic disorder-related cognitive impairments, such as Chronic meningitis, autoimmune encephalitis or neurosarcoidosis.
The present invention moreover relates to the use of a HIP/PAP protein, a derivative thereof, or a composition comprising it, for alleviating cognitive deficit in an individual affected by a disorder selected from the group consisting of Obsessive-compulsive disorder, Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington’s disease (HD), Parkinson’s disease (PD), bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars-cov-2 infection.
The present invention moreover relates to the use of a HIP/PAP protein, a derivative thereof, or a composition comprising it, for treating and/or preventing diet induced cognitive and anxiety deficits in an individual in need thereof, comprising administering to the said individual a HIP/PAP protein, a derivative thereof, or a composition comprising it, according to the invention.
The invention is described below in greater detail by means of the following examples which are given solely by way of illustration.
All the references to percentages are percentages by weight unless otherwise indicated.
EXAMPLES
Example 1
Animal injections
Animals were anesthetized using isoflurane and positioned in a World Precision Instruments stereotactic surgery apparatus. An incision was made on the sagittal surface of the skull. Six months old APP/PS1 mice (denominated transgenic or Tg) were injected into the right and left hippocampus (HPC) (X=+/-2.7 Y=-2.7, Z=-3 from bregma) as well as right and left cortex (X=+/-2 Y=-2, Z=-3 from bregma) with 2 microliters of either rAAV9-empty capsid (Transgenic vehicle, Tg Veh, n=8) or rAAV9-hHIP/PAP (rAAV9-HIP/PAP (see Fig. 6A) Tg HIP/PAP, n=8) at 5xlOnpg/mL. Non-transgenic littermates (Ntg n=10) were used as controls for behavior baseline. Six months after surgery, animals underwent behavior testing for 2 weeks. At the end of behavior testing, animals were euthanized and tissue collected. Behavioral Analysis
Prior to euthanizing, mice were tested in a battery of behavioral tasks including open field, novel object recognition, elevated plus maze and radial arm water maze. A group of age-matched wild type mice were used for comparison. Tasks were performed from least stressful (open field) to most stressful (RAWM) as described here-after.
Analysis of measures were performed using one-way or two-way ANOVA. Repeated measure was performed on tasks like water maze which require multiple training/trials. Tukey’s HSD Post-hoc means comparisons for significant ANOVA measures were used using GraphPad Prism. Grubb’s test was used to determine outliers.
Open field
The open field was used as a standard test of general activity. Animals were monitored for 15 min in a 40 cm square open field with video tracking software (ANY-Maze, Stoelting, IL), under moderate lighting.
General activity levels were evaluated by measurements of horizontal and vertical activity.
Novel object recognition test (NOR)
Mice were placed in a 40 x 40 cm arena monitored and quantified by video tracking (ANY-Maze, Stoelting, IL). Two objects similar in scale to the mouse were placed along the center line of the arena approximately 3-5 cm from the outside wall.
Each animal was given three acclimation trials of 5 minutes each with a 5 minutes inter-trial interval.
After each trial, the arena and object cues were cleaned with 70% ethanol to minimize olfactory cues. After the acclimation trials, one of the acclimated objects was replaced with a novel object. Animals were given a 5 minutes exploratory trial during which object exploration was monitored by video recording.
Working memory was evaluated by the time spent exploring both novel and familiar objects.
Radial arm water maze and Reversal
The radial arm water maze contained 6 swim paths (arms) radiating from an open central area with a hidden escape platform located at the end of one of the arms. The pool was surrounded by several extra-maze cues to allow spatial navigation. On each trial, the mouse was allowed to swim for up to 60 seconds to find the escape platform. The platform was located in the same arm on each trial.
On day one, mice were given 15 trials alternating between a visible platform (above the water) and a hidden platform (below the water). On day two, mice were given 15 additional trials with all the trials using a hidden platform. The start arm was varied for each trial so that mice relied upon spatial cues to solve the task instead of learning motor rules (i.e. second arm on the right).
The goal arm for each mouse was different to avoid odor cues revealing the goal arm. Entry into an incorrect arm (all four limbs within the arm) was scored as an error. Failure to make an arm entry within 15 seconds was also scored as an error. The errors for blocks of 3 consecutive trials were averaged for data analysis. Mice averaging 1 error or less by the end of day 2 were considered to have reached the learning criterion.
On the third day, a reversal trial was performed with the goal platform placed in the arm 180° from the original location. Mice were given 15 trials, all with a hidden platform. Animals were monitored with video tracking software (Ethovision, Noldus).
Elevated plus maze
The elevated plus maze test is one of the most widely used tests for measuring anxiety-like behavior.
The test is based on the natural aversion of mice for open and elevated areas, as well as on their natural spontaneous exploratory behavior in novel environments. Mice were placed at the junction of a four-arms maze composed of two open arms without walls and two arms enclosed by 15.25 cm high walls 30 cm long and 5 cm wide.
Animals were monitored for 5 min with video tracking software (ANY-Maze, Stoelting, IL), under moderate lighting. Anxiety like behavior was evaluated by measurements of number of entries/duration in open versus closed arms.
The more time the mice spend in the closed arms the more anxious they are, which is a normal behavior observed in the non-transgenic control mice. Results
(i) Open field
There was no difference in general activity between non-transgenic controls mice and transgenic mice, regardless of treatment. Overexpression of HIP/PAP in the brain of APP/PS1 mice did not induce any visible change in locomotor activity (see Figures 1A (Open Field - Distance travelled), IB (Open Field - Time Immobile)
(ii) Novel object recognition test (NOR)
Upon exposure to the novel object non-transgenic control mice spent significantly more time with the novel object when compared to the familiar one, suggesting short memory of the previous trials. In contrast, Transgenic mice, regardless of treatment, spent an equal amount of time with both objects suggesting a deficiency in short memory. Overexpression of HIP/PAP in the brain of APP/PS1 mice did not rescue the genotype effect in short memory observed during novel object recognition (See Figure 2).
(iii) Radial arm water maze
APP/PS 1 mice treated with vehicle made significantly more errors in trying to reach the platform than nontransgenic control mice, as evidenced by the higher number of errors in blocks (Fig 3 A) and total errors during day 2 (Fig 3B). These results are indicative of cognitive dysfunction especially in learning and memory. APP/PS 1 mice treated with HIP/PAP made significantly less errors than the APP/PS 1 mice treated with vehicle indicating a rescue in cognitive function for this test (see Figures 3 A and 3B).
(iv) Reversal
As expected, APP/PS 1 control mice made significantly more errors than non- transgenic littermates (see Figure 4B). There was no visible rescue in APP/PS 1 mice treated with HIP/PAP (see Figure 4A).
(v) Elevated plus maze
As shown in Figure 5A, non-transgenic control mice spent significantly more time in closed arms than open arms, exhibiting a normal amount of anxiety and fear of open space, a physiological defense mechanism. In contrast, vehicle treated transgenic mice spent the same amount of time in both arms, indicative of a deficit in anxiety-like behavior (Figure 5A). Moreover, when comparing the time spent in closed arms, vehicle treated transgenic mice spent significantly less time in closed arms compared to non-transgenic controls, indicative of behavior disinhibition and increased risk taking behavior (Figure 5B). Treatment with HIP/PAP in transgenic mice rescued a normal anxiety-like behavior as shown by the significant increase time spent in closed arms compared to open arms. Moreover, the increased time spend in closed arms observed upon treatment with HIP/PAP was significant against vehicle treated transgenic mice, but not non-transgenic mice, arguing in favor of a rescued phenotype, rather than an anxiogenic effect (Figure 5A).
Conclusion
Overexpression of HIP/PAP in a transgenic mouse model significantly improved memory during Radial Arm Water Maze (RAWM) rescuing cognitive deficits during this test. A deficit in anxiety-like behavior was also rescued upon treatment with HIP/PAP during elevated plus maze when compared to transgenic vehicle treated mice. HIP/PAP treatment accordingly allows the restoration in mice of a normal response to an anxiogenic situation. Treatment with HIP/PAP indeed normalized the anxiety like behavior that was lost in transgenic control mice.
Indeed, non-transgenic control mice spent significantly more time in closed arms than open arms, exhibiting a normal amount of anxiety and fear of open space, a physiological defense mechanism. In contrast, control APP/PS1 mice spent the same amount of time in both arms, indicative of a deficit in anxiety-like behavior. Moreover, when comparing the time spent in closed arms, control APP/PS1 mice spent significantly less time in closed arms compared to non-transgenic controls, indicative of behavior disinhibition and increased risk-taking behavior.
Treatment with HIP/PAP in transgenic mice rescued a normal anxiety-like behavior as shown by the significant increase time spent in closed arms compared to open arms.
This difference was not significant against non-transgenic mice, arguing in favor of a rescued phenotype, rather than an anxiogenic effect.
This improvement in cognition was not associated with a decreased amyloid pathology in the hippocampus, as indicated by similar levels of Ap and congo red stained amyloid plaques (Fig. 7). However, western blot analysis of hippocampus revealed a significant increase in antioxidant enzyme sodium dismutase-1 (SOD-1) and heme oxygenase-1 (HO-1) when compared to both non transgenic and APP/PS1 control mice (Fig. 8 A, C, D) and a trend towards increase in the levels of catalase (Fig. 8 A, B, p=0.06).
These data show that the antioxidant effect of HIP/PAP is surprisingly in place in the brain and contributes to the unexpected beneficial effects of HIP/PAP on cognition.
HIP/PAP expression
Tissue from the mice was collected at 12 months of age (following 6 mo. of expression) after the battery of behavioral testing.
HIP/PAP expression was measured through hemagglutinin (HA) staining in the brain (Fig. 6C) and measured HIP/PAP concentration in the cortex (Fig. 6D) with human HIP/PAP ELISA (R&D Systems, Minneapolis, USA).
No positive HA staining was detected in controls (Fig. 6B) and no HIP/PAP was detected in the plasma (not shown).
Example 2
HIP/PAP crosses the blood brain barrier (BBB) from peripheral injection of rHIP/PAP or rAAV injections. Pharmacokinetics studies performed in the mouse using [3H]- rHIP/PAP, demonstrated significant levels of radioactivity detected not only in the plasma (18.20 +/- 15.82 ng/g) and liver (64.22 +/- 11.73 ng/g) but also in the brain (85.57 +/- 11.55 ng/g), 24 hours following intravenous administration of Img/kg of [3 H] -rHIP/PAP.
Moreover, brain tissue from non-transgenic mice that had rHIP/PAP subcutaneously administered through ALZET pumps at the dose of 43 pg/day for one month were tested.
Brain and plasma were collected and levels of rHIP/PAP were assessed through ELISA (Abeam, R&D systems).
Significant levels of rHIP/PAP in the brain and plasma were found after one month (Fig. 9A).
In addition, brain penetrance of a fluorescently labelled rHIP/PAP was established using in vivo imaging system (IVIS, PerkinElmer, Waltham, MA, USA) and vivotag 680 (Revvity, Waltham, MA, USA). Thirty minutes after heart injection of rHIP/PAP-680 or control Bovine serum albumin (BSA)-680, a strong signal was found in the brain of the animals injected with rHIP/PAP-680 but not B SA-680, indicating crossing of the BBB of rHIP/PAP (Fig. 9B). Thus, significant blood brain barrier crossing of HIP/PAP was established following either subcutaneous, or intravenous administration of the protein.
Peripheral rAAV9-HIP/PAP rAAV9-HIP/PAP was injected peripherally either intravenously or intramuscularly (hindlimb). Following one month of expression, significant levels of rHIP/PAP were found in the plasma (Fig. 9C) and the brain (Fig. 9D) of injected mice.
Levels of rHIP/PAP in the brain one month after peripheral injection were similar to the levels observed following central injection (Fig. 9D) making relevant the use of peripheral injection for this aim. No rHIP/PAP signal was detected in control animals (not shown).
Example 3 - Tests performed on a High Fat Diet model of non-transgenic wild type mice
Non-transgenic mice aged 6 months were fed ad libitum with either a control diet (n=6), a high fat diet 60% kcal/fat (HFD, n=5), or HFD following 2 weeks after intracranial injection of 2 microliters of rAAV9-hHIP/PAP (n=4) at 5xl0u pg/mL into the right and left hippocampus (HPC) (X=+/-2.7 Y=-2.7, Z=-3 from bregma) as well as right and left cortex (X=+/-2 Y=-2, Z=-3 from bregma).
Body weight and food intake were monitored once a week throughout the study.
Behavior analysis to assess effects of diet on locomotor activity, cognition and anxiety were performed after 10 weeks of diet.
Results
Following 10 weeks of diet, significant weight gain was observed in the mice fed with a HFD compared to the ones fed a control diet (Fig 10A), regardless of treatment.
During elevated plus maze as detailed above, mice under control diet spent significantly more time in closed arms than in open arms, exhibiting normal physiological response to anxiety behavior (Fig 10B).
However, mice given HFD for 10 weeks spent the same amount of time in both arms, displaying a deficit in anxiety behavior. On the contrary, mice given a HFD and treated with HIP/PAP showed similar behavior to control mice fed the control diet, with significant increased time spent in closed arms compared to open arms.
All together, these results demonstrate that: - the diet was effective at inducing obesity, which was not prevented by brain administration of HIP/PAP; and
- obesity phenotype induced a deficit in anxiety, which was prevented in the mice treated with HIP/PAP.
These results confirm a beneficial role for HIP/PAP in cognitive and anxiety related behavior and is accordingly highly interesting in diet induced cognitive and anxiety deficits.
SEQUENCE LISTING
SEQ ID NO: 1 is the amino acid sequence of the HIP/PAP protein from which the N-terminal 26-amino acid signal peptide has been deleted EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAE GSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTIS SPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
SEQ ID NO: 2 is the amino acid sequence of the HIP/PAP protein from which the N-terminal 26-amino acid signal peptide and the 11 -amino acid propeptide in the N-terminal position have been deleted
IRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSI GNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRS TAFLRWKDYNCNVRLPYVCKFTD
SEQ ID NO: 3 is the amino acid sequence of the HIP/PAP protein from which the N-terminal 26-amino acid signal peptide has been deleted and a methionine added in N-terminal position MEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSG AEGSF VS SLVKSIGNS YS YVWIGLHDPTQGTEPNGEGWEWS S SDVMNYF AWERNPST ISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
SEQ ID NO: 4 is the amino acid sequence of the full HIP/PAP protein
MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLS PKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTE PNGEGWEWS S SDVMNYF AWERNPSTIS SPGHC ASLSRSTAFLRWKDYNCNVRLPYV CKFTD
Amino acid sequences are disclosed in the present specification that serve as references. The same sequences are also presented in a sequence listing formatted according to standard requirements for the purpose of patent matters. In case of any sequence discrepancy with the standard sequence listing, the sequences described in the present specification shall be the reference.

Claims

1. A HIP/PAP protein, or a derivative thereof, for its use in treating and/or preventing, in particular treating, a cognitive disorder associated with anxiety disorder(s) in an individual in need thereof.
2. The HIP/PAP protein, or a derivative thereof, for use according to claim 1 in which the anxiety disorder(s) associated with the cognitive disorder is:
(i) a primary symptom, such as in Obsessive-compulsive disorder, and/or
(ii) a secondary symptom, such as in a neurodegenerative disease selected in the group consisting of Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington’s disease (HD), Parkinson’s disease, bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars-cov-2 infection.
3. A HIP/PAP protein, or a derivative thereof, for use in improving cognition in an individual affected by a neurological disorder associated with anxiety disorder(s), selected from the group consisting of Autism spectrum disorder, Angelman syndrome, Down’s syndrome and other neurologic disorder-related cognitive impairments, such as Chronic meningitis, autoimmune encephalitis or neurosarcoidosis.
4. A HIP/PAP protein, or a derivative thereof, for use in alleviating cognitive deficit in an individual affected by a disorder selected from the group consisting of Obsessive- compulsive disorder, Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington’s disease (HD), Parkinson’s disease, bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars-cov-2 infection.
5. The HIP/PAP protein, or a derivative thereof, for use according to any one of claims 1 to 4, wherein the anxiety disorder is an externalizing disorder and, in particular, the cognitive disorder is selected from the group consisting of bipolar disorder, substance abuse, attention deficit disorders and psychotic disorders.
6. A HIP/PAP protein, or a derivative thereof, for use in the prevention and/or treatment of diet induced cognitive and anxiety deficits in an individual in need thereof, and in particular high fat diet induced cognitive and anxiety deficits.
7. The HIP/PAP protein, or a derivative thereof, for use according to any one of claims 1 to 6, wherein the individual is a mammal, in particular a human being.
8. The HIP/PAP protein, or a derivative thereof, for use according to any one of claims 1 to 7, wherein the HIP/PAP protein comprises an amino acid sequence selected from the group consisting of sequences set forth as SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, and is in particular the sequence set forth as SEQ ID NO: 4.
9. The HIP/PAP protein, or a derivative thereof, for use according to any one of claims 1 to 8, wherein said derivative comprises an amino acid sequence having a sequence identity of at least 80% with the amino acid sequence selected from the group consisting of sequences SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4 and a biological activity of the same nature as the amino acid sequence selected from the group consisting of sequences SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, and more particularly a sequence identity of at least 80% with the amino acid sequence set forth as SEQ ID NO: 4 and a biological activity of the same nature as the amino acid sequence set forth as SEQ ID NO: 4.
10. The HIP/PAP protein, or a derivative thereof, for use according to any one of claims 1 to 9, wherein the HIP/PAP protein, or a derivative thereof, is in a composition comprising a physiologically acceptable medium.
11. The HIP/PAP protein, or a derivative thereof, for use according to claim 10, wherein the composition is for oral, sublingual, subcutaneous, intramuscular, intravenous, topical, local, intratracheal, intranasal or rectal administration.
12. The HIP/PAP protein, or a derivative thereof, for use according to claim 10 or 11, wherein the composition is for oral, subcutaneous, intravenous, topical or local administration.
13. The HIP/PAP protein, or a derivative thereof, for use according to any one of claims 10 to 12, wherein the composition further comprises at least one agent known for being useful in the prevention and/or treatment of a cognitive deficit, such has for example an agent selected from the group consisting of Cholinesterase inhibitors, such as donepezil, rivastigmine or galantamine; Glutamate regulators; such as memantine; cholinesterase inhibitors, in particular in combination with glutamate regulators, such as the combination of donepezil and memantine; Methylphenidate; Amphetamine; Atomoxetine; AMPA-R agonists; Alpha? nicotinic agonists; Guanfacine; Bupropion; Vortioxetine and D-cycloserine.
14. The HIP/PAP protein, or a derivative thereof, for use according to any one of claims 10 to 13, wherein the composition further comprises at least one agent known for being useful in the prevention and/or treatment of an anxiety disorder, in particular selected from the group consisting of selective serotonin reuptake inhibitors, serotonin-norepinephrine reuptake inhibitors, tricyclic antidepressants, calcium modulators, azapirone, reversible inhibitors of monoamine oxidase A, agomelatine, quetiapine and vortioxetine, and more particularly selected from the group consisting of citalopram, escitalopram, fluoxetine, fluvoxamine, paroxetine, sertraline, duloxetine, venlafaxine, clomipramine, pregabalin, buspirone, moclobemide, agomelatine, quetiapine and vortioxetine.
15. The HIP/PAP protein, or a derivative thereof, for use according to claim 14, wherein the cognitive disorder associated with anxiety disorder(s) is selected from the group consisting of Obsessive-compulsive disorder, Attention deficit disorder, Dementia with Lewy bodies disease, Early onset dementia, Epilepsy-related cognitive dysfunction, Fronto-temporal dementia, Posterior cortical atrophy, Huntington’s disease (HD), Parkinson’s disease, bipolar disorder, substance abuse, attention deficit disorders, psychotic disorders and a sars-cov-2 infection.
16. The HIP/PAP protein, or a derivative thereof, for use according to any one of claims 10 to 15, wherein the composition further comprises at least one agent known for being useful in alleviating the symptoms associated with a disorder selected from the group consisting of Autism spectrum disorder, Angelman syndrome, Down’s syndrome and other neurologic disorder-related cognitive impairments, such as Chronic meningitis, autoimmune encephalitis or neurosarcoidosis, in particular selected from the group consisting of an anti-seizure medication; amino acid supplements; antifungals; corticosteroids, such as prednisone; and immunosuppressants, such as methotrexate or azathioprine.
EP24728149.6A 2023-05-17 2024-05-16 Hip/pap protein or a derivative thereof for treating a cognitive disorder associated with anxiety disorder Pending EP4712996A1 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
EP23305788.4A EP4464330A1 (en) 2023-05-17 2023-05-17 Hip/pap protein or a derivative thereof for treating a cognitive disorder associated with anxiety disorder
EP24315159 2024-04-12
PCT/EP2024/063628 WO2024236159A1 (en) 2023-05-17 2024-05-16 Hip/pap protein or a derivative thereof for treating a cognitive disorder associated with anxiety disorder

Publications (1)

Publication Number Publication Date
EP4712996A1 true EP4712996A1 (en) 2026-03-25

Family

ID=91247503

Family Applications (1)

Application Number Title Priority Date Filing Date
EP24728149.6A Pending EP4712996A1 (en) 2023-05-17 2024-05-16 Hip/pap protein or a derivative thereof for treating a cognitive disorder associated with anxiety disorder

Country Status (6)

Country Link
EP (1) EP4712996A1 (en)
CN (1) CN121604971A (en)
AU (1) AU2024271182A1 (en)
CO (1) CO2025015546A2 (en)
IL (1) IL324576A (en)
WO (1) WO2024236159A1 (en)

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1488798A1 (en) 2003-06-18 2004-12-22 Institut National De La Sante Et De La Recherche Medicale (Inserm) HIP/PAP polypeptide composition for use in liver regeneration and for the prevention of liver failure
EP1883417A2 (en) 2005-05-25 2008-02-06 Curedm Inc. Peptides, derivatives and analogs thereof, and methods of using same
EP2260857A1 (en) * 2009-06-11 2010-12-15 Alfact Innovation Novel applications of HIP/PAP or derivatives thereof

Also Published As

Publication number Publication date
WO2024236159A1 (en) 2024-11-21
AU2024271182A1 (en) 2025-11-13
IL324576A (en) 2026-01-01
CN121604971A (en) 2026-03-03
CO2025015546A2 (en) 2026-02-13

Similar Documents

Publication Publication Date Title
US20240382436A1 (en) Application of r-ketamine and salt thereof as pharmaceuticals
Ganguly et al. Proteinopathy, oxidative stress and mitochondrial dysfunction: cross talk in Alzheimer’s disease and Parkinson’s disease
Barilar et al. Shared cerebral metabolic pathology in non-transgenic animal models of Alzheimer's and Parkinson's disease
IL303969A (en) Bnjm
Zhao et al. Formaldehyde‐crosslinked nontoxic Aβ monomers to form toxic Aβ dimers and aggregates: Pathogenicity and therapeutic perspectives
CA3205873A1 (en) Arimoclomol for the treatment of niemann pick disease, type c, in patients with er type missense mutations
US9814761B2 (en) Compositions, methods and assays comprising amylin or amlyin analogs for abeta-peptide mediated disorders
KR20190102181A (en) A composition comprising an anti-Abeta primitive fibrous antibody and a beta-secretase BACE1 inhibitor for the treatment of Alzheimer&#39;s disease
Ehrensing et al. Improvement in major depression after low subcutaneous doses of MIF-1
CN113924087A (en) Prophylactic efficacy of serotonin 4receptor agonists against stress
CN105682741A (en) Compositions and methods for treating neuropsychiatric disorders using endothelin-B receptor agonists
CN116036076A (en) Application of lithium amino acid in preparation of medicine for treating manic mental illness
EP4464330A1 (en) Hip/pap protein or a derivative thereof for treating a cognitive disorder associated with anxiety disorder
EP4712996A1 (en) Hip/pap protein or a derivative thereof for treating a cognitive disorder associated with anxiety disorder
US20220347266A1 (en) Method and medicine for treating depressive disorders
US20230390232A1 (en) N-propargylglycine: a unique inhibitor of proline dehydrogenase with brain-enhancing mitohormesis properties capable of mitigating the pathogenesis of neurodegenerative disorders
US20140113924A1 (en) Novel class of non-stimulant treatment and adhd and related disorders
JP2020530846A (en) Method
HK40069995A (en) Application of r-ketamine and salt thereof as pharmaceuticals
Bhuiyan et al. Intranasal Dantrolene Nanoparticles for Treatment of Amyotrophic Lateral Sclerosis as a Disease-Modifying Drug
Islam A look into parkinson’s disease and the implications of gene therapy as a novel clinical approach
Pilski Neurodegeneration and behavior in rodents treated with chronic methamphetamine
RU2655763C2 (en) Pharmaceutical composition and method for treating female sexual dysfunctions
CN116916918A (en) Arelomol for the treatment of Niemann-Pick disease type C in patients with ER-type missense mutations
Keller et al. Venlafaxine vs fluoxetine, fluvoxamine and paroxetine: Onset of antidepressant action in patients with recurrent depression

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20251215

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR