EP4704977A1 - Immunogenic composition useful for self-administration by pigs - Google Patents

Immunogenic composition useful for self-administration by pigs

Info

Publication number
EP4704977A1
EP4704977A1 EP24725954.2A EP24725954A EP4704977A1 EP 4704977 A1 EP4704977 A1 EP 4704977A1 EP 24725954 A EP24725954 A EP 24725954A EP 4704977 A1 EP4704977 A1 EP 4704977A1
Authority
EP
European Patent Office
Prior art keywords
immunogenic composition
virus
subject
virus antigen
antigen
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP24725954.2A
Other languages
German (de)
French (fr)
Inventor
Fernando Lopes Leivas LEITE
Marc Eichmeyer
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Boehringer Ingelheim Vetmedica GmbH
Original Assignee
Boehringer Ingelheim Vetmedica GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Boehringer Ingelheim Vetmedica GmbH filed Critical Boehringer Ingelheim Vetmedica GmbH
Publication of EP4704977A1 publication Critical patent/EP4704977A1/en
Pending legal-status Critical Current

Links

Classifications

    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23K—FODDER
    • A23K10/00—Animal feeding-stuffs
    • A23K10/10—Animal feeding-stuffs obtained by microbiological or biochemical processes
    • A23K10/16—Addition of microorganisms or extracts thereof, e.g. single-cell proteins, to feeding-stuff compositions
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23K—FODDER
    • A23K20/00—Accessory food factors for animal feeding-stuffs
    • A23K20/10—Organic substances
    • A23K20/142—Amino acids; Derivatives thereof
    • A23K20/147—Polymeric derivatives, e.g. peptides or proteins
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23K—FODDER
    • A23K50/00—Feeding-stuffs specially adapted for particular animals
    • A23K50/30—Feeding-stuffs specially adapted for particular animals for swines
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES, NOT OTHERWISE PROVIDED FOR; PREPARATION OR TREATMENT THEREOF
    • A23L29/00—Foods or foodstuffs containing additives; Preparation or treatment thereof
    • A23L29/20—Foods or foodstuffs containing additives; Preparation or treatment thereof containing gelling or thickening agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/0012—Galenical forms characterised by the site of application
    • A61K9/0053—Mouth and digestive tract, i.e. intraoral and peroral administration
    • A61K9/0056—Mouth soluble or dispersible forms; Suckable, eatable, chewable coherent forms; Forms rapidly disintegrating in the mouth; Lozenges; Lollipops; Bite capsules; Baked products; Baits or other oral forms for animals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/20—Antivirals for DNA viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525—Virus
    • A61K2039/5258—Virus-like particles
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • A61K2039/541—Mucosal route
    • A61K2039/542—Mucosal route oral/gastrointestinal
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
    • A61K2039/552—Veterinary vaccine
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/12—Viral antigens
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/24011—Poxviridae
    • C12N2710/24041—Use of virus, viral particle or viral elements as a vector
    • C12N2710/24043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011—Details
    • C12N2750/10011—Circoviridae
    • C12N2750/10034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Polymers & Plastics (AREA)
  • Engineering & Computer Science (AREA)
  • Veterinary Medicine (AREA)
  • Zoology (AREA)
  • Food Science & Technology (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Medicinal Chemistry (AREA)
  • Microbiology (AREA)
  • Animal Husbandry (AREA)
  • Virology (AREA)
  • Molecular Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • Physiology (AREA)
  • Communicable Diseases (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Oncology (AREA)
  • Nutrition Science (AREA)
  • Biomedical Technology (AREA)
  • Birds (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Immunology (AREA)
  • Mycology (AREA)
  • Dispersion Chemistry (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)

Abstract

The present invention relates to immunogenic compositions comprising (i) an antigen composition which comprises or consists of a virus antigen and (ii) a gel composition comprising a flavoring agent, wherein such immunogenic composition can be placed into the housing environment of livestock, in particular of pigs. Thereby the self-administration of the immunogenic composition by the pigs is enabled, which allows to simply induce an immune response in the animals, by a minimum workload for personnel and less stress for the pigs.

Description

23-0040-ff Boehringer Ingelheim Vetmedica GmbH Immunogenic composition useful for self-administration by pigs BACKGROUND OF THE INVENTION TECHNICAL FIELD The present invention relates to immunogenic compositions comprising (i) an antigen composition which comprises or consists of a virus antigen and (ii) a gel composition comprising a flavoring agent, wherein such immunogenic composition can be placed into the housing environment of livestock, in particular of pigs. Thereby the self-administration of the immunogenic composition by the pigs is enabled, which allows to simply induce an immune response in the animals, by a minimum workload for personnel and less stress for the pigs. BACKGROUND INFORMATION Viral infection remains an important health problem in animals with adverse economic consequences. For example, there are a number of viral pathogens that cause disease in economically important livestock animals such as pigs. Viruses infecting pigs include, for example, porcine circovirus type 2 and porcine parvovirus. Porcine circovirus type 2 (PCV2) is a small (17-22 nm in diameter), icosahedral, non-enveloped DNA virus, which contains a single-stranded circular genome. PCV2 shares approximately 80% sequence identity with porcine circovirus type 1 (PCV1). However, in contrast with PCV1, which is generally non-virulent, swine infected with PCV2 exhibit a syndrome commonly referred to as Post-weaning Multisystemic Wasting Syndrome (PMWS). PMWS is clinically characterized by wasting, paleness of the skin, unthriftiness, respiratory distress, diarrhea, icterus, and jaundice. In some affected swine, a combination of all symptoms will be apparent while other swine will only have one or two of these symptoms. During necropsy, microscopic and macroscopic lesions also appear on multiple tissues and organs, with lymphoid organs being the most common site for lesions. A strong correlation has been observed between the amount of PCV2 nucleic acid or antigen and the severity of microscopic lymphoid lesions. Mortality rates for swine infected with PCV2 can approach 80%. In addition to PMWS, PCV2 has been associated with several other infections including pseudorabies, porcine reproductive and respiratory syndrome (PRRS), Glasser’s disease, streptococcal meningitis, salmonellosis, postweaning colibacillosis, dietetic hepatosis, and suppurative bronchopneumonia. Several vaccines are available to reduce the impact of PCV2 infections in pigs. U.S. Patent 23-0040-ff Boehringer Ingelheim Vetmedica GmbH No.6,703,023 (US 6,703,023 B1) provides a DNA based vaccine for the prophylaxis of pigs against PMWS, wherein this and the following publications referred to herein are incorporated by reference in their entirety. In WO2003049703 production of a live chimeric vaccine is described, comprising the non-pathogenic PCV1 virus in which, however, the ORF2 protein is replaced by the ORF2 protein of the pathogenic PCV2. WO199918214 and WO199929717 have provided several PCV2 strains and procedures for the preparation of a killed PVC2 vaccine. Preparation of subunit vaccines have also been described in WO199918214 and WO199929717. An effective ORF2 based subunit vaccine has been reported in WO2006072065. Further ORF2 based subunit vaccines are described also in WO200728823 or WO2015051099. Porcine parvovirus (PPV) is an autonomous replicating virus of the Parvovirinae subfamily of the genus Protoparvovirus within the family Parvoviridae containing a single stranded DNA molecule of about 5100 nucleotides. Only the minus strand of the DNA is packaged into virions. The genome of the virus encodes three capsid proteins (VP1, VP2, VP3) and one non- structural protein (NS1). The capsid of parvovirus is about 22-25 nanometers in diameter and is comprised of VP1 and VP2 subunits. These proteins are derived from alternatively spliced versions of the same RNA molecule and thus overlap in sequence. Further, porcine parvovirus exhibits a high level of sequence similarity to feline panleukopenia virus, canine parvoviruses PPV infection is a common cause of reproductive failure in breeding pigs throughout the world. Serological studies show that porcine parvovirus is widespread in all swine producing regions of the world with up to 80 % of animals showing seroconversion. Currently available PPV vaccines are produced, on the one hand, by growing native virus on primary cells of porcine origin or in established cell lines and, after this, infectious virus is isolated and inactivated with chemical agents to end up with a whole cell killed virus vaccine. On the other hand, an effective VP2 based subunit vaccine, and its production, has been reported in WO2018083154 or WO2018083156. Vaccination of pigs with conventional vaccines against viruses, such as PCV2 and PPV, which is usually done by injection, is a labor intensive and time-consuming process, as each animal needs to be handled separately. Additionally, the process of vaccination may put the pigs under stress, which can result in adverse effects such as a reduced food uptake by the animals. Thus, immunogenic compositions are desired which can be simply placed into the housing environment of pigs, which stably remain in the housing over a sufficient period of time, and 23-0040-ff Boehringer Ingelheim Vetmedica GmbH which are then self-administered by, and mount to an immune response against virus in the animals. DESCRIPTION OF THE INVENTION The solution to the above technical problems is achieved by the description and the embodiments characterized in the claims. Thus, the invention in its different aspects is implemented according to the claims. The invention is based on the surprising finding that placing an immunogenic composition which comprises (i) a recombinant PCV2 ORF2 protein and (ii) a gel composition with a flavoring agent into the housing of pigs resulted in the self-consuming of the immunogenic composition by the pigs and their immunization against PCV2. In a first aspect, the invention thus relates to an immunogenic composition comprising - an antigen composition comprising or consisting of a virus antigen; and - a gel composition, wherein the gel composition comprises a flavoring agent, wherein said immunogenic composition is also termed “the immunogenic composition of the present invention” hereinafter. Said antigen composition, which is hereinafter also termed “the antigen composition according to the present invention”, preferably comprises or consists of a virus protein. Thus, said virus antigen, which is also termed “the virus antigen according to the present invention” herein, is in particular a virus protein. The term “virus protein” encompasses any protein that is derived from a virus. Specific examples include a virus capsid protein, a virus coat protein, a virus envelope protein, and a virus core protein. Said gel composition, which is hereinafter also termed “the gel composition according to the present invention”, is in particular a gel composition suitable for oral and/or mucosal administration. 23-0040-ff Boehringer Ingelheim Vetmedica GmbH The term "gel composition", as used herein, refers to a suitable liquid, semi-solid or solid material, which includes an amount of one or more gelling agents effective for gelling the composition. The term "immunogenic composition" refers to a composition that comprises at least one antigen, which elicits an immune response in the host to which the immunogenic composition is administered. Such immunological response can be a cellular and/or antibody-mediated immune response to the immunogenic composition according to the invention. The host is also described as "subject". Preferably, any of the hosts or subjects described or mentioned herein is an animal. The term "animal", as used herein, in particular relates to a mammal, preferably to swine, more preferably to a pig, most preferably to a piglet or a sow. The term "antigen composition" refers to a composition comprising a material that stimulates the immune system and elicits an immune response in a host or subject. As used herein, the term “virus antigen” means a substance derived from a virus or a component thereof or both of them, the substance being capable of inducing an immune response. Usually, an "immune response" includes but is not limited to one or more of the following effects: the production or activation of antibodies, B cells, helper T cells, suppressor T cells, and/or cytotoxic T cells and/or gamma-delta T cells, directed specifically to an antigen or antigens included in the immunogenic composition of the present invention. Preferably, the host will display either a protective immune response or a therapeutic response. A "protective immune response" will be demonstrated by either a reduction or lack of one or more clinical signs normally displayed by an infected host, a quicker recovery time and/or a lowered duration of infectivity or lowered pathogen titer in the tissues or body fluids or excretions of the infected host. For instance, in order to assess a protective immune response against PCV2, PCV2 specific T cell immunity can be evaluated, following the protocol of Koinig HC et al. Vet Res.46:20 (2015). As it is known, and described therein, multi-functional T cells, which simultaneously produce IFN-γ, interleukin-2 (IL-2) and TNF-α, are strongly correlated with protection, and the appearance of IFN-γ/TNF-α co-producing T cells after PCV2 vaccination correlated with prevention of viremia after PCV2 vaccination. 23-0040-ff Boehringer Ingelheim Vetmedica GmbH The “pathogen” or “particular pathogen”, as mentioned herein, in particular relates to the virus from which the virus antigen is derived. For example, the pathogen, as mentioned herein, is a PCV2 or a PPV. In case where the host displays a protective immunological response such that resistance to new infection will be enhanced and/or the clinical severity of the disease reduced, the immunogenic composition is described as a "vaccine". An "antigen" as described herein refers to, but is not limited to, components which elicit an immune response in a host to an immunogenic composition or vaccine of interest comprising such antigen or an immunologically active component thereof. In particular, the term “antigen” as used herein refers to a protein or protein domain, which, if administered to a host, can elicit an immunological response in the host. The "inducing of an immune response", “induce an immune response”, or “elicit an immune response”, respectively, generally involves the administration of an effective amount of the immunogenic composition of the present invention to a subject or herd of subjects in need of or that could benefit from the treatment/prophylaxis caused thereby. The term "treatment and/or prophylaxis" refers to the lessening of the incidence of the particular pathogen infection in a herd or the reduction in the severity of one or more clinical signs caused by or associated with the particular pathogen infection. Thus, the term "treatment and/or prophylaxis" also refers to the reduction of the number of animals in a herd that become infected with the particular pathogen (= lessening of the incidence of the particular pathogen infection) or to the reduction of the severity of one or more clinical signs normally associated with or caused by an infection with the pathogen in a group of animals which animals have received an effective amount of the immunogenic composition as provided herein in comparison to a group of animals which animals have not received such immunogenic composition. The term "treatment" refers to the administration of the effective amount of the immunogenic composition once the subject or at least some animals of the herd is/are already infected with such pathogen and wherein such animals already show some clinical signs caused by or associated with such pathogen infection. The term "prophylaxis" refers to the administration to a subject prior to any infection of such subject with a pathogen or at least where such animal or all of the animals in a group of animals do not show one or more clinical signs caused by or associated with the infection by such pathogen. 23-0040-ff Boehringer Ingelheim Vetmedica GmbH The term "an effective amount" as used herein means, but is not limited to an amount of virus antigen, in particular of the proteins or virus-like particles of the present disclosure, that induces or is able to induce an immune response in a subject. Such effective amount is able to lessen the incidence of the particular pathogen infection in a herd or to reduce the severity of one or more clinical signs of the particular pathogen infection. Preferably, one or more clinical signs are lessened in incidence or severity by at least 10%, more preferably by at least 20%, still more preferably by at least 30%, even more preferably by at least 40%, still more preferably by at least 50%, even more preferably by at least 60%, still more preferably by at least 70%, even more preferably by at least 80%, still more preferably by at least 90%, and most preferably by at least 95% in comparison to subjects that are not treated but subsequently infected by the particular pathogen. The term "clinical signs" as used herein refers to signs of infection of a subject from the particular pathogen. The clinical signs of infection depend on the pathogen selected. Examples for such clinical signs, caused by a PCV2 infection, include but are not limited to wasting or weight loss, pallor of the skin, respiratory distress, diarrhea, and occasionally, icterus. Reducing the incidence of or reducing the severity of one or more clinical signs caused by or being associated with the particular pathogen infection in a subject can be reached by the administration of one or more doses of the immunogenic composition of the present invention to a subject. According to a particularly preferred aspect, the immunogenic composition of the present invention is free of an adjuvant. According to a particular preferred aspect, the immunogenic composition of the present invention consists of - an antigen composition comprising or consisting of a virus antigen; and - a gel composition comprising one or more flavoring agents; and - one or more veterinary-acceptable carriers. According to a further particularly preferred aspect, the immunogenic composition of the present invention consists of - an antigen composition comprising or consisting of 23-0040-ff Boehringer Ingelheim Vetmedica GmbH a virus antigen; and - a gel composition comprising one or more flavoring agents; and - one or more veterinary-acceptable carriers; and - at least one immunogenic substance different from said virus antigen. In another preferred aspect, the immunogenic composition of the present invention consists of - an antigen composition comprising or consisting of a virus antigen; and - a gel composition comprising one or more flavoring agents; and - one or more veterinary-acceptable carriers; and - an adjuvant. In yet another preferred aspect, the immunogenic composition of the present invention consists of - an antigen composition comprising or consisting of a virus antigen; and - a gel composition comprising one or more flavoring agents; and - one or more veterinary-acceptable carriers; and - an adjuvant; and - at least one immunogenic substance different from said virus antigen. Preferably, the virus antigen according to the present invention is capable of forming a virus- like particle. 23-0040-ff Boehringer Ingelheim Vetmedica GmbH As used herein, the term “virus-like particle” refers to a structure resembling a virus particle but which is non-pathogenic, non-replicative, and non-infectious as it lacks all or part of the viral genome. According to a further preferred aspect, the virus antigen according to the present invention is a virus capsid protein. Preferably, the virus antigen according to the present invention is a circovirus capsid protein. In still another aspect, the virus antigen according to the present invention is a porcine circovirus (PCV) capsid protein. In particular, the virus antigen according to the present invention is a porcine circovirus type 2 (PCV2) ORF2 protein, wherein the PCV2 ORF2 protein preferably comprises or consists of an amino acid sequence having at least 90%, preferably at least 95%, more preferably at least 98%, still more preferably at least 99% or in particular 100% sequence identity with the sequence of SEQ ID NO:1. According to another preferred aspect, the virus antigen according to the present invention is selected from the group consisting of PCV2 genotype a (PCV2a) ORF2 protein, PCV2 genotype b (PCV2b) ORF2 protein, PCV2 genotype c (PCV2c) ORF2 protein, PCV2 genotype d (PCV2d) ORF2 protein, PCV2 genotype e (PCV2e) ORF2 protein, PCV2 genotype f (PCV2f) ORF2 protein, PCV2 genotype g (PCV2g) ORF2 protein and PCV2 genotype h (PCV2h) ORF2 protein. The terms “PCV2a”, “PCV2b”, “PCV2c”, “PCV2d”, “PCV2e”, “PCV2f”, “PCV2g”, “PCV2h”, as used herein, in particular relate to the established PCV2 genotype classification which is described in: Franzo G & Segalés J. PLos One 13(12):e0208585 (2018) and Link EK et al. Virol J.18(1):70 (2021). According to one specific aspect, the virus antigen according to the present invention is a PCV2 genotype a (PCV2a) ORF2 protein. Preferably, the herein mentioned PCV2a ORF2 protein comprises or consists of an amino acid sequence having at least at least 95%, preferably at least 98%, more preferably at least 99% or in particular 100% sequence identity with the sequence of SEQ ID NO:1. According to another specific aspect, the virus antigen according to the present invention is a PCV2 genotype d (PCV2d) ORF2 protein. 23-0040-ff Boehringer Ingelheim Vetmedica GmbH Preferably, the herein mentioned PCV2d ORF2 protein comprises or consists of an amino acid sequence having at least at least 95%, preferably at least 98%, more preferably at least 99% or in particular 100% sequence identity with the sequence of SEQ ID NO:2. According to another preferred aspect, the virus antigen according to the present invention is a parvovirus capsid protein. In one aspect, the virus antigen according to the present invention is a porcine parvovirus (PPV) capsid protein, in particular a PPV viral protein 2 (VP2). Preferably, the herein mentioned PPV VP2 comprises or consists of an amino acid sequence having at least 90%, preferably at least 95%, more preferably at least 98%, still more preferably at least 99% or in particular 100% sequence identity with a sequence selected from the group consisting identical to the sequence of SEQ ID NO:3. Regarding the term “at least 90%”, as mentioned in the context of the present invention, it is understood that said term preferably relates to “at least 91%”, more preferably to “at least 92%”, still more preferably to “at least 93%” or in particular to “at least 94%”. Regarding the term “at least 95%” as mentioned in the context of the present invention, it is understood that said term preferably relates to “at least 96%”, more preferably to “at least 97%”, still more preferably to “at least 98%” or in particular to “at least 99%”. Regarding the term “at least 99%” as mentioned in the context of the present invention, it is understood that said term preferably relates to “at least 99.2%”, more preferably to “at least 99.4%”, still more preferably to “at least 99.6%” or in particular to “at least 99.8%”. More particular, the term “at least 99% sequence identity” refers to 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9% sequence identity. The term “having 100% sequence identity”, as used herein, is understood to be equivalent to the term “being identical”. As used herein, it is in particular understood that the term “sequence identity with the sequence of SEQ ID NO:X” is equivalent to the term “sequence identity with the sequence of SEQ ID NO:X over the length of SEQ ID NO:X” or to the term “sequence identity with the sequence of SEQ ID NO:X over the whole length of SEQ ID NO:X”, respectively. In this context, “X” is any integer selected from 1 to 3 so that “SEQ ID NO:X” represents any of the SEQ ID NOs mentioned herein. 23-0040-ff Boehringer Ingelheim Vetmedica GmbH According to a more general aspect, the virus antigen according to the present invention is a non-replicating virus antigen and replicating virus antigen. Thus, according to a particular preferred aspect, the antigenic composition according to the present invention comprises or consists of non-replicating virus antigen. The term "non-replicating virus antigen” in particular relates to molecules derived from a virus, such as proteins, carbohydrates, lipids or nucleic acids, or are complex combinations thereof, more or less pure. When prepared from a virus, non-replicating antigen can refer to an intact but killed (i.e. non-replicative) virus, or can be a part thereof such as an extract, fraction, homogenate, or sonicate. Also, a non-replicating virus antigen can be a nucleic acid based, or recombinant product, such as an expression vector or an expressed protein, or the product of an in vitro expression system. All these are well-known in the art. According to another particular preferred aspect, the antigen composition according to the present invention is a virus-like particle. Preferably, the virus antigen according to the present invention is recombinantly expressed, in particular baculovirus expressed. For example, the virus antigen is preferably a recombinantly expressed virus protein, in particular a recombinant baculovirus expressed virus protein. The term “recombinantly expressed”, as used herein, is in particular understood to be equivalent to “recombinant”. Thus, for instance “recombinantly expressed virus antigen” is equivalent to “recombinant virus antigen”. The virus antigen according to the present invention is preferably a recombinant virus protein, in particular a recombinant baculovirus expressed virus protein. The term "recombinant virus protein" or “recombinantly expressed virus protein”, respectively, as used herein, in particular refers to a virus protein which is produced by recombinant DNA techniques, wherein generally DNA encoding the expressed protein is inserted into a suitable expression vector which is in turn used to transform or, in the case of a virus vector, to infect a host cell to produce the heterologous protein. Thus, the term "recombinant virus protein" or “recombinantly expressed virus protein”, respectively, as used herein, particularly refers to a protein molecule that is expressed from a recombinant DNA molecule. "Recombinant DNA molecule" as used herein refers to a DNA molecule that is comprised of segments of DNA joined together by means of molecular biological techniques. Suitable systems for production of recombinant proteins include but are not limited to insect cells (e.g., baculovirus), prokaryotic 23-0040-ff Boehringer Ingelheim Vetmedica GmbH systems (e.g., Escherichia coli), fungi (e.g., Myceliophthora thermophile, Aspergillus oryzae, Ustilago maydis), yeast (e.g., Saccharomyces cerevisiae, Pichia pastoris), mammalian cells (e.g., Chinese hamster ovary, HEK293), plants (e.g., safflower), algae, avian cells, amphibian cells, fish cells, and cell-free systems (e.g., rabbit reticulocyte lysate). According to another particularly preferred aspect, the antigen composition according to the present invention is a virus-like particle comprising a virus antigen. Said virus antigen is preferably any of the above-mentioned virus antigens according to the present invention. Thus, in one example, the virus antigen according to the present invention is a virus-like particle comprising recombinantly expressed PCV2 ORF2 protein. In another example, the virus antigen according to the present invention is a virus-like particle comprising recombinantly expressed PPV VP2. In one aspect, the antigen composition comprises at least 10 µg of the virus antigen per dose of the immunogenic composition. In one aspect, the antigen composition comprises at least 15 µg of the virus antigen per dose of the immunogenic composition. In one aspect, the antigen composition comprises at least 30 µg of the virus antigen per dose of the immunogenic composition. In one aspect, the antigen composition comprises at least 50 µg of the virus antigen per dose of the immunogenic composition. In one aspect, the antigen composition comprises at least 100 µg of the virus antigen per dose of the immunogenic composition. In one aspect, the antigen composition comprises at least 150 µg of the virus antigen per dose of the immunogenic composition. In one aspect, the antigen composition comprises at least 200 µg of the virus antigen per dose of the immunogenic composition. In one aspect, the antigen composition comprises at least 250 µg of the virus antigen per dose of the immunogenic composition. 23-0040-ff Boehringer Ingelheim Vetmedica GmbH It is understood that the wording “the antigen composition comprises […] of the virus antigen per dose of the immunogenic composition” is in particular equivalent to the wording “per dose of the immunogenic composition the antigenic composition comprises […] of the virus antigen” or to the wording “the immunogenic composition is formulated to allow administration of […] of the virus antigen per dose”, respectively. The term “per dose” or “per dose of the immunogenic composition”, respectively, as used herein, in particular means “per dose of the immunogenic composition which is to be administered to a subject”, in order to achieve a desired effect, namely to induce an immune response, in the subject, and wherein said subject is in particular a pig. Preferably, one dose of the immunogenic composition has a volume of about 100 mL. According to another aspect a further preferred aspect, the gel composition according to the present invention comprises water. In particular, said gel composition is a hydrogel composition. Gel compositions according to the present invention, which can be used in the preparation of the immunogenic composition of the present invention, are readily available. In one example, the commercially available Underline® gel concentrate (Animal Science Products, Nacogdoches, TX (USA)) is used as the gel composition included in the immunogenic composition of the present invention, but other gel compositions are suitable as well. According to a further preferred aspect, the immunogenic composition of the present invention is liquid. In one aspect, the immunogenic composition of the present invention is viscous. In another aspect, the immunogenic composition of the present invention has a viscosity of at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800 cP (mPa·s) or higher. In one aspect, the immunogenic composition of the present invention has a viscosity of at least 150 mPa·s (at least 150 cP). In another aspect, the immunogenic composition of the present invention has a viscosity of at least 100 mPa·s (at least 100 cP). 23-0040-ff Boehringer Ingelheim Vetmedica GmbH In one aspect, the immunogenic composition of the present invention has a viscosity of at least 50 mPa·s or at least 50 cP. In another aspect, the immunogenic composition of the present invention has a viscosity between 50 cP (50 mPa·s) and 150 cP (150 mPa·s). In yet another aspect, the immunogenic composition of the present invention has a viscosity between 50 cP (50 mPa·s) and 350 cP (350 mPa·s). In one aspect, the immunogenic composition of the present invention has a viscosity of at least 25 mPa·s or at least 25 cP. In another aspect, the immunogenic composition of the present invention has a viscosity between 25 cP (25 mPa·s) and 150 cP (150 mPa·s). In yet another aspect, the immunogenic composition of the present invention has a viscosity between 25 cP (25 mPa·s) and 350 cP (350 mPa·s). The measurement unit of viscosity is Pa·s (pascal second) or mPa·s (millipascal second). The conventional measurement unit is cP (centipoise). A centipoise is one millipascal-second (1 cP = 10-3 Pa⋅s = 1 mPa⋅s). According to another aspect, the immunogenic composition of the present invention is solid. The term "solid" in this context in particular relates to a gel having some resilience or dimensional stability, in contrast to "semi-solid" gels which are smearable and do not have such dimensional stability. The gel composition according to the present invention comprises one or more flavoring agents. It is understood that, as used herein, the wording “comprises or consists of one or more flavoring agents” is in particular encompassed by the wording “comprises a flavoring agent”. The term "flavoring agent" as used herein refers to one or more compounds or mixtures that improve the palatability and/or taste in animals, preferably in pigs. In particular, the flavoring agent is, or the one or more flavoring agents are, respectively, capable of attracting pigs. Flavoring agents are well known to the person skilled in the art. Flavoring agents include, but are not limited to, nutritive and non-nutritive sweeteners, flavor additives, by-products and alternative ingredients. By way of example suitable flavorants include but are not limited to sucrose, glucose, sodium saccharin, sodium cyclamate, xylitol, perillartien, sucralose, D- tryptophan, aspartame, dihydrochalcones and the like, artificial fruit flavoring (e.g., strawberry flavoring), plasma protein (e.g., spray-dried plasma protein), cheese and cheese-like flavorings, dried milk, chocolate and chocolate by-products. 23-0040-ff Boehringer Ingelheim Vetmedica GmbH Preferably, the one or more flavoring agents comprise or consists of a flavoring agent giving the immunogenic composition of the invention a particular taste and/or a flavoring agent giving the immunogenic composition of the invention a particular smell. In particular, the one or more flavoring agents comprise or consist of a flavoring agent capable of being tasted by a pig, such as a sweetener, and/or a flavoring agent capable of being smelled by a pig. In particular, the one or more flavoring agents comprise or consists of - a sweetener, and a flavor additive capable of being smelled by pigs. The sweetener, as mentioned herein, is preferably selected from the group of sucrose, glucose, sodium saccharin, sodium cyclamate, xylitol, perillartine, sucralose, D-tryptophan, aspartame, dihydrochalcones. The flavor additive, as mentioned herein, is preferably selected from the group consisting of artificial fruit flavoring (e.g., strawberry flavoring), and cheese and cheese-like flavorings. Most preferably, the gel composition of the present invention comprises a sweetener and an artificial fruit flavoring The at least one flavoring agent is preferably incorporated in the immunogenic composition of the present invention at a concentration of 0.1% to 0.5% by weight. In some aspects, in the immunogenic composition of the present invention the at least one flavoring agent is in a final concentration by weight of about 0.1%, 0.2%, 03%, 0.4%, 0.5%, or any ranges therebetween including, for example, from about 0.1% to 0.4% by weight, from about 0.1% to 0.3% by weight, from about 0.1% to 0.2% by weight, from about 0.2% to 0.4% by weight, from about 0.2% to 0.3% by weight, from about 0.3% to 0.4% by weight. In one aspect, the gel composition according to the present invention further comprises one or more colorants. The term "colorant" also may be used in the compositions of the described invention to provide visual cues to the animals, in particular to pigs, and/or visual verification to animal caretakers that the composition is present, uniformly applied and appropriately adherent. Preferably, the gel composition according to the present invention further comprises one or more colorants capable of attracting pigs. Colorants are well known to the person skilled in the art and include pigments or dyes or a combination thereof. Suitable colorants include, but are not limited to, FD&C colorants such as FD&C Blue No.1, FD&C Blue No.2, FD&C Green No.3, Orange B, 23-0040-ff Boehringer Ingelheim Vetmedica GmbH Citrus Red No.2, FD&C Red No.2, FD&C Red No.3, FD&C Red No.40, FD&C Yellow No.5 and FD&C Yellow No.6. FD&C Blue No. 1 is the dye named Brilliant blue FCF, which is also denoted by E number E133. FD&C Blue No.2 is the dye named indigotine which is also denoted by E number E132. FD&C Green No.3 is the dye Fast Green FCF, which is also denoted by E number E143. FD&C Red No.2 is the dye Amaranth which is also denoted by E number E123, FD&C Red No.3 is the dye erythrosine, which is also denoted by E number E127, FD&C Red No.40 is the dye Allura Red AC, which is also denoted by E number E129. FD&C Yellow No.5 is the dye Tartrazine, which is also denoted by E number E102, FD&C Yellow No.6 is the dye Sunset yellow FCF, which is also denoted by E number 110. The gel composition according to the present invention preferably comprises at least one colorant selected from the group consisting of Brilliant blue FCF, indigotine, Fast Green FCF, Amaranth, erythrosine, Allura Red AC, Tartrazine, Sunset yellow FCF. Preferably, the gel composition comprises the colorants Brilliant blue FCF and Tartrazine. Thus, the at least one colorant, as mentioned herein, is preferably a mixture of Brilliant blue FCF and Tartrazine. Thus, in a preferred aspect, the gel composition according to the present invention has a green color. According to another preferred aspect, the gel composition according to the present invention comprises water and/or an adhesion enhancing agent and/or a pH adjusting agent and/or a stabilizer. In one aspect, the at least one adhesion enhancing agent is a hydrophilic polymer or copolymer that is linear or branched, crosslinked, is not biodegradable, or is selected from the group consisting of maltodextrins, hemicellulose extract, hemicellulose, xanthan, guar, pectins, gums, guar derivatives, chitosan, dextran, carrageenans, starch, polyethylene glycol, albumin, cellulose ethers, hyaluronic acid, carboxymethylhydroxyethylcellulose, hydroxypropylmethyl cellulose (HPMC), hydroxypropyl cellulose (HPC), hydroxyethyl cellulose (HEC), carboxy methyl cellulose (CMC), gelatins, vinyl acetates, polyvinyl pyrrolidone, polyvinyl pyrrolidone- 23-0040-ff Boehringer Ingelheim Vetmedica GmbH vinyl acetate copolymers, polyvinyl alcohols, polyphosphoesters, N-(2-hydroxypropyl) methacryl amide (HPMA) copolymers, polyacrylic acids, polyacrylamides, polyoxazolines, divinyl ether-maleic anhydride, polyphosphazenes, including derivatives and substitutions and salts of any of the foregoing, and combinations thereof. In one aspect, the at least one adhesion enhancing agent is one or more adhesion enhancing agents based on starch and/or hemicellulose. In another aspect, the at least one adhesion enhancing agent(s) is or are maltodextrins and/or hemicellulose extract. In one aspect, the gel composition according to the present invention comprises maltodextrin. In one aspect, the gel composition according to the present invention comprises hemicellulose extract. Preferably, the herein mentioned hemicellulose extract comprises xanthan. In some aspects, in the immunogenic composition of the present invention the at least one adhesion enhancing agent is in a final concentration (w/v) of about 0.1%, 0.2%, 03%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1.0%, 1.1%, 1.2%, 1.3%, 1.4%, 1.5%, 1.6%, 1.7%, 1.8%, 1.9%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, or 49%, or any ranges therebetween including, for example, from about 0.5% to 15% w/v, from about 0.5% to 10% w/v, from about 0.5% to 5% w/v, from about 0.5% to 2% w/v. In one aspect, in the immunogenic composition of the present invention the adhesion enhancing agent is in a final concentration (w/v) of about 0.5% to 15% w/v. According to a further preferred aspect, the gel composition according to the present invention comprises one or more pharmaceutically acceptable carriers, in particular selected from the group consisting of stabilizers, pH adjusting compositions, alcohols, glycols, glycerols, and glycerines, lanolin and derivatives thereof, fatty acids and derivatives thereof, fatty alcohols and derivatives thereof, and fatty esters and derivatives thereof, or combinations thereof. Preferably, the one or more pharmaceutically acceptable carriers are selected from the group consisting of propylene glycol (PG), propylene glycol monolaurate (PGML), propylene glycol capryiate, polyethylene glycol monolaurate (PEGML), glycerol monolaurate (GML), methyl 23-0040-ff Boehringer Ingelheim Vetmedica GmbH formamide (DMF), allantoin, urazole, N,N-dimethylacetamide (DMA), dimethyl sulfoxide (DMSO), decylmethylsulfoxide, lecithin, polyoxylglycerides, the 1-substituted azacycloheptan- 2-ones, particularly 1-n-dodecylcyclazacycloheptan-2-one, alcohols, and oils safe for porcine consumption such as vegetable oils. In particular, the gel composition according to the present invention comprises a stabilizer, and wherein the stabilizer is preferably propylene glycol. A "pH adjusting agent" is typically added to bring the pH of the composition to the desired value. Desirable pH values are between about 6 to about 8. The immunogenic compositions of the present invention therefore may be formulated to have a pH value that ranges between about 6 and about 8, or about 6.5 and about 7.5. Suitable pH adjusting agents include, but are not limited to, one or more adipic acids, glycines, citric acids, calcium hydroxides, magnesium aluminometasilicates, disodium phosphate, sodium phosphate, potassium phosphate, potassium chloride, sodium citrate, calcium lactate, sodium succinate, sodium glutamate, sodium bicarbonate, and potassium bicarbonate, and combinations thereof. As used herein, "stabilizer" is an agent that helps stabilize the active agent in the immunogenic composition of the present invention. The stabilizer includes but is not limited to reducing agents. Stabilizers that may be used include sodium thiosulfate, sodium metabisulfite, sodium bisulfite, sodium sulfite, sulphur dioxide, ammonium bisulfite, and ammonium thiosulfate. Sodium thiosulfate is preferred as it possess a high neutralization ability and is considered safe and not corrosive. The term "stabilizer" also encompasses chelating agents. Chelating agents are optionally added to the gel composition according to the present invention to enhance the preservative or preservative system. Preferred chelating agents are mild agents, such as, for example, ethylenediaminetetraacetic acid (EDTA), EDTA derivatives, or any combination thereof. Suitable stabilizers or preservatives for use in the immunogenic compositions of the present invention include, without limitation, one or more alkanols, disodium EDTA (ethylenediamine tetraacetate), EDTA salts, EDTA fatty acid conjugates, isothiazolinone, parabens such as methylparaben and propylparaben, propylene glycols, sorbates, urea derivatives such as diazolindinyl urea, or any combinations thereof. In some aspects of the invention, in the immunogenic composition of the present invention the at least one pharmaceutically acceptable carrier is in a final concentration (v/v) of about 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23-0040-ff Boehringer Ingelheim Vetmedica GmbH 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, or 49%, or any ranges therebetween including, for example, about 5% to about 10%, about 10% to about 15%, about 12% to about 13%, about 15% to about 20%, about 20% to about 25%, about 25% to about 30%, about 30% to about 35%, about 35% to about 40%, about 40% to about 45%, and about 45% to about 50%. In one aspect of the present invention the gel composition according to the present invention comprises water, an adhesion enhancing agent, and a stabilizer. In one aspect, the gel composition according to the present invention comprises water, an adhesion enhancing agent and a stabilizer, and a pH adjusting agent. In one aspect, the gel composition according to the present invention comprises water, maltodextrins, hemicellulose extract, and propylene glycol. In another aspect, the gel composition according to the present invention comprises water, maltodextrins, cellulose, a gum and a stabilizer, preferably the stabilizer is propylene glycol. In one aspect, the gel composition according to the present invention comprises water, maltodextrins, hemicellulose extract, propylene glycol, and artificial coloring. According to a particularly preferred aspect, the gel composition according to the present invention comprises or consists of: - water, - maltodextrins, - propylene glycol, - hemicellulose extract, - one or more colorants, and - one or more flavoring agents. According to another preferred aspect, the immunogenic composition of the present invention comprises or contains one or more veterinary-acceptable carriers. 23-0040-ff Boehringer Ingelheim Vetmedica GmbH In one aspect of the present invention the one or more veterinary-acceptable carriers is a diluent. “Diluent” can include water, saline, dextrose, ethanol, glycerol, and the like. Isotonic agents can include sodium chloride, dextrose, mannitol, sorbitol, and lactose, among others. Stabilizers include albumin and alkali salts of ethylenediaminetetraacetic acid, among others. In one aspect of the present invention the one or more veterinary-acceptable carriers is a physiologic buffer. In one aspect of the present invention the one or more veterinary-acceptable carriers is phosphate buffered saline. Preferably, the one or more veterinary-acceptable carriers are selected from the group consisting of solvents, dispersion media, coatings, stabilizing agents, diluents, preservatives, antibacterial and antifungal agents, isotonic agents, adsorption delaying agents, and combinations thereof. Preferably, the immunogenic composition further comprises sucrose gelatin stabilizer. Preferably, the immunogenic composition can further include one or more other immunomodulatory agents such as, e.g. interleukins, interferons, or other cytokines. According to another aspect, the immunogenic composition of the present invention comprises or contains an adjuvant. It is understood, in the context of the present invention, that the person skilled in the art will preferably choose an adjuvant suitable for oral and/or mucosal administration. Thus, the immunogenic composition of the present invention preferably comprises or contains an adjuvant suitable for oral and/or mucosal administration. According to a further aspect, the immunogenic composition of the present invention comprises or contains at least one immunogenic substance different from said virus antigen. In one aspect, the virus antigen according to the invention is a PCV2a ORF2 protein and said at least one immunogenic substance different from said virus antigen is a PCV2d ORF2 protein, and wherein preferably said PCV2a ORF2 protein comprises or consists of an amino acid sequence having at least at least 95%, preferably at least 98%, more preferably at least 99% or in particular 100% sequence identity with the sequence of SEQ ID NO:1, and 23-0040-ff Boehringer Ingelheim Vetmedica GmbH said PCV2d ORF2 protein comprises or consists of an amino acid sequence having at least at least 95%, preferably at least 98%, more preferably at least 99% or in particular 100% sequence identity with the sequence of SEQ ID NO:2. . In another aspect, the at least one immunogenic substance different from said subunit antigen comprises a bacterial antigen. Preferably, the at least one immunogenic substance different from said subunit antigen comprises a Lawsonia intracellularis and/or a Salmonella spp. antigen. In still another aspect, the invention also relates to the use of the immunogenic composition of the present invention in the preparation of a medicament, preferably of a vaccine. The present invention also provides the immunogenic composition according to the present invention for use as a medicament, preferably as a vaccine. The present invention further provides the immunogenic composition according to the present invention for use in a method for inducing an immune response in a subject, wherein said immune response is preferably an immune response against a virus. Preferably, “an immune response against a virus”, as mentioned herein, is an immune response against a virus, which virus is of the species having a genome encoding - the virus antigen according to the present invention, or - the amino acid sequence of the antigenic determinant of the virus antigen according to the present invention. As used herein, the term “antigenic determinant” is in particular understood to refer to that portion of an antigen that is specifically recognized by either B- or T-lymphocytes. B- lymphocytes respond to foreign antigenic determinants via antibody production, whereas T- lymphocytes are the mediator of cellular immunity. Thus, antigenic determinants or epitopes are those parts of an antigen that are recognized by antibodies, or in the context of a Major 23-0040-ff Boehringer Ingelheim Vetmedica GmbH Histocompatibility Complex (MHC), by T-cell receptors. An antigenic determinant contains one or more epitopes. With reference to the clauses disclosed further below, in some embodiments, the present invention provides the immunogenic composition, as specified in any one of clauses13 to 19, and 24 to 64, for use in a method for inducing an immune response against PCV2 in a subject. According to a preferred aspect, the herein mentioned immune response is a protective immune response. The present invention also provides the immunogenic composition according to the present invention for use in a method for reducing one or more clinical signs, viral load and/or viremia caused by a virus infection in a subject. Preferably, a “virus infection”, as mentioned herein, is an infection with a virus, which virus is of the species having a genome encoding - the virus antigen according to the present invention, or - the amino acid sequence of the antigenic determinant of the virus antigen according to the present invention. With reference to the clauses disclosed further below, in some embodiments, the present invention provides the immunogenic composition, as specified in any one of clauses 13 to 19, and 24 to 64, for use in a method for reducing one or more clinical signs, viral load and/or viremia caused by a PCV2 infection in a subject. In one aspect, the immunogenic composition according to the present invention is administered orally, in particular by oral drench, to the subject. In another preferred aspect, the immunogenic composition of the present invention is administered mucosally to the subject. The invention further provides a method for reducing one or more clinical signs, viral load and/or viremia caused by a virus infection in a subject, wherein the method comprises the steps of: - placing the immunogenic composition of the present invention into the housing environment of the subject, and 23-0040-ff Boehringer Ingelheim Vetmedica GmbH - allowing the subject to self-administer the immunogenic composition. In some embodiments, a method for reducing one or more clinical signs, viral load and/or viremia caused by a PCV2 infection in a subject is provided, wherein, with reference to the clauses disclosed further below, the method comprises the steps of: - placing the immunogenic composition, as specified of any one of clauses 13 to 19, and 24 to 64, into the housing environment of the subject, and - allowing the subject to self-administer the immunogenic composition. Preferably, in said methods including placing the immunogenic composition into the housing of a subject, the immunogenic composition is put on the floor of the housing environment of the subject. According to another preferred aspect, in said methods including placing the immunogenic composition into the housing of a subject, the immunogenic composition is put into a bowl or vessel being located in the housing environment of the subject. Preferably, the immunogenic composition is placed only once into the housing environment of the subject. In a particular preferred aspect, in said methods including placing the immunogenic composition into the housing of a subject, the immunogenic composition is placed into the housing environment of the subject by using a dosing unit, wherein the dosing unit is preferably a handpump backpack sprayer. Thus, the present invention also provides a dosing unit, in particular a handpump backpack sprayer, containing the immunogenic composition of the present invention. All of the above-mentioned methods for inducing an immune response in a subject and for reducing one or more clinical signs, viral load and/or viremia caused by virus infection in a subject will hereinafter also be termed “the methods according to the present invention”. In one aspect, in the methods according to the present invention the immunogenic composition of the present invention is administered, within a prime-boost administration, as a booster to the subject, wherein the subject has been preferably primed before by the administration of a vaccine being free of a gel composition comprising a flavoring agent. 23-0040-ff Boehringer Ingelheim Vetmedica GmbH According to another preferred aspect, in the methods according to the present invention the subject is not pre-vaccinated with a vaccine against a virus, which virus is of the species having a genome encoding the antigenic determinant of said virus antigen. In some embodiments of the present invention, the subject is a PCV2 vaccination naïve subject. In one aspect, in the methods according to the present invention - said immune response, or - said reducing of one or more clinical signs, viral load and/or viremia caused by a virus infection in a subject is obtained by the administration of the immunogenic composition. In another aspect, in the methods according to the present invention - said immune response, or - said reducing of one or more clinical signs, viral load and/or viremia caused by a virus infection in a subject is obtained without a further administration of a vaccine against a virus to the subject, which virus is of the species having a genome encoding the antigenic determinant of the virus antigen included in said immunogenic composition. In one preferred aspect of the methods according to the present invention, the subject is preferably an animal, in particular a pig. In a further preferred aspect of the methods according to the present invention, the subject is a piglet or a sow. The invention further provides a dosing unit comprising the immunogenic composition of the present invention, which is also termed “the dosing unit according to the present invention” hereinafter. Preferably, the dosing unit according to the present invention is a handpump backpack sprayer. 23-0040-ff Boehringer Ingelheim Vetmedica GmbH In another aspect, the invention also relates to the use of the dosing unit according to the present invention for placing the immunogenic composition of the present invention into the housing environment of a subject. According to a further preferred aspect, the invention relates to any of said methods including placing an immunogenic composition of the present invention into the housing of a subject, wherein the dosing unit according to the present invention is used for placing said immunogenic composition into the housing environment of the subject EXAMPLES The following examples are only intended to illustrate the present disclosure. They shall not limit the scope of the claims in any way. EXAMPLE 1 Results of PCV2 VLP Gel Administration Study Objective: To investigate if Porcine Circovirus type 2 (PCV2) virus like particle (VLP) is immunogenic when administered to pigs by a gel, thus being an oral and mucosal vaccine to prevent against PCV2 associated disease in swine. Methods: To investigate the immunogenicity of Porcine Circovirus type 2, virus like particle, administered by gel for swine, an experiment was conducted with two treatment groups. SPF pigs being, on study day 0, about 6 weeks of age were randomly assigned to treatment group 1) Non-Vaccinated Control and 2) Gel VLP Vaccine group. These groups were comprised of 7 and 10 pigs, respectively. On study day 0, pigs in the Gel VLP Vaccine group were provided an immunogenic composition of the present invention such that for each pig, 100 mL of finally prepared Gel VLP vaccine containing a total of 300 µg of recombinant baculovirus expressed PCV2d ORF2 protein (SEQ ID NO:2 (corresponds to SEQ ID NO:1 of WO2015051099)), said virus antigen herein being also termed “Porcine Circovirus, type 2d, killed baculovirus vector expressed virus like particle” or “PCV2 VLP”, respectively, was made available. The PCV2d ORF2 protein had 23-0040-ff Boehringer Ingelheim Vetmedica GmbH been produced as described in WO2015051099 (Examples 1 to 3), and was then further subjected to a downstream processing as set out in WO 2019191005 (Example 1, without mixing with a carbomer solution (adjuvant)). The finally prepared Gel VLP Vaccine was manufactured by mixing commercially available Underline® gel concentrate (Animal Science Products, Nacogdoches, TX (USA)) - which has the ingredients: water, maltodextrins, propylene glycol, hemicellulose extract, artificial color, natural and artificial flavor - according to the manufacturer´s specifications with PCV2 VLP in the following ratios: 1 part Underline® gel concentrate was mixed with 2 parts of cold PCV2 VLP liquid. The Gel VLP Vaccine was placed into the housing of the pigs by adding a total of 500 mL thereof (comprising 1,500 µg PCV2 VLP) per pen containing five pigs. This composition was added to two bowls (gruel feeders) per pen to allow for the pigs to consume the gel vaccine mixture on their own. This vaccine did not contain adjuvant. At 23 days post vaccination, all pigs had blood drawn for peripheral blood mononuclear cell (PBMC) extraction to evaluate PCV2 specific T cell immunity, following the protocol of Koinig HC et al. Vet Res.46:20 (2015). All blood samples were also submitted to test for PCV2 viremia by PCR. Results: PCV2 viremia was not detected in any pig. The pigs immediately were attracted to the gel VLP mixture and consumed it entirely. This allowed for the immunization of pigs against PCV2 without needing to individually handle each pig, drastically reducing the labor and time needed to immunize the animals. This vaccine composition was well tolerated, and no adverse events were observed. Analysis of cellular immunity revealed that the pigs in the Gel VLP Vaccine group developed PCV2 antigen specific T cells while pigs in the Non-Vaccinated Control group did not. At 23 days post vaccination, the Oral VLP vaccine group had PCV2 antigen specific interferon gamma and tumor necrosis factor producing CD4+ T cells, while the Non-Vaccinated Control group did not (Figure 1 (“Fig.1”)). Conclusion: Porcine Circovirus, type 2, virus like particle when combined with a semi-solid, liquid, gel formulation for consumption was immunogenic to pigs, thus being a method and vaccine to prevent disease caused by PCV2 in pigs. 23-0040-ff Boehringer Ingelheim Vetmedica GmbH LIST OF FIGURES: Figure 1 (“Fig.1”): Percentage of interferon gamma (IFNg) and tumor necrosis factor alpha (TNFa) positive PCV2 antigen specific CD4+ T cells measured in blood of pigs at 23 days post vaccination. Sequences included in the sequence listing: SEQ ID NO:1 SEQ ID NO:1 corresponds to the sequence of a PCV2a ORF2 protein (being 233 amino acid residues in length). SEQ ID NO:1 has the amino acid sequence (in the one letter code for amino acid residues, from N- to C-terminus, including an N-terminal methionine residue (M) at amino acid position 1): MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKAT TVTTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGS TAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKR NQLWLRLQTSRNVDHVGLGTAFENSKYDQDYNIRVTMYVQFREFNLKDPPLEP SEQ ID NO:2 SEQ ID NO:2 corresponds to the sequence of a PCV2d ORF2 protein (being 234 amino acid residues in length). SEQ ID NO:2 has the amino acid sequence (in the one letter code for amino acid residues, from N- to C-terminus, including an N-terminal methionine residue (M) at amino acid position 1): MTYPRRRFRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTIGYTVKKT TVTTPSWNVDMMRFNINDFLPPGGGSNPLTVPFEYYRIRKVKVEFWPCSPITQGDRGVGS TAVILDDNFVTKANALTYDPYVNYSSRHTITQPFSYHSRYFTPKPVLDRTIDYFQPNNKR NQLWLRLQTTGNVDHVGLGTAFENSIYDQDYNIRITMYVQFREFNLKDPPLNPK SEQ ID NO:3 SEQ ID NO:3 corresponds to the sequence of a PPV VP2 (being 579 amino acid residues in length). SEQ ID NO:3 has the amino acid sequence (in the one letter code for amino acid residues, from N- to C-terminus, including an N-terminal methionine residue (M) at amino acid position 1): MSENVEQHNPINAGTELSATGNESIGGGGGGGGRGSIGVGVSTGSFNNQTEFQYLGEGLV RITAHASRLIHLNMPEHETYKRIHVLNSESGVAGQMVQDDAHTQMVTPWSLIDANAWGVW FNPADWQLISNNMTEINLVSFEQEIFNVVLKTITESATSPPTKIYNNDLTASLMVALDTN 23-0040-ff Boehringer Ingelheim Vetmedica GmbH NTLPYTPAAPRSETLGFYPWLPTKPTQYRYYLSCTRNLNPPTYTGQSEQITDSIQTGLHS DIMFYTIENAVPIHLLRTGDEFSTGIYHFDTKPLKLTHSWQTNRSLGLPPKLLTEPTTEG DQHPGTLPAANTRKGYHQTINNSYTEATAIRPAQVGYNTPYMNFEYSNGGPFLTPIVPTA DTQYNDDEPNGAIRFTMGYQHGQLTTSSQELERYTFNPQSKCGRAPKQQFNQQSPLNLQN TNNGTLLPSDPIGGKTNMHFMNTLNTYGPLTALNNTAPVFPNGQIWDKELDTDLKPRLHV TAPFVCKNNPPGQLFVKIAPNLTDDFNADSPQQPRIITYSNFWWKGTLTFTAKMRSSNMW NPIQQHTTTAENIGNYIPTNIGGIKMFPEYSQLIPRKLY The following clauses are also disclosed herein. Thus, the present disclosure further includes aspects as featured by the following clauses: 1. An immunogenic composition comprising - an antigen composition comprising or consisting of a virus antigen; and - a gel composition, wherein the gel composition comprises a flavoring agent. 2. The immunogenic composition according to clause 1, wherein said immunogenic composition is an immunogenic composition consisting of - an antigen composition comprising or consisting of a virus antigen; and - a gel composition comprising one or more flavoring agents; and - one or more veterinary-acceptable carriers. 3. The immunogenic composition according to clause 1, wherein said immunogenic composition is an immunogenic composition consisting of - an antigen composition comprising or consisting of a virus antigen; and - a gel composition comprising one or more flavoring agents; and - one or more veterinary-acceptable carriers; and -0040-ff Boehringer Ingelheim Vetmedica GmbH - at least one immunogenic substance different from said virus antigen. 4. The immunogenic composition according to clause 1, wherein said immunogenic composition is an immunogenic composition consisting of - an antigen composition comprising or consisting of a virus antigen; and - a gel composition comprising one or more flavoring agents; and - one or more veterinary-acceptable carriers; and - an adjuvant. 5. The immunogenic composition according to clause 1, wherein said immunogenic composition is an immunogenic composition consisting of - an antigen composition comprising or consisting of a virus antigen; and - a gel composition comprising one or more flavoring agents; and - one or more veterinary-acceptable carriers; and - an adjuvant; and - at least one immunogenic substance different from said virus antigen. 6. The immunogenic composition according to any one of clauses 1 to 5, wherein the gel composition is a gel composition suitable for oral and/or mucosal administration. 7. The immunogenic composition according to any one of clauses 1 to 6, wherein the virus antigen is a virus protein. 8. The immunogenic composition according to any one of clauses 1 to 7, wherein the virus antigen is a non-replicating virus antigen. 9. The immunogenic composition according to any one of clauses 1 to 8, wherein the virus antigen is capable of forming a virus-like particle -0040-ff Boehringer Ingelheim Vetmedica GmbH 10. The immunogenic composition according to any one of clauses 1 to 9, wherein the virus antigen is a virus capsid protein. 11. The immunogenic composition according to any one of clauses 1 to 10, wherein the virus antigen is a circovirus capsid protein. 12. The immunogenic composition according to any one of clauses 1 to 11, wherein the virus antigen is a porcine circovirus (PCV) capsid protein. 13. The immunogenic composition according to any one of clauses 1 to 12, wherein the virus antigen is a porcine circovirus type 2 (PCV2) ORF2 protein. 14. The immunogenic composition according to clause 13, wherein the PCV2 ORF2 protein comprises or consists of an amino acid sequence having at least 90%, preferably at least 95%, more preferably at least 98%, still more preferably at least 99% or in particular 100% sequence identity with the sequence of SEQ ID NO:1. 15. The immunogenic composition according to any one of clauses 1 to 14, wherein the virus antigen is selected from the group consisting of PCV2 subtype a (PCV2a) ORF2 protein, PCV2 subtype b (PCV2b) ORF2 protein, PCV2 subtype c (PCV2c) ORF2 protein, PCV2 subtype d (PCV2d) ORF2 protein, PCV2 subtype e (PCV2e) ORF2 protein, PCV2 subtype f (PCV2f) ORF2 protein, PCV2 subtype g (PCV2g) ORF2 protein and PCV2 subtype h (PCV2h) ORF2 protein. 16. The immunogenic composition according to any one of clauses 1 to 15, wherein the virus antigen is a PCV2 subtype a (PCV2a) ORF2 protein. 17. The immunogenic composition according to clause 15 or 16, wherein said PCV2a ORF2 protein comprises or consists of an amino acid sequence having at least 95%, preferably at least 98%, more preferably at least 99% or in particular 100% sequence identity with the sequence of SEQ ID NO:1. 18. The immunogenic composition according to any one of clauses 1 to 15, wherein the virus antigen is a PCV2 subtype d (PCV2d) ORF2 protein. 19. The immunogenic composition according to any one of clauses 1 to 15, and 18, wherein said PCV2d ORF2 protein comprises or consists of an amino acid sequence having at least 95%, preferably at least 98%, more preferably at least 99% or in particular 100% sequence identity with the sequence of SEQ ID NO:2. -0040-ff Boehringer Ingelheim Vetmedica GmbH 20. The immunogenic composition according to any one of clauses 1 to 10, wherein the virus antigen is a parvovirus capsid protein. 21. The immunogenic composition according to any one of clauses 1 to 10, and 20, wherein the virus antigen is a porcine parvovirus (PPV) capsid protein. 22. The immunogenic composition according to any one of clauses 1 to 10, 20, and 21, wherein the PPV capsid protein is a PPV viral protein 2 (VP2). 23. The immunogenic composition according to clause 22, wherein said PPV VP2 comprises or consists of an amino acid sequence having at least 95%, preferably at least 98%, more preferably at least 99% or in particular 100% sequence identity with the sequence of SEQ ID NO:3. 24. The immunogenic composition according to any one of clauses 1 to 23, wherein the virus antigen is recombinantly expressed. 25. The immunogenic composition according to any one of clauses 1 to 24, wherein the virus antigen is baculovirus expressed. 26. The immunogenic composition according to any one of clauses 1 to 25, wherein said antigen composition is a virus-like particle. 27. The immunogenic composition according to clause 26, wherein said antigen composition is a virus-like particle comprising a virus antigen. 28. The immunogenic composition according to clause 27, wherein said virus antigen is a virus antigen as specified in any one of clauses 7 to 25. 29. The immunogenic composition according to any one of clauses 1 to 28, wherein the antigen composition comprises at least 10 µg of the virus antigen per dose of the immunogenic composition, or wherein the antigen composition comprises at least 15 µg of the virus antigen per dose of the immunogenic composition. 30. The immunogenic composition according to any one of clauses 1 to 29, wherein the antigen composition comprises at least 30 µg of the virus antigen per dose of the immunogenic composition, -0040-ff Boehringer Ingelheim Vetmedica GmbH or wherein the antigen composition comprises at least 50 µg of the virus antigen per dose of the immunogenic composition. 31. The immunogenic composition according to any one of clauses 1 to 30, wherein the antigen composition comprises at least 100 µg of the virus antigen per dose of the immunogenic composition. 32. The immunogenic composition according to any one of clauses 1 to 31, wherein the antigen composition comprises at least 150 µg of the virus antigen per dose of the immunogenic composition. 33. The immunogenic composition according to any one of clauses 1 to 32, wherein the antigen composition comprises at least 200 µg of the virus antigen per dose of the immunogenic composition. 34. The immunogenic composition according to any one of clauses 1 to 33, wherein the antigen composition comprises at least 250 µg of the virus antigen per dose of the immunogenic composition. 35. The immunogenic composition according to any one of clauses 1 to 34, wherein one dose of the immunogenic composition has a volume of about 100 mL. 36. The immunogenic composition according to any one of clauses 1 to 35, wherein said gel composition comprises water. 37. The immunogenic composition according to any one of clauses 1 to 36, wherein said gel composition is a hydrogel composition. 38. The immunogenic composition according to any one of clauses 1 to 37, wherein said gel composition comprises at least one adhesion enhancing agent. 39. The immunogenic composition according to clause 38, wherein the at least one adhesion enhancing agent is selected from the group consisting of maltodextrins, hemicellulose extract, hemicellulose, xanthan, guar, pectins, gums, guar derivatives, chitosan, dextran, carrageenans, starch, polyethylene glycol, albumin, cellulose ethers, hyaluronic acid, carboxymethylhydroxyethylcellulose, hydroxypropylmethyl cellulose (HPMC), hydroxypropyl cellulose (HPC), hydroxyethyl cellulose (HEC), carboxy methyl cellulose (CMC), gelatins, vinyl acetates, polyvinyl pyrrolidone, polyvinyl pyrrolidone-vinyl acetate copolymers, -0040-ff Boehringer Ingelheim Vetmedica GmbH polyvinyl alcohols, polyphosphoesters, N-(2-hydroxypropyl) methacryl amide (HPMA) copolymers, polyacrylic acids, polyacrylamides, polyoxazolines, divinyl ether-maleic anhydride, polyphosphazenes, including derivatives and substitutions, and combinations thereof. 40. The immunogenic composition according to any one of clauses 1 to 39, wherein said gel composition comprises maltodextrin. 41. The immunogenic composition according to any one of clauses 1 to 40, wherein said gel composition comprises hemicellulose extract. 42. The immunogenic composition according to any one of clauses 39 to 41, wherein the hemicellulose extract comprises xanthan. 43. The immunogenic composition according to any one of clauses 1 to 42, wherein said gel composition comprises one or more pharmaceutically acceptable carriers. 44. The immunogenic composition according clause 43, wherein the one or more pharmaceutically acceptable carriers is selected from the group consisting of propylene glycol (PG), propylene glycol monolaurate (PGML), propylene glycol capryiate, polyethylene glycol monolaurate (PEGML), glycerol monolaurate (GML), methyl formamide (DMF), allantoin, urazole, N,N-dimethylacetamide (DMA), dimethyl sulfoxide (DMSO), decylmethylsulfoxide, lecithin, polyoxylglycerides, the 1-substituted azacycloheptan-2-ones, particularly 1-n- dodecylcyclazacycloheptan-2-one, alcohols, and oils safe for porcine consumption such as vegetable oils. 45. The immunogenic composition according to any one of clauses 1 to 44, wherein said gel composition comprises propylene glycol. 46. The immunogenic composition according to any one of clauses 1 to 45, wherein said gel composition comprises one or more colorants. 47. The immunogenic composition according to any one of clauses 1 to 46, wherein said gel composition comprises one or more flavoring agents. 48. The immunogenic composition according to any one of clauses 1 to 47, wherein said gel composition comprises or consists of: -0040-ff Boehringer Ingelheim Vetmedica GmbH - water, - maltodextrins, - propylene glycol, - hemicellulose extract, - one or more colorants, and - one or more flavoring agents. 49. The immunogenic composition according to any one of clauses 46 to 48, wherein the one or more colorants are selected from the group consisting of pigments, dyes and combinations thereof, and/or wherein the one or more colorants are capable of attracting pigs. 50. The immunogenic composition according to any one of clauses 46 to 49, wherein the one or more colorants are selected from the group consisting of FD&C Blue No.1, FD&C Blue No.2, FD&C Green No.3, Orange B, Citrus FD&C Red No.2, FD&C Red No. 2, FD&C Red No. 3, FD&C Red No.40, FD&C Yellow No.5 and FD&C Yellow No.6. 51. The immunogenic composition according to any one of clauses 47 to 50, wherein the one or more flavoring agents are capable of attracting pigs. 52. The immunogenic composition according to any one of clauses 47 to 51, wherein the one or more flavoring agents are selected from the group consisting of sucrose, glucose, sodium saccharin, sodium cyclamate, xylitol, perillartien, sucralose, D- tryptophan, aspartame, dihydrochalcones, artificial fruit flavoring (e.g., strawberry flavoring), plasma protein (e.g., spray-dried plasma protein), cheese and cheese- like flavorings, dried milk, chocolate and chocolate by-products. 53. The immunogenic composition according to any one of clauses 1 to 52, wherein the immunogenic composition is liquid. 54. The immunogenic composition according to any one of clauses 1 to 53, wherein the immunogenic composition is viscous. -0040-ff Boehringer Ingelheim Vetmedica GmbH 55. The immunogenic composition according to any one of clauses 1 to 54, wherein the immunogenic composition has a viscosity of at least 50 mPa·s or at least 50 cP. 56. The immunogenic composition according to any one of clauses 1 to 52, 54 and 55, wherein the immunogenic composition is solid. 57. The immunogenic composition according to any one of clauses 1 to 56, wherein the immunogenic composition comprises an adjuvant. 58. The immunogenic composition according to any one of clauses 1 to 57, wherein said immunogenic composition further comprises or contains one or more veterinary-acceptable carriers. 59. The immunogenic composition according to any one of clauses 2 to 58, wherein said one or more veterinary-acceptable carriers are selected from the group consisting of solvents, dispersion media, coatings, stabilizing agents, diluents, preservatives, antibacterial and antifungal agents, isotonic agents, adsorption delaying agents. 60. The immunogenic composition according to any one of clauses 1, 3, and 5 to 59, wherein the immunogenic composition comprises or contains at least one immunogenic substance different from said virus antigen. 61. The immunogenic composition according to any one of clauses 3, 5 to 17, and 24 to 60, wherein said virus antigen is PCV2a ORF2 protein, and wherein the at least one immunogenic substance different from said virus antigen is a PCV2d ORF2 protein. 62. The immunogenic composition according to clause 61, wherein said PCV2a ORF2 protein comprises or consists of an amino acid sequence having at least at least 95%, preferably at least 98%, more preferably at least 99% or in particular 100% sequence identity with the sequence of SEQ ID NO:1, and wherein said PCV2d ORF2 protein comprises or consists of an amino acid sequence having at least at least 95%, preferably at least 98%, more preferably at least 99% or in particular 100% sequence identity with the sequence of SEQ ID NO:2 -0040-ff Boehringer Ingelheim Vetmedica GmbH 63. The immunogenic composition according to any one of clauses 3, and 5 to 62, wherein the at least one immunogenic substance different from said virus antigen comprises a bacterial antigen. 64. The immunogenic composition according to any one of clauses 3, and 5 to 63, wherein the at least one immunogenic substance different from said virus antigen comprises a Lawsonia intracellularis antigen and/or a Salmonella spp. antigen. 65. Use of the immunogenic composition of any one of clauses 1 to 64 in the preparation of a medicament, preferably of a vaccine. 66. The immunogenic composition according to any one of clauses 1 to 64 for use as a medicament. 67. The immunogenic composition according to any one of clauses 1 to 64 for use as a vaccine. 68. The immunogenic composition according to any one of clauses 1 to 64 for use in a method for inducing an immune response in a subject. 69. The immunogenic composition for use in a method according to clause 68, wherein said immune response is an immune response against a virus. 70. The immunogenic composition for use in a method according to clause 69, wherein said immune response is against a virus, which virus is of the species having a genome encoding - the virus antigen, or - the amino acid sequence of the antigenic determinant of the virus antigen. 71. The immunogenic composition according to any one of clauses 13 to 19, and 24 to 64 for use in a method for inducing an immune response against PCV2 in a subject. 72. The immunogenic composition for use in a method according to any one of clauses 68 to 71, wherein said immune response is a protective immune response. -0040-ff Boehringer Ingelheim Vetmedica GmbH 73. The immunogenic composition according to any one of clauses 1 to 64 for use in a method for reducing one or more clinical signs, viral load and/or viremia caused by a virus infection in a subject. 74. The immunogenic composition for use in a method according to clause 73, wherein said virus infection is an infection with a virus, which virus is of the species having a genome encoding - the virus antigen, or - the amino acid sequence of the antigenic determinant of the virus antigen. 75. The immunogenic composition according to any one of clauses 13 to 19, and 24 to 64 for use in a method for reducing one or more clinical signs, viral load and/or viremia caused by a PCV2 infection in a subject. 76. A method of inducing an immune response in a subject, wherein the method comprises administering to the subject an effective amount of the immunogenic composition according to any one of clauses 1 to 64. 77. The method according to clause 76, wherein said immune response against a virus is preferably an immune response against a virus, which virus is of the species having a genome encoding - the virus antigen, or - the amino acid sequence of the antigenic determinant of the virus antigen. 78. A method of inducing an immune response against PCV2 in a subject, wherein the method comprises administering to the subject an effective amount of the immunogenic composition according to any one of clauses 13 to 19, and 24 to 64. 79. The method according to any one of clauses 76 to 78, wherein said immune response is a protective immune response. 80. A method for reducing one or more clinical signs, viral load and/or viremia caused by a virus infection in a subject, wherein the method comprises administering to the subject an effective amount of the immunogenic composition according to any one of clauses 1 to 64. -0040-ff Boehringer Ingelheim Vetmedica GmbH 81. The method according to clause 80, wherein said virus infection is an infection with a virus, which virus is of the species having a genome encoding - the virus antigen, or - the amino acid sequence of the antigenic determinant of the virus antigen. 82. A method for reducing one or more clinical signs, viral load and/or viremia caused by a PCV2 infection in a subject, wherein the method comprises administering to the subject an effective amount of the immunogenic composition according to any one of clauses 13 to 19, and 24 to 64. 83. A method for inducing an immune response in a subject, wherein the method comprises the steps of: placing the immunogenic composition of any one of clauses 1 to 64 into the housing environment of the subject, and allowing the subject to self-administer the immunogenic composition. 84. The method according to clause 83, wherein said immune response against a virus is preferably an immune response against a virus, which virus is of the species having a genome encoding - the virus antigen, or - the amino acid sequence of the antigenic determinant of the virus antigen. 85. The method of clause 83 or 84, wherein said immune response is an immune response against PCV2 in a subject, and wherein said immunogenic composition is the immunogenic composition according to any one of clauses 13 to 19, and 24 to 64. 86. The method according to any one of clauses 83 to 85, wherein said immune response is a protective immune response. 87. A method for reducing one or more clinical signs, viral load and/or viremia caused by a virus infection in a subject, wherein the method comprises the steps of: -0040-ff Boehringer Ingelheim Vetmedica GmbH placing the immunogenic composition of any one of clauses 1 to 64 into the housing environment of the subject, and allowing the subject to self-administer the immunogenic composition. 88. The method according to clause 87, wherein said virus infection is an infection with a virus, which virus is of the species having a genome encoding - the virus antigen, or - the amino acid sequence of the antigenic determinant of the virus antigen. 89. A method for reducing one or more clinical signs, viral load and/or viremia caused by a PCV2 infection in a subject, wherein the method comprises the steps of: placing the immunogenic composition of any one of clauses 13 to 19, and 24 to 64 into the housing environment of the subject, and allowing the subject to self-administer the immunogenic composition. 90. The method of any one of clauses 83 to 89, wherein the immunogenic composition is put on the floor of the housing environment of the subject. 91. The method of any one of clauses 83 to 90, wherein the immunogenic composition is put into a bowl or vessel being located in the housing environment of the subject. 92. Use of the immunogenic composition according to any one of clauses 1 to 64 in the preparation of a medicament for use in a method of inducing an immune response in a subject. 93. The use according to clause 92, wherein said immune response against a virus is preferably an immune response against a virus, which virus is of the species having a genome encoding - the virus antigen, or - the amino acid sequence of the antigenic determinant of the virus antigen. -0040-ff Boehringer Ingelheim Vetmedica GmbH 94. Use of the immunogenic composition according to any one of clauses 13 to 19, and 24 to 64 in the preparation of a medicament for use in a method of inducing an immune response against PCV2 in a subject. 95. The use according to any one of clauses 92 to 94, wherein said immune response is a protective immune response. 96. Use of the immunogenic composition according to any one of clauses 1 to 64 in the preparation of a medicament for use in a method for reducing one or more clinical signs, viral load and/or viremia caused by a virus infection in a subject. 97. The use according to clause 96, wherein said virus infection is an infection with a virus, which virus is of the species having a genome encoding - the virus antigen, or - the amino acid sequence of the antigenic determinant of the virus antigen. 98. Use of the immunogenic composition according to any one of clauses 13 to 19, and 24 to 64 in the preparation of a medicament for use in a method for reducing one or more clinical signs, viral load and/or viremia caused by a PCV2 infection in a subject. 99. The immunogenic composition according to any one of clauses 68 to 75, the method according to any one of clauses 76 to 82, or the use according to any one of clauses 92 to 98, wherein the immunogenic composition is administered orally to the subject. 100. The immunogenic composition according to any one of clauses 68 to 75, the method according to any one of clauses 76 to 82, or the use according to any one of clauses 92 to 98, wherein the immunogenic composition is administered mucosally to the subject. 101. The immunogenic composition according to any one of clauses 68 to 75, the method according to any one of clauses 76 to 91, or the use according to any one of clauses 92 to 98, wherein the immunogenic composition is administered, within a prime-boost administration, as a booster to the subject. -0040-ff Boehringer Ingelheim Vetmedica GmbH 102. The immunogenic composition according to clause 101, the method according to clause 101, or the use according to clause 101, wherein the subject has been primed before by the administration of an immunogenic composition being free of a gel composition comprising a flavoring agent. 103. The immunogenic composition according to any one of clauses 68 to 75, 99, and 100, the method according to any one of clauses 76 to 82, 99, and 100, or the use according to any one of clauses 92 to 100, wherein the method consists of administering only one dose of the immunogenic composition to the subject. 104. The method of any one of clauses 83 to 91, wherein the immunogenic composition is placed only once into the housing environment of the subject. 105. The immunogenic composition according to any one of clauses 69 to 75, 99, 100, and 103, the method according to any one of clauses 76 to 91, 99, 100, 103, and 104, or the use according to any one of clauses 92 to 100, and 103, wherein the subject is not pre-vaccinated with a vaccine against a virus, which virus is of the species having a genome encoding the antigenic determinant of said virus antigen. 106. The immunogenic composition according to any one of clauses 69 to 75, 99, 100, 103, and 105, the method according to any one of clauses 76 to 91, 99, 100, and 103 to 105, or the use according to any one of clauses 92 to 100, 103, and 105, wherein the subject is a PCV2 vaccination naïve subject. 107. The immunogenic composition according to any one of clauses 69 to 75, 99, 100, 103, 105, and 106, the method according to any one of clauses 76 to 91, 99, 100, and 103 to 106, or the use according to any one of clauses 92 to 100, 103, 105, and 106, wherein - said immune response, or - said reducing of one or more clinical signs, viral load and/or viremia caused by a virus infection in a subject is obtained by the administration of the immunogenic composition. 108. The immunogenic composition according to any one of clauses 69 to 75, 99, 100, 103, and 105 to 107, the method according to any one of clauses 76 to 91, 99, -0040-ff Boehringer Ingelheim Vetmedica GmbH 100, and 103 to 107, or the use according to any one of clauses 92 to 100, 103, and 105 to 107, wherein - said immune response, or - said reducing of one or more clinical signs, viral load and/or viremia caused by a virus infection in a subject is obtained without a further administration of a vaccine against a virus to the subject, which virus is of the species having a genome encoding the antigenic determinant of the virus antigen included in said immunogenic composition. 109. The immunogenic composition according to any one of clauses 69 to 75, 99 to 103, and 105 to 108, , the method according to any one of clauses 76 to 91, and 99 to 108, or the use according to any one of clauses 92 to 103, and 105 to 108, wherein the subject is an animal. 110. The immunogenic composition according to clause 109, the method according to clause 109, or the use according to clause 109, wherein the subject is a pig. 111. The immunogenic composition according to clause 109 or 110, the method according to clause 109 or 110, or the use according to clause 109 or 110, wherein the subject is a piglet or a sow. 112. Dosing unit comprising the immunogenic composition according to any one of clauses 1 to 64. 113. Dosing unit according to clause 112, wherein the dosing unit is a handpump backpack sprayer. 114. Use of the dosing unit according to clause 112 or 113 for placing the immunogenic composition into the housing environment of a subject. 115. Method according to any one of clauses 82 to 91, and 99 to 111, wherein the dosing unit according to clause 112 or 113 is used for placing the immunogenic composition into the housing environment of the subject.

Claims

-0040-ff Boehringer Ingelheim Vetmedica GmbH CLAIMS: 1. An immunogenic composition comprising - an antigen composition comprising or consisting of a virus antigen; and - a gel composition, wherein the gel composition comprises a flavoring agent. 2. The immunogenic composition according to claim 1, wherein said immunogenic composition is an immunogenic composition consisting of - an antigen composition comprising or consisting of a virus antigen; and - a gel composition comprising one or more flavoring agents, wherein the gel composition is optionally a gel composition suitable for oral and/or mucosal administration; and - one or more veterinary-acceptable carriers; - and optionally an adjuvant and/or optionally at least one immunogenic substance different from said virus antigen. 3. The immunogenic composition according claim 1 or 2, wherein the virus antigen is - a virus protein; and/or - a non-replicating virus antigen; and/or - capable of forming a virus-like particle; and/or - a virus capsid protein; and/or - a circovirus capsid protein or a porcine parvovirus (PPV) capsid protein; and/or - a porcine circovirus (PCV) capsid protein. 4. The immunogenic composition according to any one of claims 1 to 3, wherein the virus antigen is a porcine circovirus type 2 (PCV2) ORF2 protein, -0040-ff Boehringer Ingelheim Vetmedica GmbH and wherein the PCV2 ORF2 protein optionally comprises or consists of an amino acid sequence having at least 90%, preferably at least 95%, more preferably at least 98%, still more preferably at least 99% or in particular 100% sequence identity with the sequence of SEQ ID NO:1. 5. The immunogenic composition according to any one of claims 1 to 4, wherein the antigen composition comprises at least 10 µg of the virus antigen per dose of the immunogenic composition, or at least 15 µg of the virus antigen per dose of the immunogenic composition, or at least 30 µg of the virus antigen per dose of the immunogenic composition, or at least 50 µg of the virus antigen per dose of the immunogenic composition, or at least 100 µg of the virus antigen per dose of the immunogenic composition, or at least 150 µg of the virus antigen per dose of the immunogenic composition, or at least 200 µg of the virus antigen per dose of the immunogenic composition, or at least 250 µg of the virus antigen per dose of the immunogenic composition. 6. The immunogenic composition according to any one of claims 1 to 5, wherein said gel composition comprises water and/or wherein said gel composition is a hydrogel composition. 7. The immunogenic composition according to any one of claims 1 to 6, wherein said gel composition comprises at least one adhesion enhancing agent, and wherein the at least one adhesion enhancing agent is preferably selected from the group consisting of maltodextrins, hemicellulose extract, hemicellulose, xanthan, guar, pectins, gums, guar derivatives, chitosan, dextran, carrageenans, starch, polyethylene glycol, albumin, cellulose ethers, hyaluronic acid, carboxymethylhydroxyethylcellulose, hydroxypropylmethyl cellulose (HPMC), hydroxypropyl cellulose (HPC), hydroxyethyl cellulose (HEC), carboxy methyl cellulose (CMC), gelatins, vinyl acetates, polyvinyl pyrrolidone, polyvinyl pyrrolidone-vinyl acetate copolymers, polyvinyl alcohols, polyphosphoesters, N-(2- hydroxypropyl) methacryl amide (HPMA) copolymers, polyacrylic acids, polyacrylamides, polyoxazolines, divinyl ether-maleic anhydride, -0040-ff Boehringer Ingelheim Vetmedica GmbH polyphosphazenes, including derivatives and substitutions, and combinations thereof. 8. The immunogenic composition according to any one of claims 1 to 7, wherein said gel composition comprises - maltodextrin; and/or - hemicellulose extract; and/or - xanthan; and/or - one or more pharmaceutically acceptable carriers, and wherein the one or more pharmaceutically acceptable carriers is preferably selected from the group consisting of propylene glycol (PG), propylene glycol monolaurate (PGML), propylene glycol capryiate, polyethylene glycol monolaurate (PEGML), glycerol monolaurate (GML), methyl formamide (DMF), allantoin, urazole, N,N-dimethylacetamide (DMA), dimethyl sulfoxide (DMSO), decylmethylsulfoxide, lecithin, polyoxylglycerides, the 1-substituted azacycloheptan-2-ones, particularly 1-n-dodecylcyclazacycloheptan-2-one, alcohols, and oils safe for porcine consumption such as vegetable oils. 9. The immunogenic composition according to any one of claims 1 to 8, wherein said gel composition comprises one or more colorants, in particular one or more colorants capable of attracting pigs, wherein the one or more colorants are preferably selected from the group consisting of pigments, dyes and combinations thereof, and/or wherein the one or more colorants are preferably selected from the group consisting of FD&C Blue No.1, FD&C Blue No.2, FD&C Green No.3, Orange B, Citrus FD&C Red No.2, FD&C Red No.2, FD&C Red No.3, FD&C Red No.40, FD&C Yellow No.5 and FD&C Yellow No.6. 10. The immunogenic composition according to any one of claims 1 to 9, wherein said gel composition comprises one or more flavoring agents, wherein preferably the one or more flavoring agents are capable of attracting pigs, -0040-ff Boehringer Ingelheim Vetmedica GmbH and/or wherein the one or more flavoring agents are preferably selected from the group consisting of sucrose, glucose, sodium saccharin, sodium cyclamate, xylitol, perillartien, sucralose, D-tryptophan, aspartame, dihydrochalcones, artificial fruit flavoring (e.g., strawberry flavoring), plasma protein (e.g., spray-dried plasma protein), cheese and cheese-like flavorings, dried milk, chocolate and chocolate by-products. 11. The immunogenic composition according to any one of claims 1 to 10, wherein said gel composition comprises or consists of: - water, - maltodextrins, - propylene glycol, - hemicellulose extract, - one or more colorants, and - one or more flavoring agents. 12. The immunogenic composition according to any one of claims 1 to 11, wherein the immunogenic composition is liquid or solid, and/or wherein the immunogenic composition is viscous, and/or wherein the immunogenic composition has a viscosity of at least 50 mPa·s or at least 50 cP. 13. The immunogenic composition according to any one of claims 1 to 12 for use as a medicament, in particular as a vaccine. 14. The immunogenic composition according to any one of claims 1 to 12 for use in a method for inducing an immune response in a subject, wherein optionally said immune response is an immune response against a virus, and/or wherein said immune response is preferably against a virus, which virus is of the species having a genome encoding - said virus antigen, or -0040-ff Boehringer Ingelheim Vetmedica GmbH - the amino acid sequence of the antigenic determinant of said virus antigen. 15. The immunogenic composition according to any one of claims 1 to 12 for use in a method for reducing one or more clinical signs, viral load and/or viremia caused by a virus infection in a subject, and wherein said virus infection is preferably an infection with a virus, which virus is of the species having a genome encoding - said virus antigen, or - the amino acid sequence of the antigenic determinant of said virus antigen. 16. The immunogenic composition according to claim 4 for use in a method for inducing an immune response against PCV2 in a subject, and/or for use in a method for reducing one or more clinical signs, viral load and/or viremia caused by a PCV2 infection in a subject. 17. A method of inducing an immune response in a subject, wherein the method comprises administering to the subject an effective amount of the immunogenic composition according to any one of claims 1 to 12, wherein said immune response against a virus is preferably an immune response against a virus, which virus is of the species having a genome encoding - said virus antigen, or - the amino acid sequence of the antigenic determinant of said virus antigen. 18. A method of inducing an immune response against PCV2 in a subject, wherein the method comprises administering to the subject an effective amount of the immunogenic composition according to claim 4. 19. A method for reducing one or more clinical signs, viral load and/or viremia caused by a virus infection in a subject, wherein the method comprises administering to the subject an effective amount of the immunogenic composition according to any one of claims 1 to 12, and wherein said virus infection is preferably an infection with a virus, which virus is of the species having a genome encoding -0040-ff Boehringer Ingelheim Vetmedica GmbH - said virus antigen, or - the amino acid sequence of the antigenic determinant of said virus antigen. 20. A method for reducing one or more clinical signs, viral load and/or viremia caused by a PCV2 infection in a subject, wherein the method comprises administering to the subject an effective amount of the immunogenic composition according to claim 4. 21. A method for inducing an immune response in a subject, wherein the method comprises the steps of: - placing the immunogenic composition of any one of claims 1 to 12 into the housing environment of the subject, and - allowing the subject to self-administer the immunogenic composition, and wherein said immune response against a virus is preferably an immune response against a virus, which virus is of the species having a genome encoding - said virus antigen, or - the amino acid sequence of the antigenic determinant of said virus antigen. 22. The method of claim 21, wherein said immune response is an immune response against PCV2 in a subject, and wherein said immunogenic composition is the immunogenic composition according to claim 4. 23. The immunogenic composition for use according to claim 14 or 16, or the method according to any one of claims 17, 18, 21, and 22, wherein said immune response is a protective immune response. 24. A method for reducing one or more clinical signs, viral load and/or viremia caused by a virus infection in a subject, wherein the method comprising the steps of: - placing the immunogenic composition of any one of claims 1 to 12 into the housing environment of the subject, and - allowing the subject to self-administer the immunogenic composition, -0040-ff Boehringer Ingelheim Vetmedica GmbH and wherein said virus infection is preferably an infection with a virus, which virus is of the species having a genome encoding - said virus antigen, or - the amino acid sequence of the antigenic determinant of said virus antigen. 25. A method for reducing one or more clinical signs, viral load and/or viremia caused by a PCV2 infection in a subject, wherein the method comprises the steps of: - placing the immunogenic composition of claim 4 into the housing environment of the subject, and - allowing the subject to self-administer the immunogenic composition. 26. The method of any one of claims 21 to 25, wherein the immunogenic composition is put on the floor of the housing environment of the subject, and/or wherein the immunogenic composition is put into a bowl or vessel being located in the housing environment of the subject. 27. The immunogenic composition for use in a method according to any one of claims 14 to 16, and 23, or the method according to any one of claims 17 to 26, wherein the subject is - an animal, and/or - a pig, and/or - a piglet or a sow. 28. Dosing unit comprising the immunogenic composition according to any one of claims 1 to 12, wherein the dosing unit is optionally a handpump backpack sprayer. 29. Use of the dosing unit according to claim 28 for placing said immunogenic composition into the housing environment of a subject. 30. Method according to any one of claims 21 to 27, wherein the dosing unit according to claim 28 is used for placing the immunogenic composition into the housing environment of the subject.
EP24725954.2A 2023-05-03 2024-05-02 Immunogenic composition useful for self-administration by pigs Pending EP4704977A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202363499937P 2023-05-03 2023-05-03
PCT/IB2024/054269 WO2024228148A1 (en) 2023-05-03 2024-05-02 Immunogenic composition useful for self-administration by pigs

Publications (1)

Publication Number Publication Date
EP4704977A1 true EP4704977A1 (en) 2026-03-11

Family

ID=91082061

Family Applications (1)

Application Number Title Priority Date Filing Date
EP24725954.2A Pending EP4704977A1 (en) 2023-05-03 2024-05-02 Immunogenic composition useful for self-administration by pigs

Country Status (10)

Country Link
EP (1) EP4704977A1 (en)
KR (1) KR20260005383A (en)
CN (1) CN121013728A (en)
AR (1) AR132581A1 (en)
AU (1) AU2024266173A1 (en)
CL (1) CL2025003188A1 (en)
CO (1) CO2025015952A2 (en)
MX (1) MX2025012908A (en)
TW (1) TW202509055A (en)
WO (1) WO2024228148A1 (en)

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
UA78180C2 (en) 1997-10-03 2007-03-15 Меріаль Porcine circovirus, vaccines and diagnostic reagents
FR2772047B1 (en) 1997-12-05 2004-04-09 Ct Nat D Etudes Veterinaires E GENOMIC SEQUENCE AND POLYPEPTIDES OF CIRCOVIRUS ASSOCIATED WITH PIGLET LOSS DISEASE (MAP), APPLICATIONS TO DIAGNOSIS AND TO PREVENTION AND / OR TREATMENT OF INFECTION
JP3795751B2 (en) 1997-12-11 2006-07-12 ユニバーシティ オブ サスカッチェワン Postweaning multiple systemic wasting syndrome virus from pigs
US7276353B2 (en) 2001-12-12 2007-10-02 Virginia Tech Intellectual Properties, Inc. Chimeric infectious DNA clones, chimeric porcine circoviruses and uses thereof
US7833707B2 (en) 2004-12-30 2010-11-16 Boehringer Ingelheim Vetmedica, Inc. Methods of overexpression and recovery of porcine circovirus type 2 ORF2
KR101347503B1 (en) 2005-09-09 2014-01-02 인터벳 인터내셔널 비.브이. Pcv-2 vaccine
KR101030792B1 (en) * 2010-09-16 2011-04-27 주식회사 코미팜 Vector for surface expression of porcine circovirus 2 (PCB2) gene and transformed Salmonella vaccine strain
US9505808B2 (en) 2013-10-02 2016-11-29 Boehringer Ingelheim Vetmedica, Inc. PCV2 ORF2 protein variant and virus like particles composed thereof
CN106399138B (en) * 2016-09-07 2019-11-12 复旦大学 Porcine circovirus type II oral virus-like particle vaccine and its preparation method and application
US10485866B2 (en) 2016-11-03 2019-11-26 Boehringer Ingelheim Vetmedica Gmbh Vaccine against porcine parvovirus
PT3534939T (en) 2016-11-03 2023-04-20 Boehringer Ingelheim Vetmedica Gmbh Vaccine against porcine parvovirus and porcine reproductive and respiratory syndrome virus and methods of production thereof
CN119488586A (en) 2018-03-26 2025-02-21 勃林格殷格翰动物保健美国有限公司 Methods for preparing immunogenic compositions
KR20230164694A (en) * 2021-04-09 2023-12-04 카이코 가부시키가이샤 oral vaccine composition

Also Published As

Publication number Publication date
AR132581A1 (en) 2025-07-16
AU2024266173A1 (en) 2025-12-11
CO2025015952A2 (en) 2025-11-28
KR20260005383A (en) 2026-01-09
WO2024228148A1 (en) 2024-11-07
CL2025003188A1 (en) 2026-01-30
TW202509055A (en) 2025-03-01
MX2025012908A (en) 2025-12-01
CN121013728A (en) 2025-11-25

Similar Documents

Publication Publication Date Title
ES2719483T3 (en) CVP / Mycoplasma hyopneumoniae / SRRP combination vaccine
Chien et al. Oral immunization with cell-free self-assembly virus-like particles against orange-spotted grouper nervous necrosis virus in grouper larvae, Epinephelus coioides
ES2434117T3 (en) Prevention and treatment of subclinical pcvd
JP6876127B2 (en) Vaccine against porcine parvovirus
US11896659B2 (en) Porcine Circovirus Type 3 (PCV3) vaccines, and production and uses thereof
KR102802419B1 (en) Vaccine formulation and method for preventing iridoviral disease in fish
AU2016222962A1 (en) Bivalent swine influenza virus vaccine
Van Oirschot Vaccinology: Present and future of veterinary viral vaccinology: A review
KR20170094186A (en) Process for ready-to-use pcv2/m.hyo combination vaccine
WO2024228149A2 (en) Method for inducing an immune response
JP7303306B2 (en) Foot-and-mouth disease virus-like particle antigen, vaccine composition thereof, preparation method and application
EP4704977A1 (en) Immunogenic composition useful for self-administration by pigs
US20250360189A1 (en) Immunogenic gel compositions
WO2021217982A1 (en) Foot-and-mouth disease virus-like particle antigen and vaccine composition thereof, and preparation method and application of vaccine composition
BR112020017520A2 (en) METHOD FOR REDUCING SCATOL AND / OR INDOL IN ANIMALS
CN108883169A (en) For the intradermal application vaccine of PCV2 and PRRS virus infection
JP2019509302A (en) Combination vaccine against PCV2 and PRRS virus infections containing albumin

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20251203

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR