EP4694920A1 - Rna for preventing or treating tuberculosis - Google Patents

Rna for preventing or treating tuberculosis

Info

Publication number
EP4694920A1
EP4694920A1 EP24725309.9A EP24725309A EP4694920A1 EP 4694920 A1 EP4694920 A1 EP 4694920A1 EP 24725309 A EP24725309 A EP 24725309A EP 4694920 A1 EP4694920 A1 EP 4694920A1
Authority
EP
European Patent Office
Prior art keywords
antigen
amino acid
acid sequence
linker
full
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP24725309.9A
Other languages
German (de)
French (fr)
Inventor
Louis Simon ATES
Julia UEBELE
Neha Agrawal
Charles Lefco DULBERGER
Huitian DIAO
Asaf PORAN
Dinesh Manandhar
Daniel Abram Rothenberg
Thomas SCRIBA
Munyaradzi MUSVOSVI
Gerlinde OBERMOSER
Mark Davis
Huang Huang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Biontech SE
Leland Stanford Junior University
University of Cape Town
Original Assignee
Biontech SE
Leland Stanford Junior University
University of Cape Town
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Biontech SE, Leland Stanford Junior University, University of Cape Town filed Critical Biontech SE
Publication of EP4694920A1 publication Critical patent/EP4694920A1/en
Pending legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/04Mycobacterium, e.g. Mycobacterium tuberculosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • A61P31/06Antibacterial agents for tuberculosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55555Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/572Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/034Fusion polypeptide containing a localisation/targetting motif containing a motif for targeting to the periplasmic space of Gram negative bacteria as a soluble protein, i.e. signal sequence should be cleaved

Definitions

  • the disclosure provides agents and methods for preventing or treating tuberculosis using RNA.
  • the RNA encoding chimeric antigens of Mycobacterium tuberculosis, immunogenic variants or fragments thereof is formulated and administered in a way that the antigens, variants or fragments are produced by cells of a subject, in particular after intramuscular or intravenous administration of the RNA.
  • RNA to deliver foreign genetic information into target cells offers an attractive alternative to DNA.
  • the advantages of RNA include transient expression and non-transforming character. RNA does not require nucleus infiltration for expression and moreover cannot integrate into the host genome, thereby eliminating the risk of oncogenesis.
  • the COVID-19 pandemic has showcased the utility and advantages of RNA technology for vaccination, as out of all COVID- 19 vaccines under development, the first two to have received emergency use authorization by the FDA were RNA-based.
  • the biotechnology response to the COVID- 19 pandemic has highlighted the speed and flexibility of mRNA vaccines, and reveals mRNA therapeutics to be a powerful tool to address epidemic outbreaks caused by newly emerging viruses.
  • the relative simplicity of the development process and flexibility of the manufacturing platform can markedly accelerate clinical development. As such, mRNA-based vaccine technology has attracted a lot of attention during the COVID-19 pandemic.
  • the first authorized vaccine was developed by BioNTech in collaboration with Pfizer.
  • the RNA of this vaccine BNT162b2
  • the RNA incorporates 1-methyl-pseudouridine, which dampens innate immune sensing and increases mRNA translation in //Vo and is formulated in lipid nanoparticles (LNP).
  • BNT162b2 is administered to adults intramuscularly (IM) in two 30 pg doses given 21 days apart.
  • Tuberculosis is caused by the bacterial pathogen Mycobacterium tuberculosis (Mtb ⁇ ) and, in rarer cases, by other pathogens from the Mycobacteriaceae family and is the leading cause of death from a single infectious agent.
  • Mtb is a gram-positive, rod-shaped bacterium from the Mycobacteriaceae family.
  • the more than 4,000 genes encoded within an approximately 4 million base pair genome render Mtb a complex pathogenic organism. This is further emphasized by the atypical composition of its cell wall, which has a high lipid content.
  • BCG Mycobacterium bovis, bacillus Calmette-Guerin
  • the pipeline of clinical trials for TB vaccine candidates comprises use of live, live-attenuated, and inactivated mycobacteria, and of Mtb antigens as recombinant protein (subunit vaccine) (TuBerculosis Vaccine Initiative (TBVI). Available from: https://www.tbvi.eu/what-we-do/pipeline-of-vaccines/).
  • TBVI TuBerculosis Vaccine Initiative
  • the drawbacks from these vaccine platforms are i. their low safety, due to replication-competent live vaccines still being infectious, II. low immunogenicity of inactivated vaccines, and ill. the need for addition of adjuvants to subunit vaccines to enhance immunogenicity. To date, most vaccine candidates have failed to demonstrate better protection from TB or from the development of TB compared to placebo in clinical trials.
  • compositions which are useful as TB vaccines comprise RNA for delivering Mycobacterium tuberculosis (Mtb) antigens to a subject.
  • Mtb Mycobacterium tuberculosis
  • RNA design specifically aimed at optimizing T cell responses in RNA vaccines, which is utilized here to specifically design potent T cell inducing RNA vaccines to prevent or treat tuberculosis.
  • Antigens for these vaccines have been selected to be included either as full-length antigens or as antigen fragments. These full-length antigens or fragments thereof are combined into chimeric proteins by stringing them together interspersed by polypeptide linkers that also function to minimize the risk of creating neoepitopes.
  • novel RNA vaccines encoding chimeric proteins comprising three or more antigens, as full-length antigens and antigen fragments, elicit a robust and specific T cell response in subjects infected with or at risk of contracting tuberculosis.
  • Fifteen antigens were selected as primary targets for the novel RNA vaccines, including Wbbll, PPE18, PE13, EsxA, EsxB, EsxG, EsxH, Esxl, EsxJ, EsxK, EsxL, EsxM, EsxN, EsxV and EsxW.
  • the Esx proteins EsxN, Esxl, EsxV and EsxL are highly homologous members of the same protein family and are known to be highly immunogenic. Each of these proteins is transcribed and produced with a direct secretion partner - another Esx protein - and these two secretion partners together form a heterodimer.
  • EsxJ partner of Esxl
  • EsxK partner of EsxL
  • EsxM partner of EsxN
  • EsxW partner of EsxV
  • This second group of proteins (together referred to as the QQILSS proteins based on the residues in their C-terminal sequences, also contains highly immunogenic proteins playing a role in virulence or dissemination. Based on sequence analysis, we identified that if a full-length Esxl protein is combined with a fragment of EsxN (or a full-length EsxN), these antigens would also induce immune responses against the other antigens EsxV and EsxL.
  • the antigens forming the core functionality of the novel RNA vaccines can be combined with other known Mtb antigens.
  • Mtb displays differential gene expression patterns during its active and dormant (non-dividing) phases (Andersen P, et al. Cold Spring Harb Perspect Med, 2014; 4(6):a018523).
  • Mahersen P et al. Cold Spring Harb Perspect Med, 2014; 4(6):a018523
  • the TB vaccines developed here comprising the RNA components described above are designed to induce protective immune responses against antigens specific for different stages of Mtb infection.
  • Combinations with additional known Mtb antigens can be used to elicit a stronger immune response towards individual stages of Mtb infection or to increase the number of stages of Mtb infection, against which the vaccine elicits an immune response.
  • antigen presentation and trafficking can be optimized by adding to the chimeric protein an N-terminal signal peptide designed to traffic the recombinant protein towards the exterior of transfected cells.
  • the C-terminus of the chimeric protein can be modified by a trafficking signal and/or transmembrane domain designed to enhance endocytosis of the recombinant protein, thereby leading to optimal MHC-II presentation and ensuing CD4 + T cell responses.
  • RNA vaccines described herein comprising non-modified uridine containing mRNA (uRNA) or nucleoside modified mRNA (modRNA), expressing Mtb antigens, immunogenic variants or fragments thereof, are useful for preventing or treating tuberculosis.
  • uRNA uridine containing mRNA
  • modRNA nucleoside modified mRNA
  • the RNA encoding Mtb antigens, immunogenic variants or fragments thereof is formulated and administered in a way that the antigens, variants or fragments can be produced and preferably secreted by patient cells to prevent or combat tuberculosis.
  • this TB vaccine candidate does not carry the risks associated with infection and may therefore be given to people who cannot be administered live organism (such as pregnant women and immunocompromised persons).
  • the disclosure provides an RNA molecule encoding a chimeric protein comprising T cell epitopes of three or more different Mycobacterium tuberculosis antigens or immunogenic variants thereof, wherein the chimeric protein comprises one or more antigen fragments, wherein at least one Mycobacterium tuberculosis antigen or immunogenic variant thereof is represented by one or more antigen fragments and the remaining Mycobacterium tuberculosis antigens or immunogenic variants thereof are represented by one or more antigen fragments and/or one or more full-length antigens, wherein each antigen fragment or full-length antigen comprises one or more T cell epitopes, and wherein each antigen fragment or full-length antigen is separated from other antigen fragments or full-length antigens in the chimeric protein by a polypeptide linker.
  • the chimeric protein comprises T cell epitopes of four or more different Mycobacterium tuberculosis antigens. In some embodiments, the chimeric protein comprises T cell epitopes of five or more different Mycobacterium tuberculosis antigens. In some embodiments, the chimeric protein comprises T cell epitopes of six or more different Mycobacterium tuberculosis antigens. In some embodiments, the chimeric protein comprises T cell epitopes of seven or more different Mycobacterium tuberculosis antigens.
  • the Mycobacterium tuberculosis antigens are selected from the group of Wbbll, PPE18, PE13, EsxA, EsxB, EsxG, EsxH, Esxl, EsxJ, EsxK, EsxL, EsxM, EsxN, EsxV and EsxW.
  • the Wbbll antigen comprises the amino acid sequence of SEQ ID NO: 1 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 1;
  • the PPE18 antigen comprises the amino acid sequence of SEQ ID NO: 2 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 2;
  • the PE13 antigen comprises the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO: 4 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO: 4;
  • the EsxA antigen comprises the amino acid sequence of SEQ ID NO:
  • the Mycobacterium tuberculosis antigens comprise Wbbll, PPE18 and PE13.
  • the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a first, a second and a third antigen fragment of PPE18; and c) a full-length antigen of WbbLl.
  • the first antigen fragment of PE13 comprises the amino acid sequence of positions 1 to 27 of SEQ ID NO: 3 or an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 1 to 27 of SEQ ID NO: 3;
  • the second antigen fragment of PE13 comprises the amino acid sequence of positions 39 to 99 of SEQ ID NO: 3 or an amino acid sequence having at least 98%, 96%, 94%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 39 to 99 of SEQ ID NO: 3;
  • the first antigen fragment of PPE18 comprises the amino acid sequence of positions 1 to 155 of SEQ ID NO: 2 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 1 to 155 of SEQ ID NO: 2;
  • the second antigen fragment of PPE18 comprises the amino acid sequence of positions 186 to 296 of
  • the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: first antigen fragment of PE13 - linker - third antigen fragment of PPE18 - linker - full-length antigen of Wbbll - linker - second antigen fragment of PPE18 - linker - second antigen fragment of PE13 - linker - first antigen fragment of PPE18.
  • the Mycobacterium tuberculosis antigens comprise EsxG, EsxH, Esxl, EsxJ, EsxN, and EsxW. In some embodiments, the Mycobacterium tuberculosis antigens additionally comprise EsxB.
  • the chimeric protein comprises: a) a full-length antigen of EsxG; b) a full-length antigen of EsxH; c) a full-length antigen of Esxl; d) an antigen fragment of EsxJ; e) a full-length antigen of EsxN; and f) a full-length antigen of EsxW.
  • the chimeric protein additionally comprises: a) an antigen fragment of EsxB b) a full-length antigen of EsxG; c) a full-length antigen of EsxH; d) a full-length antigen of Esxl; e) an antigen fragment of EsxJ; f) a full-length antigen of EsxN; and g) a full-length antigen of EsxW.
  • the antigen fragment of EsxB comprises the amino acid sequence of positions 1 to 87 of SEQ ID NO: 6 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 1 to 87 of SEQ ID NO: 6; and/or b) the antigen fragment of EsxJ comprises the amino acid sequence of positions 1 to 14 of SEQ ID NO: 10 or an amino acid sequence having at least 93%, 86% or 79% identity to the amino acid sequence of positions 1 to 14 of SEQ ID NO: 10.
  • the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: a) full-length antigen of EsxG - linker - full-length antigen of EsxH - linker - full-length antigen of Esxl
  • the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: a) antigen fragment of EsxB - linker - full-length antigen of EsxG - linker - full-length antigen of EsxH
  • the Mycobacterium tuberculosis antigens comprise PE13 and two or more antigens selected from PPE18, EsxW, EsxJ. EsxG, Esxl, EsxN, EsxH and EsxA.
  • the Mycobacterium tuberculosis antigens comprise a) PE13, PPE18, Esxl, EsxJ, EsxN and EsxW; b) PE13, PPE18, EsxG, EsxJ, and EsxW; c) PE13, PPE18, EsxG, Esxl, and EsxN; d) PE13, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW; e) PE13, EsxA, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW; f) PE13, Esxl, EsxJ, EsxN and EsxW; or g) PE13, PPE18, Esxl, EsxJ, EsxN and EsxW.
  • the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a first, a second and a third antigen fragment of PPE18; c) a full-length antigen of Esxl; d) an antigen fragment of EsxJ; e) an antigen fragment of EsxN; and f) a full-length antigen of EsxW.
  • the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a first, a second and a third antigen fragment of PPE18; c) a full-length antigen of EsxG; d) an antigen fragment of EsxJ; and e) a full-length antigen of EsxW.
  • the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a first, a second and a third antigen fragment of PPE18; c) a full-length antigen of EsxG; d) an antigen fragment of Esxl; and e) a full-length antigen of EsxN.
  • the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a full-length antigen of EsxG; c) a full-length antigen of EsxH; d) a full-length antigen of Esxl; e) an antigen fragment of EsxJ; f) an antigen fragment of EsxN; and g) a full-length antigen of EsxW.
  • the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a first and a second antigen fragment of EsxA; c) a full-length antigen of EsxG; d) a full-length antigen of EsxH: e) a full-length antigen of Esxl; f) an antigen fragment of EsxJ; g) an antigen fragment of EsxN; and h) a full-length antigen of EsxW.
  • the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a full-length antigen of Esxl; c) an antigen fragment of EsxJ; d) an antigen fragment of EsxN; and e) a full-length antigen of EsxW.
  • the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a second and a third antigen fragment of PPE18; c) a full-length antigen of Esxl; d) an antigen fragment of EsxJ; e) an antigen fragment of EsxN; and f) a full-length antigen of EsxW.
  • the first antigen fragment of PE13 comprises the amino acid sequence of positions 1 to 27 of SEQ ID NO: 3 or an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 1 to 27 of SEQ ID NO: 3; or the first antigen fragment of PE13 comprises the amino acid sequence of positions 1 to 29 of SEQ ID NO: 4 or an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 1 to 29 of SEQ ID NO: 4; b) the second antigen fragment of PE13 comprises the amino acid sequence of positions 39 to 97 of SEQ ID NO: 3 or an amino acid sequence having at least 98%, 96%, 94%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 39 to 97 of SEQ ID NO: 3; or the second antigen fragment of PE13 comprises the amino acid sequence of positions 41 to 99 of SEQ ID NO: 4 or an amino acid sequence having at least 98%,
  • the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: first antigen fragment of PE13 - linker - third antigen fragment of PPE18 - linker - full-length antigen of EsxW
  • the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: first antigen fragment of PE13 - linker - third antigen fragment of PPE18 - linker - full-length antigen of EsxW
  • the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: a) second antigen fragment of PE13 - linker - third antigen fragment of PPE18 - linker - antigen fragment of EsxN - linker - full-length antigen of EsxG - linker - first antigen fragment of PE13 - linker - second antigen fragment of PPE18 - linker - full-length antigen of Esxl - linker - first antigen fragment of PPE18; or b) second antigen fragment of PE13 - linker - first antigen fragment of PPE18 - linker - full-length antigen of Esxl - linker - second antigen fragment of PPE18 - linker - first antigen fragment of PE13 - linker - full-length antigen of EsxG - linker - antigen fragment of EsxN - linker - third antigen fragment of PPE18.
  • the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: a) first antigen fragment of PE13 - linker - full-length antigen of EsxW - linker - full-length antigen of EsxG
  • the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: a) first antigen fragment of PE13 - linker - full-length antigen of EsxW - linker - full-length antigen of EsxG
  • one or more of the polypeptide linkers comprises one or more glycine and/or one or more serine amino acid. In some embodiments, one or more of the polypeptide linkers is at least 1, at least 5 or at least 10 amino acids in length. In some embodiments, one or more of the polypeptide linkers has the amino acid sequence of SEQ ID NO: 56.
  • the chimeric protein comprises a non-native signal peptide at its N-terminus.
  • the non-native signal peptide is a human, bacterial or viral signal peptide.
  • the non-native signal peptide comprises a secretory signal.
  • the non-native signal peptide is functional in mammalian cells.
  • the non-native signal peptide comprises an amino acid sequence selected from the group of SEQ ID NOs: 17 to 37 or 65, an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to SEQ ID NOs: 17 to 37 or 65, an amino acid sequence encoded by a nucleotide sequence selected from the group of SEQ ID NOs: 38 to 51, or an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to amino acid sequences encoded by a nucleotide sequence selected from the group of SEQ ID NOs: 38 to 51.
  • the non-native signal peptide is a viral signal peptide.
  • the non-native signal peptide is a HSV-1 glycoprotein D signal peptide.
  • the chimeric protein comprises a non-native transmembrane domain at its C-terminus.
  • the non-native transmembrane domain is a human, bacterial or viral transmembrane domain.
  • the non-native transmembrane domain comprises a trafficking domain.
  • non- native trafficking domain is an MHC class I trafficking domain.
  • the MHC class I trafficking domain comprises the amino acid sequence of SEQ ID NO: 52 or an amino acid sequence having at least 98%, 96%, 90%, or 80% identity to the amino acid sequence of SEQ ID NO: 52.
  • the non-native transmembrane domain is a viral transmembrane domain.
  • the non-native transmembrane domain is derived from HSV.
  • the RNA molecule comprises a 5' cap.
  • the 5' cap comprises a capl structure.
  • the 5'-cap comprises m 2 73 -OGppp(mi 2 ' °)ApG.
  • the RNA molecule comprises a 5'-UTR.
  • the 5'-UTR comprises a modified human alpha-globin 5'-UTR.
  • the 5'-UTR comprises the nucleotide sequence of SEQ ID NO: 53, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 53.
  • the RNA comprises a 3'-UTR.
  • the 3'-UTR comprises a first sequence from the amino terminal enhancer of split (AES) messenger RNA and a second sequence from the mitochondrial encoded 12S ribosomal RNA.
  • the 3'-UTR comprises the nucleotide sequence of SEQ ID NO: 54, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 54.
  • the RNA molecule comprises a polyA sequence.
  • the polyA sequence is an interrupted sequence of A nucleotides.
  • the polyA sequence comprises 30 adenine nucleotides followed by 70 adenine nucleotides, wherein the 30 adenine nucleotides and 70 adenine nucleotides are separated by a nucleotide linker sequence of 10 nucleotides.
  • the polyA sequence comprises the nucleotide sequence of SEQ ID NO: 55, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 55.
  • the RNA molecule comprises a 5'-cap, a 5'-UTR, a 3'-UTR and a polyA sequence.
  • the RNA molecule comprises modified nucleotides, nucleosides or nucleobases. In some embodiments, the RNA molecule comprises modified uridines. In some embodiments, the RNA molecule comprises modified uridines in place of all uridines. In some embodiments, the modified uridines are Nl-methyl-pseudouridine.
  • the coding sequence of the RNA molecule is codon-optimized and/or is characterized in that its G/C content is increased compared to the parental sequence.
  • the disclosure provides a chimeric protein encoded by the RNA molecule described herein.
  • the disclosure provides a DNA molecule encoding the RNA molecule described herein.
  • the disclosure provides a pharmaceutical composition comprising one or more RNA molecules described herein.
  • the one or more RNA molecules are formulated in a lipid formulation, such as in lipid nanoparticles or liposomes.
  • the lipid formulation comprises each of: a) a cationically ionizable lipid; b) a steroid; c) a neutral lipid; and d) a polymer-conjugated lipid.
  • the cationically ionizable lipid is present in a concentration ranging from about 40 to about 60 mol percent of the total lipids.
  • the steroid is present in a concentration ranging from about 30 to about 50 mol percent of the total lipids.
  • the neutral lipid is present in a concentration ranging from about 5 to about 15 mol percent of the total lipids.
  • the polymer-conjugated lipid is present in a concentration ranging from about 1 to about 10 mol percent of the total lipids.
  • the cationically ionizable lipid is within a range of about 40 to about 60 mole percent, the steroid is within a range of about 30 to about 50 mole percent, the neutral lipid is within a range of about 5 to about 15 mole percent, and the polymer- conjugated lipid is within a range of about 1 to about 10 mole percent.
  • the cationically ionizable lipid comprises ((4-hydroxybutyl)azanediyl)bis(hexane-6,l-diyl)bis(2- hexyldecanoate).
  • the steroid comprises cholesterol.
  • the neutral lipid comprises a phospholipid.
  • the phospholipid comprises distearoylphosphatidylcholine (DSPC).
  • the polymer-conjugated lipid comprises a polyethylene glycol (PEG)-lipid.
  • the PEG-lipid comprises 2-[(polyethylene glycol)-2000]-/V z /V-ditetradecylacetamide.
  • the lipid formulation comprises:
  • ((4-hydroxybutyl)azanediyl)bis(hexane-6,l-diyl)bis(2-hexyldecanoate) is within a range of about 40 to about 60 mole percent
  • cholesterol is within a range of about 30 to about 50 mole percent
  • distearoylphosphatidylcholine (DSPC) is within a range of about 5 to about 15 mole percent
  • 2-[(polyethylene glycol)-2000]-N,N-ditetradecylacetamide is within a range of about 1 to about 10 mole percent.
  • the pharmaceutical composition further comprises one or more pharmaceutically acceptable carriers, diluents and/or excipients.
  • the one or more RNA molecules are in a liquid formulation. In some embodiments, the one or more RNA molecules are in a frozen formulation. In some embodiments, the one or more RNA molecules are in a lyophilized formulation. In some embodiments, the one or more RNA molecules are formulated for injection. In some embodiments, the one or more RNA molecules are formulated for intramuscular administration. In some embodiments, the pharmaceutical composition is formulated for administration in human.
  • the disclosure provides a kit comprising one or more pharmaceutical compositions described herein.
  • two or more pharmaceutical compositions comprising the same or different RNA molecules described herein are in separate vials.
  • the kit further comprises instructions for use of the one or more pharmaceutical composition for treating or preventing tuberculosis.
  • the disclosure provides an RNA molecule, chimeric protein, DNA molecule, pharmaceutical composition or kit described herein for use as a medicament.
  • the use comprises a therapeutic or prophylactic treatment of a disease or disorder in a subject.
  • the use comprises the use as a vaccine against a disease or disorder in a subject.
  • the subject is a human infected with the disease or disorder or in danger of contracting the disease or disorder.
  • the disclosure provides an RNA molecule, chimeric protein, DNA molecule, pharmaceutical composition or kit described herein for use in treating or preventing tuberculosis in a subject.
  • the subject is a human suffering from tuberculosis or in danger of contracting tuberculosis.
  • the use is as a vaccine for preventing tuberculosis.
  • the disclosure provides a use of the RNA molecule, the chimeric, the DNA molecule, the pharmaceutical composition or the kit described herein for the manufacture of a medicament for preventing or treating tuberculosis.
  • the disclosure provides a method of vaccinating a subject comprising administering the RNA molecule, the chimeric protein, the DNA molecule, the pharmaceutical composition or the kit described herein to the subject.
  • the vaccination is for preventing tuberculosis.
  • administration is by intramuscular administration.
  • the method comprises administering to the subject at least one dose of the RNA, chimeric protein or pharmaceutical composition.
  • the method comprises administering to the subject at least two doses of the RNA, chimeric protein or pharmaceutical composition.
  • an amount of the RNA of at least 10 pg per dose is administered.
  • the subject is a human.
  • the tuberculosis is caused by an infection with a Mycobacterium.
  • the Mycobacterium is selected from the group of Mycobacterium tuberculosis, Mycobacterium bovis, Mycobacterium caprae, Mycobacterium orygis, Mycobacterium africanum, Mycobacterium microti, Mycobacterium canetti and Mycobacterium pinnipedii.
  • the Mycobacterium is Mycobacterium tuberculosis.
  • Figures 1 to 11 Bioinformatic data guiding the selection of antigens and design of chimeric proteins
  • Panel B Predicted class I epitopes for a wide array of human HLA alleles. A cumulative score is listed with the y-axis representing how many peptides are predicted to bind the different HLA-alleles for each residue.
  • Panel C The predicted start sites of the epitopes predicted in B.
  • Panel D The predicted stop sites of the epitopes predicted in B.
  • Panels E-G The same analyses as described in B-D, but for HLA class II alleles.
  • Figures 12-18 Domain structure of chimeric proteins
  • panel A shows the domain structure of an exemplary chimeric protein disclosed herein.
  • the chimeric protein comprises sequences from several antigens either in the form of full-length antigens or antigen fragments - separated from each other by polypeptide linkers.
  • the exemplary chimeric protein comprises a signal peptide (sec) at its N-terminus, whereas a transmembrane domain is located at its C-terminus.
  • the lower half of panel A shows the length of the protein sequences by number of amino acids.
  • panel B the figures respectively list the sequences and positions of individual domains within the domain structure of the exemplary chimeric protein.
  • Figures 19 and 20 Expression of chimeric proteins as analyzed by mass-spectrometry
  • panel A shows the position of tryptic digest fragments analyzed by mass- spectrometry on the sequence of the chimeric protein and panel B) shows the detection of tryptic digest fragments by mass-spectrometry.
  • panel A shows the position of detected epitopes on the sequence of the chimeric proteins and panel B) shows the sequence and human HLA subtype presenting the epitopes identified in panel A.
  • panel A shows in the left column the in vivo T-cell responses in mice immunized with RNA encoding the chimeric proteins as measured by induction of interferon y (IFN y) in the total T-cell population - separated by domain.
  • IFN y interferon y
  • Panels B) and C) have the same structure, showing respective induction of interleukin-2 (IL-2) and tumor necrosis factor o (TNFo).
  • Panel D) shows the responses in NaCI mock-immunized mice as a negative control.
  • Panel A shows the in vivo T-cell responses in mice immunized with RNA encoding the chimeric protein string 1 as measured by induction of interferon y (IFN y) in the total T-cell population - separated by domain.
  • IFN y interferon y
  • Panel B IFN y induction is shown for CD4 + and CD8 + cells of string 1, respectively.
  • Panels C and D and Panels E and F have the same structure but show the results for string 2 and string 3, respectively. Results are displayed as bars of the mean value ⁇ standard deviation in combination with single values of individual mice.
  • Figures show IFNy secretion as spot forming units in peptide-restimulated full splenoyctes (Panel A, C, E), and CD4 + (white bars) or CD8 + T cells (grey bars; Panel B, D, F).
  • Figure 27 In vivo T-cell responses to chimeric proteins with different TMDs in C57BI6 mice
  • Panel A shows in the left column the in vivo T-cell responses in mice immunized with RNA encoding the chimeric proteins as measured by induction of interferon y (IFN y) in the total T-cell population - separated by domain.
  • IFN y interferon y
  • Panels B) and C) have the same structure, showing respective induction of interleukin-2 (IL-2) and tumor necrosis factor a (TNFa).
  • IL-2 interleukin-2
  • TNFa tumor necrosis factor a
  • Figure 28 In vivo solenocyte and T cell response to BCG
  • Panel A shows the in vivo T-cell responses in mice immunized with RNA encoding the chimeric proteins as measured by induction of interferon y (IFN y) for CD4+ cells (white bars) and CD8+ cells (grey bars) - separated by domain.
  • Panels B) and C) have the same structure, showing respective induction of interleukin-2 (IL-2) and tumor necrosis factor o (TNFo).
  • Panel D shows IFN y, IL-2 and TNFo induction in total splenocytes.
  • Figure 29-39 Visualization of IEDB and lioandomics-derived epitope hits of antigens and antigen fragments
  • Figures 29-39 show for the antigens or antigen fragments four subplots (labeled A-D) in the top-to-bottom order:
  • C) "Ligandomics HLA alleles” shows a heatmap that highlights the number of times that the corresponding HLA class I allele was identified as presenting any ligandomics epitope
  • Figures 40-45 Domain structure of chimeric proteins
  • panel A shows the domain structure of an exemplary chimeric protein disclosed herein.
  • the chimeric protein comprises sequences from several antigens either in the form of full-length antigens or antigen fragments - separated from each other by polypeptide linkers.
  • the exemplary chimeric protein comprises a signal peptide (sec) at its N-terminus, whereas a transmembrane domain (MITD) is located at its C-terminus.
  • panel B the figures respectively list the sequences and positions of individual domains within the domain structure of the exemplary chimeric protein.
  • sequence molecules which may have different levels of sequence identity to a specified sequence, e.g., (i) sequence molecule A comprising the sequence of SEQ ID NO: a, or a sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the sequence of SEQ ID NO: a, (ii) sequence molecule B comprising the sequence of SEQ ID NO: b, or a sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the sequence of SEQ ID NO: b etc. It should be understood that the sequence molecules may be combined in any of the identity levels specified.
  • sequence molecules are combined such that the identity levels are identical; e.g., (i) sequence molecule A comprising the sequence of SEQ ID NO: a, (ii) sequence molecule B comprising the sequence of SEQ ID NO: b etc., or (i) sequence molecule A comprising a sequence having at least 90% identity to the sequence of SEQ ID NO: a, (ii) sequence molecule B comprising a sequence having at least 90% identity to the sequence of SEQ ID NO: b etc.
  • the identity levels are independently selected and are partially or entirely different from each other, i.e., the sequence molecules are combined such that the identity levels are not identical; e.g., (i) sequence molecule A comprising the sequence of SEQ ID NO: a, (ii) sequence molecule B comprising a sequence having at least 90% identity to the sequence of SEQ ID NO: b etc., or (i) sequence molecule A comprising a sequence having at least 90% identity to the sequence of SEQ ID NO: a, (ii) sequence molecule B comprising a sequence having at least 85% identity to the sequence of SEQ ID NO: b etc.
  • the term "about” denotes an interval of accuracy that the person of ordinary skill will understand to still ensure the technical effect of the feature in question.
  • the term typically indicates deviation from the indicated numerical value by ⁇ 10%, ⁇ 5%, ⁇ 4%, ⁇ 3%, ⁇ 2%, ⁇ 1%, ⁇ 0.9%, ⁇ 0.8%, ⁇ 0.7%, ⁇ 0.6%, ⁇ 0.5%, ⁇ 0.4%, ⁇ 0.3%, ⁇ 0.2%, ⁇ 0.1%, ⁇ 0.05%, and for example ⁇ 0.01%.
  • "about” indicates deviation from the indicated numerical value by ⁇ 10%.
  • “about” indicates deviation from the indicated numerical value by ⁇ 5%.
  • “about” indicates deviation from the indicated numerical value by ⁇ 4%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 3%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 2%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 1%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.9%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.8%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.7%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.6%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.5%.
  • “about” indicates deviation from the indicated numerical value by ⁇ 0.4%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.3%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.2%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.1%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.05%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.01%. As will be appreciated by the person of ordinary skill, the specific such deviation for a numerical value for a given technical effect will depend on the nature of the technical effect. For example, a natural or biological technical effect may generally have a larger such deviation than one for a man-made or engineering technical effect.
  • sequences described herein, in particular in the sequence listing refer to DNA molecules
  • nucleotide sequence as described herein in particular in the sequence listing
  • the nucleotide sequence referred to is actually identical to the base-sequence of the DNA molecule described herein, in particular in the sequence listing, e.g., represented in a SEQ ID NO referred to, except that thymine is replaced by uracil.
  • Mycobacterium tuberculosis is a non-motile, slowly growing and rod shaped (2-4 pm in length and 0.2-0.5 pm in width) bacterium. Mtb ⁇ s gram-positive, obligate aerobe, requires a host for growth and reproduction, and does not form spores.
  • Tuberculosis is used to describe the infection caused by infective agents from the genus "Mycobacterium ".
  • Tuberculosis is a potentially fatal contagious disease that can affect almost any part of the body but is most frequently an infection of the lungs. While the majority of tuberculosis infections is caused by Mycobacterium tuberculosis, there are other Mycobacterium species that can cause tuberculosis as well. These species include Mycobacterium bovis, Mycobacterium caprae, Mycobacterium orygis, Mycobacterium africanum, Mycobacterium microti, Mycobacterium canetti and Mycobacterium pinnipedii.
  • Mycobacterium tuberculosis and some other mycobacteria are transmitted by airborne droplet nuclei produced when an individual with active disease coughs, speaks, or sneezes. When inhaled, the droplet nuclei reach the alveoli of the lung. In susceptible individuals the organisms may then multiply and spread through lymphatics to the lymph nodes, and through the bloodstream to other sites such as the lung apices, bone marrow, kidneys, and meninges. Infections with other Mycobacterium species, such as Mycobacterium bovis or Mycobacterium caprae are also associated with the consumption of un-pasteurized milk from infected animals. The development of acquired immunity in 2 to 10 weeks results in a halt to bacterial multiplication.
  • latent TB dormant
  • the clinical status of latent TB is traditionally associated with the transition of Mtb to a dormant state in response to non-optimal growth conditions in vivo due to activation of the host immune response.
  • Dormancy is a specific physiological state characterized by significant cessation of metabolic activity and growth, whereas resuscitation from dormancy is a process of restoring cell activity followed by bacterial multiplication, which in case of Mtb can lead to disease progression.
  • the risk of developing active disease with clinical symptoms diminishes with time and may never occur, but is a lifelong risk. Approximately 5% of individuals with tuberculous infection progress to active disease.
  • “enhance” means the ability to cause an overall increase, or enhancement, for example, by at least about 5% or greater, about 10% or greater, about 15% or greater, about 20% or greater, about 25% or greater, about 30% or greater, about 40% or greater, about 50% or greater, about 75% or greater, or about 100% or greater in the level.
  • physiological pH refers to a pH of about 7.4. In some embodiments, physiological pH is from 7.3 to 7.5. In some embodiments, physiological pH is from 7.35 to 7.45. In some embodiments, physiological pH is 7.3, 7.35, 7.4, 7.45, or 7.5. As used in the present disclosure, “% w/v” refers to weight by volume percent, which is a unit of concentration measuring the amount of solute in grams (g) expressed as a percent of the total volume of solution in milliliters (mL).
  • % by weight refers to weight percent, which is a unit of concentration measuring the amount of a substance in grams (g) expressed as a percent of the total weight of the total composition in grams (g).
  • mol % is defined as the ratio of the number of moles of one component to the total number of moles of all components, multiplied by 100.
  • mol % of the total lipid is defined as the ratio of the number of moles of one lipid component to the total number of moles of all lipids, multiplied by 100.
  • total lipid includes lipids and lipid-like material.
  • ionic strength refers to the mathematical relationship between the number of different kinds of ionic species in a particular solution and their respective charges.
  • ionic strength I is represented mathematically by the formula:
  • the term "ionic strength" in some embodiments relates to the presence of monovalent ions.
  • divalent ions in particular divalent cations
  • their concentration or effective concentration (presence of free ions) due to the presence of chelating agents is, in some embodiments, sufficiently low so as to prevent degradation of the nucleic acid.
  • the concentration or effective concentration of divalent ions is below the catalytic level for hydrolysis of the phosphodiester bonds between nucleotides such as RNA nucleotides.
  • the concentration of free divalent ions is 20 pM or less. In some embodiments, there are no or essentially no free divalent ions.
  • Oleality refers to the concentration of a particular solute expressed as the number of osmoles of solute per kilogram of solvent.
  • lyophilizing refers to the freeze-drying of a substance by freezing it and then reducing the surrounding pressure (e.g., below 15 Pa, such as below 10 Pa, below 5 Pa, or 1 Pa or less) to allow the frozen medium in the substance to sublimate directly from the solid phase to the gas phase.
  • surrounding pressure e.g., below 15 Pa, such as below 10 Pa, below 5 Pa, or 1 Pa or less
  • spray-drying refers to spray-drying a substance by mixing (heated) gas with a fluid that is atomized (sprayed) within a vessel (spray dryer), where the solvent from the formed droplets evaporates, leading to a dry powder.
  • reconstitute relates to adding a solvent such as water to a dried product to return it to a liquid state such as its original liquid state.
  • recombinant in the context of the present disclosure means "made through genetic engineering”. In some embodiments, a "recombinant object" in the context of the present disclosure is not occurring naturally.
  • naturally occurring refers to the fact that an object can be found in nature.
  • a peptide or nucleic acid that is present in an organism (including viruses) and can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally occurring.
  • found in nature means "present in nature” and includes known objects as well as objects that have not yet been discovered and/or isolated from nature, but that may be discovered and/or isolated in the future from a natural source.
  • room temperature and “ambient temperature” are used interchangeably herein and refer to temperatures from at least about 15°C, e.g., from about 15°C to about 35°C, from about 15°C to about 30°C, from about 15°C to about 25°C, or from about 17°C to about 22°C. Such temperatures will include 15°C, 16°C, 17°C, 18°C, 19°C, 20°C, 21°C and 22°C.
  • EDTA refers to ethylenediaminetetraacetic acid disodium salt. All concentrations are given with respect to the EDTA disodium salt.
  • cryoprotectant relates to a substance that is added to a formulation in order to protect the active ingredients during the freezing stages.
  • lyoprotectant relates to a substance that is added to a formulation in order to protect the active ingredients during the drying stages.
  • peptide refers to substances which comprise about two or more, about 3 or more, about 4 or more, about 6 or more, about 8 or more, about 10 or more, about 13 or more, about 16 or more, about 20 or more, and up to about 50, about 100 or about 150, consecutive amino acids linked to one another via peptide bonds.
  • polypeptide refers to large peptides, in particular peptides having at least about 151 amino acids.
  • eptides and “polypeptides” are both protein molecules, although the terms “protein” and “polypeptide” are used herein usually as synonyms.
  • biological activity means the response of a biological system to a molecule.
  • biological systems may be, for example, a cell or an organism. In some embodiments, such response is therapeutically or pharmaceutically useful.
  • portion refers to a fraction. With respect to a particular structure such as an amino acid sequence or protein the term “portion” thereof may designate a continuous or a discontinuous fraction of said structure.
  • part and fragment are used interchangeably herein and refer to a continuous element.
  • a part of a structure such as an amino acid sequence or protein refers to a continuous element of said structure.
  • the term “part” means a portion of the composition.
  • a part of a composition may be any portion from 0.1% to 99.9% (such as 0.1%, 0.5%, 1%, 5%, 10%, 50%, 90%, or 99%) of said composition.
  • “Fragment” with reference to an amino acid sequence (peptide or polypeptide), relates to a part of an amino acid sequence, i.e. a sequence which represents the amino acid sequence shortened at the N-terminus and/or C-terminus.
  • a fragment shortened at the C-terminus is obtainable, e.g., by translation of a truncated open reading frame that lacks the 3'-end of the open reading frame.
  • a fragment shortened at the N-terminus is obtainable, e.g., by translation of a truncated open reading frame that lacks the 5'-end of the open reading frame, as long as the truncated open reading frame comprises a start codon that serves to initiate translation.
  • a fragment of an amino acid sequence comprises, e.g., at least 50 %, at least 60 %, at least 70 %, at least 80%, at least 90% of the amino acid residues from an amino acid sequence.
  • a fragment of an amino acid sequence comprises, e.g., at least 5, at least 6, at least 7, in particular at least 8, at least 10, at least 12, at least 15, at least 20, at least 30, at least 50, or at least 100 consecutive amino acids from an amino acid sequence.
  • a fragment of an amino acid sequence comprises, e.g., a sequence of up to 8, in particular up to 10, up to 12, up to 15, up to 20, up to 30, up to 50, up to 80, up to 100, up to 150 or up to 200 consecutive amino acids of the amino acid sequence.
  • Mycobacterium tuberculosis antigen or immunogenic variant thereof represented by one or more antigen fragments and/or one or more full length antigens refers to the full length Mycobacterium tuberculosis antigen or an immunogenic variant of the full length Mycobacterium tuberculosis antigen, or one or more fragments of the Mycobacterium tuberculosis antigen or an immunogenic variant of the Mycobacterium tuberculosis antigen, wherein the fragments may or may not be overlapping.
  • An immunogenic variant of a Mycobacterium tuberculosis antigen or one or more fragments of a Mycobacterium tuberculosis antigen or an immunogenic variant of a Mycobacterium tuberculosis antigen are capable of inducing an immune response against the Mycobacterium tuberculosis antigen when delivered to a subject, e.g. in the form of a protein or an RNA transcribed by a cell of the subject.
  • a fragment of a Mycobacterium tuberculosis antigen or an immunogenic variant of a Mycobacterium tuberculosis antigen comprises at least one epitope, e.g., at least one T cell epitope, of a Mycobacterium tuberculosis antigen or an immunologically equivalent variant of said at least one epitope.
  • a fragment of a Mycobacterium tuberculosis antigen or an immunogenic variant of a Mycobacterium tuberculosis antigen comprises a fragment of, e.g., at least 5, at least 6, at least 7, in particular at least 8, at least 10, at least 12, at least 15, at least 20, at least 30, at least 50, or at least 100 consecutive amino acids of said Mycobacterium tuberculosis antigen or immunogenic variant of a Mycobacterium tuberculosis antigen.
  • RNA encoding a chimeric protein or encoding at least one full-length antigen or antigen fragment representing at least one Mycobacterium tuberculosis antigen or immunogenic variant thereof encompasses monocistronic and polycistronic RNAs.
  • the RNA may encode one or more fragments of the Mycobacterium tuberculosis antigen or immunogenic variant thereof. If the RNA encodes more than one fragment of the Mycobacterium tuberculosis antigen or immunogenic variant thereof, fragments of the Mycobacterium tuberculosis antigen or immunogenic variant thereof may be encoded by different open reading frames located on the same or on different RNA molecules.
  • the RNA may encode one Mycobacterium tuberculosis antigen or immunogenic variant thereof as one or more fragments and, optionally, as an additional full length antigen, whereas the remaining Mycobacterium tuberculosis antigens or immunogenic variants thereof are encoded as the full length antigen and/or as one or more antigen fragments, respectively.
  • the RNA encodes the full-length antigen of each of the more than one Mycobacterium tuberculosis antigen or immunogenic variant thereof.
  • the RNA encodes one or more fragments of each of the more than one Mycobacterium tuberculosis antigen or immunogenic variant thereof. In some embodiments, the RNA encodes the full-length antigen of some of the more than one Mycobacterium tuberculosis antigen or immunogenic variant thereof and encodes one or more fragments of some of the more than one Mycobacterium tuberculosis antigen or immunogenic variant thereof, wherein the RNA may encode the full-length antigen as well as one or more fragments of the same Mycobacterium tuberculosis antigen or immunogenic variant thereof.
  • the full-length antigens and/or fragments discussed above may be encoded by the same or different open reading frames located on the same or on different RNA molecules.
  • chimeric protein is used herein as a synonym for "fusion protein” and means a protein comprising two or more subunits, such as a full-length antigen, antigen fragment and/or other functional amino acid sequence.
  • the fusion protein is a translational fusion between the two or more subunits.
  • the translational fusion may be generated by genetically engineering the coding nucleotide sequence for one subunit in a reading frame with the coding nucleotide sequence of a further subunit.
  • Subunits may be interspersed by a polypeptide linker.
  • polypeptide linker describes either a single amino acid or a sequence of amino acids connecting the amino acid sequences of two adjacent subunits in a linear amino acid sequence of a chimeric protein.
  • a polypeptide linker may have a length of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15 or more amino acids.
  • the polypeptide linker is 10 amino acids in length.
  • Exemplary linkers include glycine-serine-polypeptide linkers, glycine-proline-polypeptide linkers, and proline-alanine polypeptide linkers.
  • the linker is a glycine-serine-polypeptide linker (GS linker), i.e., a peptide that consists of glycine and serine residues.
  • GS linker comprises the amino acid sequence of SEQ ID NO: 56.
  • wild type or “WT” or “native” herein is meant an amino acid sequence that is found in nature, including allelic variations and/or naturally occurring mutations.
  • a wild type amino acid sequence, peptide or polypeptide has an amino acid sequence that has not been intentionally modified by man.
  • non-native as used herein in conjunction with amino acid sequences is meant to refer to amino acid sequences not found in nature, i.e., that have been intentionally modified by man - either in sequence or in sequence context.
  • a non-native signal peptide sequence fused or operatively linked to a Mycobacterium tuberculosis antigen denotes that said signal peptide in nature does not occur fused or operatively linked to said Mycobacterium tuberculosis antigen, either because said signal peptide can naturally be found fused or operatively linked only to other Mycobacterium tuberculosis antigens or only in other organisms, such as mammals, e.g.
  • a non-native signal peptide has been mutated in a purposeful manner (e.g., by random mutagenesis and targeted selection or by guided mutagenesis techniques, including, e.g., sequence synthesis) in order to obtain certain functional properties or to eliminate certain functional properties, resulting in a signal peptide structurally and functionally distinct from a signal peptide found in nature fused or operatively linked to the Mycobacterium tuberculosis antigen in question.
  • Variant as used herein and with reference to an amino acid sequence (peptide or polypeptide), is meant an amino acid sequence that differs from a parent amino acid sequence by virtue of at least one amino acid (e.g., a different amino acid, or a modification of the same amino acid).
  • the parent amino acid sequence may be a naturally occurring or wild type (WT) amino acid sequence, or may be a modified version of a wild type amino acid sequence.
  • the variant amino acid sequence has at least one amino acid difference as compared to the parent amino acid sequence, e.g., from 1 to about 20 amino acid differences, such as from 1 to about 10 or from 1 to about 5 amino acid differences compared to the parent.
  • variants of an amino acid sequence may comprise amino acid insertion variants, amino acid addition variants, amino acid deletion variants and/or amino acid substitution variants.
  • variant includes all mutants, splice variants, post-translationally modified variants, conformations, isoforms, allelic variants, species variants, and species homologs, in particular those which are naturally occurring.
  • variant includes, in particular, fragments of an amino acid sequence.
  • Amino acid insertion variants comprise insertions of single or two or more amino acids in a particular amino acid sequence. In the case of amino acid sequence variants having an insertion, one or more amino acid residues are inserted into a particular site in an amino acid sequence, although random insertion with appropriate screening of the resulting product is also possible.
  • Amino acid addition variants comprise amino- and/or carboxy-terminal fusions of one or more amino acids, such as 1, 2, 3, 5, 10, 20, 30, 50, or more amino acids.
  • Amino acid deletion variants are characterized by the removal of one or more amino acids from the sequence, such as by removal of 1, 2, 3, 5, 10, 20, 30, 50, or more amino acids. The deletions may be in any position of the protein.
  • Amino acid deletion variants that comprise the deletion at the N-terminal and/or C-terminal end of the protein are also called N-terminal and/or C- terminal truncation variants.
  • Amino acid substitution variants are characterized by at least one residue in the sequence being removed and another residue being inserted in its place. Preference is given to the modifications being in positions in the amino acid sequence which are not conserved between homologous peptides or polypeptides and/or to replacing amino acids with other ones having similar properties.
  • amino acid changes in peptide and polypeptide variants are conservative amino acid changes, i.e., substitutions of similarly charged or uncharged amino acids.
  • a conservative amino acid change involves substitution of one of a family of amino acids which are related in their side chains.
  • Naturally occurring amino acids are generally divided into four families: acidic (aspartate, glutamate), basic (lysine, arginine, histidine), non-polar (alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), and uncharged polar (glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine) amino acids. Phenylalanine, tryptophan, and tyrosine are sometimes classified jointly as aromatic amino acids.
  • conservative amino acid substitutions include substitutions within the following groups:
  • the degree of similarity such as identity between a given amino acid sequence and an amino acid sequence which is a variant of said given amino acid sequence, will be at least about 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%.
  • the degree of similarity or identity is given for an amino acid region which is at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90% or about 100% of the entire length of the reference amino acid sequence.
  • the degree of similarity or identity is given, e.g., for at least about 20, at least about 40, at least about 60, at least about 80, at least about 100, at least about 120, at least about 140, at least about 160, at least about 180, or about 200 amino acids, in some embodiments, continuous amino acids.
  • the degree of similarity or identity is given for the entire length of the reference amino acid sequence.
  • the alignment for determining sequence similarity, such as sequence identity can be done with art known tools, such as using the best sequence alignment, for example, using Align, using standard settings, preferably EMBOSS: : needle, Matrix: Blosum62, Gap Open 10.0, Gap Extend 0.5.
  • Sequence similarity indicates the percentage of amino acids that either are identical or that represent conservative amino acid substitutions.
  • Sequence identity between two amino acid sequences indicates the percentage of amino acids that are identical between the sequences.
  • Sequnce identity between two nucleic acid sequences indicates the percentage of nucleotides that are identical between the sequences.
  • % identical and % identity are intended to refer, in particular, to the percentage of nucleotides or amino acids which are identical in an optimal alignment between the sequences to be compared. Said percentage is purely statistical, and the differences between the two sequences may be but are not necessarily randomly distributed over the entire length of the sequences to be compared. Comparisons of two sequences are usually carried out by comparing the sequences, after optimal alignment, with respect to a segment or "window of comparison", in order to identify local regions of corresponding sequences. The optimal alignment for a comparison may be carried out manually or with the aid of the local homology algorithm by Smith and Waterman, 1981, Ads App. Math. 2, 482, with the aid of the local homology algorithm by Neddleman and Wunsch, 1970, J.
  • NCBI National Center for Biotechnology Information
  • the algorithm parameters used for BLASTN algorithm on the NCBI website include: (i) Expect Threshold set to 10; (ii) Word Size set to 28; (iii) Max matches in a query range set to 0; (iv) Match/Mismatch Scores set to 1, - 2; (v) Gap Costs set to Linear; and (vi) the filter for low complexity regions being used.
  • the algorithm parameters used for BLASTP algorithm on the NCBI website include: (i) Expect Threshold set to 10; (ii) Word Size set to 3; (iii) Max matches in a query range set to 0; (iv) Matrix set to BLOSUM62; (v) Gap Costs set to Existence: 11 Extension: 1; and (vi) conditional compositional score matrix adjustment.
  • Percentage identity is obtained by determining the number of identical positions at which the sequences to be compared correspond, dividing this number by the number of positions compared (e.g, the number of positions in the reference sequence) and multiplying this result by 100.
  • the degree of similarity or identity is given for a region which is at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90% or about 100% of the entire length of the reference sequence.
  • the degree of identity is given for at least about 100, at least about 120, at least about 140, at least about 160, at least about 180, or about 200 nucleotides, in some embodiments continuous nucleotides.
  • the degree of similarity or identity is given for the entire length of the reference sequence.
  • Homologous amino acid sequences exhibit according to the disclosure at least 40%, in particular at least 50%, at least 60%, at least 70%, at least 80%, at least 90% and, e.g., at least 95%, at least 98 or at least 99% identity of the amino acid residues.
  • amino acid sequence variants described herein may readily be prepared by the skilled person, for example, by recombinant DNA manipulation.
  • the manipulation of DNA sequences for preparing peptides or polypeptides having substitutions, additions, insertions or deletions, is described in detail in Molecular Cloning: A Laboratory Manual, 4 th Edition, M.R. Green and J. Sambrook eds., Cold Spring Harbor Laboratory Press, Cold Spring Harbor 2012, for example.
  • the peptides, polypeptides and amino acid variants described herein may be readily prepared with the aid of known peptide synthesis techniques such as, for example, by solid phase synthesis and similar methods.
  • a fragment or variant of an amino acid sequence is a "functional fragment” or “functional variant”.
  • the term "functional fragment” or “functional variant” of an amino acid sequence relates to any fragment or variant exhibiting one or more functional properties identical or similar to those of the amino acid sequence from which it is derived, i.e., it is functionally equivalent.
  • one particular function is one or more immunogenic activities displayed by the amino acid sequence from which the fragment or variant is derived.
  • the modifications in the amino acid sequence of the parent molecule or sequence do not significantly affect or alter the characteristics of the molecule or sequence.
  • the function of the functional fragment or functional variant may be reduced but still significantly present, e.g., function of the functional fragment or functional variant may be at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% of the parent molecule or sequence.
  • function of the functional fragment or functional variant may be enhanced compared to the parent molecule or sequence.
  • amino acid sequence (peptide or polypeptide) "derived from” a designated amino acid sequence (peptide or polypeptide) refers to the origin of the first amino acid sequence.
  • the amino acid sequence which is derived from a particular amino acid sequence has an amino acid sequence that is identical, essentially identical or homologous to that particular sequence or a fragment thereof.
  • Amino acid sequences derived from a particular amino acid sequence may be variants of that particular sequence or a fragment thereof.
  • the antigens suitable for use herein may be altered such that they vary in sequence from the naturally occurring or native sequences from which they were derived, while retaining the desirable activity of the native sequences.
  • isolated means removed (e.g., purified) from the natural state or from an artificial composition, such as a composition from a production process.
  • a nucleic acid, peptide or polypeptide naturally present in a living animal is not “isolated”, but the same nucleic acid, peptide or polypeptide partially or completely separated from the coexisting materials of its natural state is “isolated”.
  • An isolated nucleic acid, peptide or polypeptide can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
  • transfection relates to the introduction of nucleic acids, in particular RNA, into a cell.
  • the term “transfection” also includes the introduction of a nucleic acid into a cell or the uptake of a nucleic acid by such cell, wherein the cell may be present in a subject, e.g., a patient, or the cell may be in vitro, e.g., outside of a patient.
  • a cell for transfection of a nucleic acid described herein can be present in vitro or in vivo, e.g. the cell can form part of an organ, a tissue and/or the body of a patient.
  • transfection can be transient or stable.
  • RNA can be transfected into cells to transiently express its coded protein. Since the nucleic acid introduced in the transfection process is usually not integrated into the nuclear genome, the foreign nucleic acid will be diluted through mitosis or degraded. Cells allowing episomal amplification of nucleic acids greatly reduce the rate of dilution. If it is desired that the transfected nucleic acid actually remains in the genome of the cell and its daughter cells, a stable transfection must occur. Such stable transfection can be achieved by using virus-based systems or transposon-based systems for transfection, for example. Generally, nucleic acid encoding antigen is transiently transfected into cells. RNA can be transfected into cells to transiently express its coded protein.
  • an analog of a peptide or polypeptide is a modified form of said peptide or polypeptide from which it has been derived and has at least one functional property of said peptide or polypeptide.
  • a pharmacological active analog of a peptide or polypeptide has at least one of the pharmacological activities of the peptide or polypeptide from which the analog has been derived.
  • modifications include any chemical modification and comprise single or multiple substitutions, deletions and/or additions of any molecules associated with the peptide or polypeptide, such as carbohydrates, lipids and/or peptides or polypeptides.
  • analogs of peptides or polypeptides include those modified forms resulting from glycosylation, acetylation, phosphorylation, amidation, palmitoylation, myristoylation, isoprenylation, lipidation, alkylation, derivatization, introduction of protective/blocking groups, proteolytic cleavage or binding to an antibody or to another cellular ligand.
  • the term “analog” also extends to all functional chemical equivalents of said peptides and polypeptides.
  • endogenous refers to any material from or produced inside an organism, cell, tissue or system.
  • exogenous refers to any material introduced from or produced outside an organism, cell, tissue or system.
  • a nucleic acid such as RNA encoding a peptide or polypeptide is taken up by or introduced, i.e. transfected or transduced, into a cell which cell may be present in vitro or in a subject, resulting in expression of said peptide or polypeptide.
  • the cell may, e.g., express the encoded peptide or polypeptide intracellularly e.g. in the cytoplasm and/or in the nucleus), may secrete the encoded peptide or polypeptide, and/or may express it on the surface.
  • the cell secretes the encoded peptide or polypeptide.
  • nucleic acid expressing and “nucleic acid encoding” or similar terms are used interchangeably herein and with respect to a particular peptide or polypeptide mean that the nucleic acid, if present in the appropriate environment, e.g. within a cell, can be expressed to produce said peptide or polypeptide.
  • the term "encoding" refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an RNA (in particular, mRNA), to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
  • a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
  • Both the coding strand the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
  • an "open reading frame” or “ORF” is a continuous stretch of codons beginning with a start codon and ending with a stop codon.
  • transcription includes the transcription and/or translation of a particular nucleotide sequence.
  • transcription relates to a process, wherein the genetic code in a DNA sequence is transcribed into RNA (especially mRNA). Subsequently, the RNA may be translated into peptide or polypeptide.
  • RNA With respect to RNA, the term "expression” or “translation” relates to the process in the ribosomes of a cell by which a strand of mRNA directs the assembly of a sequence of amino acids to make a peptide or polypeptide.
  • a medical preparation, in particular kit, described herein may comprise instructional material or instructions.
  • "instructional material” or “instructions” includes a publication, a recording, a diagram, or any other medium of expression which can be used to communicate the usefulness of the compositions and methods of the present disclosure.
  • the instructional material of the kit of the present disclosure may, for example, be affixed to a container which contains the compositions/formulations of the present disclosure or be shipped together with a container which contains the compositions/formulations. Alternatively, the instructional material may be shipped separately from the container with the intention that the instructional material and the compositions be used cooperatively by the recipient.
  • set e.g., as used herein in the context of "set of full-length antigens and antigen fragments" means more than 1, e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, or 8 or more.
  • RNA molecule means 1 or more, e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, or 8 or more. In some embodiments, the term “at least one” refers to 1, 2, 3, 4, 5, 6, 7, or 8.
  • RNA molecules refers to a set of RNA molecules, e.g., 2, 3, 4 or more RNA molecules, wherein each RNA molecule encodes an amino acid sequence comprising at least one full-length Mtb antigen or antigen fragment, immunogenic variants or fragments thereof, e.g., an amino acid sequence comprising two different Mtb antigens, immunogenic variants or fragments thereof.
  • such at least one RNA molecule or set of RNA molecules comprises the RNA molecules in a mixtures, which mixture may be obtainable by transcribing in a common reaction a mixture of DNA templates encoding said RNA molecules.
  • Prodrugs of a particular compound described herein are those compounds that upon administration to an individual undergo chemical conversion under physiological conditions to provide the particular compound. Additionally, prodrugs can be converted to the particular compound by chemical or biochemical methods in an ex vivo environment. For example, prodrugs can be slowly converted to the particular compound when, for example, placed in a transdermal patch reservoir with a suitable enzyme or chemical reagent. Exemplary prodrugs are esters (using an alcohol or a carboxy group contained in the particular compound) or amides (using an amino or a carboxy group contained in the particular compound) which are hydrolyzable in vivo. Specifically, any amino group which is contained in the particular compound and which bears at least one hydrogen atom can be converted into a prodrug form. Typical N-prodrug forms include carbamates, Mannich bases, enamines, and enaminones.
  • a structural formula of a compound may represent a certain isomer of said compound. It is to be understood, however, that the present disclosure includes all isomers such as geometrical isomers, optical isomers based on an asymmetrical carbon, stereoisomers, tautomers and the like which occur structurally and isomer mixtures and is not limited to the description of the formula. Furthermore, in the present specification, a structural formula of a compound may represent a specific salt and/or solvate of said compound. It is to be understood, however, that the present disclosure includes all salts (e.g., pharmaceutically acceptable salts) and solvates (e.g., hydrates) and is not limited to the description of the specific salt and/or solvate.
  • salts e.g., pharmaceutically acceptable salts
  • solvates e.g., hydrates
  • “Isomers” are compounds having the same molecular formula but differ in structure (“structural isomers”) or in the geometrical (spatial) positioning of the functional groups and/or atoms (“stereoisomers”).
  • “Enantiomers” are a pair of stereoisomers which are non-superimposable mirror-images of each other.
  • a “racemic mixture” or “racemate” contains a pair of enantiomers in equal amounts and is denoted by the prefix ( ⁇ ).
  • “Diastereomers” are stereoisomers which are non-superimposable and which are not mirror-images of each other.
  • Tautomers are structural isomers of the same chemical substance that spontaneously and reversibly interconvert into each other, even when pure, due to the migration of individual atoms or groups of atoms; i.e., the tautomers are in a dynamic chemical equilibrium with each other.
  • An example of tautomers are the isomers of the keto-enol-tautomerism.
  • Conformers are stereoisomers that can be interconverted just by rotations about formally single bonds, and include - in particular - those leading to different 3-dimentional forms of (hetero)cyclic rings, such as chair, half-chair, boat, and twist-boat forms of cyclohexane.
  • solvate refers to an addition complex of a dissolved material in a solvent (such as an organic solvent (e.g., an aliphatic alcohol (such as methanol, ethanol, n-propanol, isopropanol), acetone, acetonitrile, ether, and the like), water or a mixture of two or more of these liquids), wherein the addition complex exists in the form of a crystal or mixed crystal.
  • a solvent such as an organic solvent (e.g., an aliphatic alcohol (such as methanol, ethanol, n-propanol, isopropanol), acetone, acetonitrile, ether, and the like), water or a mixture of two or more of these liquids), wherein the addition complex exists in the form of a crystal or mixed crystal.
  • the amount of solvent contained in the addition complex may be stoichiometric or non- stoichiometric.
  • a “hydrate” is a solvate wherein the solvent
  • isotopically labeled compounds one or more atoms are replaced by a corresponding atom having the same number of protons but differing in the number of neutrons.
  • a hydrogen atom may be replaced by a deuterium or tritium atom.
  • Exemplary isotopes which can be used in the present disclosure include deuterium, tritium, n C, 13 C, 14 C, 15 N, 18 F, 32 P, 32 S, 35 S, 35 CI, and 125 I.
  • average diameter refers to the mean hydrodynamic diameter of particles as measured by dynamic light scattering (DLS) with data analysis using the so-called cumulant algorithm, which provides as results the so-called with the dimension of a length, and the polydispersity index (PDI), which is dimensionless (Koppel, D., J. Chem. Phys. 57, 1972, pp 4814-4820, ISO 13321).
  • PDI polydispersity index
  • the "polydispersity index” is calculated based on dynamic light scattering measurements by the so-called cumulant analysis as mentioned in the definition of the "average diameter". Under certain prerequisites, it can be taken as a measure of the size distribution of an ensemble of nanoparticles.
  • the "radius of gyration" (abbreviated herein as R g ) of a particle about an axis of rotation is the radial distance of a point from the axis of rotation at which, if the whole mass of the particle is assumed to be concentrated, its moment of inertia about the given axis would be the same as with its actual distribution of mass.
  • R g is the root mean square distance of the particle's components from either its center of mass or a given axis.
  • Rg is the square-root of the mass average of s, 2 over all mass elements and can be calculated as follows:
  • the radius of gyration can be determined or calculated experimentally, e.g., by using light scattering.
  • the structure function S is defined as follows: wherein N is the number of components (Guinier's law).
  • the "hydrodynamic radius” (which is sometimes called “Stokes radius” or “Stokes-Einstein radius”) of a particle is the radius of a hypothetical hard sphere that diffuses at the same rate as said particle.
  • the hydrodynamic radius is related to the mobility of the particle, taking into account not only size but also solvent effects. For example, a smaller charged particle with stronger hydration may have a greater hydrodynamic radius than a larger charged particle with weaker hydration. This is because the smaller particle drags a greater number of water molecules with it as it moves through the solution.
  • the hydrodynamic radius may be defined by the Stokes-Einstein equation: wherein B is the Boltzmann constant; 7 ⁇ is the temperature; g is the viscosity of the solvent; and D is the diffusion coefficient.
  • B is the Boltzmann constant
  • 7 ⁇ is the temperature
  • g is the viscosity of the solvent
  • D is the diffusion coefficient.
  • the diffusion coefficient can be determined experimentally, e.g., by using dynamic light scattering (DLS).
  • one procedure to determine the hydrodynamic radius of a particle or a population of particles is to measure the DLS signal of said particle or population of particles (such as DLS signal of particles contained in a sample or control composition as disclosed herein or the DLS signal of a particle peak obtained from subjecting such a sample or control composition to field-flow fractionation).
  • light scattering refers to the physical process where light is forced to deviate from a straight trajectory by one or more paths due to localized non-uniformities in the medium through which the light passes.
  • UV means ultraviolet and designates a band of the electromagnetic spectrum with a wavelength from 10 nm to 400 nm, i.e., shorter than that of visible light but longer than X-rays.
  • multi-angle light scattering or “MALS” as used herein relates to a technique for measuring the light scattered by a sample into a plurality of angles.
  • Multi-angle means in this respect that scattered light can be detected at different discrete angles as measured, for example, by a single detector moved over a range including the specific angles selected or an array of detectors fixed at specific angular locations.
  • the light source used in MALS is a laser source (MALLS: multi-angle laser light scattering).
  • the Zimm plot is a graphical presentation using the following equation: wherein cis the mass concentration of the particles in the solvent (g/mL); A2 is the second virial coefficient (mol-mL/g 2 ); P(0) is a form factor relating to the dependence of scattered light intensity on angle; Re is the excess Rayleigh ratio (cm 1 ); and A* is an optical constant that is equal to 4n 2 q 0 (d/7/dc) 2 Xo -4 /VA -1 , where q 0 is the refractive index of the solvent at the incident radiation (vacuum) wavelength, X o is the incident radiation (vacuum) wavelength (nm), Ne is Avogadro's number (mol 1 ), and d/7/dc is the differential refractive index increment (mL/g) (cf., e.g., Buchholz et al.
  • the Berry plot is calculated using the following term or the reciprocal thereof: wherein c, Re and K* are as defined above.
  • the Debye plot is calculated using the following term or the reciprocal thereof: wherein c, /fa and A"*are as defined above.
  • DLS dynamic light scattering
  • a monochromatic light source usually a laser
  • the scattered light then goes through a second polarizer where it is detected and the resulting image is projected onto a screen.
  • the particles in the solution are being hit with the light and diffract the light in all directions.
  • the diffracted light from the particles can either interfere constructively (light regions) or destructively (dark regions). This process is repeated at short time intervals and the resulting set of speckle patterns are analyzed by an autocorrelator that compares the intensity of light at each spot over time.
  • SLS static light scattering
  • MALS multi-angle light scattering
  • MALLS multi-angle laser light scattering
  • nucleic acid comprises deoxyribonucleic acid (DNA), ribonucleic acid (RNA), combinations thereof, and modified forms thereof.
  • the term comprises genomic DNA, cDNA, mRNA, recombinantly produced and chemically synthesized molecules.
  • a nucleic acid is DNA.
  • a nucleic acid is RNA.
  • a nucleic acid is a mixture of DNA and RNA.
  • a nucleic acid may be present as a single-stranded or double-stranded and linear or covalently circularly closed molecule.
  • a nucleic acid can be isolated.
  • isolated nucleic acid means, according to the present disclosure, that the nucleic acid (i) was amplified in vitro, for example via polymerase chain reaction (PCR) for DNA or in vitro transcription (using, e.g., an RNA polymerase) for RNA, (ii) was produced recombinantly by cloning, (iii) was purified, for example, by cleavage and separation by gel electrophoresis, or (iv) was synthesized, for example, by chemical synthesis.
  • PCR polymerase chain reaction
  • RNA polymerase RNA polymerase
  • nucleoside (abbreviated herein as "N") relates to compounds which can be thought of as nucleotides without a phosphate group. While a nucleoside is a nucleobase linked to a sugar e.g, ribose or deoxyribose), a nucleotide is composed of a nucleoside and one or more phosphate groups. Examples of nucleosides include cytidine, uridine, pseudouridine, adenosine, and guanosine. The five standard nucleosides which usually make up naturally occurring nucleic acids are uridine, adenosine, thymidine, cytidine and guanosine.
  • thymidine is more commonly written as “dT” ("d” represents “deoxy") as it contains a 2'-deoxyribofuranose moiety rather than the ribofuranose ring found in uridine. This is because thymidine is found in deoxyribonucleic acid (DNA) and not ribonucleic acid (RNA). Conversely, uridine is found in RNA and not DNA. The remaining three nucleosides may be found in both RNA and DNA. In RNA, they would be represented as A, C and G, whereas in DNA they would be represented as dA, dC and dG.
  • a modified purine (A or G) or pyrimidine (C, T, or U) base moiety is, in some embodiments, modified by one or more alkyl groups, e.g., one or more CH alkyl groups, e.g., one or more methyl groups.
  • modified purine or pyrimidine base moieties include N 7 -alkyl-guanine, N 5 -alkyl-adenine, 5-alkyl-cytosine, 5-alkyl-uracil, and N(l)- alkyl-uracil, such as N 7 -CI-4 alkyl-guanine, N 5 -CI-4 alkyl-adenine, 5-C1-4 alkyl-cytosine, 5-C1-4 alkyl-uracil, and N(1)-CM alkyl-uracil, preferably N 7 -methyl-guanine, N 5 -methyl-adenine, 5-methyl-cytosine, 5-methyl-uracil, and N(l)-methyl- uracil.
  • DNA relates to a nucleic acid molecule which is entirely or at least substantially composed of deoxyribonucleotide residues.
  • the DNA contains all or a majority of deoxyribonucleotide residues.
  • deoxyribonucleotide refers to a nucleotide which lacks a hydroxyl group at the 2'-position of a p-D-ribofuranosyl group.
  • DNA encompasses without limitation, double stranded DNA, single stranded DNA, isolated DNA such as partially purified DNA, essentially pure DNA, synthetic DNA, recombinantly produced DNA, as well as modified DNA that differs from naturally occurring DNA by the addition, deletion, substitution and/or alteration of one or more nucleotides. Such alterations may refer to addition of non-nucleotide material to internal DNA nucleotides or to the end(s) of DNA. It is also contemplated herein that nucleotides in DNA may be non-standard nucleotides, such as chemically synthesized nucleotides or ribonucleotides. For the present disclosure, these altered DNAs are considered analogs of naturally-occurring DNA.
  • a molecule contains "a majority of deoxyribonucleotide residues" if the content of deoxyribonucleotide residues in the molecule is more than 50% (such as at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%), based on the total number of nucleotide residues in the molecule.
  • the total number of nucleotide residues in a molecule is the sum of all nucleotide residues (irrespective of whether the nucleotide residues are standard (Ze., naturally occurring) nucleotide residues or analogs thereof).
  • DNA may be recombinant DNA and may be obtained by cloning of a nucleic acid, in particular cDNA.
  • the cDNA may be obtained by reverse transcription of RNA.
  • RNA relates to a nucleic acid molecule which includes ribonucleotide residues. In preferred embodiments, the RNA contains all or a majority of ribonucleotide residues.
  • ribonucleotide refers to a nucleotide with a hydroxyl group at the 2'-position of a p-D-ribofuranosyl group.
  • RNA encompasses without limitation, double stranded RNA, single stranded RNA, isolated RNA such as partially purified RNA, essentially pure RNA, synthetic RNA, recombinantly produced RNA, as well as modified RNA that differs from naturally occurring RNA by the addition, deletion, substitution and/or alteration of one or more nucleotides. Such alterations may refer to addition of non- nucleotide material to internal RNA nucleotides or to the end(s) of RNA. It is also contemplated herein that nucleotides in RNA may be non-standard nucleotides, such as chemically synthesized nucleotides or deoxynucleotides.
  • altered/modified nucleotides can be referred to as analogs of naturally occurring nucleotides, and the corresponding RNAs containing such altered/modified nucleotides (Ze., altered/modified RNAs) can be referred to as analogs of naturally occurring RNAs.
  • a molecule contains "a majority of ribonucleotide residues" if the content of ribonucleotide residues in the molecule is more than 50% (such as at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%), based on the total number of nucleotide residues in the molecule.
  • the total number of nucleotide residues in a molecule is the sum of all nucleotide residues (irrespective of whether the nucleotide residues are standard (Ze., naturally occurring) nucleotide residues or analogs thereof).
  • RNA includes mRNA, tRNA, ribosomal RNA (rRNA), small nuclear RNA (snRNA), self-amplifying RNA (saRNA), transamplifying RNA (taRNA), single-stranded RNA (ssRNA), dsRNA, inhibitory RNA (such as antisense ssRNA, small interfering RNA (siRNA), or microRNA (miRNA)), activating RNA (such as small activating RNA) and immunostimulatory RNA (isRNA).
  • RNA refers to mRNA.
  • IVT in vitro transcription
  • the term '"RNA includes “mRNA”.
  • mRNA means “messenger-RNA” and includes a “transcript” which may be generated by using a DNA template.
  • mRNA encodes a peptide or polypeptide.
  • mRNA is single-stranded but may contain self-complementary sequences that allow parts of the mRNA to fold and pair with itself to form double helices.
  • dsRNA means double-stranded RNA and is RNA with two partially or completely complementary strands.
  • the mRNA relates to an RNA transcript which encodes a peptide or polypeptide.
  • the mRNA which preferably encodes a peptide or polypeptide has a length of at least 45 nucleotides (such as at least 60, at least 90, at least 100, at least 200, at least 300, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1,000, at least 1,500, at least 2,000, at least 2,500, at least 3,000, at least 3,500, at least 4,000, at least 4,500, at least 5,000, at least 6,000, at least 7,000, at least 8,000, at least 9,000 nucleotides), preferably up to 15,000, such as up to 14,000, up to 13,000, up to 12,000 nucleotides, up to 11,000 nucleotides or up to 10,000 nucleotides.
  • nucleotides such as at least 60, at least 90, at least 100, at least 200, at least 300, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1,000,
  • mRNA generally contains a 5' untranslated region (5'-UTR), a peptide/polypeptide coding region and a 3' untranslated region (3'-UTR).
  • the mRNA is produced by in vitro transcription or chemical synthesis.
  • the mRNA is produced by in vitro transcription using a DNA template.
  • the in vitro transcription methodology is known to the skilled person; cf., e.g., Molecular Cloning: A Laboratory Manual, 4 th Edition, M.R. Green and J. Sambrook eds., Cold Spring Harbor Laboratory Press, Cold Spring Harbor 2012.
  • in vitro transcription kits are commercially available, e.g., from Thermo Fisher Scientific (such as TranscriptAidTM T7 kit, MEGAscript® T7 kit, MAXIscript®), New England BioLabs Inc. (such as HiScribeTM T7 kit, HiScribeTM T7 ARCA mRNA kit), Promega (such as RiboMAXTM, HeLaScribe®, Riboprobe® systems), Jena Bioscience (such as SP6 or T7 transcription kits), and Epicentre (such as AmpliScribeTM).
  • Thermo Fisher Scientific such as TranscriptAidTM T7 kit, MEGAscript® T7 kit, MAXIscript®), New England BioLabs Inc.
  • HiScribeTM T7 kit such as HiScribeTM T7 kit, HiScribeTM T7 ARCA mRNA kit
  • Promega such as RiboMAXTM, HeLaScribe®, Riboprobe® systems
  • Jena Bioscience such as SP6 or T
  • correspondingly modified nucleotides such as modified naturally occurring nucleotides, non-naturally occurring nucleotides and/or modified non-naturally occurring nucleotides, can be incorporated during synthesis (preferably in vitro transcription), or modifications can be effected in and/or added to the mRNA after transcription.
  • RNA is in vitro transcribed RNA (IVT-RNA) and may be obtained by in vitro transcription of an appropriate DNA template.
  • the promoter for controlling transcription can be any promoter for any RNA polymerase.
  • RNA polymerases are the T7, T3, and SP6 RNA polymerases.
  • the in vitro transcription is controlled by a T7 or SP6 promoter.
  • a DNA template for in vitro transcription may be obtained by cloning of a nucleic acid, in particular cDNA, and introducing it into an appropriate vector for in vitro transcription.
  • the cDNA may be obtained by reverse transcription of RNA.
  • the RNA is "replicon RNA” or simply a “replicon”, in particular "selfreplicating RNA” or “self-amplifying RNA”.
  • the replicon or self-replicating RNA is derived from or comprises elements derived from an ssRNA virus, in particular a positive-stranded ssRNA virus such as an alphavirus.
  • Alphaviruses are typical representatives of positive-stranded RNA viruses.
  • Alphaviruses replicate in the cytoplasm of infected cells (for review of the alphaviral life cycle see Jose et at, Future Microbiol., 2009, vol. 4, pp. 837-856).
  • the total genome length of many alphaviruses typically ranges between 11,000 and 12,000 nucleotides, and the genomic RNA typically has a 5'-cap, and a 3' poly(A) tail.
  • the genome of alphaviruses encodes non-structural proteins (involved in transcription, modification and replication of viral RNA and in protein modification) and structural proteins (forming the virus particle). There are typically two open reading frames (ORFs) in the genome.
  • the four non-structural proteins (nsPl-nsP4) are typically encoded together by a first ORF beginning near the 5' terminus of the genome, while alphavirus structural proteins are encoded together by a second ORF which is found downstream of the first ORF and extends near the 3' terminus of the genome.
  • the first ORF is larger than the second ORF, the ratio being roughly 2: 1.
  • the genomic RNA In cells infected by an alphavirus, only the nucleic acid sequence encoding non-structural proteins is translated from the genomic RNA, while the genetic information encoding structural proteins is translatable from a subgenomic transcript, which is an RNA molecule that resembles eukaryotic messenger RNA (mRNA; Gould et al, 2010, Antiviral Res., vol. 87 pp. 111-124). Following infection, i.e. at early stages of the viral life cycle, the (+) stranded genomic RNA directly acts like a messenger RNA for the translation of the open reading frame encoding the non- structural poly-protein (nsP1234).
  • mRNA eukaryotic messenger RNA
  • Alphavirus-derived vectors have been proposed for delivery of foreign genetic information into target cells or target organisms.
  • the open reading frame encoding alphaviral structural proteins is replaced by an open reading frame encoding a protein of interest.
  • Alphavirus-based trans-replication (trans-amplification) systems rely on alphavirus nucleotide sequence elements on two separate nucleic acid molecules: one nucleic acid molecule encodes a viral replicase, and the other nucleic acid molecule is capable of being replicated by said replicase in trans (hence the designation trans-replication system).
  • Trans-replication requires the presence of both these nucleic acid molecules in a given host cell.
  • the nucleic acid molecule capable of being replicated by the replicase in trans must comprise certain alphaviral sequence elements to allow recognition and RNA synthesis by the alphaviral replicase.
  • the RNA (in particular, mRNA) described herein contains one or more modifications, e.g., in order to increase its stability and/or increase translation efficiency and/or decrease immunogenicity and/or decrease cytotoxicity.
  • the RNA (in particular, mRNA) may be modified within the coding region, i.e., the sequence encoding the expressed peptide or polypeptide, preferably without altering the sequence of the expressed peptide or polypeptide.
  • Such modifications are described, for example, in WO 2007/036366 and PCT/EP2019/056502, and include the following: a 5'-cap structure; an extension or truncation of the naturally occurring poly(A) tail; an alteration of the 5'- and/or 3'-untranslated regions (UTR) such as introduction of a UTR which is not related to the coding region of said RNA; the replacement of one or more naturally occurring nucleotides with synthetic nucleotides; and codon optimization (e.g, to alter, preferably increase, the GC content of the RNA).
  • UTR 5'-cap structure
  • an extension or truncation of the naturally occurring poly(A) tail an alteration of the 5'- and/or 3'-untranslated regions (UTR) such as introduction of a UTR which is not related to the coding region of said RNA
  • UTR 5'- and/or 3'-untranslated regions
  • codon optimization e.g, to alter, preferably increase, the
  • a combination of the above described modifications i.e., incorporation of a 5'-cap structure, incorporation of a poly-A sequence, unmasking of a poly-A sequence, alteration of the 5'- and/or 3'-UTR (such as incorporation of one or more 3'-UTRs), replacing one or more naturally occurring nucleotides with synthetic nucleotides (e.g, 5-methylcytidine for cytidine and/or pseudouridine (QJ) or N(l)-methylpseudouridine (mlQJ) or 5-methyluridine (m5U) for uridine), and codon optimization, has a synergistic influence on the stability of RNA (preferably mRNA) and increase in translation efficiency.
  • synthetic nucleotides e.g, 5-methylcytidine for cytidine and/or pseudouridine (QJ) or N(l)-methylpseudouridine (mlQJ) or 5-methyluridine (m5U) for
  • the RNA (in particular, mRNA) described in the present disclosure contains a combination of at least two, at least three, at least four or all five of the above-mentioned modifications, i.e., (i) incorporation of a 5'-cap structure, (ii) incorporation of a poly-A sequence, unmasking of a poly- A sequence; (iii) alteration of the 5'- and/or 3'-UTR (such as incorporation of one or more 3'-UTRs); (iv) replacing one or more naturally occurring nucleotides with synthetic nucleotides (e.g, 5-methylcytidine for cytidine and/or pseudouridine (QJ) or N(l)-methylpseudouridine (mlQJ) or 5-methyluridine (m5U) for uridine), and (v) codon optimization.
  • synthetic nucleotides e.g, 5-methylcytidine for cytidine and/or pseudouridine (QJ) or
  • the RNA (in particular, mRNA) described herein comprises a 5'-cap structure. In some embodiments, the RNA does not have uncapped 5'-triphosphates. In some embodiments, the RNA (in particular, mRNA) may comprise a conventional 5'-cap and/or a 5'-cap analog.
  • inventional 5'-cap refers to a cap structure found on the 5'-end of an RNA molecule and generally comprises a guanosine 5'-triphosphate (Gppp) which is connected via its triphosphate moiety to the 5'-end of the next nucleotide of the RNA (Ze., the guanosine is connected via a 5' to 5' triphosphate linkage to the rest of the RNA).
  • Gppp guanosine 5'-triphosphate
  • the guanosine may be methylated at position N 7 (resulting in the cap structure m 7 Gppp).
  • 5'-cap analog includes a 5'-cap which is based on a conventional 5'-cap but which has been modified at either the 2'- or 3'-position of the m 7 guanosine structure in order to avoid an integration of the 5'-cap analog in the reverse orientation (such 5'-cap analogs are also called anti-reverse cap analogs (ARCAs)).
  • ARCAs anti-reverse cap analogs
  • Particularly preferred 5'-cap analogs are those having one or more substitutions at the bridging and non-bridging oxygen in the phosphate bridge, such as phosphorothioate modified 5'-cap analogs at the p-phosphate (such as m2 7 ' 2 O G(5')ppSp(5')G (referred to as beta-S-ARCA or -S-ARCA)), as described in PCT/EP2019/056502.
  • phosphorothioate modified 5'-cap analogs at the p-phosphate such as m2 7 ' 2 O G(5')ppSp(5')G (referred to as beta-S-ARCA or -S-ARCA)
  • RNA in particular, mRNA
  • a 5'-cap structure as described herein may be achieved by in vitro transcription of a DNA template in presence of a corresponding 5'-cap compound, wherein said 5'-cap structure is co-transcriptionally incorporated into the generated RNA (in particular, mRNA) strand, or the RNA (in particular, mRNA) may be generated, for example, by in vitro transcription, and the 5'-cap structure may be attached to the RNA post-transcriptionally using capping enzymes, for example, capping enzymes of vaccinia virus.
  • capping enzymes for example, capping enzymes of vaccinia virus.
  • the RNA comprises a 5'-cap structure selected from the group consisting of m 2 7 ' 2 O G(5')ppSp(5')G (in particular its DI diastereomer), m2 7 ' 3 O G(5')ppp(5')G, and m2 7 ' 3 O Gppp(mi 2 ' °)ApG.
  • RNA comprises m2 7 ' 2 O G(5')ppSp(5')G (in particular its DI diastereomer) as 5'-cap structure.
  • RNA comprises m2 7 ' 3 ' 0 Gppp(mi 2 ' 0 )ApG as 5'-cap structure.
  • the RNA comprises a capO, capl, or cap2, preferably capl or cap2.
  • capO means the structure "m 7 GpppN", wherein N is any nucleoside bearing an OH moiety at position 2'.
  • capl means the structure "m 7 GpppNm”, wherein Nm is any nucleoside bearing an OCH3 moiety at position 2'.
  • cap2 means the structure "m 7 GpppNmNm", wherein each Nm is independently any nucleoside bearing an OCH3 moiety at position 2'.
  • the 5'-cap analog beta-S-ARCA (P-S-ARCA) has the following structure:
  • the "DI diastereomer of beta-S-ARCA" or "beta-S-ARCA(Dl)” is the diastereomer of beta-S-ARCA which elutes first on an HPLC column compared to the D2 diastereomer of beta-S-ARCA (beta-S-ARCA(D2)) and thus exhibits a shorter retention time.
  • the HPLC preferably is an analytical HPLC.
  • a Supelcosil LC-18-T RP column preferably of the format: 5 pm, 4.6 x 250 mm is used for separation, whereby a flow rate of 1.3 ml/min can be applied.
  • VWD UV-detection
  • FLD fluorescence detection
  • the 5'-cap analog m 2 7 ' 3 ' 0 Gppp(mi 2, 0 )ApG also referred to as m 2 7 ' 30 G(5')ppp(5')m 2 ' 0 ApG) which is a building block of a capl has the following structure:
  • An exemplary capO mRNA comprising p-S-ARCA and mRNA has the following structure:
  • An exemplary capO mRNA comprising m 2 7 ' 3 O G(5')ppp(5')G and mRNA has the following structure:
  • An exemplary capl mRNA comprising m2 7 ' 3 O Gppp(mi 2 ' °)ApG and mRNA has the following structure:
  • the RNA is unmodified RNA and comprises a 5'-cap, which is capl.
  • the RNA comprises modified nucleotides, nucleosides or nucleobases and a 5'-cap, which is capl.
  • such modified RNA comprises one or more modified uridines in place of unmodified uridines.
  • the modified RNA comprising the capl structure comprises modified uridines in place of all uridines, the modified uridines preferably being Nl-methyl-pseudouridine.
  • poly-A tail or "poly-A sequence” refers to an uninterrupted or interrupted sequence of adenylate residues which is typically located at the 3'-end of an RNA (in particular, mRNA) molecule.
  • Poly-A tails or poly-A sequences are known to those of skill in the art and may follow the 3'-UTR in the RNAs (in particular, mRNAs) described herein.
  • An uninterrupted poly-A tail is characterized by consecutive adenylate residues. In nature, an uninterrupted poly-A tail is typical.
  • RNAs in particular, mRNAs
  • RNAs can have a poly-A tail attached to the free 3'-end of the RNA by a template-independent RNA polymerase after transcription or a poly-A tail encoded by DNA and transcribed by a template-dependent RNA polymerase.
  • a poly-A tail of about 120 A nucleotides has a beneficial influence on the levels of RNA in transfected eukaryotic cells, as well as on the levels of protein that is translated from an open reading frame that is present upstream (S' of the poly-A tail (Holtkamp eta/., 2006, Blood, vol. 108, pp. 4009-4017).
  • the poly-A tail may be of any length.
  • a poly-A tail comprises, essentially consists of, or consists of at least 20, at least 30, at least 40, at least 80, or at least 100 and up to 500, up to 400, up to 300, up to 200, or up to 150 A nucleotides, and, in particular, about 120 A nucleotides.
  • nucleotides in the poly-A tail typically at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% by number of nucleotides in the poly-A tail are A nucleotides, but permits that remaining nucleotides are nucleotides other than A nucleotides, such as U nucleotides (uridylate), G nucleotides (guanylate), or C nucleotides (cytidylate).
  • consists of means that all nucleotides in the poly-A tail, i.e., 100% by number of nucleotides in the poly-A tail, are A nucleotides.
  • a nucleotide or “A” refers to adenylate.
  • a poly-A tail is attached during RNA transcription, e.g, during preparation of in vitro transcribed RNA, based on a DNA template comprising repeated dT nucleotides (deoxythymidylate) in the strand complementary to the coding strand.
  • the DNA sequence encoding a poly-A tail (coding strand) is referred to as poly(A) cassette.
  • the poly(A) cassette present in the coding strand of DNA essentially consists of dA nucleotides, but is interrupted by a random sequence of the four nucleotides (dA, dC, dG, and dT). Such random sequence may be 5 to 50, 10 to 30, or 10 to 20 nucleotides in length.
  • a cassette is disclosed in WO 2016/005324 Al, hereby incorporated by reference. Any poly(A) cassette disclosed in WO 2016/005324 Al may be used in the present disclosure.
  • a poly(A) cassette that essentially consists of dA nucleotides, but is interrupted by a random sequence having an equal distribution of the four nucleotides (dA, dC, dG, dT) and having a length of e.g., 5 to 50 nucleotides shows, on DNA level, constant propagation of plasmid DNA in £ co// and is still associated, on RNA level, with the beneficial properties with respect to supporting RNA stability and translational efficiency is encompassed.
  • the poly-A tail contained in an RNA (in particular, mRNA) molecule described herein essentially consists of A nucleotides, but is interrupted by a random sequence of the four nucleotides (A, C, G, U). Such random sequence may be 5 to 50, 10 to 30, or 10 to 20 nucleotides in length.
  • the poly(A) tail comprises 30 adenine nucleotides followed by 70 adenine nucleotides, wherein the 30 adenine nucleotides and 70 adenine nucleotides are separated by a linker sequence of 10 nucleotides.
  • no nucleotides other than A nucleotides flank a poly-A tail at its 3'-end, i.e., the poly-A tail is not masked or followed at its 3'-end by a nucleotide other than A.
  • a poly-A tail may comprise at least 20, at least 30, at least 40, at least 80, or at least 100 and up to 500, up to 400, up to 300, up to 200, or up to 150 nucleotides. In some embodiments, the poly-A tail may essentially consist of at least 20, at least 30, at least 40, at least 80, or at least 100 and up to 500, up to 400, up to 300, up to 200, or up to 150 nucleotides. In some embodiments, the poly-A tail may consist of at least 20, at least 30, at least 40, at least 80, or at least 100 and up to 500, up to 400, up to 300, up to 200, or up to 150 nucleotides.
  • the poly-A tail comprises the poly-A tail shown in SEQ ID NO: 55. In some embodiments, the poly- A tail comprises at least 100 nucleotides. In some embodiments, the poly-A tail comprises about 150 nucleotides. In some embodiments, the poly-A tail comprises about 120 nucleotides.
  • the term "untranslated region" or “UTR” relates to a region in a DNA molecule which is transcribed but is not translated into an amino acid sequence, or to the corresponding region in an RNA molecule, such as an mRNA molecule.
  • An untranslated region (UTR) can be present 5' (upstream) of an open reading frame (5'-UTR) and/or 3' (downstream) of an open reading frame (3'-UTR).
  • a 5'-UTR if present, is located at the 5'-end, upstream of the start codon of a proteinencoding region.
  • a 5'-UTR is downstream of the 5'-cap (if present), e.g., directly adjacent to the 5'-cap.
  • a 3'-UTR if present, is located at the 3'-end, downstream of the termination codon of a protein-encoding region, but the term "3'- UTR" does generally not include the poly-A sequence.
  • the 3'-UTR is upstream of the poly-A sequence (if present), e.g, directly adjacent to the poly-A sequence.
  • Incorporation of a 3'-UTR into the 3'-non translated region of an RNA (preferably mRNA) molecule can result in an enhancement in translation efficiency.
  • a synergistic effect may be achieved by incorporating two or more of such 3'-UTRs (which are preferably arranged in a head-to-tail orientation; cf., e.g, Holtkamp et al., Blood 108, 4009-4017 (2006)).
  • the 3'-UTRs may be autologous or heterologous to the RNA (e.g., mRNA) into which they are introduced.
  • the 3'-UTR is derived from a globin gene or mRNA, such as a gene or mRNA of alpha2-globin, alphal-globin, or beta-globin, e.g., beta-globin, e.g., human beta-globin.
  • the RNA may be modified by the replacement of the existing 3'-UTR with or the insertion of one or more, e.g., two copies of a 3'-UTR derived from a globin gene, such as alpha2-globin, alphal-globin, betaglobin, e.g., beta-globin, e.g., human beta-globin.
  • a globin gene such as alpha2-globin, alphal-globin, betaglobin, e.g., beta-globin, e.g., human beta-globin.
  • a 5'-UTR is or comprises a modified human alpha-globin 5'-UTR.
  • a particularly preferred 5'-UTR comprises the nucleotide sequence of SEQ ID NO: 53.
  • a 3'-UTR comprises a first sequence from the amino terminal enhancer of split (AES) messenger RNA and a second sequence from the mitochondrial encoded 12S ribosomal RNA.
  • a particularly preferred 3'-UTR comprises the nucleotide sequence of SEQ ID NO: 54.
  • RNA comprises a 5'-UTR comprising the nucleotide sequence of SEQ ID NO: 53, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 53.
  • RNA comprises a 3'-UTR comprising the nucleotide sequence of SEQ ID NO: 54, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 54.
  • RNA in particular, mRNA
  • RNA may have modified ribonucleotides in order to increase its stability and/or decrease immunogenicity and/or decrease cytotoxicity.
  • uridine in the RNA (in particular, mRNA) described herein is replaced (partially or completely, preferably completely) by a modified nucleoside.
  • the modified nucleoside is a modified uridine.
  • the modified uridine replacing uridine is selected from the group consisting of pseudouridine (ip), Nl-methyl-pseudouridine (mlip), 5-methyl-uridine (m5U), and combinations thereof.
  • the modified nucleoside replacing (partially or completely, preferably completely) uridine in the RNA may be any one or more of 3-methyl-uridine (m3U), 5-methoxy-uridine (mo5U), 5-aza-uridine, 6-aza-uridine, 2- thio-5-aza-uridine, 2-thio-uridine (s2U), 4-thio-uridine (s4U), 4-thio-pseudouridine, 2-thio-pseudouridine, 5-hydroxy- uridine (ho5U), 5-aminoallyl-uridine, 5-halo-uridine (e.g, 5-iodo-uridineor 5-bromo-uridine), uridine 5-oxyacetic acid (cmo5U), uridine 5-oxyacetic acid methyl ester (mcmo5U), 5-carboxymethyl-uridine (cm5U), 1-carboxymethyl- pseudouridine, 5-carboxyhydroxymethyl-uridine (chm5U), 5-car
  • RNA preferably mRNA which is modified by pseudouridine (replacing partially or completely, preferably completely, uridine) is referred to herein as "QJ-modified", whereas the term “m li -modified” means that the RNA (preferably mRNA) contains N(l)-methylpseudouridine (replacing partially or completely, preferably completely, uridine). Furthermore, the term “m5U-modified” means that the RNA (preferably mRNA) contains 5-methyluridine (replacing partially or completely, preferably completely, uridine).
  • RNAs usually exhibit decreased immunogenicity compared to their unmodified forms and, thus, are preferred in applications where the induction of an immune response is to be avoided or minimized.
  • the RNA preferably mRNA
  • the codons of the RNA (in particular, mRNA) described in the present disclosure may further be optimized, e.g., to increase the GC content of the RNA and/or to replace codons which are rare in the cell (or subject) in which the peptide or polypeptide of interest is to be expressed by codons which are synonymous frequent codons in said cell (or subject).
  • the amino acid sequence encoded by the RNA (in particular, mRNA) described in the present disclosure is encoded by a coding sequence which is codon-optimized and/or the G/C content of which is increased compared to wild type coding sequence.
  • This also includes embodiments, wherein one or more sequence regions of the coding sequence are codon-optimized and/or increased in the G/C content compared to the corresponding sequence regions of the wild type coding sequence.
  • the codon-optimization and/or the increase in the G/C content preferably does not change the sequence of the encoded amino acid sequence.
  • coding regions may be codon-optimized for optimal expression in a subject to be treated using the RNA (in particular, mRNA) described herein. Codon-optimization is based on the finding that the translation efficiency is also determined by a different frequency in the occurrence of tRNAs in cells. Thus, the sequence of RNA (in particular, mRNA) may be modified such that codons for which frequently occurring tRNAs are available are inserted in place of "rare codons".
  • the guanosine/cytosine (G/C) content of the coding region of the RNA (in particular, mRNA) described herein is increased compared to the G/C content of the corresponding coding sequence of the wild type RNA, wherein the amino acid sequence encoded by the RNA is preferably not modified compared to the amino acid sequence encoded by the wild type RNA.
  • This modification of the RNA sequence is based on the fact that the sequence of any RNA region to be translated is important for efficient translation of that RNA. Sequences having an increased G (guanosine)/C (cytosine) content are more stable than sequences having an increased A (adenosine)/U (uracil) content.
  • codons which contain A and/or U nucleotides can be modified by substituting these codons by other codons, which code for the same amino acids but contain no A and/or U or contain a lower content of A and/or U nucleotides.
  • the G/C content of the coding region of the RNA (in particular, mRNA) described herein is increased by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 55%, or even more compared to the G/C content of the coding region of the wild type RNA.
  • RNA in particular, mRNA
  • non-immunogenic RNA refers to RNA that does not induce a response by the immune system upon administration, e.g, to a mammal, or induces a weaker response than would have been induced by the same RNA that differs only in that it has not been subjected to the modifications and treatments that render the non-immunogenic RNA non-immunogenic, i.e., than would have been induced by standard RNA (stdRNA).
  • stdRNA standard RNA
  • non-immunogenic RNA is rendered non-immunogenic by incorporating modified nucleosides suppressing RNA-mediated activation of innate immune receptors into the RNA and/or limiting the amount of double-stranded RNA (dsRNA), e.g., by limiting the formation of double-stranded RNA (dsRNA), e.g., during in vitro transcription, and/or by removing double-stranded RNA (dsRNA), e.g., following in vitro transcription.
  • dsRNA double-stranded RNA
  • non-immunogenic RNA is rendered non-immunogenic by incorporating modified nucleosides suppressing RNA-mediated activation of innate immune receptors into the RNA and/or by removing double-stranded RNA (dsRNA), e.g., following in vitro transcription.
  • dsRNA double-stranded RNA
  • any modified nucleoside may be used as long as it lowers or suppresses immunogenicity of the RNA.
  • modified nucleosides that suppress RNA-mediated activation of innate immune receptors.
  • the modified nucleosides comprise a replacement of one or more uridines with a nucleoside comprising a modified nucleobase.
  • the modified nucleobase is a modified uracil.
  • the nucleoside comprising a modified nucleobase is selected from the group consisting of 3-methyl- uridine (m 3 U), 5-methoxy-uridine (mo 5 U), 5-aza-uridine, 6-aza-uridine, 2-thio-5-aza-uridine, 2-thio-uridine (s 2 U), 4- thio-uridine (s 4 U), 4-thio-pseudouridine, 2-thio-pseudouridine, 5-hydroxy-uridine (ho 5 U), 5-aminoallyl-uridine, 5-halo- uridine e.g, 5-iodo-uridine or 5-bromo-uridine), uridine 5-oxyacetic acid (cmo 5 U), uridine 5-oxyacetic acid methyl ester (mcmo 5 U), 5-carboxymethyl-uridine (cm 5 U), 1-carboxymethyl-pseudouridine, 5-carboxyhydroxymethyl-uridine (chm 5 U), 5-carboxyhydroxymethyl-uridine (ch
  • the nucleoside comprising a modified nucleobase is pseudouridine (ip), Nl-methyl-pseudouridine (mlip) or 5-methyl-uridine (m5U), in particular Nl-methyl-pseudouridine.
  • the replacement of one or more uridines with a nucleoside comprising a modified nucleobase comprises a replacement of at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, at least 10%, at least 25%, at least 50%, at least 75%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% of the uridines.
  • dsRNA double-stranded RNA
  • IVT in vitro transcription
  • dsRNA double-stranded RNA
  • formation of dsRNA can be limited during synthesis of mRNA by in vitro transcription (IVT), for example, by limiting the amount of uridine triphosphate (UTP) during synthesis.
  • UTP may be added once or several times during synthesis of mRNA.
  • dsRNA can be removed from RNA such as IVT RNA, for example, by ion-pair reversed phase HPLC using a non-porous or porous C-18 polystyrene-divinylbenzene (PS-DVB) matrix.
  • PS-DVB polystyrene-divinylbenzene
  • an enzymatic based method using E. co//RNaseIII that specifically hydrolyzes dsRNA but not ssRNA, thereby eliminating dsRNA contaminants from IVT RNA preparations can be used.
  • dsRNA can be separated from ssRNA by using a cellulose material.
  • an RNA preparation is contacted with a cellulose material and the ssRNA is separated from the cellulose material under conditions which allow binding of dsRNA to the cellulose material and do not allow binding of ssRNA to the cellulose material.
  • Suitable methods for providing ssRNA are disclosed, for example, in WO 2017/182524.
  • remove or “removal” refers to the characteristic of a population of first substances, such as non-immunogenic RNA, being separated from the proximity of a population of second substances, such as dsRNA, wherein the population of first substances is not necessarily devoid of the second substance, and the population of second substances is not necessarily devoid of the first substance.
  • a population of first substances characterized by the removal of a population of second substances has a measurably lower content of second substances as compared to the non-separated mixture of first and second substances.
  • the amount of double-stranded RNA is limited, e.g., dsRNA (especially dsmRNA) is removed from non-immunogenic RNA , such that less than 10%, less than 5%, less than 4%, less than 3%, less than 2%, less than 1%, less than 0.5%, less than 0.3%, less than 0.1%, less than 0.05%, less than 0.03%, less than 0.01%, less than 0.005%, less than 0.004%, less than 0.003%, less than 0.002%, less than 0.001%, or less than 0.0005% of the RNA in the non-immunogenic RNA composition is dsRNA.
  • dsRNA double-stranded RNA
  • the non-immunogenic RNA is free or essentially free of dsRNA.
  • the non-immunogenic RNA (especially mRNA) composition comprises a purified preparation of single-stranded nucleoside modified RNA.
  • the non-immunogenic RNA (especially mRNA) composition comprises single-stranded nucleoside modified RNA (especially mRNA) and is substantially free of double stranded RNA (dsRNA).
  • the non-immunogenic RNA (especially mRNA) composition comprises at least 90%, at least 91%, at least 92%, at least 93 %, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.9%, at least 99.99%, at least 99.991%, at least 99.992%, , at least 99.993%,, at least 99.994%, , at least 99.995%, at least 99.996%, at least 99.997%, or at least 99.998% single stranded nucleoside modified RNA, relative to all other nucleic acid molecules (DNA, dsRNA, etc.).
  • RNA may be taken as a measure for the amount of dsRNA in the sample.
  • a sample containing a known amount of dsRNA may be used as a reference.
  • RNA may be spotted onto a membrane, e.g., nylon blotting membrane.
  • the membrane may be blocked, e.g., in TBS-T buffer (20 mM TRIS pH 7.4, 137 mM NaCI, 0.1% (v/v) TWEEN-20) containing 5% (w/v) skim milk powder.
  • the membrane may be incubated with dsRNA-specific antibody, e.g., dsRNA-specific mouse mAb (English & Scientific Consulting, Szirak, Hungary).
  • the membrane After washing, e.g., with TBS-T, the membrane may be incubated with a secondary antibody, e.g., HRP-conjugated donkey anti-mouse IgG (Jackson ImmunoResearch, Cat #715-035-150), and the signal provided by the secondary antibody may be detected.
  • a secondary antibody e.g., HRP-conjugated donkey anti-mouse IgG (Jackson ImmunoResearch, Cat #715-035-150), and the signal provided by the secondary antibody may be detected.
  • the non-immunogenic RNA (especially mRNA) is translated in a cell more efficiently than standard RNA with the same sequence.
  • translation is enhanced by a factor of 2-fold relative to its unmodified counterpart.
  • translation is enhanced by a 3-fold factor.
  • translation is enhanced by a 4-fold factor.
  • translation is enhanced by a 5-fold factor.
  • translation is enhanced by a 6-fold factor.
  • translation is enhanced by a 7-fold factor.
  • translation is enhanced by an 8-fold factor.
  • translation is enhanced by a 9-fold factor.
  • translation is enhanced by a 10-fold factor.
  • translation is enhanced by a 15-fold factor. In some embodiments, translation is enhanced by a 20-fold factor. In some embodiments, translation is enhanced by a 50-fold factor. In some embodiments, translation is enhanced by a 100- fold factor. In some embodiments, translation is enhanced by a 200-fold factor. In some embodiments, translation is enhanced by a 500-fold factor. In some embodiments, translation is enhanced by a 1000-fold factor. In some embodiments, translation is enhanced by a 2000-fold factor. In some embodiments, the factor is 10-1000-fold. In some embodiments, the factor is 10-100-fold. In some embodiments, the factor is 10-200-fold. In some embodiments, the factor is 10-300-fold.
  • the factor is 10-500-fold. In some embodiments, the factor is 20-1000- fold. In some embodiments, the factor is 30-1000-fold. In some embodiments, the factor is 50-1000-fold. In some embodiments, the factor is 100-1000-fold. In some embodiments, the factor is 200-1000-fold. In some embodiments, translation is enhanced by any other significant amount or range of amounts.
  • the non-immunogenic RNA exhibits significantly less innate immunogenicity than standard RNA with the same sequence. In some embodiments, the non-immunogenic RNA (especially mRNA) exhibits an innate immune response that is 2-fold less than its unmodified counterpart. In some embodiments, innate immunogenicity is reduced by a 3-fold factor. In some embodiments, innate immunogenicity is reduced by a 4-fold factor. In some embodiments, innate immunogenicity is reduced by a 5-fold factor. In some embodiments, innate immunogenicity is reduced by a 6-fold factor. In some embodiments, innate immunogenicity is reduced by a 7-fold factor. In some embodiments, innate immunogenicity is reduced by an 8-fold factor.
  • innate immunogenicity is reduced by a 9-fold factor. In some embodiments, innate immunogenicity is reduced by a 10-fold factor. In some embodiments, innate immunogenicity is reduced by a 15-fold factor. In some embodiments, innate immunogenicity is reduced by a 20-fold factor. In some embodiments, innate immunogenicity is reduced by a 50-fold factor. In some embodiments, innate immunogenicity is reduced by a 100-fold factor. In some embodiments, innate immunogenicity is reduced by a 200-fold factor. In some embodiments, innate immunogenicity is reduced by a 500- fold factor. In some embodiments, innate immunogenicity is reduced by a 1000-fold factor. In some embodiments, innate immunogenicity is reduced by a 2000-fold factor.
  • the term "exhibits significantly less innate immunogenicity" refers to a detectable decrease in innate immunogenicity.
  • the term refers to a decrease such that an effective amount of the non-immunogenic RNA (especially mRNA) can be administered without triggering a detectable innate immune response.
  • the term refers to a decrease such that the non-immunogenic RNA (especially mRNA) can be repeatedly administered without eliciting an innate immune response sufficient to detectably reduce production of the protein encoded by the non-immunogenic RNA.
  • the decrease is such that the non-immunogenic RNA (especially mRNA) can be repeatedly administered without eliciting an innate immune response sufficient to eliminate detectable production of the protein encoded by the non-immunogenic RNA.
  • Immunogenicity is the ability of a foreign substance, such as RNA, to provoke an immune response in the body of a human or other animal.
  • the innate immune system is the component of the immune system that is relatively unspecific and immediate. It is one of two main components of the vertebrate immune system, along with the adaptive immune system.
  • Antigen-coding RNA and use thereof for inducing an immune response
  • RNA in particular, mRNA
  • the peptide or polypeptide for inducing an immune response is also designated herein as "vaccine antigen" or simply "antigen”.
  • the RNA in particular, mRNA
  • the RNA is translated into the respective protein upon entering cells of a subject being administered the RNA, e.g., muscle cells or antigen-presenting cells (APCs).
  • a subject e.g., muscle cells or antigen-presenting cells (APCs).
  • APCs antigen-presenting cells
  • the RNA encoding the vaccine antigen is expressed in cells of the subject to provide the vaccine antigen. In some embodiments, the RNA encoding the vaccine antigen is transiently expressed in cells of the subject. In some embodiments, the vaccine antigen is presented in the context of MHC. In some embodiments, the vaccine antigen is secreted by cells of the subject.
  • the RNA encoding the vaccine antigen is administered intramuscularly.
  • the RNA encoding the vaccine antigen is administered systemically, e.g., intravenously. In some embodiments, after systemic administration of the RNA encoding the vaccine antigen, expression of the RNA encoding the vaccine antigen in spleen occurs. In some embodiments, after systemic administration of the RNA encoding the vaccine antigen, expression of the RNA encoding the vaccine antigen in antigen presenting cells, preferably professional antigen presenting cells occurs. In some embodiments, the antigen presenting cells are selected from the group consisting of dendritic cells, macrophages and B cells.
  • RNA encoding the vaccine antigen after systemic administration of the RNA encoding the vaccine antigen, no or essentially no expression of the RNA encoding the vaccine antigen in lung and/or liver occurs. In some embodiments, after systemic administration of the RNA encoding the vaccine antigen, expression of the RNA encoding the vaccine antigen in spleen is at least 5-fold the amount of expression in lung.
  • a vaccine antigen comprises an epitope for inducing an immune response against a disease-associated antigen, e.g., a protein of an infectious agent (e.g., Mtb antigen), in a subject.
  • the vaccine antigen comprises an antigenic sequence for inducing an immune response against a disease-associated antigen in a subject.
  • Such antigenic sequence may correspond to a target antigen or disease-associated antigen, an immunogenic variant thereof, or an immunogenic fragment of the target antigen or disease-associated antigen or the immunogenic variant thereof.
  • the antigenic sequence may comprise at least an epitope of a target antigen or disease-associated antigen or an immunogenic variant thereof.
  • the antigenic sequences e.g., epitopes, suitable for use according to the disclosure typically may be derived from a target antigen, i.e. the antigen against which an immune response is to be elicited.
  • the antigenic sequences contained within the vaccine antigen may be a target antigen or a fragment or variant of a target antigen.
  • the antigenic sequence or a procession product thereof, e.g., a fragment thereof may bind to an antigen receptor such as TCR carried by immune effector cells.
  • the antigenic sequence is selected from the group consisting of the antigen expressed by a target cell to which the immune effector cells are targeted or a fragment thereof, or a variant of the antigenic sequence or the fragment.
  • a vaccine antigen which may be provided to a subject according to the present disclosure by administering RNA encoding the vaccine antigen preferably results in the induction of an immune response, e.g., in the stimulation, priming and/or expansion of immune effector cells, in the subject being provided the vaccine antigen.
  • Said immune response e.g., stimulated, primed and/or expanded immune effector cells, is preferably directed against a target antigen, in particular a target antigen expressed in diseased cells, tissues and/or organs, i.e., a disease-associated antigen.
  • a vaccine antigen may comprise the disease-associated antigen, or a fragment or variant thereof. In some embodiments, such fragment or variant is immunologically equivalent to the disease-associated antigen.
  • immunologically equivalent means that the immunologically equivalent molecule such as the immunologically equivalent amino acid sequence exhibits the same or essentially the same immunological properties and/or exerts the same or essentially the same immunological effects, e.g., with respect to the type of the immunological effect.
  • immunologically equivalent is preferably used with respect to the immunological effects or properties of antigens or antigen variants used for immunization.
  • an amino acid sequence is immunologically equivalent to a reference amino acid sequence if said amino acid sequence when exposed to the immune system of a subject induces an immune reaction having a specificity of reacting with the reference amino acid sequence.
  • a molecule which is immunologically equivalent to an antigen exhibits the same or essentially the same properties and/or exerts the same or essentially the same effects regarding the stimulation, priming and/or expansion of T cells as the antigen to which the T cells are targeted.
  • fragment of an antigen or “variant of an antigen” means an agent which results in the induction of an immune response, e.g., in the stimulation, priming and/or expansion of immune effector cells, which immune response, e.g., stimulated, primed and/or expanded immune effector cells, targets the antigen, i.e. a disease-associated antigen, in particular when presented by diseased cells, tissues and/or organs.
  • the vaccine antigen may correspond to or may comprise the disease-associated antigen, may correspond to or may comprise a fragment of the disease-associated antigen or may correspond to or may comprise an antigen which is homologous to the disease-associated antigen or a fragment thereof.
  • the vaccine antigen comprises a fragment of the disease-associated antigen or an amino acid sequence which is homologous to a fragment of the disease-associated antigen
  • said fragment or amino acid sequence may comprise an epitope of the disease-associated antigen to which the antigen receptor of the immune effector cells is targeted or a sequence which is homologous to an epitope of the disease-associated antigen.
  • a vaccine antigen may comprise an immunogenic fragment of a disease-associated antigen or an amino acid sequence being homologous to an immunogenic fragment of a disease-associated antigen.
  • an "immunogenic fragment of an antigen” preferably relates to a fragment of an antigen which is capable of inducing an immune response against, e.g., stimulating, priming and/or expanding immune effector cells carrying an antigen receptor binding to, the antigen or cells expressing the antigen.
  • the vaccine antigen (similar to the disease-associated antigen) provides the relevant epitope for binding by the antigen receptor present on the immune effector cells.
  • the vaccine antigen or a fragment thereof is expressed on the surface of a cell such as an antigen-presenting cell (optionally in the context of MHC) so as to provide the relevant epitope for binding by immune effector cells.
  • the vaccine antigen may be a recombinant antigen.
  • the RNA encoding the vaccine antigen is expressed in cells of a subject to provide the antigen or a procession product thereof for binding by the antigen receptor expressed by immune effector cells, said binding resulting in stimulation, priming and/or expansion of the immune effector cells.
  • an “antigen” covers any substance that will elicit an immune response and/or any substance against which an immune response or an immune mechanism such as a cellular response and/or humoral response is directed. This also includes situations wherein the antigen is processed into antigen peptides and an immune response or an immune mechanism is directed against one or more antigen peptides, in particular if presented in the context of MHC molecules.
  • an “antigen” relates to any substance, such as a peptide or polypeptide, that reacts specifically with antibodies or T-lymphocytes (T-cells).
  • the term "antigen" may comprise a molecule that comprises at least one epitope, such as a T cell epitope.
  • an antigen is a molecule which, optionally after processing, induces an immune reaction, which may be specific for the antigen (including cells expressing the antigen).
  • an antigen is a disease-associated antigen, such as an Mtb antigen.
  • an antigen is presented or present on the surface of cells of the immune system such as antigen presenting cells like dendritic cells or macrophages.
  • An antigen or a procession product thereof such as a T cell epitope is in some embodiments bound by an antigen receptor. Accordingly, an antigen or a procession product thereof may react specifically with immune effector cells such as T-lymphocytes (T cells).
  • an antigen or a combination of antigens described herein may induce an immune response, wherein the immune response may comprise a humoral or cellular immune response, or both.
  • the antigen is presented by a cell, such as by an antigen presenting cell, in the context of MHC molecules, which results in an immune response against the antigen.
  • An antigen may be a product which corresponds to or is derived from a naturally occurring antigen. According to the present disclosure, an antigen may correspond to a naturally occurring product.
  • disease-associated antigen is used in its broadest sense to refer to any antigen associated with a disease.
  • a disease-associated antigen is a molecule which contains epitopes that will stimulate a host's immune system to make a cellular antigen-specific immune response and/or a humoral antibody response against the disease.
  • Disease-associated antigens include pathogen-associated antigens, i.e., antigens which are associated with infection by microbes, typically microbial antigens (such as bacterial or viral antigens, e.g., Mtb antigens), or antigens associated with cancer, typically tumors, such as tumor antigens.
  • bacterial antigen refers to any bacterial component having antigenic properties, i.e. being able to provoke an immune response in an individual.
  • the bacterial antigen may be derived from the cell wall or cytoplasm membrane of the bacterium.
  • bacterial antigen includes Mtb antigens, e.g., Mtb antigens as described herein.
  • epitope refers to an antigenic determinant in a molecule such as an antigen, i.e., to a part in or fragment of the molecule that is recognized by the immune system, for example, that is recognized by antibodies, T cells or B cells, in particular when presented in the context of MHC molecules.
  • An epitope of a protein may comprises a continuous or discontinuous portion of said protein and, e.g., may be between about 5 and about 100, between about 5 and about 50, between about 8 and about 30, or about 10 and about 25 amino acids in length, for example, the epitope may be preferably 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids in length.
  • the epitope in the context of the present disclosure is a T cell epitope.
  • an antigen which is, e.g., capable of eliciting an immune response against the antigen or a cell expressing or comprising and presenting the antigen.
  • the terms relate to an immunogenic portion of an antigen. In some embodiments, it is a portion of an antigen that is recognized (Ze., specifically bound) by a T cell receptor, in particular if presented in the context of MHC molecules. Certain preferred immunogenic portions bind to an MHC class I or class II molecule.
  • epitope refers to a part or fragment of a molecule such as an antigen that is recognized by the immune system.
  • the epitope may be recognized by T cells, B cells or antibodies.
  • An epitope of an antigen may include a continuous or discontinuous portion of the antigen and may be between about 5 and about 100, such as between about 5 and about 50, between about 8 and about 30, or between about 8 and about 25 amino acids in length, for example, the epitope may be 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids in length. In some embodiments, an epitope is between about 10 and about 25 amino acids in length.
  • epitope includes T cell epitopes.
  • T cell epitope refers to a part or fragment of a protein that is recognized by a T cell when presented in the context of MHC molecules, including epitopes predicted by bioinformatic means.
  • major histocompatibility complex and the abbreviation "MHC” includes MHC class I and MHC class II molecules and relates to a complex of genes which is present in all vertebrates. MHC proteins or molecules are important for signaling between lymphocytes and antigen presenting cells or diseased cells in immune reactions, wherein the MHC proteins or molecules bind peptide epitopes and present them for recognition by T cell receptors on T cells.
  • the proteins encoded by the MHC are expressed on the surface of cells, and display both self-antigens (peptide fragments from the cell itself) and non-self- antigens e.g, fragments of invading microorganisms) to a T cell.
  • the binding peptides are typically about 8 to about 10 amino acids long although longer or shorter peptides may be effective.
  • the binding peptides are typically about 10 to about 25 amino acids long and are in particular about 13 to about 18 amino acids long, whereas longer and shorter peptides may be effective.
  • vaccine antigen i.e., an antigen whose inoculation into a subject induces an immune response
  • the vaccine antigen is recognized by an immune effector cell.
  • the vaccine antigen if recognized by an immune effector cell is able to induce in the presence of appropriate co-stimulatory signals, stimulation, priming and/or expansion of the immune effector cell carrying an antigen receptor recognizing the vaccine antigen.
  • the vaccine antigen may be, e.g., presented or present on the surface of a cell, such as an antigen presenting cell.
  • an antigen is expressed in a diseased cell (such as an infected cell).
  • an antigen is presented by a diseased cell (such as an infected cell).
  • an antigen receptor is a TCR which binds to an epitope of an antigen presented in the context of MHC.
  • binding of a TCR when expressed by T cells and/or present on T cells to an antigen presented by cells such as antigen presenting cells results in stimulation, priming and/or expansion of said T cells.
  • binding of a TCR when expressed by T cells and/or present on T cells to an antigen presented on diseased cells results in cytolysis and/or apoptosis of the diseased cells, wherein said T cells release cytotoxic factors, e.g., perforins and granzymes.
  • an antigen receptor is an antibody or B cell receptor which binds to an epitope in an antigen. In some embodiments, an antibody or B cell receptor binds to native epitopes of an antigen.
  • T cell and 'T lymphocyte
  • T helper cells CD4+ T cells
  • CTLs cytotoxic T cells
  • antigen-specific T cell or similar terms relate to a T cell which recognizes the antigen to which the T cell is targeted, in particular when presented on the surface of antigen presenting cells or diseased cells in the context of MHC molecules and preferably exerts effector functions of T cells.
  • T cells are considered to be specific for antigen if the cells kill target cells expressing an antigen. T cell specificity may be evaluated using any of a variety of standard techniques, for example, within a chromium release assay or proliferation assay. Alternatively, synthesis of lymphokines (such as interferon-y) can be measured.
  • the term "target” shall mean an agent such as a cell or tissue which is a target for an immune response such as a cellular immune response.
  • Targets include cells that present an antigen or an antigen epitope, i.e., a peptide fragment derived from an antigen.
  • the target cell is a cell expressing an antigen and presenting said antigen with class I MHC.
  • Antigen processing refers to the degradation of an antigen into processing products which are fragments of said antigen (e.g, the degradation of a polypeptide into peptides) and the association of one or more of these fragments e.g, via binding) with MHC molecules for presentation by cells, such as antigen-presenting cells to specific T-cells.
  • Antigen-presenting cells can be distinguished in professional antigen presenting cells and non-professional antigen presenting cells.
  • the term "professional antigen presenting cells” relates to antigen presenting cells which constitutively express the Major Histocompatibility Complex class II (MHC class II) molecules required for interaction with naive T cells. If a T cell interacts with the MHC class II molecule complex on the membrane of the antigen presenting cell, the antigen presenting cell produces a co-stimulatory molecule inducing activation of the T cell.
  • Professional antigen presenting cells comprise dendritic cells and macrophages.
  • non-professional antigen presenting cells relates to antigen presenting cells which do not constitutively express MHC class II molecules, but upon stimulation by certain cytokines such as interferon-gamma.
  • exemplary, non- professional antigen presenting cells include fibroblasts, thymic epithelial cells, thyroid epithelial cells, glial cells, pancreatic beta cells or vascular endothelial cells.
  • dendritic cell refers to a subtype of phagocytic cells belonging to the class of antigen presenting cells.
  • dendritic cells are derived from hematopoietic bone marrow progenitor cells. These progenitor cells initially transform into immature dendritic cells. These immature cells are characterized by high phagocytic activity and low T cell activation potential. Immature dendritic cells constantly sample the surrounding environment for pathogens such as viruses and bacteria. Once they have come into contact with a presentable antigen, they become activated into mature dendritic cells and begin to migrate to the spleen or to the lymph node.
  • Immature dendritic cells phagocytose pathogens and degrade their proteins into small pieces and upon maturation present those fragments at their cell surface using MHC molecules. Simultaneously, they upregulate cell-surface receptors that act as co-receptors in T cell activation such as CD80, CD86, and CD40 greatly enhancing their ability to activate T cells. They also upregulate CCR7, a chemotactic receptor that induces the dendritic cell to travel through the blood stream to the spleen or through the lymphatic system to a lymph node. Here they act as antigen-presenting cells and activate helper T cells and killer T cells as well as B cells by presenting them antigens, alongside non-antigen specific co-stimulatory signals. Thus, dendritic cells can actively induce a T cell- or B cell-related immune response. In some embodiments, the dendritic cells are splenic dendritic cells.
  • macrophage refers to a subgroup of phagocytic cells produced by the differentiation of monocytes. Macrophages which are activated by inflammation, immune cytokines or microbial products nonspecifically engulf and kill foreign pathogens within the macrophage by hydrolytic and oxidative attack resulting in degradation of the pathogen. Peptides from degraded proteins are displayed on the macrophage cell surface where they can be recognized by T cells, and they can directly interact with antibodies on the B cell surface, resulting in T and B cell activation and further stimulation of the immune response. Macrophages belong to the class of antigen presenting cells. In some embodiments, the macrophages are splenic macrophages.
  • antigen-responsive CTL is meant a CD8 + T-cell that is responsive to an antigen or a peptide derived from said antigen, which is presented with class I MHC on the surface of antigen presenting cells.
  • CTL responsiveness may include sustained calcium flux, cell division, production of cytokines such as IFN-y and TNF-a, up-regulation of activation markers such as CD44 and CD69, and specific cytolytic killing of tumor antigen expressing target cells.
  • CTL responsiveness may also be determined using an artificial reporter that accurately indicates CTL responsiveness.
  • Activation refers to the state of a cell that has been sufficiently stimulated to induce detectable cellular proliferation, such as an immune effector cell such as T cell. Activation can also be associated with initiation of signaling pathways, induced cytokine production, and detectable effector functions.
  • activated immune effector cells refers to, among other things, immune effector cells that are undergoing cell division.
  • the term "priming" refers to a process wherein an immune effector cell such as a T cell has its first contact with its specific antigen and causes differentiation into effector cells such as effector T cells.
  • expansion refers to a process wherein a specific entity is multiplied.
  • the term is used in the context of an immunological response in which immune effector cells are stimulated by an antigen, proliferate, and the specific immune effector cell recognizing said antigen is amplified.
  • expansion leads to differentiation of the immune effector cells.
  • immune response and “immune reaction” are used herein interchangeably in their conventional meaning and refer to an integrated bodily response to an antigen and may refer to a cellular immune response, a humoral immune response, or both.
  • the term "immune response to” or “immune response against” with respect to an agent such as an antigen, cell or tissue relates to an immune response such as a cellular response directed against the agent.
  • An immune response may comprise one or more reactions selected from the group consisting of developing antibodies against one or more antigens and expansion of antigen-specific T-lymphocytes, such as CD4 + and CD8 + T-lymphocytes, e.g. CD8 + T-lymphocytes, which may be detected in various proliferation or cytokine production tests in vitro.
  • inducing an immune response and “eliciting an immune response” and similar terms in the context of the present disclosure refer to the induction of an immune response, such as the induction of a cellular immune response, a humoral immune response, or both.
  • the immune response may be protective/preventive/prophylactic and/or therapeutic.
  • the immune response may be directed against any immunogen or antigen or antigen peptide, such as against a pathogen-associated antigen e.g, an antigen of Mtb).
  • “Inducing” in this context may mean that there was no immune response against a particular antigen or pathogen before induction, but it may also mean that there was a certain level of immune response against a particular antigen or pathogen before induction and after induction said immune response is enhanced.
  • inducing the immune response in this context also includes “enhancing the immune response”.
  • said individual after inducing an immune response in an individual, said individual is protected from developing a disease such as an infectious disease or the disease condition is ameliorated by inducing an immune response.
  • cellular immune response means to include a cellular response directed to cells characterized by expression of an antigen and/or presentation of an antigen with class I or class II MHC.
  • the cellular response relates to cells called T cells or T lymphocytes which act as either "helpers” or “killers".
  • the helper T cells also termed CD4 + T cells
  • the killer cells also termed cytotoxic T cells, cytolytic T cells, CD8 + T cells or CTLs kill cells such as diseased cells.
  • the term "humoral immune response” refers to a process in living organisms wherein antibodies are produced in response to agents and organisms, which they ultimately neutralize and/or eliminate.
  • the specificity of the antibody response is mediated by T and/or B cells through membrane-associated receptors that bind antigen of a single specificity.
  • B lymphocytes divide, which produces memory B cells as well as antibody secreting plasma cell clones, each producing antibodies that recognize the identical antigenic epitope as was recognized by its antigen receptor.
  • Memory B lymphocytes remain dormant until they are subsequently activated by their specific antigen. These lymphocytes provide the cellular basis of memory and the resulting escalation in antibody response when re-exposed to a specific antigen.
  • antibody refers to an immunoglobulin molecule, which is able to specifically bind to an epitope on an antigen.
  • antibody refers to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds.
  • antibody includes monoclonal antibodies, recombinant antibodies, human antibodies, humanized antibodies, chimeric antibodies and combinations of any of the foregoing.
  • Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (CH).
  • VL light chain variable region
  • CL light chain constant region
  • variable regions and constant regions are also referred to herein as variable domains and constant domains, respectively.
  • the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs).
  • CDRs complementarity determining regions
  • FRs framework regions
  • Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the CDRs of a VH are termed HCDR1, HCDR2 and HCDR3, the CDRs of a VL are termed LCDR1, LCDR2 and LCDR3.
  • variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of an antibody comprise the heavy chain constant region (CH) and the light chain constant region (CL), wherein CH can be further subdivided into constant domain CHI, a hinge region, and constant domains CH2 and CH3 (arranged from amino-terminus to carboxy-terminus in the following order: CHI, CH2, CH3).
  • the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system e.g, effector cells) and the first component (Clq) of the classical complement system.
  • Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoactive portions of intact immunoglobulins. Antibodies are typically tetramers of immunoglobulin molecules. Antibodies may exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, Fv, Fab and F(ab)2, as well as single chain antibodies and humanized antibodies.
  • immunoglobulin relates to proteins of the immunoglobulin superfamily, such as to antigen receptors such as antibodies or the B cell receptor (BCR).
  • the immunoglobulins are characterized by a structural domain, i.e., the immunoglobulin domain, having a characteristic immunoglobulin (Ig) fold.
  • the term encompasses membrane bound immunoglobulins as well as soluble immunoglobulins.
  • Membrane bound immunoglobulins are also termed surface immunoglobulins or membrane immunoglobulins, which are generally part of the BCR. Soluble immunoglobulins are generally termed antibodies.
  • Immunoglobulins generally comprise several chains, typically two identical heavy chains and two identical light chains which are linked via disulfide bonds.
  • immunoglobulin domains such as the VL (variable light chain) domain, CL (constant light chain) domain, VH (variable heavy chain) domain, and the CH (constant heavy chain) domains CHI, CH2, CH3, and CH4.
  • immunoglobulin heavy chains There are five types of mammalian immunoglobulin heavy chains, i.e., a, 8, E, y, and
  • the heavy chains of membrane or surface immunoglobulins comprise a transmembrane domain and a short cytoplasmic domain at their carboxy-terminus.
  • the immunoglobulin chains comprise a variable region and a constant region.
  • the constant region is essentially conserved within the different isotypes of the immunoglobulins, wherein the variable part is highly divers and accounts for antigen recognition.
  • vaccination and “immunization” describe the process of treating an individual for therapeutic or prophylactic reasons and relate to the procedure of administering one or more immunogen(s) or antigen(s) or derivatives thereof, in particular in the form of RNA (especially mRNA) coding therefor, as described herein to an individual and stimulating an immune response against said one or more immunogen(s) or antigen(s) or cells characterized by presentation of said one or more immunogen(s) or antigen(s).
  • RNA especially mRNA
  • cell characterized by presentation of an antigen or “cell presenting an antigen” or “MHC molecules which present an antigen on the surface of an antigen presenting cell” or similar expressions is meant a cell such as a diseased cell, in particular an infected cell, or an antigen presenting cell presenting the antigen or an antigen peptide, either directly or following processing, in the context of MHC molecules, such as MHC class I and/or MHC class II molecules.
  • the MHC molecules are MHC class I molecules.
  • RNA pharmaceutical compositions may be used herein, namely non-modified uridine containing mRNA (uRNA), nucleoside modified mRNA (modRNA), self-amplifying RNA (saRNA), and transamplifying RNAs.
  • uRNA non-modified uridine containing mRNA
  • modRNA nucleoside modified mRNA
  • saRNA self-amplifying RNA
  • transamplifying RNAs RNA
  • modified uridine e.g., pseudouridine
  • pseudouridine may include reduced adjuvant effect, blunted immune innate immune sensor activating capacity and thus augmented polypeptide ⁇ e.g., protein) expression.
  • self-amplifying platform may include, for example, long duration of polypeptide e.g., protein) expression, good tolerability and safety, higher likelihood for efficacy with very low RNA dose.
  • polypeptide e.g., protein
  • a self-amplifying platform ⁇ e.g., RNA
  • a selfamplifying platform ⁇ e.g., RNA) comprises a plurality of nucleic acid molecules, wherein said nucleic acids encode a plurality of replicases and/or replicons.
  • a /rans-replication system comprises the presence of both nucleic acid molecules in a single host cell.
  • a nucleic acid encoding a replicase ⁇ e.g., a viral replicase is not capable of self-replication in a target cell and/or target organism.
  • a nucleic acid encoding a replicase ⁇ e.g., a viral replicase lacks at least one conserved sequence element important for (-) strand synthesis based on a (+) strand template and/or for (+) strand synthesis based on a (-) strand template.
  • a self-amplifying RNA comprises a 3' untranslated region (UTR), a 5' UTR, a cap structure, a poly adenine (polyA) tail, and any combinations thereof.
  • a self-amplifying platform does not require propagation of virus particles e.g., is not associated with undesired virus-particle formation). In some embodiments, a self-amplifying platform is not capable of forming virus particles.
  • RNA e.g., a single stranded RNA described herein has a length of at least 500 ribonucleotides (such as, e.g., at least 600 ribonucleotides, at least 700 ribonucleotides, at least 800 ribonucleotides, at least 900 ribonucleotides, at least 1000 ribonucleotides, at least 1250 ribonucleotides, at least 1500 ribonucleotides, at least 1750 ribonucleotides, at least 2000 ribonucleotides, at least 2500 ribonucleotides, at least 3000 ribonucleotides, at least 3500 ribonucleotides, at least 4000 ribonucleotides, at least 4500 ribonucleotides, at least 5000 ribonucleotides, or longer).
  • RNA described herein is
  • a relevant RNA includes a polypeptide-encoding portion or a plurality of polypeptide-encoding portions.
  • such a portion or portions encode one or more polypeptides which are not endogenous (i.e., it is foreign) to the subject treated.
  • the RNA described herein is single-stranded RNA (in particular, mRNA) that may be translated into the respective protein upon entering cells, e.g., cells of a recipient, e.g., muscle cells or antigen- presenting cells (APCs).
  • mRNA single-stranded RNA
  • the RNA may contain one or more structural elements optimized for maximal efficacy of the RNA with respect to stability and translational efficiency (5' cap, 5' UTR, 3' UTR, poly(A)-tail). In some embodiments, the RNA contains all of these elements.
  • beta-S-ARCA(Dl) (m2 7 ' 2 ' °GppSpG) or m2 7 ' 3 ' °Gppp(mi 2 ' °)ApG may be utilized as specific capping structure at the 5'-end of the RNA.
  • 5'-UTR sequence the 5'-UTR sequence of the human alphaglobin mRNA, optionally with an optimized 'Kozak sequence' to increase translational efficiency may be used.
  • FI element a combination of two sequence elements derived from the "amino terminal enhancer of split" (AES) mRNA (called F) and the mitochondrial encoded 12S ribosomal RNA (called I) placed between the coding sequence and the poly(A)-tail to assure higher maximum protein levels and prolonged persistence of the mRNA
  • F amino terminal enhancer of split
  • I mitochondrial encoded 12S ribosomal RNA
  • a poly(A)-tail measuring 110 nucleotides in length, consisting of a stretch of 30 adenosine residues, followed by a 10 nucleotide linker sequence (of random nucleotides) and another 70 adenosine residues may be used.
  • the 5'-UTR comprises the nucleotide sequence of SEQ ID NO: 53, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 53.
  • the 3'-UTR comprises the nucleotide sequence of SEQ ID NO: 54, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 54.
  • the poly(A) sequence comprises the nucleotide sequence of SEQ ID NO: 55, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 55.
  • the RNA described herein is not chemically modified, i.e. it solely contains naturally occurring nucleosides, and preferably has the composition of naturally occurring RNA.
  • the RNA described herein is modified for optimized efficacy of the RNA (e.g., increased translation efficacy, decreased immunogenicity, and/or decreased cytotoxicity) (e.g., by replacing (partially or completely, preferably completely) naturally occurring nucleosides (in particular uridine) with synthetic nucleosides (e.g., modified nucleosides, e.g., selected from the group consisting of pseudouridine (ip), Nl-methyl-pseudouridine (mlip), and 5-methyl-uridine); and/or codon-optimization).
  • the RNA comprises a modified nucleoside in place of uridine.
  • the modified nucleoside replacing (partially or completely, preferably completely) uridine is selected from the group consisting of pseudouridine (i ), Nl-methyl-pseudouridine (mli ), and 5-methyl-uridine.
  • the RNA encoding the vaccine antigen has a coding sequence (a) which is codon-optimized, (b) the G/C content of which is increased compared to the wild type coding sequence, or (c) both (a) and (b).
  • the RNA described herein comprises a 5' cap, a 5' UTR, a 3' UTR, and a poly(A) sequence (e.g., as described above); is modified by replacing (partially or completely, preferably completely) uridine with modified nucleosides, e.g., selected from the group consisting of pseudouridine (i ), Nl-methyl-pseudouridine (mlip), and 5- methyl-uridine; and has a coding sequence which is codon-optimized, and the G/C content of which is increased compared to the wild type coding sequence.
  • pseudouridine i
  • mlip Nl-methyl-pseudouridine
  • 5- methyl-uridine 5- methyl-uridine
  • RNA molecules if the present disclosure provides for a mixture of different RNA molecules, a composition comprising different RNA molecules or an administration of different RNA molecules, these different RNA molecules are present in approximately the same amount.
  • Such different RNA molecules may be formulated in individual particulate formulations, mixed particulate formulations, or combined particulate formulations as described herein.
  • RNA in particular, mRNA
  • RNA comprising a nucleic acid sequence encoding an Mtb antigen, an immunogenic variant thereof, or an immunogenic fragment of the Mtb antigen or the immunogenic variant thereof.
  • RNA (in particular, mRNA) described in the present disclosure comprises a nucleic acid sequence encoding an Mtb antigen, an immunogenic variant thereof, or an immunogenic fragment of the Mtb antigen or the immunogenic variant thereof, and is capable of expressing said Mtb antigen, immunogenic variant, or immunogenic fragment, in particular if transferred into a cell or subject, preferably a human cell or subject.
  • the RNA (in particular, mRNA) described in the present disclosure contains a coding region (open reading frame (ORF)) encoding an Mtb antigen, an immunogenic variant thereof, or an immunogenic fragment of the Mtb antigen or the immunogenic variant thereof.
  • ORF open reading frame
  • RNA comprises a nucleic acid sequence encoding more than one Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof, e.g., two, three, four or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof. In some embodiments, two or more of such Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof are present as a fusion protein.
  • the one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof encoded by the RNA may comprise or consist of naturally occurring sequences, may comprise or consist of variants of naturally occurring sequences, or may comprise or consist of sequences which are not naturally occurring, e.g., recombinant sequences.
  • the peptide or polypeptide encoded by the RNA described herein may consist of the one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof, or may comprise the one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof and may comprise additional sequences such as secretion signals, extended-PK groups, tags and any other sequences.
  • the additional sequences are fused to the one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof, in some embodiments, separated by a linker.
  • the one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof may be considered the pharmaceutically active peptide or polypeptide even if additional sequences support the function or effect of the one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof.
  • the term "pharmaceutically active peptide or polypeptide” means a peptide or polypeptide that can be used in the treatment of an individual where the expression of the peptide or polypeptide would be of benefit, e.g., in ameliorating the symptoms of a disease.
  • a pharmaceutically active peptide or polypeptide has curative or palliative properties and may be administered to ameliorate, relieve, alleviate, reverse, delay onset of or lessen the severity of one or more symptoms of a disease.
  • a pharmaceutically active peptide or polypeptide has a positive or advantageous effect on the condition or disease state of an individual when administered to the individual in a therapeutically effective amount.
  • a pharmaceutically active peptide or polypeptide may have prophylactic properties and may be used to delay the onset of a disease or to lessen the severity of such disease.
  • pharmaceutically active peptide or polypeptide includes entire peptides or polypeptides, and can also refer to pharmaceutically active fragments thereof. It can also include pharmaceutically active variants and/or analogs of a peptide or polypeptide.
  • pharmaceutically active peptides and polypeptides include, but are not limited to, antigens for vaccination such as Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof.
  • Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof described herein can be prepared as fusion or chimeric polypeptides that include a portion which corresponds to three or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof and a heterologous polypeptide (i.e., a polypeptide that is not an Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof).
  • a heterologous polypeptide i.e., a polypeptide that is not an Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof.
  • a "signal peptide” (or signal sequence) is fused, either directly or through a linker, to the N-terminus of a chimeric protein described herein.
  • an open reading frame of the RNA described herein encodes a polypeptide that includes a signal sequence, e.g., that is functional in mammalian cells.
  • a utilized signal sequence is "intrinsic" in that it is, in nature, associated with (e.g., linked to) the full-length antigen or antigen fragment whose sequences are included in the encoded chimeric protein.
  • a utilized signal sequence is non-native to the encoded polypeptide - e.g., is not naturally part of a full-length antigen or antigen fragment whose sequences are included in the encoded chimeric protein.
  • signal peptides are sequences, which are typically characterized by a length of about 15 to 30 amino acids.
  • signal peptides are positioned at the N-terminus of an encoded chimeric protein as described herein, without being limited thereto.
  • signal peptides preferably allow the transport of the polypeptide encoded by RNAs of the present disclosure with which they are associated into a defined cellular compartment, preferably the cell surface, the endoplasmic reticulum (ER) or the endosomal-lysosomal compartment.
  • an RNA sequence encodes a peptidoglycan hydrolase, e.g., an endolysin, that may comprise or otherwise be linked to a signal sequence (e.g., secretory sequence), such as those listed in Table 2 and 3, or a sequence having 1, 2, 3, 4, or 5 amino acid differences relative thereto.
  • a signal sequence such as MRVMAPRTLILLLSGALALTETWAGS [SEQ ID NO: 17], or a sequence having 1, 2, 3, 4, or at the most 5 amino acid differences relative thereto is utilized.
  • a signal peptide is selected from those included in the Table 2 below and/or those encoded by the sequences in Table 3 below or a sequence having 1, 2, 3, 4, or 5 amino acid differences relative thereto:
  • an amino acid sequence enhancing antigen processing and/or presentation is fused, either directly or through a linker, to an antigenic peptide or polypeptide (antigenic sequence), e.g., one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof.
  • antigenic sequence e.g., one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof.
  • the RNA described herein comprises at least one coding region encoding an antigenic peptide or polypeptide and an amino acid sequence enhancing antigen processing and/or presentation.
  • the transmembrane domain and/or trafficking signal is positioned at the C-terminus of a chimeric protein described herein.
  • the amino acid sequence enhancing antigen processing and/or presentation includes, without being limited thereto, sequences derived from Human herpes simplex virus 1, envelope glycoprotein D (HSV-gDl), in particular a sequence comprising the amino acid sequence of SEQ ID NO: 140. Such sequence is designated herein as HSV-TMD.
  • HSV-gDl Human herpes simplex virus 1, envelope glycoprotein D
  • an amino acid sequence enhancing antigen processing and/or presentation comprises the amino acid sequence of SEQ ID NO: 140, an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 140, or a functional fragment of the amino acid sequence of SEQ ID NO: 140, or the amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 140.
  • an amino acid sequence enhancing antigen processing and/or presentation comprises the amino acid sequence of SEQ ID NO: 140.
  • the amino acid sequence enhancing antigen processing and/or presentation as defined herein includes, without being limited thereto, sequences derived from the human MHC class I complex (HLA-B51, haplotype A2, B27/B51, Cw2/Cw3), in particular a sequence comprising the amino acid sequence of SEQ ID NO: 52 or a functional variant thereof.
  • sequences derived from the human MHC class I complex HLA-B51, haplotype A2, B27/B51, Cw2/Cw3
  • sequence which includes a transmembrane domain and a trafficking signal derived from human MHC class I, is designated herein as MITD.
  • an amino acid sequence enhancing antigen processing and/or presentation comprises the amino acid sequence of SEQ ID NO: 52, an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 52, or a functional fragment of the amino acid sequence of SEQ ID NO: 52, or the amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 52.
  • an amino acid sequence enhancing antigen processing and/or presentation comprises the amino acid sequence of SEQ ID NO: 52.
  • the RNA described herein comprises at least one coding region encoding an antigenic peptide or polypeptide and an amino acid sequence enhancing antigen processing and/or presentation, said amino acid sequence enhancing antigen processing and/or presentation preferably being fused to the antigenic peptide or polypeptide, more preferably to the C-terminus of the antigenic peptide or polypeptide as described herein.
  • a secretory sequence e.g., a sequence comprising the amino acid sequence selected from SEQ ID NOs: 17 to 37 or 65 or encoded by the nucleotide sequence selected from SEQ ID NOs: 38 to 51, may be fused to the N- terminus of the antigenic peptide or polypeptide.
  • Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof may be fused to an extended-PK group, which increases circulation half-life.
  • extended-PK groups are described herein. It should be understood that other PK groups that increase the circulation half-life of peptides or polypeptides such as Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof are also applicable to the present disclosure.
  • the extended-PK group is a serum albumin domain (e.g., mouse serum albumin, human serum albumin, or recombinant serum albumin).
  • PK is an acronym for "pharmacokinetic” and encompasses properties of a compound including, by way of example, absorption, distribution, metabolism, and elimination by a subject.
  • an "extended-PK group” refers to a protein, peptide, or moiety that increases the circulation half-life of a biologically active molecule when fused to or administered together with the biologically active molecule.
  • examples of an extended-PK group include serum albumin (e.g., HSA), Immunoglobulin Fc or Fc fragments and variants thereof, transferrin and variants thereof, and human serum albumin (HSA) binders (as disclosed in U.S. Publication Nos. 2005/0287153 and 2007/0003549).
  • extended-PK groups are disclosed in Kontermann, Expert Opin Biol Ther, 2016 Jul;16(7):903-15 which is herein incorporated by reference in its entirety.
  • an "extended-PK" polypeptide refers to a polypeptide moiety such as an Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof in combination with an extended-PK group.
  • the extended-PK polypeptide is a fusion protein in which a polypeptide moiety is linked or fused to an extended-PK group.
  • the serum half-life of an extended-PK polypeptide is increased relative to the polypeptide alone (i.e., the polypeptide not fused to an extended-PK group). In certain embodiments, the serum half-life of the extended-PK polypeptide is at least 20%, at least 40%, at least 60%, at least 80%, at least 100%, at least 120%, at least 150%, at least 180%, at least 200%, at least 400%, at least 600%, at least 800%, or at least 1000% longer relative to the serum half-life of the polypeptide alone.
  • the serum half-life of the extended- PK polypeptide is at least 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 6-fold, 7-fold, 8-fold, 10- fold, 12-fold, 13-fold, 15-fold, 17-fold, 20-fold, 22-fold, 25-fold, 27-fold, 30-fold, 35-fold, 40-fold, or 50-fold greater than the serum half-life of the polypeptide alone.
  • the serum half-life of the extended-PK polypeptide is at least 10 hours, 15 hours, 20 hours, 25 hours, 30 hours, 35 hours, 40 hours, 50 hours, 60 hours, 70 hours, 80 hours, 90 hours, 100 hours, 110 hours, 120 hours, 130 hours, 135 hours, 140 hours, 150 hours, 160 hours, or 200 hours.
  • half-life refers to the time taken for the serum or plasma concentration of a compound such as a peptide or polypeptide to reduce by 50%, in vivo, for example due to degradation and/or clearance or sequestration by natural mechanisms.
  • An extended-PK polypeptide suitable for use herein is stabilized in vivo and its half-life increased by, e.g., fusion to serum albumin (e.g., human serum albumin (HSA) or mouse serum albumin (MSA)), which resist degradation and/or clearance or sequestration.
  • serum albumin e.g., human serum albumin (HSA) or mouse serum albumin (MSA)
  • the half-life can be determined in any manner known per se, such as by pharmacokinetic analysis.
  • Suitable techniques will be clear to the person skilled in the art, and may for example generally involve the steps of suitably administering a suitable dose of the amino acid sequence or compound to a subject; collecting blood samples or other samples from said subject at regular intervals; determining the level or concentration of the amino acid sequence or compound in said blood sample; and calculating, from (a plot of) the data thus obtained, the time until the level or concentration of the amino acid sequence or compound has been reduced by 50% compared to the initial level upon dosing. Further details are provided in, e.g., standard handbooks, such as Kenneth, A. et al., Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists and in Peters et al., Pharmacokinetic Analysis: A Practical Approach (1996). Reference is also made to Gibaldi, M. et al., Pharmacokinetics, 2nd Rev. Edition, Marcel Dekker (1982).
  • the extended-PK group includes serum albumin, or fragments thereof or variants of the serum albumin or fragments thereof (all of which for the purpose of the present disclosure are comprised by the term "albumin”).
  • Polypeptides described herein may be fused to albumin (or a fragment or variant thereof) to form albumin fusion proteins.
  • albumin fusion proteins are described in U.S. Publication No. 20070048282.
  • albumin fusion protein refers to a protein formed by the fusion of at least one molecule of albumin (or a fragment or variant thereof) to at least one molecule of a protein such as a therapeutic protein, in particular an Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof.
  • the albumin fusion protein may be generated by translation of a nucleic acid in which a polynucleotide encoding a therapeutic protein is joined in-frame with a polynucleotide encoding an albumin.
  • an albumin fusion protein comprises at least one molecule of a therapeutic protein (including, but not limited to a mature form of the therapeutic protein) and at least one molecule of albumin (including but not limited to a mature form of albumin).
  • an albumin fusion protein is processed by a host cell such as a cell of the target organ for administered RNA, e.g. a liver cell, and secreted into the circulation.
  • Processing of the nascent albumin fusion protein that occurs in the secretory pathways of the host cell used for expression of the RNA may include, but is not limited to signal peptide cleavage; formation of disulfide bonds; proper folding; addition and processing of carbohydrates (such as for example, N- and O-linked glycosylation); specific proteolytic cleavages; and/or assembly into multimeric proteins.
  • An albumin fusion protein is preferably encoded by RNA in a non-processed form which in particular has a signal peptide at its N-terminus and following secretion by a cell is preferably present in the processed form wherein in particular the signal peptide has been cleaved off.
  • the "processed form of an albumin fusion protein” refers to an albumin fusion protein product which has undergone N- terminal signal peptide cleavage, herein also referred to as a "mature albumin fusion protein”.
  • albumin fusion proteins comprising a therapeutic protein have a higher plasma stability compared to the plasma stability of the same therapeutic protein when not fused to albumin.
  • Plasma stability typically refers to the time period between when the therapeutic protein is administered in //Vo and carried into the bloodstream and when the therapeutic protein is degraded and cleared from the bloodstream, into an organ, such as the kidney or liver, that ultimately clears the therapeutic protein from the body.
  • Plasma stability is calculated in terms of the half-life of the therapeutic protein in the bloodstream. The half-life of the therapeutic protein in the bloodstream can be readily determined by common assays known in the art.
  • albumin refers collectively to albumin protein or amino acid sequence, or an albumin fragment or variant, having one or more functional activities (e.g., biological activities) of albumin.
  • albumin refers to human albumin or fragments or variants thereof especially the mature form of human albumin, or albumin from other vertebrates or fragments thereof, or variants of these molecules.
  • the albumin may be derived from any vertebrate, especially any mammal, for example human, cow, sheep, or pig. Non-mammalian albumins include, but are not limited to, hen and salmon.
  • the albumin portion of the albumin fusion protein may be from a different animal than the therapeutic protein portion.
  • the albumin is human serum albumin (HSA), or fragments or variants thereof, such as those disclosed in US 5,876,969, WO 2011/124718, WO 2013/075066, and WO 2011/0514789.
  • HSA human serum albumin
  • human serum albumin HSA
  • human albumin HA
  • albumin and serum albumin are broader, and encompass human serum albumin (and fragments and variants thereof) as well as albumin from other species (and fragments and variants thereof).
  • a fragment of albumin sufficient to prolong the therapeutic activity or plasma stability of the therapeutic protein refers to a fragment of albumin sufficient in length or structure to stabilize or prolong the therapeutic activity or plasma stability of the protein so that the plasma stability of the therapeutic protein portion of the albumin fusion protein is prolonged or extended compared to the plasma stability in the non-fusion state.
  • the albumin portion of the albumin fusion proteins may comprise the full length of the albumin sequence, or may include one or more fragments thereof that are capable of stabilizing or prolonging the therapeutic activity or plasma stability.
  • Such fragments may be of 10 or more amino acids in length or may include about 15, 20, 25, 30, 50, or more contiguous amino acids from the albumin sequence or may include part or all of specific domains of albumin.
  • one or more fragments of HSA spanning the first two immunoglobulin-like domains may be used.
  • the HSA fragment is the mature form of HSA.
  • an albumin fragment or variant will be at least 100 amino acids long, preferably at least 150 amino acids long.
  • albumin may be naturally occurring albumin or a fragment or variant thereof.
  • Albumin may be human albumin and may be derived from any vertebrate, especially any mammal.
  • the albumin fusion protein comprises albumin as the N-terminal portion, and a therapeutic protein as the C-terminal portion.
  • an albumin fusion protein comprising albumin as the C-terminal portion, and a therapeutic protein as the N-terminal portion may also be used.
  • the albumin fusion protein has a therapeutic protein fused to both the N-terminus and the C-terminus of albumin.
  • the therapeutic proteins fused at the N- and C-termini are the same therapeutic proteins.
  • the therapeutic proteins fused at the N- and C-termini are different therapeutic proteins.
  • the different therapeutic proteins are both Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof.
  • the therapeutic protein(s) is (are) joined to the albumin through (a) peptide linker(s).
  • a peptide linker between the fused portions may provide greater physical separation between the moieties and thus maximize the accessibility of the therapeutic protein portion, for instance, for binding to its cognate receptor.
  • the peptide linker may consist of amino acids such that it is flexible or more rigid.
  • the linker sequence may be cleavable by a protease or chemically.
  • Fc region refers to the portion of a native immunoglobulin formed by the respective Fc domains (or Fc moieties) of its two heavy chains.
  • Fc domain refers to a portion or fragment of a single immunoglobulin (Ig) heavy chain wherein the Fc domain does not comprise an Fv domain.
  • an Fc domain begins in the hinge region just upstream of the papain cleavage site and ends at the C- terminus of the antibody. Accordingly, a complete Fc domain comprises at least a hinge domain, a CH2 domain, and a CH3 domain.
  • an Fc domain comprises at least one of: a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, a CH4 domain, or a variant, portion, or fragment thereof.
  • a hinge e.g., upper, middle, and/or lower hinge region
  • a CH2 domain e.g., a CH2 domain, and a CH3 domain
  • an Fc domain comprises a hinge domain (or portion thereof) fused to a CH3 domain (or portion thereof).
  • an Fc domain comprises a CH2 domain (or portion thereof) fused to a CH3 domain (or portion thereof).
  • an Fc domain consists of a CH3 domain or portion thereof.
  • an Fc domain consists of a hinge domain (or portion thereof) and a CH3 domain (or portion thereof). In certain embodiments, an Fc domain consists of a CH2 domain (or portion thereof) and a CH3 domain. In certain embodiments, an Fc domain consists of a hinge domain (or portion thereof) and a CH2 domain (or portion thereof). In certain embodiments, an Fc domain lacks at least a portion of a CH2 domain (e.g., all or part of a CH2 domain).
  • An Fc domain herein generally refers to a polypeptide comprising all or part of the Fc domain of an immunoglobulin heavy-chain.
  • the Fc domain may be derived from an immunoglobulin of any species and/or any subtype, including, but not limited to, a human IgGl, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM antibody.
  • the Fc domain encompasses native Fc and Fc variant molecules.
  • any Fc domain may be modified such that it varies in amino acid sequence from the native Fc domain of a naturally occurring immunoglobulin molecule.
  • the Fc domain has reduced effector function (e.g., FcyR binding).
  • an Fc domain of a polypeptide described herein may be derived from different immunoglobulin molecules.
  • an Fc domain of a polypeptide may comprise a CH2 and/or CH3 domain derived from an IgGl molecule and a hinge region derived from an IgG3 molecule.
  • an Fc domain can comprise a chimeric hinge region derived, in part, from an IgGl molecule and, in part, from an IgG3 molecule.
  • an Fc domain can comprise a chimeric hinge derived, in part, from an IgGl molecule and, in part, from an IgG4 molecule.
  • an extended-PK group includes an Fc domain or fragments thereof or variants of the Fc domain or fragments thereof (all of which for the purpose of the present disclosure are comprised by the term "Fc domain").
  • the Fc domain does not contain a variable region that binds to antigen.
  • Fc domains suitable for use in the present disclosure may be obtained from a number of different sources.
  • an Fc domain is derived from a human immunoglobulin.
  • the Fc domain is from a human IgGl constant region. It is understood, however, that the Fc domain may be derived from an immunoglobulin of another mammalian species, including for example, a rodent (e.g. a mouse, rat, rabbit, guinea pig) or non-human primate (e.g. chimpanzee, macaque) species.
  • rodent e.g. a mouse, rat, rabbit, guinea pig
  • non-human primate e.g. chimpanzee, mac
  • the Fc domain (or a fragment or variant thereof) may be derived from any immunoglobulin class, including IgM, IgG, IgD, IgA, and IgE, and any immunoglobulin isotype, including IgGl, IgG2, IgG3, and IgG4.
  • Fc domain gene sequences e.g., mouse and human constant region gene sequences
  • Constant region domains comprising an Fc domain sequence can be selected lacking a particular effector function and/or with a particular modification to reduce immunogenicity.
  • Many sequences of antibodies and antibody-encoding genes have been published and suitable Fc domain sequences (e.g. hinge, CH2, and/or CH3 sequences, or fragments or variants thereof) can be derived from these sequences using art recognized techniques.
  • the extended-PK group is a serum albumin binding protein such as those described in US2005/0287153, US2007/0003549, US2007/0178082, US2007/0269422, US2010/0113339, W02009/083804, and W02009/133208, which are herein incorporated by reference in their entirety.
  • the extended- PK group is transferrin, as disclosed in US 7,176,278 and US 8,158,579, which are herein incorporated by reference in their entirety.
  • the extended-PK group is a serum immunoglobulin binding protein such as those disclosed in US2007/0178082, US2014/0220017, and US2017/0145062, which are herein incorporated by reference in their entirety.
  • the extended-PK group is a fibronectin (Fn)-based scaffold domain protein that binds to serum albumin, such as those disclosed in US2012/0094909, which is herein incorporated by reference in its entirety. Methods of making fibronectin-based scaffold domain proteins are also disclosed in US2012/0094909.
  • Fn3-based extended-PK group is Fn3(HSA), i.e., a Fn3 protein that binds to human serum albumin.
  • the extended-PK polypeptide can employ one or more peptide linkers.
  • peptide linker refers to a peptide or polypeptide sequence which connects two or more domains (e.g., the extended-PK moiety and a polypeptide moiety, e.g., an Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof) in a linear amino acid sequence of a polypeptide chain.
  • peptide linkers may be used to connect an Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof to a HSA domain.
  • Linkers suitable for fusing the extended-PK group to, e.g., an Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof are well known in the art and described herein above.
  • cap 5'-cap structure, e.g., selected from the group consisting of m2 7 ' 2 O G(5')ppSp(5')G (in particular its DI diastereomer), m2 7 ' 3 O G(5')ppp(5')G, and m2 7 ' 3 O Gppp(mi 2 ' °)ApG.
  • hAg-Kozak 5'-UTR sequence of the human alpha-globin mRNA with an optimized 'Kozak sequence' to increase translational efficiency.
  • sec/TMD Fusion-protein tags derived from the sequence encoding the human MHC class I complex (HLA-B51, haplotype A2, B27/B51, Cw2/Cw3), which have been shown to improve antigen processing and presentation.
  • Sec corresponds to the 78 bp fragment coding for the secretory signal peptide, which guides translocation of the nascent polypeptide chain into the endoplasmatic reticulum.
  • the TMD comprises an amino acid sequence enhancing antigen processing and/or presentation.
  • the TMD comprises a trafficking signal.
  • the TMD is MITD. MITD corresponds to the transmembrane and cytoplasmic domain of the MHC class I molecule, also called MHC class I trafficking domain.
  • Antigen Sequences encoding the respective vaccine antigen(s)/epitope(s), i.e., one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof.
  • Glycine-serine linker (GS): Sequences coding for short peptide linkers predominantly consisting of the amino acids glycine (G) and serine (S), as commonly used for fusion proteins.
  • the 3'-UTR is a combination of two sequence elements derived from the "amino terminal enhancer of split" (AES) mRNA (called F) and the mitochondrial encoded 12S ribosomal RNA (called I). These were identified by an ex vivo selection process for sequences that confer RNA stability and augment total protein expression.
  • AES amino terminal enhancer of split
  • A30L70 A poly(A)-tail measuring 110 nucleotides in length, consisting of a stretch of 30 adenosine residues, followed by a 10 nucleotide linker sequence and another 70 adenosine residues designed to enhance RNA stability and translational efficiency in dendritic cells.
  • vaccine RNA described herein has one of the following structures: cap-hAg-Kozak-Antigen(s)-FI-A30L70 cap-hAg-Kozak-sec-Antigen(s)-FI-A30L70 cap-hAg-Kozak-sec-Antigen(s)-TMD-FI-A30L70
  • vaccine antigen described herein has the structure: sec-Antigen sec-Antigen-TMD
  • hAg-Kozak comprises the nucleotide sequence of SEQ ID NO: 53.
  • sec of the encoded vaccine antigen/epitope comprises an amino acid sequence selected from SEQ ID NOs: 17 to 37 or 65 or encoded by the nucleotide sequence selected from SEQ ID NOs: 38 to 51.
  • the TMD of the encoded vaccine antigen/epitope is MITD comprising the amino acid sequence of SEQ ID NO: 52.
  • the TMD of the encoded vaccine antigen/epitope is a viral signal peptide, preferably a HSV-1 glycoprotein D signal peptide.
  • FI comprises the nucleotide sequence of SEQ ID NO: 54.
  • A30L70 comprises the nucleotide sequence of SEQ ID NO: 55.
  • the different elements may be linked by one or more GS linkers.
  • a GS linker of the encoded vaccine antigen/epitope comprises the amino acid sequence of SEQ ID NO: 56.
  • the sequence encoding the vaccine antigen/epitope comprises a modified nucleoside replacing (partially or completely, preferably completely) uridine, wherein the modified nucleoside is selected from the group consisting of pseudouridine (i ), Nl-methyl-pseudouridine (mli ), and 5-methyl-uridine.
  • the sequence encoding the vaccine antigen/epitope is codon-optimized.
  • the G/C content of the sequence encoding the vaccine antigen/epitope is increased compared to the wild type coding sequence.
  • the RNA (in particular, mRNA) described herein comprises: a 5' UTR comprising the nucleotide sequence of SEQ ID NO: 53, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 53; a 3' UTR comprising the nucleotide sequence of SEQ ID NO: 54, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 54; and a poly-A sequence comprising the nucleotide sequence of SEQ ID NO: 55.
  • the RNA (in particular, mRNA) described herein comprises: m2 7 ' 3 ' °Gppp(mi 2 ' 0 ) ApG as capping structure at the 5'-end of the mRNA; a 5' UTR comprising the nucleotide sequence of SEQ ID NO: 53, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 53; a 3' UTR comprising the nucleotide sequence of SEQ ID NO: 54, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 54; and a poly-A sequence comprising the nucleotide sequence of SEQ ID NO: 55.
  • the RNA is unmodified. In some embodiments, the RNA is modified. In some embodiments, the RNA comprises Nl-methyl-pseudouridine (mli ) in place of at least one uridine (e.g., in place of each uridine).
  • mi Nl-methyl-pseudouridine
  • the RNA (in particular, mRNA) described herein comprises: m2 7 ' 3 ' °Gppp(mi 2 ' 0 ) ApG as capping structure at the 5'-end of the mRNA; a 5' UTR comprising the nucleotide sequence of SEQ ID NO: 53, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 53; a 3' UTR comprising the nucleotide sequence of SEQ ID NO: 54, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 54; and a poly-A sequence comprising the nucleotide sequence of SEQ ID NO: 55; and
  • Nl-methyl-pseudouridine in place of at least one uridine (e.g., in place of each uridine).
  • a vaccine antigen or epitope described herein is derived from Mycobacterium tuberculosis.
  • a vaccine antigen or epitope described herein is derived from a Mycobacterium tuberculosis protein, an immunogenic variant thereof, or an immunogenic fragment of the Mycobacterium tuberculosis protein or the immunogenic variant thereof.
  • the RNA e.g., mRNA, used in the present disclosure encodes an amino acid sequence comprising an Mtb protein, an immunogenic variant thereof, or an immunogenic fragment of the Mtb protein or the immunogenic variant thereof.
  • a vaccine antigen or epitope described herein is derived from an Mtb protein from the acute phase of the Mtb life cycle, an immunogenic variant thereof, or an immunogenic fragment of the Mtb protein from the acute phase of the Mtb life cycle or the immunogenic variant thereof.
  • a vaccine antigen or epitope described herein is derived from an Mtb protein from the latent phase of the Mtb life cycle, an immunogenic variant thereof, or an immunogenic fragment of the Mtb protein from the latent phase of the Mtb life cycle or the immunogenic variant thereof.
  • a vaccine antigen or epitope described herein is derived from an Mtb protein from the resuscitation phase of the Mtb life cycle, an immunogenic variant thereof, or an immunogenic fragment of the Mtb protein from the resuscitation phase of the Mtb life cycle or the immunogenic variant thereof.
  • RNA in particular, mRNA
  • RNA may be presented as a product containing the vaccine RNA as active substance and other ingredients comprising: ALC-0315 ((4- hydroxybutyl)azanediyl)bis(hexane-6,l-diyl)bis(2-hexyldecanoate), ALC-0159 (2-[(polyethylene glycol)-2000]-N,N- ditetradecylacetamide), l,2-Distearoyl-sn-glycero-3-phosphocholine (DSPC), and cholesterol.
  • ALC-0315 ((4- hydroxybutyl)azanediyl)bis(hexane-6,l-diyl)bis(2-hexyldecanoate)
  • ALC-0159 (2-[(polyethylene glycol)-2000]-N,N- ditetradecylacetamide), l,2-Distearoyl-sn-glycero-3-phosphocholine (
  • the RNA (in particular, mRNA) described herein is formulated or is to be formulated as a liquid, a solid, or a combination thereof.
  • the RNA (in particular, mRNA) described herein is formulated or is to be formulated for injection.
  • the RNA (in particular, mRNA) described herein is formulated or is to be formulated for intramuscular administration.
  • the RNA (in particular, mRNA) described herein is formulated or is to be formulated as a composition, e.g., a pharmaceutical composition.
  • the composition comprises a cationically ionizable lipid.
  • the composition comprises a cationically ionizable lipid and one or more additional lipids.
  • the one or more additional lipids are selected from polymer-conjugated lipids, neutral lipids, and combinations thereof.
  • the neutral lipids include phospholipids, steroid lipids, and combinations thereof.
  • the one or more additional lipids are a combination of a polymer-conjugated lipid, a phospholipid, and a steroid lipid.
  • the composition comprises a cationically ionizable lipid; a polymer-conjugated lipid which is a PEG-conjugated lipid; cholesterol; and a phospholipid.
  • the phospholipid is DSPC.
  • the phospholipid is DOPE.
  • the composition comprises a cationically ionizable lipid; a polymer-conjugated lipid which is 2- [(polyethylene glycol)-2000]-N,N-ditetradecylacetamide; cholesterol; and a phospholipid.
  • the phospholipid is DSPC.
  • the phospholipid is DOPE.
  • the composition comprises a cationically ionizable lipid which is ((4- hydroxybutyl)azanediyl)bis(hexane-6,l-diyl)bis(2-hexyldecanoate); a polymer-conjugated lipid which is 2- [(polyethylene glycol)-2000]-N,N-ditetradecylacetamide; cholesterol; and a phospholipid.
  • the phospholipid is DSPC.
  • the phospholipid is DOPE.
  • the particles are nanoparticles, such as lipid nanoparticles (LNPs).
  • the composition in particular the pharmaceutical composition, is a vaccine.
  • the composition in particular the pharmaceutical composition, further comprises one or more pharmaceutically acceptable carriers, diluents and/or excipients.
  • the RNA and/or the composition, in particular the pharmaceutical composition is/are a component of a kit.
  • the kit further comprises instructions for use of the RNA for inducing an immune response against Mycobacterium tuberculosis in a subject.
  • the kit further comprises instructions for use of the RNA for therapeutically or prophylactically treating a Mycobacterium tuberculosis infection in a subject.
  • the subject is a human.
  • the RNA in particular, mRNA
  • RNA encoding vaccine antigen described in the present disclosure is non-immunogenic.
  • RNA encoding an immunostimulant may be administered according to the present disclosure to provide an adjuvant effect.
  • the RNA encoding an immunostimulant may be standard RNA or non- immunogenic RNA.
  • Mtb antigens immunogenic variants thereof, and immunogenic fragments of the Mtb antigens or the immunogenic variants thereof (referred to as "Mtb antigens" herein) and RNA encoding these antigens.
  • Mtb antigens primarily described herein include Wbbll, PPE18 and PE13.
  • the Mtb antigen Wbbll comprises the amino acid sequence according to SEQ ID NO: 1.
  • a full- length antigen representing the antigen Wbbll is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 1
  • an antigen fragment representing the antigen Wbbll is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 1 but which still is able to induce an immune reaction to Wbbll, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen Wbbll comprises an amino acid sequence which is "immunologically equivalent" to Wbbll and thus, is able to induce an immune reaction to Wbbll, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen Wbbll comprises an amino acid sequence differing from SEQ ID NO: 1 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 1 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen Wbbll is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen Wbbll is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to Wbbll, when delivered to a subject.
  • the Mtb antigen Wbbll is encoded by a nucleotide sequence according to SEQ ID NO: 147.
  • an immunogenic variant of the Mtb antigen Wbbll is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 147 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the Mtb antigen PPE18 comprises the amino acid sequence according to SEQ ID NO: 2.
  • a full- length antigen representing the antigen PPE18 is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 2
  • an antigen fragment representing the antigen PPE18 is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 2 but which still is able to induce an immune reaction to PPE18, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen PPE18 comprises an amino acid sequence which is "immunologically equivalent" to PPE18 and thus, is able to induce an immune reaction to PPE18, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen PPE18 comprises an amino acid sequence differing from SEQ ID NO: 2 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 2 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen PPE18 is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen PPE18 is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to PPE18, when delivered to a subject.
  • the Mtb antigen PPE18 is encoded by a nucleotide sequence according to SEQ ID NO: 148.
  • an immunogenic variant of the Mtb antigen PPE18 is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 148 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the Mtb antigen PE13 comprises the amino acid sequence according to SEQ ID NO: 3. In other embodiments, the Mtb antigen PE13 comprises the amino acid sequence according to SEQ ID NO: 4.
  • a full-length antigen representing the antigen PE13 is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 3 or 4, whereas an antigen fragment representing the antigen PE13 is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 3 or 4 but which still is able to induce an immune reaction to PE13, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen PE13 comprises an amino acid sequence which is "immunologically equivalent" to PE13 and thus, is able to induce an immune reaction to PE13, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen PE13 comprises an amino acid sequence differing from SEQ ID NO: 3 or 4 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 3 or 4 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen PE13 is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen PE13 is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to PE13, when delivered to a subject.
  • the Mtb antigen PE13 is encoded by a nucleotide sequence according to SEQ ID NO: 149 or SEQ ID NO: 150.
  • an immunogenic variant of the Mtb antigen PE13 is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 149 or SEQ ID NO: 150 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the Mtb antigen EsxA comprises the amino acid sequence according to SEQ ID NO: 5.
  • a full- length antigen representing the antigen EsxA is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 5, whereas an antigen fragment representing the antigen EsxA is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 5 but which still is able to induce an immune reaction to EsxA, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxA comprises an amino acid sequence which is "immunologically equivalent" to EsxA and thus, is able to induce an immune reaction to EsxA, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxA comprises an amino acid sequence differing from SEQ ID NO: 5 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 5 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen EsxA is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxA is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxA, when delivered to a subject.
  • EsxA is also called ESAT-6 and both terms are used synonymously herein.
  • the Mtb antigen EsxA is encoded by a nucleotide sequence according to SEQ ID NO: 151.
  • an immunogenic variant of the Mtb antigen EsxA is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 151 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the Mtb antigen EsxB comprises the amino acid sequence according to SEQ ID NO: 6.
  • a full- length antigen representing the antigen EsxB is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 6, whereas an antigen fragment representing the antigen EsxB is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 6 but which still is able to induce an immune reaction to EsxB, when delivered to a subject.
  • An immunogenic variant of the Mtb antigen EsxB comprises an amino acid sequence which is "immunologically equivalent" to EsxB and thus, is able to induce an immune reaction to EsxB, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxB comprises an amino acid sequence differing from SEQ ID NO: 6 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 6 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen EsxB is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxB is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxB, when delivered to a subject.
  • EsxB is also called CFP-10 and both terms are used synonymously herein.
  • the Mtb antigen EsxB is encoded by a nucleotide sequence according to SEQ ID NO: 152.
  • an immunogenic variant of the Mtb antigen EsxB is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 152 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the Mtb antigen EsxG comprises the amino acid sequence according to SEQ ID NO: 7.
  • a full- length antigen representing the antigen EsxG is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 7, whereas an antigen fragment representing the antigen EsxG is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 7 but which still is able to induce an immune reaction to EsxG, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxG comprises an amino acid sequence which is "immunologically equivalent" to EsxG and thus, is able to induce an immune reaction to EsxG, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxG comprises an amino acid sequence differing from SEQ ID NO: 7 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 7 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen EsxG is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxG is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxG, when delivered to a subject.
  • the Mtb antigen EsxG is encoded by a nucleotide sequence according to SEQ ID NO: 153.
  • an immunogenic variant of the Mtb antigen EsxG is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 153 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the Mtb antigen EsxH comprises the amino acid sequence according to SEQ ID NO: 8.
  • a full- length antigen representing the antigen EsxH is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 8, whereas an antigen fragment representing the antigen EsxH is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 8 but which still is able to induce an immune reaction to EsxH, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxH comprises an amino acid sequence which is "immunologically equivalent" to EsxH and thus, is able to induce an immune reaction to EsxH, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxH comprises an amino acid sequence differing from SEQ ID NO: 8 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 8 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen EsxH is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxH is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxH, when delivered to a subject.
  • the Mtb antigen EsxH is encoded by a nucleotide sequence according to SEQ ID NO: 154.
  • an immunogenic variant of the Mtb antigen EsxH is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 154 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the Mtb antigen Esxl comprises the amino acid sequence according to SEQ ID NO: 9.
  • a full- length antigen representing the antigen Esxl is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 9, whereas an antigen fragment representing the antigen Esxl is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 9 but which still is able to induce an immune reaction to Esxl, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen Esxl comprises an amino acid sequence which is "immunologically equivalent" to Esxl and thus, is able to induce an immune reaction to Esxl, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen Esxl comprises an amino acid sequence differing from SEQ ID NO: 9 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 9 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen Esxl is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen Esxl is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to Esxl, when delivered to a subject.
  • the Mtb antigen Esxl is encoded by a nucleotide sequence according to SEQ ID NO: 155.
  • an immunogenic variant of the Mtb antigen Esxl is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 155 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN). EsxJ
  • the Mtb antigen EsxJ comprises the amino acid sequence according to SEQ ID NO: 10.
  • a full- length antigen representing the antigen EsxJ is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 10
  • an antigen fragment representing the antigen EsxJ is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 10 but which still is able to induce an immune reaction to EsxJ, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxJ comprises an amino acid sequence which is "immunologically equivalent" to EsxJ and thus, is able to induce an immune reaction to EsxJ, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxJ comprises an amino acid sequence differing from SEQ ID NO: 10 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 10 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen EsxJ is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxJ is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxJ, when delivered to a subject.
  • the Mtb antigen EsxJ is encoded by a nucleotide sequence according to SEQ ID NO: 156.
  • an immunogenic variant of the Mtb antigen EsxJ is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 156 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the Mtb antigen EsxK comprises the amino acid sequence according to SEQ ID NO: 11.
  • a full- length antigen representing the antigen EsxK is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 11, whereas an antigen fragment representing the antigen EsxK is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 11 but which still is able to induce an immune reaction to EsxK, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxK comprises an amino acid sequence which is "immunologically equivalent" to EsxK and thus, is able to induce an immune reaction to EsxK, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxK comprises an amino acid sequence differing from SEQ ID NO: 11 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 11 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen EsxK is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxK is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxK, when delivered to a subject.
  • the Mtb antigen EsxK is encoded by a nucleotide sequence according to SEQ ID NO: 157.
  • an immunogenic variant of the Mtb antigen EsxK is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 157 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the Mtb antigen EsxL comprises the amino acid sequence according to SEQ ID NO: 12.
  • a full- length antigen representing the antigen EsxL is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 12, whereas an antigen fragment representing the antigen EsxL is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 12 but which still is able to induce an immune reaction to EsxL, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxL comprises an amino acid sequence which is "immunologically equivalent" to EsxL and thus, is able to induce an immune reaction to EsxL, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxL comprises an amino acid sequence differing from SEQ ID NO: 12 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 12 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen EsxL is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxL is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxL, when delivered to a subject.
  • the Mtb antigen EsxL is encoded by a nucleotide sequence according to SEQ ID NO: 158.
  • an immunogenic variant of the Mtb antigen EsxL is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 158 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the Mtb antigen EsxM comprises the amino acid sequence according to SEQ ID NO: 13.
  • a full- length antigen representing the antigen EsxM is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 13, whereas an antigen fragment representing the antigen EsxM is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 13 but which still is able to induce an immune reaction to EsxM, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxM comprises an amino acid sequence which is "immunologically equivalent" to EsxM and thus, is able to induce an immune reaction to EsxM, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxM comprises an amino acid sequence differing from SEQ ID NO: 13 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 13 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen EsxM is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxM is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxM, when delivered to a subject.
  • the Mtb antigen EsxM is encoded by a nucleotide sequence according to SEQ ID NO: 159.
  • an immunogenic variant of the Mtb antigen EsxM is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 159 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the Mtb antigen EsxN comprises the amino acid sequence according to SEQ ID NO: 14.
  • a full- length antigen representing the antigen EsxN is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 14, whereas an antigen fragment representing the antigen EsxN is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 14 but which still is able to induce an immune reaction to EsxN, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxN comprises an amino acid sequence which is "immunologically equivalent" to EsxN and thus, is able to induce an immune reaction to EsxN, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxN comprises an amino acid sequence differing from SEQ ID NO: 14 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 14 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen EsxN is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxN is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxN, when delivered to a subject.
  • the Mtb antigen EsxN is encoded by a nucleotide sequence according to SEQ ID NO: 160.
  • an immunogenic variant of the Mtb antigen EsxN is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 160 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the Mtb antigen EsxV comprises the amino acid sequence according to SEQ ID NO: 15.
  • a full- length antigen representing the antigen EsxV is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 15, whereas an antigen fragment representing the antigen EsxV is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 15 but which still is able to induce an immune reaction to EsxV, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxV comprises an amino acid sequence which is "immunologically equivalent" to EsxV and thus, is able to induce an immune reaction to EsxV, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxV comprises an amino acid sequence differing from SEQ ID NO: 15 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 15 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen EsxV is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxV is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxV, when delivered to a subject.
  • the Mtb antigen EsxV is encoded by a nucleotide sequence according to SEQ ID NO: 161.
  • an immunogenic variant of the Mtb antigen EsxV is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 161 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the Mtb antigen EsxW comprises the amino acid sequence according to SEQ ID NO: 16.
  • a full- length antigen representing the antigen EsxW is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 16, whereas an antigen fragment representing the antigen EsxW is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 16 but which still is able to induce an immune reaction to EsxW, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxW comprises an amino acid sequence which is "immunologically equivalent" to EsxW and thus, is able to induce an immune reaction to EsxW, when delivered to a subject.
  • an immunogenic variant of the Mtb antigen EsxW comprises an amino acid sequence differing from SEQ ID NO: 16 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 16 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • a full-length antigen representing an immunogenic variant of the antigen EsxW is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxW is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxW, when delivered to a subject.
  • the Mtb antigen EsxW is encoded by a nucleotide sequence according to SEQ ID NO: 162.
  • an immunogenic variant of the Mtb antigen EsxW is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 162 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • amino acid sequences described herein comprise a secretory signal peptide as described herein above.
  • the chimeric protein (also referred to as "string” herein) comprises one or more Mtb antigens and antigen fragments described above.
  • the chimeric protein (named "string 1") comprises Wbbll, PPE18 and PE13. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PPE18 and PE13 and WbbLl as full- length antigen. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, three antigen fragments of PPE18, and a full-length antigen of WbbLl.
  • the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 57 or an amino acid sequence that differs from SEQ ID NO: 57 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 57 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • the chimeric protein as shown in SEQ ID NO: 57 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
  • the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of SEQ ID NO: 163 or 164 or a nucleotide that differs from SEQ ID NO: 163 or 164 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 163 or 164 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the chimeric protein (named "string 2") comprises EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises an antigen fragment of EsxJ and full length antigens of EsxG, EsxH, Esxl, EsxN and EsxW. In some embodiments, the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 59 or an amino acid sequence that differs from SEQ ID NO: 59 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 59 (e.g.
  • the chimeric protein as shown in SEQ ID NO: 59 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
  • the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of SEQ ID NO: 165 or 166 or a nucleotide that differs from SEQ ID NO: 165 or 166 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 165 or 166 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the chimeric protein (named "string 3") comprises EsxB, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises an antigen fragment of EsxB, an antigen fragment of EsxJ and full length antigens of EsxG, EsxH, Esxl, EsxN and EsxW.
  • the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 58 or an amino acid sequence that differs from SEQ ID NO: 58 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 58 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • the chimeric protein as shown in SEQ ID NO: 58 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
  • the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of SEQ ID NO: 167 or 168 or a nucleotide that differs from SEQ ID NO: 167 or 168 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 167 or 168 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the chimeric protein (named "string 4") comprises PE13, PPE18, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PPE18, PE13, EsxJ and EsxN and full length antigens of Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, three antigen fragments of PPE18, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of Esxl and EsxW.
  • the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 60 or 61 or an amino acid sequence that differs from SEQ ID NO: 60 or 61 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 60 or 61 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • the chimeric protein as shown in SEQ ID NO: 60 or 61 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
  • the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of any one of SEQ ID NOs: 169 to 172 or a nucleotide that differs from SEQ ID NOs: 169 to 172 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to any one of SEQ ID NOs: 169 to 172 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the chimeric protein (named "string 5") comprises PE13, PPE18, EsxG, EsxJ, and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PPE18, PE13 and EsxJ and full length antigens of EsxG and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, three antigen fragments of PPE18, one antigen fragment of EsxJ and full length antigens of EsxG and EsxW.
  • the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 62 or 66 or an amino acid sequence that differs from SEQ ID NO: 62 or 66 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 62 or 66 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • the chimeric protein as shown in SEQ ID NO: 62 or 66 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
  • the chimeric protein (named "string 6") comprises PE13, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, EsxJ and EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW.
  • the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 63 or 67 or an amino acid sequence that differs from SEQ ID NO: 63 or 67 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 63 or 67 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • the chimeric protein as shown in SEQ ID NO: 63 or 67 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
  • the chimeric protein (named "string 7") comprises PE13, EsxA, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, EsxA, EsxJ and EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, two antigen fragments of EsxA, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW.
  • the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 64 or 68 or an amino acid sequence that differs from SEQ ID NO: 64 or 68 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 64 or 68 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • the chimeric protein as shown in SEQ ID NO: 64 or 68 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
  • the chimeric protein (named "string 8") comprises PE13, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, EsxJ and EsxN and full length antigens of Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of Esxl and EsxW.
  • the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 173 or 174 or an amino acid sequence that differs from SEQ ID NO: 173 or 174 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 173 or 174 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • the chimeric protein as shown in SEQ ID NO: 173 or 174 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
  • the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of SEQ ID NO: 175 or 176 or a nucleotide that differs from SEQ ID NO: 175 or 176 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 175 or 176 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the chimeric protein (named "string 9") comprises PE13, PPE18, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, PPE18, EsxJ and EsxN and full length antigens of Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, two antigen fragments of PPE18, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of Esxl and EsxW.
  • the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 177 or 178 or an amino acid sequence that differs from SEQ ID NO: 177 or 178 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 177 or 178 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • the chimeric protein as shown in SEQ ID NO: 177 or 178 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
  • the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of SEQ ID NO: 179 or 180 or a nucleotide that differs from SEQ ID NO: 179 or 180 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 179 or 180 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the chimeric protein (named “string 10" or “string 10_R”) comprises PE13, PPE18, EsxG, Esxl and EsxN. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, PPE18 and EsxN and full length antigens of EsxG and Esxl. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, three antigen fragments of PPE18, one antigen fragment of EsxN and full length antigens of EsxG and Esxl.
  • the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 141 or 142 or an amino acid sequence that differs from SEQ ID NO: 141 or 142 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 141 or 142 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • the chimeric protein as shown in SEQ ID NO: 141 or 142 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
  • the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of any one of SEQ ID NO: 181 to 192 or a nucleotide that differs from SEQ ID NO: 181 to 192 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 181 to 192 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the chimeric protein (named "string 11" or “string 11_R") comprises PE13, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, EsxJ and EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW.
  • the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 143 or 144 or an amino acid sequence that differs from SEQ ID NO: 143 or 144 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 143 or 144 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • the chimeric protein as shown in SEQ ID NO: 143 or 144 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
  • the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of any one of SEQ ID NO: 193 to 204 or a nucleotide that differs from SEQ ID NO: 193 to 204 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 193 to 204 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • the chimeric protein (named "string 12" or “string 12_R") comprises PE13, EsxA, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, EsxA, EsxJ and EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, two antigen fragments of EsxA, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW.
  • the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 145 or 146 or an amino acid sequence that differs from SEQ ID NO: 145 or 146 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 145 or 146 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP).
  • the chimeric protein as shown in SEQ ID NO: 145 or 146 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
  • the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of any one of SEQ ID NO: 205 to 216 or a nucleotide that differs from SEQ ID NO: 205 to 216 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 205 to 216 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
  • HSV-TMD ASSASSYAATEVANAAAGGSGGGGSGGMVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSWWGLTVGSWIGSSAGLMVAAASPYVAWMSVTAGQAELTA
  • HSV-TMD NQLMNNVPQALQQLAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQTAAQNGVRAMSSLGSSLGGSGGGGSGGMASR
  • HSV-TMD GAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGGMSQIMYNYPAMLGHAGDMAGYAGTL
  • HSV-TMD GAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSGGSGGGGSGGVDAHGA
  • YSQAASSDSAQGSDVSLTA* [SEQ ID NO: 146] able 5: Nucleotide sequences of exemplary chimeric proteins
  • HSV-TMD HSV-TMD
  • HSV-TMD CTCACAGATCCCCAATCAGCAACATGGTGTCTATGGCCAACAACCACATGAGCATGACCAACAGCGGCGTGTCCATGACAAACACCCTGTCCTCCATGCTGAAGGGCTTTGCCCC AGCAGCAGCTGCACAGGCTGTTCAGACAGCAGCACAGAACGGCGTGCGGGCTATGTCTAGCCTGGGAAGCTCTCTTGGAGGTTCAGGCGGAGGCGGATCTGGCGGAGTTGTT CCTCCTGCCGCTGATGAAGTGTCTGCCCTGACAGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCAAGAGCCGCCGCAATCCACGATCAGTTCGTGGCC ACACTGGCCAGCAGCGCCAGTTCTTATGCCGCCACTGAAGTGGCCAATGCTGCCGCAGGCGGTAGCGGTGGCGGTGGTTCCGGTGGAATGGTGGATTTTGGAGCCCTGCCACC TGAGATCAACAGCGCCAGGATGTATGCCGGACCTGGATCTGCTTCTCTCTC

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Communicable Diseases (AREA)
  • Chemical & Material Sciences (AREA)
  • Pulmonology (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Oncology (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

The disclosure provides agents and methods for preventing or treating tuberculosis using RNA. The RNA encoding chimeric proteins comprising antigens of Mycobacterium tuberculosis, immunogenic variants or fragments thereof is formulated and administered in a way that the antigens, variants or fragments are produced by cells of a subject.

Description

RNA FOR PREVENTING OR TREATING TUBERCULOSIS
CROSS REFERENCE TO RELATED APPLICATIONS
The present application claims priority to United States Provisional Patent Application Nos. 63/496,147, filed April 14, 2023, 63/496,149, filed April 14, 2023, 63/512,681, filed July 10, 2023, 63/512,683, filed July 10, 2023, and US 63/586,839, filed September 29,2023, each of which is hereby incorporated by reference in its entirety.
Technical Field
The disclosure provides agents and methods for preventing or treating tuberculosis using RNA. The RNA encoding chimeric antigens of Mycobacterium tuberculosis, immunogenic variants or fragments thereof is formulated and administered in a way that the antigens, variants or fragments are produced by cells of a subject, in particular after intramuscular or intravenous administration of the RNA.
Background
The use of RNA to deliver foreign genetic information into target cells offers an attractive alternative to DNA. The advantages of RNA include transient expression and non-transforming character. RNA does not require nucleus infiltration for expression and moreover cannot integrate into the host genome, thereby eliminating the risk of oncogenesis.
The COVID-19 pandemic has showcased the utility and advantages of RNA technology for vaccination, as out of all COVID- 19 vaccines under development, the first two to have received emergency use authorization by the FDA were RNA-based. The biotechnology response to the COVID- 19 pandemic has highlighted the speed and flexibility of mRNA vaccines, and reveals mRNA therapeutics to be a powerful tool to address epidemic outbreaks caused by newly emerging viruses. The relative simplicity of the development process and flexibility of the manufacturing platform can markedly accelerate clinical development. As such, mRNA-based vaccine technology has attracted a lot of attention during the COVID-19 pandemic.
The first authorized vaccine was developed by BioNTech in collaboration with Pfizer. The RNA of this vaccine, BNT162b2, encodes full length spike protein modified by two proline mutations to stabilize the prefusion conformation. The RNA incorporates 1-methyl-pseudouridine, which dampens innate immune sensing and increases mRNA translation in //Vo and is formulated in lipid nanoparticles (LNP). BNT162b2 is administered to adults intramuscularly (IM) in two 30 pg doses given 21 days apart.
Tuberculosis (TB) is caused by the bacterial pathogen Mycobacterium tuberculosis (Mtb~) and, in rarer cases, by other pathogens from the Mycobacteriaceae family and is the leading cause of death from a single infectious agent. Mtb is a gram-positive, rod-shaped bacterium from the Mycobacteriaceae family. The more than 4,000 genes encoded within an approximately 4 million base pair genome render Mtb a complex pathogenic organism. This is further emphasized by the atypical composition of its cell wall, which has a high lipid content.
Despite the observed trend for reduction in TB cases and TB-related deaths for the last 20 years, 1.42 million people died from TB alone in 2019. In addition to the active form of TB, difficulties arise from latent TB infection (LTBI), when the infected patient doesn't present clinical symptoms. The estimated 2 billion latently infected individuals worldwide pose a huge and unpredictable reservoir of Mtb (WORLD HEALTH ORGANIZATION. Global tuberculosis report 2019. Geneva, WORLD HEALTH ORGANIZATION; 2019. ISBN: 978-92-4-156571-4). The high prevalence of HIV-1 infections further increases the risk for TB disease acquisition, activation of a latent TB infection, and death from HIV-TB co-infection. In 2009, 0.2 million deaths were related to HIV-TB comorbidity. The complexity of the Mtb cell wall makes the bacterium resistant to environmental impact and to therapy with certain antibiotics. The latter further complicates anti-TB treatment especially in low- and middle-income countries (WORLD HEALTH ORGANIZATION. Global tuberculosis report 2020. Geneva, WORLD HEALTH ORGANIZATION; 2020. ISBN: 978-92-4-001313-1).
An attenuated strain of Mycobacterium bovis, bacillus Calmette-Guerin (BCG), is the only licensed TB vaccine, introduced in 1921. The use of the live vaccine BCG is not recommended for immunocompromised individuals and the protective efficacy against pulmonary TB conferred by immunization with BCG is highly variable, ranging from 50-80%. Moreover, passaging of BCG over the decades further attenuated the currently used BCG strains, reducing its protective efficacy (Brosch R, et al. Proc. Natl. Acad. Sci. U.S.A., 2007; 104(13):5596-5601). Thus, there is an unmet medical need for a safer and more effective vaccine to prevent TB, especially for a vaccine that can be administered to immunocompromised individuals.
The pipeline of clinical trials for TB vaccine candidates comprises use of live, live-attenuated, and inactivated mycobacteria, and of Mtb antigens as recombinant protein (subunit vaccine) (TuBerculosis Vaccine Initiative (TBVI). Available from: https://www.tbvi.eu/what-we-do/pipeline-of-vaccines/). The drawbacks from these vaccine platforms are i. their low safety, due to replication-competent live vaccines still being infectious, II. low immunogenicity of inactivated vaccines, and ill. the need for addition of adjuvants to subunit vaccines to enhance immunogenicity. To date, most vaccine candidates have failed to demonstrate better protection from TB or from the development of TB compared to placebo in clinical trials.
For all these reasons, novel agents for preventing or treating tuberculosis are required.
Summary
The present disclosure provides compositions which are useful as TB vaccines. The compositions provided herein comprise RNA for delivering Mycobacterium tuberculosis (Mtb) antigens to a subject.
Immunity to tuberculosis is primarily shaped by T cell responses in most individuals. We have developed a platform of RNA design specifically aimed at optimizing T cell responses in RNA vaccines, which is utilized here to specifically design potent T cell inducing RNA vaccines to prevent or treat tuberculosis. Antigens for these vaccines have been selected to be included either as full-length antigens or as antigen fragments. These full-length antigens or fragments thereof are combined into chimeric proteins by stringing them together interspersed by polypeptide linkers that also function to minimize the risk of creating neoepitopes. The novel RNA vaccines encoding chimeric proteins comprising three or more antigens, as full-length antigens and antigen fragments, elicit a robust and specific T cell response in subjects infected with or at risk of contracting tuberculosis. Fifteen antigens were selected as primary targets for the novel RNA vaccines, including Wbbll, PPE18, PE13, EsxA, EsxB, EsxG, EsxH, Esxl, EsxJ, EsxK, EsxL, EsxM, EsxN, EsxV and EsxW.
Furthermore, in order to improve the rate of translation of the chimeric protein encoded by the novel RNA vaccines, increasing the amount of protein produced and presented to the immune system, we have developed ways to increase coverage of the elicited immune response while reducing or maintaining the length of the chimeric proteins. For instance, the Esx proteins EsxN, Esxl, EsxV and EsxL are highly homologous members of the same protein family and are known to be highly immunogenic. Each of these proteins is transcribed and produced with a direct secretion partner - another Esx protein - and these two secretion partners together form a heterodimer. These partners are EsxJ (partner of Esxl), EsxK (partner of EsxL), EsxM (partner of EsxN), and EsxW (partner of EsxV). This second group of proteins (together referred to as the QQILSS proteins based on the residues in their C-terminal sequences, also contains highly immunogenic proteins playing a role in virulence or dissemination. Based on sequence analysis, we identified that if a full-length Esxl protein is combined with a fragment of EsxN (or a full-length EsxN), these antigens would also induce immune responses against the other antigens EsxV and EsxL. Similarly, inclusion of the N terminal 14 amino acids of Esxl together with a full-length EsxW, would not only cover these two proteins completely, but would also cover 1) EsxM, in strains that express an ancestral version of this protein associated with dissemination within the host; 2) Strains that possess a single nucleotide polymorphism in EsxW associated with increased transmissibility; and 3) the full-length EsxK protein except for alanine residue 58.
In addition to the above, the antigens forming the core functionality of the novel RNA vaccines, can be combined with other known Mtb antigens. For instance, Mtb displays differential gene expression patterns during its active and dormant (non-dividing) phases (Andersen P, et al. Cold Spring Harb Perspect Med, 2014; 4(6):a018523). To prevent development ofTB, immunity against antigens specific for various stages of Mtb infection is preferable. The TB vaccines developed here comprising the RNA components described above are designed to induce protective immune responses against antigens specific for different stages of Mtb infection. Combinations with additional known Mtb antigens can be used to elicit a stronger immune response towards individual stages of Mtb infection or to increase the number of stages of Mtb infection, against which the vaccine elicits an immune response.
Furthermore, antigen presentation and trafficking can be optimized by adding to the chimeric protein an N-terminal signal peptide designed to traffic the recombinant protein towards the exterior of transfected cells. The C-terminus of the chimeric protein can be modified by a trafficking signal and/or transmembrane domain designed to enhance endocytosis of the recombinant protein, thereby leading to optimal MHC-II presentation and ensuing CD4+ T cell responses.
The RNA vaccines described herein, e.g., comprising non-modified uridine containing mRNA (uRNA) or nucleoside modified mRNA (modRNA), expressing Mtb antigens, immunogenic variants or fragments thereof, are useful for preventing or treating tuberculosis. The RNA encoding Mtb antigens, immunogenic variants or fragments thereof is formulated and administered in a way that the antigens, variants or fragments can be produced and preferably secreted by patient cells to prevent or combat tuberculosis.
Unlike the attenuated vaccine BCG, this TB vaccine candidate does not carry the risks associated with infection and may therefore be given to people who cannot be administered live organism (such as pregnant women and immunocompromised persons).
In one aspect, the disclosure provides an RNA molecule encoding a chimeric protein comprising T cell epitopes of three or more different Mycobacterium tuberculosis antigens or immunogenic variants thereof, wherein the chimeric protein comprises one or more antigen fragments, wherein at least one Mycobacterium tuberculosis antigen or immunogenic variant thereof is represented by one or more antigen fragments and the remaining Mycobacterium tuberculosis antigens or immunogenic variants thereof are represented by one or more antigen fragments and/or one or more full-length antigens, wherein each antigen fragment or full-length antigen comprises one or more T cell epitopes, and wherein each antigen fragment or full-length antigen is separated from other antigen fragments or full-length antigens in the chimeric protein by a polypeptide linker.
In some embodiments of the RNA molecule, the chimeric protein comprises T cell epitopes of four or more different Mycobacterium tuberculosis antigens. In some embodiments, the chimeric protein comprises T cell epitopes of five or more different Mycobacterium tuberculosis antigens. In some embodiments, the chimeric protein comprises T cell epitopes of six or more different Mycobacterium tuberculosis antigens. In some embodiments, the chimeric protein comprises T cell epitopes of seven or more different Mycobacterium tuberculosis antigens.
In some embodiments, the Mycobacterium tuberculosis antigens are selected from the group of Wbbll, PPE18, PE13, EsxA, EsxB, EsxG, EsxH, Esxl, EsxJ, EsxK, EsxL, EsxM, EsxN, EsxV and EsxW.
In some embodiments: a) the Wbbll antigen comprises the amino acid sequence of SEQ ID NO: 1 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 1; b) the PPE18 antigen comprises the amino acid sequence of SEQ ID NO: 2 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 2; c) the PE13 antigen comprises the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO: 4 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO: 4; d) the EsxA antigen comprises the amino acid sequence of SEQ ID NO: 5 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 5; e) the EsxB antigen comprises the amino acid sequence of SEQ ID NO: 6 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 6; f) the EsxG antigen comprises the amino acid sequence of SEQ ID NO: 7 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 7; g) the EsxH antigen comprises the amino acid sequence of SEQ ID NO: 8 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 8; h) the Esxl antigen comprises the amino acid sequence of SEQ ID NO: 9 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 9; i) the EsxJ antigen comprises the amino acid sequence of SEQ ID NO: 10 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 10; j) the EsxK antigen comprises the amino acid sequence of SEQ ID NO: 11 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 11; k) the EsxL antigen comprises the amino acid sequence of SEQ ID NO: 12 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 12; l) the EsxM antigen comprises the amino acid sequence of SEQ ID NO: 13 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 13; m) the EsxN antigen comprises the amino acid sequence of SEQ ID NO: 14 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 14; n) the EsxV antigen comprises the amino acid sequence of SEQ ID NO: 15 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 15; and/or o) the EsxW antigen comprises the amino acid sequence of SEQ ID NO: 16 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 16.
In some embodiments, the Mycobacterium tuberculosis antigens comprise Wbbll, PPE18 and PE13.
In some embodiments, the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a first, a second and a third antigen fragment of PPE18; and c) a full-length antigen of WbbLl.
In some embodiments: a) the first antigen fragment of PE13 comprises the amino acid sequence of positions 1 to 27 of SEQ ID NO: 3 or an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 1 to 27 of SEQ ID NO: 3; b) the second antigen fragment of PE13 comprises the amino acid sequence of positions 39 to 99 of SEQ ID NO: 3 or an amino acid sequence having at least 98%, 96%, 94%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 39 to 99 of SEQ ID NO: 3; c) the first antigen fragment of PPE18 comprises the amino acid sequence of positions 1 to 155 of SEQ ID NO: 2 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 1 to 155 of SEQ ID NO: 2; d) the second antigen fragment of PPE18 comprises the amino acid sequence of positions 186 to 296 of SEQ ID NO: 2 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 186 to 296 of SEQ ID NO: 2; and/or e) the third antigen fragment of PPE18 comprises the amino acid sequence of positions 303 to 391 of SEQ ID NO: 2 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 303 to 391 of SEQ ID NO: 2. In some embodiments, the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: first antigen fragment of PE13 - linker - third antigen fragment of PPE18 - linker - full-length antigen of Wbbll - linker - second antigen fragment of PPE18 - linker - second antigen fragment of PE13 - linker - first antigen fragment of PPE18.
In some embodiments, the Mycobacterium tuberculosis antigens comprise EsxG, EsxH, Esxl, EsxJ, EsxN, and EsxW. In some embodiments, the Mycobacterium tuberculosis antigens additionally comprise EsxB.
In some embodiments, the chimeric protein comprises: a) a full-length antigen of EsxG; b) a full-length antigen of EsxH; c) a full-length antigen of Esxl; d) an antigen fragment of EsxJ; e) a full-length antigen of EsxN; and f) a full-length antigen of EsxW.
In some embodiments, the chimeric protein additionally comprises: a) an antigen fragment of EsxB b) a full-length antigen of EsxG; c) a full-length antigen of EsxH; d) a full-length antigen of Esxl; e) an antigen fragment of EsxJ; f) a full-length antigen of EsxN; and g) a full-length antigen of EsxW.
In some embodiments: a) the antigen fragment of EsxB comprises the amino acid sequence of positions 1 to 87 of SEQ ID NO: 6 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 1 to 87 of SEQ ID NO: 6; and/or b) the antigen fragment of EsxJ comprises the amino acid sequence of positions 1 to 14 of SEQ ID NO: 10 or an amino acid sequence having at least 93%, 86% or 79% identity to the amino acid sequence of positions 1 to 14 of SEQ ID NO: 10.
In some embodiments, the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: a) full-length antigen of EsxG - linker - full-length antigen of EsxH - linker - full-length antigen of Esxl
- linker - antigen fragment of EsxJ - linker - full-length antigen of EsxN - linker - full-length antigen of EsxW; or b) full-length antigen of EsxG - linker - full-length antigen of Esxl - linker - full-length antigen of EsxH
- linker - antigen fragment of EsxJ - linker - full-length antigen of EsxN - linker - full-length antigen of EsxW.
In some embodiments, the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: a) antigen fragment of EsxB - linker - full-length antigen of EsxG - linker - full-length antigen of EsxH
- linker - full-length antigen of Esxl - linker - antigen fragment of EsxJ - linker - full-length antigen of EsxN - linker - full-length antigen of EsxW; or b) antigen fragment of EsxB - linker - full-length antigen of EsxG - linker - full-length antigen of Esxl
- linker - full-length antigen of EsxH - linker - antigen fragment of EsxJ - linker - full-length antigen of EsxN - linker - full-length antigen of EsxW.
In some embodiments, the Mycobacterium tuberculosis antigens comprise PE13 and two or more antigens selected from PPE18, EsxW, EsxJ. EsxG, Esxl, EsxN, EsxH and EsxA.
In some embodiments, the Mycobacterium tuberculosis antigens comprise a) PE13, PPE18, Esxl, EsxJ, EsxN and EsxW; b) PE13, PPE18, EsxG, EsxJ, and EsxW; c) PE13, PPE18, EsxG, Esxl, and EsxN; d) PE13, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW; e) PE13, EsxA, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW; f) PE13, Esxl, EsxJ, EsxN and EsxW; or g) PE13, PPE18, Esxl, EsxJ, EsxN and EsxW.
In some embodiments, the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a first, a second and a third antigen fragment of PPE18; c) a full-length antigen of Esxl; d) an antigen fragment of EsxJ; e) an antigen fragment of EsxN; and f) a full-length antigen of EsxW.
In some embodiments, the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a first, a second and a third antigen fragment of PPE18; c) a full-length antigen of EsxG; d) an antigen fragment of EsxJ; and e) a full-length antigen of EsxW.
In some embodiments, the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a first, a second and a third antigen fragment of PPE18; c) a full-length antigen of EsxG; d) an antigen fragment of Esxl; and e) a full-length antigen of EsxN.
In some embodiments, the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a full-length antigen of EsxG; c) a full-length antigen of EsxH; d) a full-length antigen of Esxl; e) an antigen fragment of EsxJ; f) an antigen fragment of EsxN; and g) a full-length antigen of EsxW.
In some embodiments, the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a first and a second antigen fragment of EsxA; c) a full-length antigen of EsxG; d) a full-length antigen of EsxH: e) a full-length antigen of Esxl; f) an antigen fragment of EsxJ; g) an antigen fragment of EsxN; and h) a full-length antigen of EsxW.
In some embodiments, the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a full-length antigen of Esxl; c) an antigen fragment of EsxJ; d) an antigen fragment of EsxN; and e) a full-length antigen of EsxW.
In some embodiments, the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a second and a third antigen fragment of PPE18; c) a full-length antigen of Esxl; d) an antigen fragment of EsxJ; e) an antigen fragment of EsxN; and f) a full-length antigen of EsxW.
In some embodiments: a) the first antigen fragment of PE13 comprises the amino acid sequence of positions 1 to 27 of SEQ ID NO: 3 or an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 1 to 27 of SEQ ID NO: 3; or the first antigen fragment of PE13 comprises the amino acid sequence of positions 1 to 29 of SEQ ID NO: 4 or an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 1 to 29 of SEQ ID NO: 4; b) the second antigen fragment of PE13 comprises the amino acid sequence of positions 39 to 97 of SEQ ID NO: 3 or an amino acid sequence having at least 98%, 96%, 94%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 39 to 97 of SEQ ID NO: 3; or the second antigen fragment of PE13 comprises the amino acid sequence of positions 41 to 99 of SEQ ID NO: 4 or an amino acid sequence having at least 98%, 96%, 94%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 41 to 99 of SEQ ID NO: 4; c) the first antigen fragment of PPE18 comprises the amino acid sequence of positions 1 to 155 of SEQ ID NO: 2 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 1 to 155 of SEQ ID NO: 2; d) the second antigen fragment of PPE18 comprises the amino acid sequence of positions 186 to 296 of SEQ ID NO: 2 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 186 to 296 of SEQ ID NO: 2; e) the third antigen fragment of PPE18 comprises the amino acid sequence of positions 303 to 391 of SEQ ID NO: 2 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 303 to 391 of SEQ ID NO: 2; f) the first antigen fragment of EsxA comprises the amino acid sequence of positions 1 to 35 of SEQ ID NO: 5 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 1 to 35 of SEQ ID NO: 5; g) the second antigen fragment of EsxA comprises the amino acid sequence of positions 26 to 81 of SEQ ID NO: 5 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 26 to 81 of SEQ ID NO: 5; h) the antigen fragment of EsxJ comprises the amino acid sequence of positions 1 to 14 of SEQ ID NO: 10 or an amino acid sequence having at least 93%, 86% or 79% identity to the amino acid sequence of positions 1 to 14 of SEQ ID NO: 10 and/or i) the antigen fragment of EsxN comprises the amino acid sequence of positions 10 to 67 of SEQ ID NO: 14 or an amino acid sequence having at least 93%, 86% or 79% identity to the amino acid sequence of positions 10 to 67 of SEQ ID NO: 14.
In some embodiments, the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: first antigen fragment of PE13 - linker - third antigen fragment of PPE18 - linker - full-length antigen of EsxW
- linker - antigen fragment of EsxJ - linker - second antigen fragment of PPE18 - linker - second antigen fragment of PE13 - linker - first antigen fragment of PPE18 - linker - full-length antigen of Esxl - linker - antigen fragment of EsxN.
In some embodiments, the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: first antigen fragment of PE13 - linker - third antigen fragment of PPE18 - linker - full-length antigen of EsxW
- linker - full-length antigen of EsxG - linker - second antigen fragment of PE13 - linker - second antigen fragment of PPE18 - linker - antigen fragment of EsxJ - linker - first antigen fragment of PPE18.
In some embodiments, the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: a) second antigen fragment of PE13 - linker - third antigen fragment of PPE18 - linker - antigen fragment of EsxN - linker - full-length antigen of EsxG - linker - first antigen fragment of PE13 - linker - second antigen fragment of PPE18 - linker - full-length antigen of Esxl - linker - first antigen fragment of PPE18; or b) second antigen fragment of PE13 - linker - first antigen fragment of PPE18 - linker - full-length antigen of Esxl - linker - second antigen fragment of PPE18 - linker - first antigen fragment of PE13 - linker - full-length antigen of EsxG - linker - antigen fragment of EsxN - linker - third antigen fragment of PPE18.
In some embodiments, the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: a) first antigen fragment of PE13 - linker - full-length antigen of EsxW - linker - full-length antigen of EsxG
- linker - second antigen fragment of PE13 - linker - full-length antigen of Esxl - linker - antigen fragment of EsxN - linker - antigen fragment of EsxJ - linker - full-length antigen of EsxH; b) second antigen fragment of PE13 - linker - full-length antigen of EsxW - linker - full-length antigen of EsxG - linker - first antigen fragment of PE13 - linker - full-length antigen of Esxl - linker - antigen fragment of EsxN
- linker - antigen fragment of EsxJ - linker - full-length antigen of EsxH; or c) second antigen fragment of PE13 - linker - full-length antigen of EsxH - linker - antigen fragment of EsxJ
- linker - antigen fragment of EsxN - linker - full-length antigen of Esxl - linker - first antigen fragment of PE13 - linker - full-length antigen of EsxG - linker - full-length antigen of EsxW.
In some embodiments, the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: a) first antigen fragment of PE13 - linker - full-length antigen of EsxW - linker - full-length antigen of EsxG
- linker - second antigen fragment of EsxA - linker - second antigen fragment of PE13 - linker - full-length antigen of Esxl - linker - first antigen fragment of EsxA - linker - antigen fragment of EsxN - linker - antigen fragment of EsxJ - linker - full-length antigen of EsxH; b) second antigen fragment of PE13 - linker - full-length antigen of EsxW - linker - full-length antigen of EsxG - linker - second antigen fragment of EsxA - linker - first antigen fragment of PE13 - linker - full-length antigen of Esxl - linker - first antigen fragment of EsxA - linker - antigen fragment of EsxN - linker - antigen fragment of EsxJ - linker - full-length antigen of EsxH; or c) second antigen fragment of PE13 - linker - full-length antigen of EsxH - linker - antigen fragment of EsxJ
- linker - antigen fragment of EsxN - linker - first antigen fragment of EsxA - linker - full-length antigen of Esxl - linker - first antigen fragment of PE13 - linker - second antigen fragment of EsxA - linker - full-length antigen of EsxG
- linker - full-length antigen of EsxW.
In some embodiments, one or more of the polypeptide linkers comprises one or more glycine and/or one or more serine amino acid. In some embodiments, one or more of the polypeptide linkers is at least 1, at least 5 or at least 10 amino acids in length. In some embodiments, one or more of the polypeptide linkers has the amino acid sequence of SEQ ID NO: 56.
In some embodiments, the chimeric protein comprises a non-native signal peptide at its N-terminus. In some embodiments, the non-native signal peptide is a human, bacterial or viral signal peptide. In some embodiments, the non-native signal peptide comprises a secretory signal. In some embodiments, the non-native signal peptide is functional in mammalian cells. In some embodiments, the non-native signal peptide comprises an amino acid sequence selected from the group of SEQ ID NOs: 17 to 37 or 65, an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to SEQ ID NOs: 17 to 37 or 65, an amino acid sequence encoded by a nucleotide sequence selected from the group of SEQ ID NOs: 38 to 51, or an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to amino acid sequences encoded by a nucleotide sequence selected from the group of SEQ ID NOs: 38 to 51. In some embodiments, the non-native signal peptide is a viral signal peptide. In some embodiments, the non-native signal peptide is a HSV-1 glycoprotein D signal peptide.
In some embodiments, the chimeric protein comprises a non-native transmembrane domain at its C-terminus. In some embodiments, the non-native transmembrane domain is a human, bacterial or viral transmembrane domain. In some embodiments, the non-native transmembrane domain comprises a trafficking domain. In some embodiments, non- native trafficking domain is an MHC class I trafficking domain. In some embodiments, the MHC class I trafficking domain comprises the amino acid sequence of SEQ ID NO: 52 or an amino acid sequence having at least 98%, 96%, 90%, or 80% identity to the amino acid sequence of SEQ ID NO: 52. In some embodiments, the non-native transmembrane domain is a viral transmembrane domain. In some embodiments, the non-native transmembrane domain is derived from HSV.
In some embodiments, the RNA molecule comprises a 5' cap. In some embodiments, the 5' cap comprises a capl structure. In some embodiments, the 5'-cap comprises m2 73 -OGppp(mi2' °)ApG.
In some embodiments, the RNA molecule comprises a 5'-UTR. In some embodiments, the 5'-UTR comprises a modified human alpha-globin 5'-UTR. In some embodiments, the 5'-UTR comprises the nucleotide sequence of SEQ ID NO: 53, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 53.
In some embodiments, the RNA comprises a 3'-UTR. In some embodiments, the 3'-UTR comprises a first sequence from the amino terminal enhancer of split (AES) messenger RNA and a second sequence from the mitochondrial encoded 12S ribosomal RNA. In some embodiments, the 3'-UTR comprises the nucleotide sequence of SEQ ID NO: 54, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 54.
In some embodiments, the RNA molecule comprises a polyA sequence. In some embodiments, the polyA sequence is an interrupted sequence of A nucleotides. In some embodiments, the polyA sequence comprises 30 adenine nucleotides followed by 70 adenine nucleotides, wherein the 30 adenine nucleotides and 70 adenine nucleotides are separated by a nucleotide linker sequence of 10 nucleotides. In some embodiments, the polyA sequence comprises the nucleotide sequence of SEQ ID NO: 55, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 55.
In some embodiments, the RNA molecule comprises a 5'-cap, a 5'-UTR, a 3'-UTR and a polyA sequence.
In some embodiments, the RNA molecule comprises modified nucleotides, nucleosides or nucleobases. In some embodiments, the RNA molecule comprises modified uridines. In some embodiments, the RNA molecule comprises modified uridines in place of all uridines. In some embodiments, the modified uridines are Nl-methyl-pseudouridine.
In some embodiments, the coding sequence of the RNA molecule is codon-optimized and/or is characterized in that its G/C content is increased compared to the parental sequence.
In one aspect, the disclosure provides a chimeric protein encoded by the RNA molecule described herein.
In one aspect, the disclosure provides a DNA molecule encoding the RNA molecule described herein.
In one aspect, the disclosure provides a pharmaceutical composition comprising one or more RNA molecules described herein. In some embodiments of the pharmaceutical composition, the one or more RNA molecules are formulated in a lipid formulation, such as in lipid nanoparticles or liposomes. In some embodiments, the lipid formulation comprises each of: a) a cationically ionizable lipid; b) a steroid; c) a neutral lipid; and d) a polymer-conjugated lipid.
In some embodiments, the cationically ionizable lipid is present in a concentration ranging from about 40 to about 60 mol percent of the total lipids. In some embodiments, the steroid is present in a concentration ranging from about 30 to about 50 mol percent of the total lipids. In some embodiments, the neutral lipid is present in a concentration ranging from about 5 to about 15 mol percent of the total lipids. In some embodiments, the polymer-conjugated lipid is present in a concentration ranging from about 1 to about 10 mol percent of the total lipids. In some embodiments, the cationically ionizable lipid is within a range of about 40 to about 60 mole percent, the steroid is within a range of about 30 to about 50 mole percent, the neutral lipid is within a range of about 5 to about 15 mole percent, and the polymer- conjugated lipid is within a range of about 1 to about 10 mole percent.
In some embodiments, the cationically ionizable lipid comprises ((4-hydroxybutyl)azanediyl)bis(hexane-6,l-diyl)bis(2- hexyldecanoate). In some embodiments, the steroid comprises cholesterol. In some embodiments, the neutral lipid comprises a phospholipid. In some embodiments, the phospholipid comprises distearoylphosphatidylcholine (DSPC).In some embodiments, the polymer-conjugated lipid comprises a polyethylene glycol (PEG)-lipid. In some embodiments, the PEG-lipid comprises 2-[(polyethylene glycol)-2000]-/Vz/V-ditetradecylacetamide.
In some embodiments, the lipid formulation comprises:
(a) ((4-hydroxybutyl)azanediyl)bis(hexane-6,l-diyl)bis(2-hexyldecanoate);
(b) cholesterol;
(c) distearoylphosphatidylcholine (DSPC); and
(d) 2-[(polyethylene glycol)-2000]-/Vz/V-ditetradecylacetamide.
In some embodiments, ((4-hydroxybutyl)azanediyl)bis(hexane-6,l-diyl)bis(2-hexyldecanoate) is within a range of about 40 to about 60 mole percent, cholesterol is within a range of about 30 to about 50 mole percent, distearoylphosphatidylcholine (DSPC) is within a range of about 5 to about 15 mole percent, and 2-[(polyethylene glycol)-2000]-N,N-ditetradecylacetamide is within a range of about 1 to about 10 mole percent.
In some embodiments, the pharmaceutical composition further comprises one or more pharmaceutically acceptable carriers, diluents and/or excipients.
In some embodiments, the one or more RNA molecules are in a liquid formulation. In some embodiments, the one or more RNA molecules are in a frozen formulation. In some embodiments, the one or more RNA molecules are in a lyophilized formulation. In some embodiments, the one or more RNA molecules are formulated for injection. In some embodiments, the one or more RNA molecules are formulated for intramuscular administration. In some embodiments, the pharmaceutical composition is formulated for administration in human.
In one aspect, the disclosure provides a kit comprising one or more pharmaceutical compositions described herein. In some embodiments of the kit, two or more pharmaceutical compositions comprising the same or different RNA molecules described herein are in separate vials. In some embodiments, the kit further comprises instructions for use of the one or more pharmaceutical composition for treating or preventing tuberculosis.
In one aspect, the disclosure provides an RNA molecule, chimeric protein, DNA molecule, pharmaceutical composition or kit described herein for use as a medicament. In some embodiments, the use comprises a therapeutic or prophylactic treatment of a disease or disorder in a subject. In some embodiments, the use comprises the use as a vaccine against a disease or disorder in a subject. In some embodiments, the subject is a human infected with the disease or disorder or in danger of contracting the disease or disorder.
In one aspect, the disclosure provides an RNA molecule, chimeric protein, DNA molecule, pharmaceutical composition or kit described herein for use in treating or preventing tuberculosis in a subject. In some embodiments, the subject is a human suffering from tuberculosis or in danger of contracting tuberculosis. In some embodiments, the use is as a vaccine for preventing tuberculosis.
In one aspect, the disclosure provides a use of the RNA molecule, the chimeric, the DNA molecule, the pharmaceutical composition or the kit described herein for the manufacture of a medicament for preventing or treating tuberculosis.
In one aspect, the disclosure provides a method of vaccinating a subject comprising administering the RNA molecule, the chimeric protein, the DNA molecule, the pharmaceutical composition or the kit described herein to the subject. In some embodiments, the vaccination is for preventing tuberculosis. In some embodiments, administration is by intramuscular administration. In some embodiments, the method comprises administering to the subject at least one dose of the RNA, chimeric protein or pharmaceutical composition. In some embodiments, the method comprises administering to the subject at least two doses of the RNA, chimeric protein or pharmaceutical composition. In some embodiments, an amount of the RNA of at least 10 pg per dose is administered. In some embodiments, the subject is a human.
In some embodiments of the RNA molecule, chimeric protein, pharmaceutical composition or kit for use, the use or the methods described herein, the tuberculosis is caused by an infection with a Mycobacterium. In some embodiments, the Mycobacterium is selected from the group of Mycobacterium tuberculosis, Mycobacterium bovis, Mycobacterium caprae, Mycobacterium orygis, Mycobacterium africanum, Mycobacterium microti, Mycobacterium canetti and Mycobacterium pinnipedii. In some embodiments, the Mycobacterium is Mycobacterium tuberculosis.
Brief description of the Figures
Figures 1 to 11: Bioinformatic data guiding the selection of antigens and design of chimeric proteins
Each antigen of interest has been analyzed by different bioinformatic analyses as further described in the accompanying text. For each antigen is depicted: Panel A) Peptides overlapping with the human proteome. Fragments were selected to exclude any of the regions above 0.0.
Panel B) Predicted class I epitopes for a wide array of human HLA alleles. A cumulative score is listed with the y-axis representing how many peptides are predicted to bind the different HLA-alleles for each residue.
Panel C) The predicted start sites of the epitopes predicted in B.
Panel D) The predicted stop sites of the epitopes predicted in B.
Panels E-G) The same analyses as described in B-D, but for HLA class II alleles.
Figures 12-18: Domain structure of chimeric proteins
In Figures 12-18, respectively, panel A shows the domain structure of an exemplary chimeric protein disclosed herein. The chimeric protein comprises sequences from several antigens either in the form of full-length antigens or antigen fragments - separated from each other by polypeptide linkers. The exemplary chimeric protein comprises a signal peptide (sec) at its N-terminus, whereas a transmembrane domain is located at its C-terminus. The lower half of panel A shows the length of the protein sequences by number of amino acids.
In panel B, the figures respectively list the sequences and positions of individual domains within the domain structure of the exemplary chimeric protein.
Figures 19 and 20: Expression of chimeric proteins as analyzed by mass-spectrometry
In Figures 19 and 20, respectively, panel A) shows the position of tryptic digest fragments analyzed by mass- spectrometry on the sequence of the chimeric protein and panel B) shows the detection of tryptic digest fragments by mass-spectrometry.
Figures 21-23: Detection of epitope binding to four different human HLA subclasses
In Figures 21-23, respectively, panel A) shows the position of detected epitopes on the sequence of the chimeric proteins and panel B) shows the sequence and human HLA subtype presenting the epitopes identified in panel A.
Figures 24 and 25: In vivo T-cell responses to chimeric proteins in C57BI6 mice
In Figures 24 and 25, respectively, panel A) shows in the left column the in vivo T-cell responses in mice immunized with RNA encoding the chimeric proteins as measured by induction of interferon y (IFN y) in the total T-cell population - separated by domain. In the right column, IFN y induction is shown for CD4+ and CD8+ cells, respectively. Panels B) and C) have the same structure, showing respective induction of interleukin-2 (IL-2) and tumor necrosis factor o (TNFo). Panel D) shows the responses in NaCI mock-immunized mice as a negative control.
Figure 26: In vivo T-cell responses to chimeric proteins in transgenic human HLA A2.1/DR1 mice
Panel A) shows the in vivo T-cell responses in mice immunized with RNA encoding the chimeric protein string 1 as measured by induction of interferon y (IFN y) in the total T-cell population - separated by domain. In panel B, IFN y induction is shown for CD4+ and CD8+ cells of string 1, respectively. Panels C and D and Panels E and F have the same structure but show the results for string 2 and string 3, respectively. Results are displayed as bars of the mean value ± standard deviation in combination with single values of individual mice. Figures show IFNy secretion as spot forming units in peptide-restimulated full splenoyctes (Panel A, C, E), and CD4+ (white bars) or CD8+ T cells (grey bars; Panel B, D, F). Figure 27: In vivo T-cell responses to chimeric proteins with different TMDs in C57BI6 mice
Panel A) shows in the left column the in vivo T-cell responses in mice immunized with RNA encoding the chimeric proteins as measured by induction of interferon y (IFN y) in the total T-cell population - separated by domain. In the right column, IFN y induction is shown for CD4+ and CD8+ cells, respectively. Panels B) and C) have the same structure, showing respective induction of interleukin-2 (IL-2) and tumor necrosis factor a (TNFa).
Figure 28: In vivo solenocyte and T cell response to BCG
Panel A) shows the in vivo T-cell responses in mice immunized with RNA encoding the chimeric proteins as measured by induction of interferon y (IFN y) for CD4+ cells (white bars) and CD8+ cells (grey bars) - separated by domain. Panels B) and C) have the same structure, showing respective induction of interleukin-2 (IL-2) and tumor necrosis factor o (TNFo). Panel D shows IFN y, IL-2 and TNFo induction in total splenocytes.
Figure 29-39: Visualization of IEDB and lioandomics-derived epitope hits of antigens and antigen fragments
Figures 29-39 show for the antigens or antigen fragments four subplots (labeled A-D) in the top-to-bottom order: A) "IEDB nCounts Epitopes" represent the total number of times that the corresponding epitope has been listed across multiple HLA alleles and studies in IEDB, B) "IEDB HLA alleles" shows a heatmap showing the number of times any particular HLA allele shown has been listed as being immunogenic together with an epitope in IEDB, C) "Ligandomics HLA alleles" shows a heatmap that highlights the number of times that the corresponding HLA class I allele was identified as presenting any ligandomics epitope, D) "String" represents a heatmap showing which region o f the antigen or antigen fragment has been used in one of the designed strings listed.
Figures 40-45: Domain structure of chimeric proteins
In Figures 40-45, respectively, panel A shows the domain structure of an exemplary chimeric protein disclosed herein. The chimeric protein comprises sequences from several antigens either in the form of full-length antigens or antigen fragments - separated from each other by polypeptide linkers. The exemplary chimeric protein comprises a signal peptide (sec) at its N-terminus, whereas a transmembrane domain (MITD) is located at its C-terminus.
In panel B, the figures respectively list the sequences and positions of individual domains within the domain structure of the exemplary chimeric protein.
Detailed Description
Although the present disclosure is further described in more detail below, it is to be understood that this disclosure is not limited to the particular methodologies, protocols and reagents described herein as these may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present disclosure which will be limited only by the appended claims. Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of ordinary skill in the art.
In the following, the elements of the present disclosure will be described in more detail. These elements are listed with specific embodiments, however, it should be understood that they may be combined in any manner and in any number to create additional embodiments. The variously described examples and preferred embodiments should not be construed to limit the present disclosure to only the explicitly described embodiments. This description should be understood to support and encompass embodiments which combine the explicitly described embodiments with any number of the disclosed and/or preferred elements. Furthermore, any permutations and combinations of all described elements in this application should be considered disclosed by the description of the present application unless the context indicates otherwise.
For example, the present disclosure describes combinations of sequence molecules which may have different levels of sequence identity to a specified sequence, e.g., (i) sequence molecule A comprising the sequence of SEQ ID NO: a, or a sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the sequence of SEQ ID NO: a, (ii) sequence molecule B comprising the sequence of SEQ ID NO: b, or a sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the sequence of SEQ ID NO: b etc. It should be understood that the sequence molecules may be combined in any of the identity levels specified. In some embodiments, the sequence molecules are combined such that the identity levels are identical; e.g., (i) sequence molecule A comprising the sequence of SEQ ID NO: a, (ii) sequence molecule B comprising the sequence of SEQ ID NO: b etc., or (i) sequence molecule A comprising a sequence having at least 90% identity to the sequence of SEQ ID NO: a, (ii) sequence molecule B comprising a sequence having at least 90% identity to the sequence of SEQ ID NO: b etc. In some embodiments, the identity levels are independently selected and are partially or entirely different from each other, i.e., the sequence molecules are combined such that the identity levels are not identical; e.g., (i) sequence molecule A comprising the sequence of SEQ ID NO: a, (ii) sequence molecule B comprising a sequence having at least 90% identity to the sequence of SEQ ID NO: b etc., or (i) sequence molecule A comprising a sequence having at least 90% identity to the sequence of SEQ ID NO: a, (ii) sequence molecule B comprising a sequence having at least 85% identity to the sequence of SEQ ID NO: b etc.
The practice of the present disclosure will employ, unless otherwise indicated, conventional chemistry, biochemistry, cell biology, immunology, and recombinant DNA techniques which are explained in the literature in the field.
Throughout this specification and the claims which follow, unless the context requires otherwise, the word "comprise", and variations such as "comprises" and "comprising", will be understood to imply the inclusion of a stated feature, element, member, integer or step or group of features, elements, members, integers or steps but not the exclusion of any other feature, element, member, integer or step or group of features, elements, members, integers or steps. The term "consisting essentially of" limits the scope of a claim or disclosure to the specified features, elements, members, integers, or steps and those that do not materially affect the basic and novel characteristic(s) of the claim or disclosure. The term "consisting of" limits the scope of a claim or disclosure to the specified features, elements, members, integers, or steps. The term "comprising" encompasses the term "consisting essentially of" which, in turn, encompasses the term "consisting of". Thus, at each occurrence in the present application, the term "comprising" may be replaced with the term "consisting essentially of" or "consisting of". Likewise, at each occurrence in the present application, the term "consisting essentially of" may be replaced with the term "consisting of".
The terms "a", "an" and "the" and similar references used in the context of describing the present disclosure (especially in the context of the claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by the context.
All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by the context.
The use of any and all examples, or exemplary language e.g, "such as"), provided herein is intended merely to better illustrate the present disclosure and does not pose a limitation on the scope of the present disclosure otherwise claimed. No language in the specification should be construed as indicating any non-claimed element essential to the practice of the present disclosure. The term "optional" or "optionally" as used herein means that the subsequently described event, circumstance or condition may or may not occur, and that the description includes instances where said event, circumstance, or condition occurs and instances in which it does not occur.
Where used herein, "and/or" is to be taken as specific disclosure of each of the two specified features or components with or without the other. For example, "X and/or Y" is to be taken as specific disclosure of each of (i) X, (ii) Y, and (iii) X and Y, just as if each is set out individually herein.
In the context of the present disclosure, the term "about" denotes an interval of accuracy that the person of ordinary skill will understand to still ensure the technical effect of the feature in question. The term typically indicates deviation from the indicated numerical value by ±10%, ±5%, ±4%, ±3%, ±2%, ±1%, ±0.9%, ±0.8%, ±0.7%, ±0.6%, ±0.5%, ±0.4%, ±0.3%, ±0.2%, ±0.1%, ±0.05%, and for example ±0.01%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±10%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±5%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±4%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±3%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±2%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±1%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±0.9%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±0.8%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±0.7%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±0.6%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±0.5%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±0.4%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±0.3%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±0.2%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±0.1%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±0.05%. In some embodiments, "about" indicates deviation from the indicated numerical value by ±0.01%. As will be appreciated by the person of ordinary skill, the specific such deviation for a numerical value for a given technical effect will depend on the nature of the technical effect. For example, a natural or biological technical effect may generally have a larger such deviation than one for a man-made or engineering technical effect.
Recitation of ranges of values herein is merely intended to serve as a shorthand method of referring individually to each separate value falling within the range. Unless otherwise indicated herein, each individual value is incorporated into the specification as if it were individually recited herein.
Several documents are cited throughout the text of this specification. Each of the documents cited herein (including all patents, patent applications, scientific publications, manufacturer's specifications, instructions, etc.), whether supra or infra, are hereby incorporated by reference in their entirety. Nothing herein is to be construed as an admission that the invention is not entitled to antedate such disclosure by virtue of prior invention.
It should be noted for unambiguousness that whenever a sequence is referred to as being the sequence between the nucleotide at position x and the nucleotide at position y, the resulting sequence includes both the nucleotide at position x and the nucleotide at position y. Similarly, whenever a sequence is referred to as being the sequence between the amino acid at position x and the amino acid at position y, the resulting sequence includes both the amino acid at position x and the amino acid at position y. Moreover, while the sequences described herein, in particular in the sequence listing, refer to DNA molecules, it is clear that when it is stated in the description or the claims that an RNA comprises a nucleotide sequence as described herein, in particular in the sequence listing, the nucleotide sequence referred to is actually identical to the base-sequence of the DNA molecule described herein, in particular in the sequence listing, e.g., represented in a SEQ ID NO referred to, except that thymine is replaced by uracil.
In the following, definitions and embodiments will be provided which apply to all aspects of the present disclosure. Terms which are defined in the following have the meanings as defined, unless otherwise indicated. Any undefined terms have their art recognized meanings.
Mycobacterium tuberculosis (Mtb) is a non-motile, slowly growing and rod shaped (2-4 pm in length and 0.2-0.5 pm in width) bacterium. Mtb \s gram-positive, obligate aerobe, requires a host for growth and reproduction, and does not form spores.
The term "tuberculosis" or "TB" is used to describe the infection caused by infective agents from the genus "Mycobacterium ". Tuberculosis is a potentially fatal contagious disease that can affect almost any part of the body but is most frequently an infection of the lungs. While the majority of tuberculosis infections is caused by Mycobacterium tuberculosis, there are other Mycobacterium species that can cause tuberculosis as well. These species include Mycobacterium bovis, Mycobacterium caprae, Mycobacterium orygis, Mycobacterium africanum, Mycobacterium microti, Mycobacterium canetti and Mycobacterium pinnipedii. Mycobacterium tuberculosis and some other mycobacteria are transmitted by airborne droplet nuclei produced when an individual with active disease coughs, speaks, or sneezes. When inhaled, the droplet nuclei reach the alveoli of the lung. In susceptible individuals the organisms may then multiply and spread through lymphatics to the lymph nodes, and through the bloodstream to other sites such as the lung apices, bone marrow, kidneys, and meninges. Infections with other Mycobacterium species, such as Mycobacterium bovis or Mycobacterium caprae are also associated with the consumption of un-pasteurized milk from infected animals. The development of acquired immunity in 2 to 10 weeks results in a halt to bacterial multiplication. Lesions heal and the individual remains asymptomatic. Mycobacteria can remain dormant (latent TB) in the body after infection for years, concealed in the phagocytosed cells, and never develop into the disease. Such an individual is said to have tuberculous infection without disease, and will show a positive tuberculin test. The clinical status of latent TB is traditionally associated with the transition of Mtb to a dormant state in response to non-optimal growth conditions in vivo due to activation of the host immune response. Dormancy is a specific physiological state characterized by significant cessation of metabolic activity and growth, whereas resuscitation from dormancy is a process of restoring cell activity followed by bacterial multiplication, which in case of Mtb can lead to disease progression. The risk of developing active disease with clinical symptoms diminishes with time and may never occur, but is a lifelong risk. Approximately 5% of individuals with tuberculous infection progress to active disease.
Terms such as "reduce" or "inhibit" as used herein means the ability to cause an overall decrease, for example, of about 5% or greater, about 10% or greater, about 15% or greater, about 20% or greater, about 25% or greater, about 30% or greater, about 40% or greater, about 50% or greater, or about 75% or greater, in the level. The term "inhibit" or similar phrases includes a complete or essentially complete inhibition, i.e. a reduction to zero or essentially to zero.
Terms such as "enhance" as used herein means the ability to cause an overall increase, or enhancement, for example, by at least about 5% or greater, about 10% or greater, about 15% or greater, about 20% or greater, about 25% or greater, about 30% or greater, about 40% or greater, about 50% or greater, about 75% or greater, or about 100% or greater in the level.
"Physiological pH" as used herein refers to a pH of about 7.4. In some embodiments, physiological pH is from 7.3 to 7.5. In some embodiments, physiological pH is from 7.35 to 7.45. In some embodiments, physiological pH is 7.3, 7.35, 7.4, 7.45, or 7.5. As used in the present disclosure, "% w/v" refers to weight by volume percent, which is a unit of concentration measuring the amount of solute in grams (g) expressed as a percent of the total volume of solution in milliliters (mL).
As used in the present disclosure, "% by weight" refers to weight percent, which is a unit of concentration measuring the amount of a substance in grams (g) expressed as a percent of the total weight of the total composition in grams (g).
As used in the present disclosure, "mol %" is defined as the ratio of the number of moles of one component to the total number of moles of all components, multiplied by 100.
As used in the present disclosure, "mol % of the total lipid" is defined as the ratio of the number of moles of one lipid component to the total number of moles of all lipids, multiplied by 100. In this context, in some embodiments, the term "total lipid" includes lipids and lipid-like material.
The term "ionic strength" refers to the mathematical relationship between the number of different kinds of ionic species in a particular solution and their respective charges. Thus, ionic strength I is represented mathematically by the formula:
' l i z2 'ci in which c is the molar concentration of a particular ionic species and z the absolute value of its charge. The sum Z is taken over all the different kinds of ions (i) in solution.
According to the disclosure, the term "ionic strength" in some embodiments relates to the presence of monovalent ions. Regarding the presence of divalent ions, in particular divalent cations, their concentration or effective concentration (presence of free ions) due to the presence of chelating agents is, in some embodiments, sufficiently low so as to prevent degradation of the nucleic acid. In some embodiments, the concentration or effective concentration of divalent ions is below the catalytic level for hydrolysis of the phosphodiester bonds between nucleotides such as RNA nucleotides. In some embodiments, the concentration of free divalent ions is 20 pM or less. In some embodiments, there are no or essentially no free divalent ions.
"Osmolality" refers to the concentration of a particular solute expressed as the number of osmoles of solute per kilogram of solvent.
The term "lyophilizing" or "lyophilization" refers to the freeze-drying of a substance by freezing it and then reducing the surrounding pressure (e.g., below 15 Pa, such as below 10 Pa, below 5 Pa, or 1 Pa or less) to allow the frozen medium in the substance to sublimate directly from the solid phase to the gas phase. Thus, the terms "lyophilizing" and "freeze-drying" are used herein interchangeably.
The term "spray-drying" refers to spray-drying a substance by mixing (heated) gas with a fluid that is atomized (sprayed) within a vessel (spray dryer), where the solvent from the formed droplets evaporates, leading to a dry powder.
The term "reconstitute" relates to adding a solvent such as water to a dried product to return it to a liquid state such as its original liquid state. The term "recombinant" in the context of the present disclosure means "made through genetic engineering". In some embodiments, a "recombinant object" in the context of the present disclosure is not occurring naturally.
The term "naturally occurring" as used herein refers to the fact that an object can be found in nature. For example, a peptide or nucleic acid that is present in an organism (including viruses) and can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally occurring. The term "found in nature" means "present in nature" and includes known objects as well as objects that have not yet been discovered and/or isolated from nature, but that may be discovered and/or isolated in the future from a natural source.
As used herein, the terms "room temperature" and "ambient temperature" are used interchangeably herein and refer to temperatures from at least about 15°C, e.g., from about 15°C to about 35°C, from about 15°C to about 30°C, from about 15°C to about 25°C, or from about 17°C to about 22°C. Such temperatures will include 15°C, 16°C, 17°C, 18°C, 19°C, 20°C, 21°C and 22°C.
The term "EDTA" refers to ethylenediaminetetraacetic acid disodium salt. All concentrations are given with respect to the EDTA disodium salt.
The term "cryoprotectant" relates to a substance that is added to a formulation in order to protect the active ingredients during the freezing stages.
The term "lyoprotectant" relates to a substance that is added to a formulation in order to protect the active ingredients during the drying stages.
According to the present disclosure, the term "peptide" refers to substances which comprise about two or more, about 3 or more, about 4 or more, about 6 or more, about 8 or more, about 10 or more, about 13 or more, about 16 or more, about 20 or more, and up to about 50, about 100 or about 150, consecutive amino acids linked to one another via peptide bonds. The term "polypeptide" refers to large peptides, in particular peptides having at least about 151 amino acids. "Peptides" and "polypeptides" are both protein molecules, although the terms "protein" and "polypeptide" are used herein usually as synonyms.
The term "biological activity" means the response of a biological system to a molecule. Such biological systems may be, for example, a cell or an organism. In some embodiments, such response is therapeutically or pharmaceutically useful.
The term "portion" refers to a fraction. With respect to a particular structure such as an amino acid sequence or protein the term "portion" thereof may designate a continuous or a discontinuous fraction of said structure.
The terms "part" and "fragment" are used interchangeably herein and refer to a continuous element. For example, a part of a structure such as an amino acid sequence or protein refers to a continuous element of said structure. When used in context of a composition, the term "part" means a portion of the composition. For example, a part of a composition may be any portion from 0.1% to 99.9% (such as 0.1%, 0.5%, 1%, 5%, 10%, 50%, 90%, or 99%) of said composition.
"Fragment", with reference to an amino acid sequence (peptide or polypeptide), relates to a part of an amino acid sequence, i.e. a sequence which represents the amino acid sequence shortened at the N-terminus and/or C-terminus. A fragment shortened at the C-terminus (N-terminal fragment) is obtainable, e.g., by translation of a truncated open reading frame that lacks the 3'-end of the open reading frame. A fragment shortened at the N-terminus (C -terminal fragment) is obtainable, e.g., by translation of a truncated open reading frame that lacks the 5'-end of the open reading frame, as long as the truncated open reading frame comprises a start codon that serves to initiate translation. A fragment of an amino acid sequence comprises, e.g., at least 50 %, at least 60 %, at least 70 %, at least 80%, at least 90% of the amino acid residues from an amino acid sequence. A fragment of an amino acid sequence comprises, e.g., at least 5, at least 6, at least 7, in particular at least 8, at least 10, at least 12, at least 15, at least 20, at least 30, at least 50, or at least 100 consecutive amino acids from an amino acid sequence. A fragment of an amino acid sequence comprises, e.g., a sequence of up to 8, in particular up to 10, up to 12, up to 15, up to 20, up to 30, up to 50, up to 80, up to 100, up to 150 or up to 200 consecutive amino acids of the amino acid sequence.
A "Mycobacterium tuberculosis antigen or immunogenic variant thereof represented by one or more antigen fragments and/or one or more full length antigens" as used herein refers to the full length Mycobacterium tuberculosis antigen or an immunogenic variant of the full length Mycobacterium tuberculosis antigen, or one or more fragments of the Mycobacterium tuberculosis antigen or an immunogenic variant of the Mycobacterium tuberculosis antigen, wherein the fragments may or may not be overlapping. An immunogenic variant of a Mycobacterium tuberculosis antigen or one or more fragments of a Mycobacterium tuberculosis antigen or an immunogenic variant of a Mycobacterium tuberculosis antigen are capable of inducing an immune response against the Mycobacterium tuberculosis antigen when delivered to a subject, e.g. in the form of a protein or an RNA transcribed by a cell of the subject. In some embodiments, a fragment of a Mycobacterium tuberculosis antigen or an immunogenic variant of a Mycobacterium tuberculosis antigen comprises at least one epitope, e.g., at least one T cell epitope, of a Mycobacterium tuberculosis antigen or an immunologically equivalent variant of said at least one epitope. In some embodiments, a fragment of a Mycobacterium tuberculosis antigen or an immunogenic variant of a Mycobacterium tuberculosis antigen comprises a fragment of, e.g., at least 5, at least 6, at least 7, in particular at least 8, at least 10, at least 12, at least 15, at least 20, at least 30, at least 50, or at least 100 consecutive amino acids of said Mycobacterium tuberculosis antigen or immunogenic variant of a Mycobacterium tuberculosis antigen.
If reference is made to RNA encoding a chimeric protein or encoding at least one full-length antigen or antigen fragment representing at least one Mycobacterium tuberculosis antigen or immunogenic variant thereof, such disclosure encompasses monocistronic and polycistronic RNAs.
If only one Mycobacterium tuberculosis antigen or immunogenic variant thereof is represented, the RNA may encode one or more fragments of the Mycobacterium tuberculosis antigen or immunogenic variant thereof. If the RNA encodes more than one fragment of the Mycobacterium tuberculosis antigen or immunogenic variant thereof, fragments of the Mycobacterium tuberculosis antigen or immunogenic variant thereof may be encoded by different open reading frames located on the same or on different RNA molecules.
If more than one Mycobacterium tuberculosis antigen or immunogenic variant thereof is represented, the RNA may encode one Mycobacterium tuberculosis antigen or immunogenic variant thereof as one or more fragments and, optionally, as an additional full length antigen, whereas the remaining Mycobacterium tuberculosis antigens or immunogenic variants thereof are encoded as the full length antigen and/or as one or more antigen fragments, respectively. In some embodiments, the RNA encodes the full-length antigen of each of the more than one Mycobacterium tuberculosis antigen or immunogenic variant thereof. In some embodiments, the RNA encodes one or more fragments of each of the more than one Mycobacterium tuberculosis antigen or immunogenic variant thereof. In some embodiments, the RNA encodes the full-length antigen of some of the more than one Mycobacterium tuberculosis antigen or immunogenic variant thereof and encodes one or more fragments of some of the more than one Mycobacterium tuberculosis antigen or immunogenic variant thereof, wherein the RNA may encode the full-length antigen as well as one or more fragments of the same Mycobacterium tuberculosis antigen or immunogenic variant thereof. The full-length antigens and/or fragments discussed above may be encoded by the same or different open reading frames located on the same or on different RNA molecules. The term "chimeric protein" is used herein as a synonym for "fusion protein" and means a protein comprising two or more subunits, such as a full-length antigen, antigen fragment and/or other functional amino acid sequence. Preferably, the fusion protein is a translational fusion between the two or more subunits. The translational fusion may be generated by genetically engineering the coding nucleotide sequence for one subunit in a reading frame with the coding nucleotide sequence of a further subunit. Subunits may be interspersed by a polypeptide linker.
The term "polypeptide linker" describes either a single amino acid or a sequence of amino acids connecting the amino acid sequences of two adjacent subunits in a linear amino acid sequence of a chimeric protein. A polypeptide linker may have a length of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15 or more amino acids. Preferably, the polypeptide linker is 10 amino acids in length. Exemplary linkers include glycine-serine-polypeptide linkers, glycine-proline-polypeptide linkers, and proline-alanine polypeptide linkers. In certain embodiments, the linker is a glycine-serine-polypeptide linker (GS linker), i.e., a peptide that consists of glycine and serine residues. In some embodiments, a GS linker comprises the amino acid sequence of SEQ ID NO: 56.
By "wild type" or "WT" or "native" herein is meant an amino acid sequence that is found in nature, including allelic variations and/or naturally occurring mutations. A wild type amino acid sequence, peptide or polypeptide has an amino acid sequence that has not been intentionally modified by man.
The term "non-native" as used herein in conjunction with amino acid sequences is meant to refer to amino acid sequences not found in nature, i.e., that have been intentionally modified by man - either in sequence or in sequence context. In one embodiment, a non-native signal peptide sequence fused or operatively linked to a Mycobacterium tuberculosis antigen denotes that said signal peptide in nature does not occur fused or operatively linked to said Mycobacterium tuberculosis antigen, either because said signal peptide can naturally be found fused or operatively linked only to other Mycobacterium tuberculosis antigens or only in other organisms, such as mammals, e.g. human, other bacteria besides Mycobacterium tuberculosis or viruses. Embodiments for such non-native signal peptides are provided herein. In another embodiment, a non-native signal peptide has been mutated in a purposeful manner (e.g., by random mutagenesis and targeted selection or by guided mutagenesis techniques, including, e.g., sequence synthesis) in order to obtain certain functional properties or to eliminate certain functional properties, resulting in a signal peptide structurally and functionally distinct from a signal peptide found in nature fused or operatively linked to the Mycobacterium tuberculosis antigen in question.
"Variant," as used herein and with reference to an amino acid sequence (peptide or polypeptide), is meant an amino acid sequence that differs from a parent amino acid sequence by virtue of at least one amino acid (e.g., a different amino acid, or a modification of the same amino acid). The parent amino acid sequence may be a naturally occurring or wild type (WT) amino acid sequence, or may be a modified version of a wild type amino acid sequence. In some embodiments, the variant amino acid sequence has at least one amino acid difference as compared to the parent amino acid sequence, e.g., from 1 to about 20 amino acid differences, such as from 1 to about 10 or from 1 to about 5 amino acid differences compared to the parent.
For the purposes of the present disclosure, "variants" of an amino acid sequence (peptide or polypeptide) may comprise amino acid insertion variants, amino acid addition variants, amino acid deletion variants and/or amino acid substitution variants. The term "variant" includes all mutants, splice variants, post-translationally modified variants, conformations, isoforms, allelic variants, species variants, and species homologs, in particular those which are naturally occurring. The term "variant" includes, in particular, fragments of an amino acid sequence.
Amino acid insertion variants comprise insertions of single or two or more amino acids in a particular amino acid sequence. In the case of amino acid sequence variants having an insertion, one or more amino acid residues are inserted into a particular site in an amino acid sequence, although random insertion with appropriate screening of the resulting product is also possible. Amino acid addition variants comprise amino- and/or carboxy-terminal fusions of one or more amino acids, such as 1, 2, 3, 5, 10, 20, 30, 50, or more amino acids. Amino acid deletion variants are characterized by the removal of one or more amino acids from the sequence, such as by removal of 1, 2, 3, 5, 10, 20, 30, 50, or more amino acids. The deletions may be in any position of the protein. Amino acid deletion variants that comprise the deletion at the N-terminal and/or C-terminal end of the protein are also called N-terminal and/or C- terminal truncation variants. Amino acid substitution variants are characterized by at least one residue in the sequence being removed and another residue being inserted in its place. Preference is given to the modifications being in positions in the amino acid sequence which are not conserved between homologous peptides or polypeptides and/or to replacing amino acids with other ones having similar properties. In some embodiments, amino acid changes in peptide and polypeptide variants are conservative amino acid changes, i.e., substitutions of similarly charged or uncharged amino acids. A conservative amino acid change involves substitution of one of a family of amino acids which are related in their side chains. Naturally occurring amino acids are generally divided into four families: acidic (aspartate, glutamate), basic (lysine, arginine, histidine), non-polar (alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), and uncharged polar (glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine) amino acids. Phenylalanine, tryptophan, and tyrosine are sometimes classified jointly as aromatic amino acids. In some embodiments, conservative amino acid substitutions include substitutions within the following groups:
- glycine, alanine;
- valine, isoleucine, leucine;
- aspartic acid, glutamic acid;
- asparagine, glutamine;
- serine, threonine;
- lysine, arginine; and
- phenylalanine, tyrosine.
In some embodiments the degree of similarity, such as identity between a given amino acid sequence and an amino acid sequence which is a variant of said given amino acid sequence, will be at least about 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%. In some embodiments, the degree of similarity or identity is given for an amino acid region which is at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90% or about 100% of the entire length of the reference amino acid sequence. For example, if the reference amino acid sequence consists of 200 amino acids, the degree of similarity or identity is given, e.g., for at least about 20, at least about 40, at least about 60, at least about 80, at least about 100, at least about 120, at least about 140, at least about 160, at least about 180, or about 200 amino acids, in some embodiments, continuous amino acids. In some embodiments, the degree of similarity or identity is given for the entire length of the reference amino acid sequence. The alignment for determining sequence similarity, such as sequence identity, can be done with art known tools, such as using the best sequence alignment, for example, using Align, using standard settings, preferably EMBOSS: : needle, Matrix: Blosum62, Gap Open 10.0, Gap Extend 0.5.
"Sequence similarity" indicates the percentage of amino acids that either are identical or that represent conservative amino acid substitutions. "Sequence identity" between two amino acid sequences indicates the percentage of amino acids that are identical between the sequences. "Sequence identity" between two nucleic acid sequences indicates the percentage of nucleotides that are identical between the sequences.
The terms "% identical" and "% identity" or similar terms are intended to refer, in particular, to the percentage of nucleotides or amino acids which are identical in an optimal alignment between the sequences to be compared. Said percentage is purely statistical, and the differences between the two sequences may be but are not necessarily randomly distributed over the entire length of the sequences to be compared. Comparisons of two sequences are usually carried out by comparing the sequences, after optimal alignment, with respect to a segment or "window of comparison", in order to identify local regions of corresponding sequences. The optimal alignment for a comparison may be carried out manually or with the aid of the local homology algorithm by Smith and Waterman, 1981, Ads App. Math. 2, 482, with the aid of the local homology algorithm by Neddleman and Wunsch, 1970, J. Mol. Biol. 48, 443, with the aid of the similarity search algorithm by Pearson and Lipman, 1988, Proc. Natl Acad. Sci. USA 88, 2444, or with the aid of computer programs using said algorithms (GAP, BESTFIT, FASTA, BLAST P, BLAST N and TFASTA in Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Drive, Madison, Wis.). In some embodiments, percent identity of two sequences is determined using the BLASTN or BLASTP algorithm, as available on the United States National Center for Biotechnology Information (NCBI) website (e.g, at blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE_TYPE=BlastSearch&BLAST_SPEC=blast2seq&LINK_LOC=align2seq). In some embodiments, the algorithm parameters used for BLASTN algorithm on the NCBI website include: (i) Expect Threshold set to 10; (ii) Word Size set to 28; (iii) Max matches in a query range set to 0; (iv) Match/Mismatch Scores set to 1, - 2; (v) Gap Costs set to Linear; and (vi) the filter for low complexity regions being used. In some embodiments, the algorithm parameters used for BLASTP algorithm on the NCBI website include: (i) Expect Threshold set to 10; (ii) Word Size set to 3; (iii) Max matches in a query range set to 0; (iv) Matrix set to BLOSUM62; (v) Gap Costs set to Existence: 11 Extension: 1; and (vi) conditional compositional score matrix adjustment.
Percentage identity is obtained by determining the number of identical positions at which the sequences to be compared correspond, dividing this number by the number of positions compared (e.g, the number of positions in the reference sequence) and multiplying this result by 100.
In some embodiments, the degree of similarity or identity is given for a region which is at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90% or about 100% of the entire length of the reference sequence. For example, if the reference nucleic acid sequence consists of 200 nucleotides, the degree of identity is given for at least about 100, at least about 120, at least about 140, at least about 160, at least about 180, or about 200 nucleotides, in some embodiments continuous nucleotides. In some embodiments, the degree of similarity or identity is given for the entire length of the reference sequence.
Homologous amino acid sequences exhibit according to the disclosure at least 40%, in particular at least 50%, at least 60%, at least 70%, at least 80%, at least 90% and, e.g., at least 95%, at least 98 or at least 99% identity of the amino acid residues.
The amino acid sequence variants described herein may readily be prepared by the skilled person, for example, by recombinant DNA manipulation. The manipulation of DNA sequences for preparing peptides or polypeptides having substitutions, additions, insertions or deletions, is described in detail in Molecular Cloning: A Laboratory Manual, 4th Edition, M.R. Green and J. Sambrook eds., Cold Spring Harbor Laboratory Press, Cold Spring Harbor 2012, for example. Furthermore, the peptides, polypeptides and amino acid variants described herein may be readily prepared with the aid of known peptide synthesis techniques such as, for example, by solid phase synthesis and similar methods. In some embodiments, a fragment or variant of an amino acid sequence (peptide or polypeptide) is a "functional fragment" or "functional variant". The term "functional fragment" or "functional variant" of an amino acid sequence relates to any fragment or variant exhibiting one or more functional properties identical or similar to those of the amino acid sequence from which it is derived, i.e., it is functionally equivalent. With respect to antigens or antigenic sequences, one particular function is one or more immunogenic activities displayed by the amino acid sequence from which the fragment or variant is derived. The term "functional fragment" or "functional variant", as used herein, in particular refers to a variant molecule or sequence that comprises an amino acid sequence that is altered by one or more amino acids compared to the amino acid sequence of the parent molecule or sequence and that is still capable of fulfilling one or more of the functions of the parent molecule or sequence, e.g, inducing an immune response. In some embodiments, the modifications in the amino acid sequence of the parent molecule or sequence do not significantly affect or alter the characteristics of the molecule or sequence. In different embodiments, the function of the functional fragment or functional variant may be reduced but still significantly present, e.g., function of the functional fragment or functional variant may be at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% of the parent molecule or sequence. However, in other embodiments, function of the functional fragment or functional variant may be enhanced compared to the parent molecule or sequence.
An amino acid sequence (peptide or polypeptide) "derived from" a designated amino acid sequence (peptide or polypeptide) refers to the origin of the first amino acid sequence. In some embodiments, the amino acid sequence which is derived from a particular amino acid sequence has an amino acid sequence that is identical, essentially identical or homologous to that particular sequence or a fragment thereof. Amino acid sequences derived from a particular amino acid sequence may be variants of that particular sequence or a fragment thereof. For example, it will be understood by one of ordinary skill in the art that the antigens suitable for use herein may be altered such that they vary in sequence from the naturally occurring or native sequences from which they were derived, while retaining the desirable activity of the native sequences.
In some embodiments, "isolated" means removed (e.g., purified) from the natural state or from an artificial composition, such as a composition from a production process. For example, a nucleic acid, peptide or polypeptide naturally present in a living animal is not "isolated", but the same nucleic acid, peptide or polypeptide partially or completely separated from the coexisting materials of its natural state is "isolated". An isolated nucleic acid, peptide or polypeptide can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
The term "transfection" relates to the introduction of nucleic acids, in particular RNA, into a cell. For purposes of the present disclosure, the term "transfection" also includes the introduction of a nucleic acid into a cell or the uptake of a nucleic acid by such cell, wherein the cell may be present in a subject, e.g., a patient, or the cell may be in vitro, e.g., outside of a patient. Thus, according to the present disclosure, a cell for transfection of a nucleic acid described herein can be present in vitro or in vivo, e.g. the cell can form part of an organ, a tissue and/or the body of a patient. According to the disclosure, transfection can be transient or stable. For some applications of transfection, it is sufficient if the transfected genetic material is only transiently expressed. RNA can be transfected into cells to transiently express its coded protein. Since the nucleic acid introduced in the transfection process is usually not integrated into the nuclear genome, the foreign nucleic acid will be diluted through mitosis or degraded. Cells allowing episomal amplification of nucleic acids greatly reduce the rate of dilution. If it is desired that the transfected nucleic acid actually remains in the genome of the cell and its daughter cells, a stable transfection must occur. Such stable transfection can be achieved by using virus-based systems or transposon-based systems for transfection, for example. Generally, nucleic acid encoding antigen is transiently transfected into cells. RNA can be transfected into cells to transiently express its coded protein.
The disclosure includes analogs of a peptide or polypeptide. According to the present disclosure, an analog of a peptide or polypeptide is a modified form of said peptide or polypeptide from which it has been derived and has at least one functional property of said peptide or polypeptide. Eg., a pharmacological active analog of a peptide or polypeptide has at least one of the pharmacological activities of the peptide or polypeptide from which the analog has been derived. Such modifications include any chemical modification and comprise single or multiple substitutions, deletions and/or additions of any molecules associated with the peptide or polypeptide, such as carbohydrates, lipids and/or peptides or polypeptides. In some embodiments, "analogs" of peptides or polypeptides include those modified forms resulting from glycosylation, acetylation, phosphorylation, amidation, palmitoylation, myristoylation, isoprenylation, lipidation, alkylation, derivatization, introduction of protective/blocking groups, proteolytic cleavage or binding to an antibody or to another cellular ligand. The term "analog" also extends to all functional chemical equivalents of said peptides and polypeptides.
As used herein, the terms "linked", "fused", or "fusion" are used interchangeably. These terms refer to the joining together of two or more elements or components or domains.
As used herein "endogenous" refers to any material from or produced inside an organism, cell, tissue or system.
As used herein, the term "exogenous" refers to any material introduced from or produced outside an organism, cell, tissue or system.
According to various embodiments of the present disclosure, a nucleic acid such as RNA encoding a peptide or polypeptide is taken up by or introduced, i.e. transfected or transduced, into a cell which cell may be present in vitro or in a subject, resulting in expression of said peptide or polypeptide. The cell may, e.g., express the encoded peptide or polypeptide intracellularly e.g. in the cytoplasm and/or in the nucleus), may secrete the encoded peptide or polypeptide, and/or may express it on the surface. In some embodiments, the cell secretes the encoded peptide or polypeptide.
According to the present disclosure, terms such as "nucleic acid expressing" and "nucleic acid encoding" or similar terms are used interchangeably herein and with respect to a particular peptide or polypeptide mean that the nucleic acid, if present in the appropriate environment, e.g. within a cell, can be expressed to produce said peptide or polypeptide.
In particular, the term "encoding" refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an RNA (in particular, mRNA), to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom. Thus, a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system. Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
In this respect, an "open reading frame" or "ORF" is a continuous stretch of codons beginning with a start codon and ending with a stop codon.
The term "expression" as used herein includes the transcription and/or translation of a particular nucleotide sequence. In the context of the present disclosure, the term "transcription" relates to a process, wherein the genetic code in a DNA sequence is transcribed into RNA (especially mRNA). Subsequently, the RNA may be translated into peptide or polypeptide.
With respect to RNA, the term "expression" or "translation" relates to the process in the ribosomes of a cell by which a strand of mRNA directs the assembly of a sequence of amino acids to make a peptide or polypeptide.
A medical preparation, in particular kit, described herein may comprise instructional material or instructions. As used herein, "instructional material" or "instructions" includes a publication, a recording, a diagram, or any other medium of expression which can be used to communicate the usefulness of the compositions and methods of the present disclosure. The instructional material of the kit of the present disclosure may, for example, be affixed to a container which contains the compositions/formulations of the present disclosure or be shipped together with a container which contains the compositions/formulations. Alternatively, the instructional material may be shipped separately from the container with the intention that the instructional material and the compositions be used cooperatively by the recipient.
The term "set", e.g., as used herein in the context of "set of full-length antigens and antigen fragments", means more than 1, e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, or 8 or more.
The term "at least one" as used herein in the context of "at least one RNA molecule" means 1 or more, e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, or 8 or more. In some embodiments, the term "at least one" refers to 1, 2, 3, 4, 5, 6, 7, or 8. In some embodiments, "at least one RNA molecule" refers to a set of RNA molecules, e.g., 2, 3, 4 or more RNA molecules, wherein each RNA molecule encodes an amino acid sequence comprising at least one full-length Mtb antigen or antigen fragment, immunogenic variants or fragments thereof, e.g., an amino acid sequence comprising two different Mtb antigens, immunogenic variants or fragments thereof. In some embodiments, such at least one RNA molecule or set of RNA molecules comprises the RNA molecules in a mixtures, which mixture may be obtainable by transcribing in a common reaction a mixture of DNA templates encoding said RNA molecules.
Prodrugs of a particular compound described herein are those compounds that upon administration to an individual undergo chemical conversion under physiological conditions to provide the particular compound. Additionally, prodrugs can be converted to the particular compound by chemical or biochemical methods in an ex vivo environment. For example, prodrugs can be slowly converted to the particular compound when, for example, placed in a transdermal patch reservoir with a suitable enzyme or chemical reagent. Exemplary prodrugs are esters (using an alcohol or a carboxy group contained in the particular compound) or amides (using an amino or a carboxy group contained in the particular compound) which are hydrolyzable in vivo. Specifically, any amino group which is contained in the particular compound and which bears at least one hydrogen atom can be converted into a prodrug form. Typical N-prodrug forms include carbamates, Mannich bases, enamines, and enaminones.
In the present specification, a structural formula of a compound may represent a certain isomer of said compound. It is to be understood, however, that the present disclosure includes all isomers such as geometrical isomers, optical isomers based on an asymmetrical carbon, stereoisomers, tautomers and the like which occur structurally and isomer mixtures and is not limited to the description of the formula. Furthermore, in the present specification, a structural formula of a compound may represent a specific salt and/or solvate of said compound. It is to be understood, however, that the present disclosure includes all salts (e.g., pharmaceutically acceptable salts) and solvates (e.g., hydrates) and is not limited to the description of the specific salt and/or solvate.
"Isomers" are compounds having the same molecular formula but differ in structure ("structural isomers") or in the geometrical (spatial) positioning of the functional groups and/or atoms ("stereoisomers"). "Enantiomers" are a pair of stereoisomers which are non-superimposable mirror-images of each other. A "racemic mixture" or "racemate" contains a pair of enantiomers in equal amounts and is denoted by the prefix (±). "Diastereomers" are stereoisomers which are non-superimposable and which are not mirror-images of each other. "Tautomers" are structural isomers of the same chemical substance that spontaneously and reversibly interconvert into each other, even when pure, due to the migration of individual atoms or groups of atoms; i.e., the tautomers are in a dynamic chemical equilibrium with each other. An example of tautomers are the isomers of the keto-enol-tautomerism. "Conformers" are stereoisomers that can be interconverted just by rotations about formally single bonds, and include - in particular - those leading to different 3-dimentional forms of (hetero)cyclic rings, such as chair, half-chair, boat, and twist-boat forms of cyclohexane.
The term "solvate" as used herein refers to an addition complex of a dissolved material in a solvent (such as an organic solvent (e.g., an aliphatic alcohol (such as methanol, ethanol, n-propanol, isopropanol), acetone, acetonitrile, ether, and the like), water or a mixture of two or more of these liquids), wherein the addition complex exists in the form of a crystal or mixed crystal. The amount of solvent contained in the addition complex may be stoichiometric or non- stoichiometric. A "hydrate" is a solvate wherein the solvent is water.
In isotopically labeled compounds one or more atoms are replaced by a corresponding atom having the same number of protons but differing in the number of neutrons. For example, a hydrogen atom may be replaced by a deuterium or tritium atom. Exemplary isotopes which can be used in the present disclosure include deuterium, tritium, nC, 13C, 14C, 15N, 18F, 32P, 32S, 35S, 35CI, and 125I.
The term "average diameter" refers to the mean hydrodynamic diameter of particles as measured by dynamic light scattering (DLS) with data analysis using the so-called cumulant algorithm, which provides as results the so-called with the dimension of a length, and the polydispersity index (PDI), which is dimensionless (Koppel, D., J. Chem. Phys. 57, 1972, pp 4814-4820, ISO 13321). Here "average diameter", "diameter" or "size" for particles is used synonymously with this value of the
In some embodiments, the "polydispersity index" is calculated based on dynamic light scattering measurements by the so-called cumulant analysis as mentioned in the definition of the "average diameter". Under certain prerequisites, it can be taken as a measure of the size distribution of an ensemble of nanoparticles.
The "radius of gyration" (abbreviated herein as Rg) of a particle about an axis of rotation is the radial distance of a point from the axis of rotation at which, if the whole mass of the particle is assumed to be concentrated, its moment of inertia about the given axis would be the same as with its actual distribution of mass. Mathematically, Rg is the root mean square distance of the particle's components from either its center of mass or a given axis. For example, for a macromolecule composed of n mass elements, of masses mi (J= 1, 2, 3, ..., ri), located at fixed distances s/ from the center of mass, Rg is the square-root of the mass average of s,2 over all mass elements and can be calculated as follows:
The radius of gyration can be determined or calculated experimentally, e.g., by using light scattering. In particular, for small scattering vectors q the structure function S is defined as follows: wherein N is the number of components (Guinier's law).
The "hydrodynamic radius" (which is sometimes called "Stokes radius" or "Stokes-Einstein radius") of a particle is the radius of a hypothetical hard sphere that diffuses at the same rate as said particle. The hydrodynamic radius is related to the mobility of the particle, taking into account not only size but also solvent effects. For example, a smaller charged particle with stronger hydration may have a greater hydrodynamic radius than a larger charged particle with weaker hydration. This is because the smaller particle drags a greater number of water molecules with it as it moves through the solution. Since the actual dimensions of the particle in a solvent are not directly measurable, the hydrodynamic radius may be defined by the Stokes-Einstein equation: wherein B is the Boltzmann constant; 7~is the temperature; g is the viscosity of the solvent; and D is the diffusion coefficient. The diffusion coefficient can be determined experimentally, e.g., by using dynamic light scattering (DLS). Thus, one procedure to determine the hydrodynamic radius of a particle or a population of particles (such as the hydrodynamic radius of particles contained in a sample or control composition as disclosed herein or the hydrodynamic radius of a particle peak obtained from subjecting such a sample or control composition to field-flow fractionation) is to measure the DLS signal of said particle or population of particles (such as DLS signal of particles contained in a sample or control composition as disclosed herein or the DLS signal of a particle peak obtained from subjecting such a sample or control composition to field-flow fractionation).
The expression "light scattering" as used herein refers to the physical process where light is forced to deviate from a straight trajectory by one or more paths due to localized non-uniformities in the medium through which the light passes.
The term "UV" means ultraviolet and designates a band of the electromagnetic spectrum with a wavelength from 10 nm to 400 nm, i.e., shorter than that of visible light but longer than X-rays.
The expression "multi-angle light scattering" or "MALS" as used herein relates to a technique for measuring the light scattered by a sample into a plurality of angles. "Multi-angle" means in this respect that scattered light can be detected at different discrete angles as measured, for example, by a single detector moved over a range including the specific angles selected or an array of detectors fixed at specific angular locations. In certain embodiments, the light source used in MALS is a laser source (MALLS: multi-angle laser light scattering). Based on the MALS signal of a composition comprising particles and by using an appropriate formalism e.g, Zimm plot, Berry plot, or Debye plot), it is possible to determine the radius of gyration (Rg) and, thus, the size of said particles. Preferably, the Zimm plot is a graphical presentation using the following equation: wherein cis the mass concentration of the particles in the solvent (g/mL); A2 is the second virial coefficient (mol-mL/g2); P(0) is a form factor relating to the dependence of scattered light intensity on angle; Re is the excess Rayleigh ratio (cm 1); and A* is an optical constant that is equal to 4n2q0 (d/7/dc)2Xo-4 /VA-1 , where q0 is the refractive index of the solvent at the incident radiation (vacuum) wavelength, Xo is the incident radiation (vacuum) wavelength (nm), Ne is Avogadro's number (mol 1), and d/7/dc is the differential refractive index increment (mL/g) (cf., e.g., Buchholz et al. (Electrophoresis 22 (2001), 4118-4128); B.H. Zimm (J. Chem. Phys. 13 (1945), 141; P. Debye (J. Appl. Phys. 15 (1944): 338; and W. Burchard (Anal. Chem. 75 (2003), 4279-4291). Preferably, the Berry plot is calculated using the following term or the reciprocal thereof: wherein c, Re and K* are as defined above. Preferably, the Debye plot is calculated using the following term or the reciprocal thereof: wherein c, /fa and A"*are as defined above.
The expression "dynamic light scattering" or "DLS" as used herein refers to a technique to determine the size and size distribution profile of particles, in particular with respect to the hydrodynamic radius of the particles. A monochromatic light source, usually a laser, is shot through a polarizer and into a sample. The scattered light then goes through a second polarizer where it is detected and the resulting image is projected onto a screen. The particles in the solution are being hit with the light and diffract the light in all directions. The diffracted light from the particles can either interfere constructively (light regions) or destructively (dark regions). This process is repeated at short time intervals and the resulting set of speckle patterns are analyzed by an autocorrelator that compares the intensity of light at each spot over time.
The expression "static light scattering" or "SLS" as used herein refers to a technique to determine the size and size distribution profile of particles, in particular with respect to the radius of gyration of the particles, and/or the molar mass of particles. A high-intensity monochromatic light, usually a laser, is launched in a solution containing the particles. One or many detectors are used to measure the scattering intensity at one or many angles. The angular dependence is needed to obtain accurate measurements of both molar mass and size for all macromolecules of radius. Hence simultaneous measurements at several angles relative to the direction of incident light, known as multi-angle light scattering (MALS) or multi-angle laser light scattering (MALLS), is generally regarded as the standard implementation of static light scattering.
Nucleic Acids
The term "nucleic acid" comprises deoxyribonucleic acid (DNA), ribonucleic acid (RNA), combinations thereof, and modified forms thereof. The term comprises genomic DNA, cDNA, mRNA, recombinantly produced and chemically synthesized molecules. In some embodiments, a nucleic acid is DNA. In some embodiments, a nucleic acid is RNA. In some embodiments, a nucleic acid is a mixture of DNA and RNA. A nucleic acid may be present as a single-stranded or double-stranded and linear or covalently circularly closed molecule. A nucleic acid can be isolated. The term "isolated nucleic acid" means, according to the present disclosure, that the nucleic acid (i) was amplified in vitro, for example via polymerase chain reaction (PCR) for DNA or in vitro transcription (using, e.g., an RNA polymerase) for RNA, (ii) was produced recombinantly by cloning, (iii) was purified, for example, by cleavage and separation by gel electrophoresis, or (iv) was synthesized, for example, by chemical synthesis.
The term "nucleoside" (abbreviated herein as "N") relates to compounds which can be thought of as nucleotides without a phosphate group. While a nucleoside is a nucleobase linked to a sugar e.g, ribose or deoxyribose), a nucleotide is composed of a nucleoside and one or more phosphate groups. Examples of nucleosides include cytidine, uridine, pseudouridine, adenosine, and guanosine. The five standard nucleosides which usually make up naturally occurring nucleic acids are uridine, adenosine, thymidine, cytidine and guanosine. The five nucleosides are commonly abbreviated to their one letter codes U, A, T, C and G, respectively. However, thymidine is more commonly written as "dT" ("d" represents "deoxy") as it contains a 2'-deoxyribofuranose moiety rather than the ribofuranose ring found in uridine. This is because thymidine is found in deoxyribonucleic acid (DNA) and not ribonucleic acid (RNA). Conversely, uridine is found in RNA and not DNA. The remaining three nucleosides may be found in both RNA and DNA. In RNA, they would be represented as A, C and G, whereas in DNA they would be represented as dA, dC and dG.
A modified purine (A or G) or pyrimidine (C, T, or U) base moiety is, in some embodiments, modified by one or more alkyl groups, e.g., one or more CH alkyl groups, e.g., one or more methyl groups. Particular examples of modified purine or pyrimidine base moieties include N7-alkyl-guanine, N5-alkyl-adenine, 5-alkyl-cytosine, 5-alkyl-uracil, and N(l)- alkyl-uracil, such as N7-CI-4 alkyl-guanine, N5-CI-4 alkyl-adenine, 5-C1-4 alkyl-cytosine, 5-C1-4 alkyl-uracil, and N(1)-CM alkyl-uracil, preferably N7-methyl-guanine, N5-methyl-adenine, 5-methyl-cytosine, 5-methyl-uracil, and N(l)-methyl- uracil.
DNA
Herein, the term "DNA" relates to a nucleic acid molecule which is entirely or at least substantially composed of deoxyribonucleotide residues. In preferred embodiments, the DNA contains all or a majority of deoxyribonucleotide residues. As used herein, "deoxyribonucleotide" refers to a nucleotide which lacks a hydroxyl group at the 2'-position of a p-D-ribofuranosyl group. DNA encompasses without limitation, double stranded DNA, single stranded DNA, isolated DNA such as partially purified DNA, essentially pure DNA, synthetic DNA, recombinantly produced DNA, as well as modified DNA that differs from naturally occurring DNA by the addition, deletion, substitution and/or alteration of one or more nucleotides. Such alterations may refer to addition of non-nucleotide material to internal DNA nucleotides or to the end(s) of DNA. It is also contemplated herein that nucleotides in DNA may be non-standard nucleotides, such as chemically synthesized nucleotides or ribonucleotides. For the present disclosure, these altered DNAs are considered analogs of naturally-occurring DNA. A molecule contains "a majority of deoxyribonucleotide residues" if the content of deoxyribonucleotide residues in the molecule is more than 50% (such as at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%), based on the total number of nucleotide residues in the molecule. The total number of nucleotide residues in a molecule is the sum of all nucleotide residues (irrespective of whether the nucleotide residues are standard (Ze., naturally occurring) nucleotide residues or analogs thereof).
DNA may be recombinant DNA and may be obtained by cloning of a nucleic acid, in particular cDNA. The cDNA may be obtained by reverse transcription of RNA.
RNA
The term "RNA" relates to a nucleic acid molecule which includes ribonucleotide residues. In preferred embodiments, the RNA contains all or a majority of ribonucleotide residues. As used herein, "ribonucleotide" refers to a nucleotide with a hydroxyl group at the 2'-position of a p-D-ribofuranosyl group. RNA encompasses without limitation, double stranded RNA, single stranded RNA, isolated RNA such as partially purified RNA, essentially pure RNA, synthetic RNA, recombinantly produced RNA, as well as modified RNA that differs from naturally occurring RNA by the addition, deletion, substitution and/or alteration of one or more nucleotides. Such alterations may refer to addition of non- nucleotide material to internal RNA nucleotides or to the end(s) of RNA. It is also contemplated herein that nucleotides in RNA may be non-standard nucleotides, such as chemically synthesized nucleotides or deoxynucleotides. For the present disclosure, these altered/modified nucleotides can be referred to as analogs of naturally occurring nucleotides, and the corresponding RNAs containing such altered/modified nucleotides (Ze., altered/modified RNAs) can be referred to as analogs of naturally occurring RNAs. A molecule contains "a majority of ribonucleotide residues" if the content of ribonucleotide residues in the molecule is more than 50% (such as at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%), based on the total number of nucleotide residues in the molecule. The total number of nucleotide residues in a molecule is the sum of all nucleotide residues (irrespective of whether the nucleotide residues are standard (Ze., naturally occurring) nucleotide residues or analogs thereof).
"RNA" includes mRNA, tRNA, ribosomal RNA (rRNA), small nuclear RNA (snRNA), self-amplifying RNA (saRNA), transamplifying RNA (taRNA), single-stranded RNA (ssRNA), dsRNA, inhibitory RNA (such as antisense ssRNA, small interfering RNA (siRNA), or microRNA (miRNA)), activating RNA (such as small activating RNA) and immunostimulatory RNA (isRNA). In some embodiments, "RNA" refers to mRNA.
The term "in vitro transcription" or "IVT" as used herein means that the transcription (Zev the generation of RNA) is conducted in a cell-free manner. Ze., IVT does not use living/cultured cells but rather the transcription machinery extracted from cells e.g, cell lysates or the isolated components thereof, including an RNA polymerase (preferably T7, T3 or SP6 polymerase)).
According to the present disclosure, the term '"RNA" includes "mRNA". According to the present disclosure, the term "mRNA" means "messenger-RNA" and includes a "transcript" which may be generated by using a DNA template. Generally, mRNA encodes a peptide or polypeptide. mRNA is single-stranded but may contain self-complementary sequences that allow parts of the mRNA to fold and pair with itself to form double helices.
According to the present disclosure, "dsRNA" means double-stranded RNA and is RNA with two partially or completely complementary strands.
In preferred embodiments of the present disclosure, the mRNA relates to an RNA transcript which encodes a peptide or polypeptide.
In some embodiments, the mRNA which preferably encodes a peptide or polypeptide has a length of at least 45 nucleotides (such as at least 60, at least 90, at least 100, at least 200, at least 300, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1,000, at least 1,500, at least 2,000, at least 2,500, at least 3,000, at least 3,500, at least 4,000, at least 4,500, at least 5,000, at least 6,000, at least 7,000, at least 8,000, at least 9,000 nucleotides), preferably up to 15,000, such as up to 14,000, up to 13,000, up to 12,000 nucleotides, up to 11,000 nucleotides or up to 10,000 nucleotides.
As established in the art, mRNA generally contains a 5' untranslated region (5'-UTR), a peptide/polypeptide coding region and a 3' untranslated region (3'-UTR). In some embodiments, the mRNA is produced by in vitro transcription or chemical synthesis. In some embodiments, the mRNA is produced by in vitro transcription using a DNA template. The in vitro transcription methodology is known to the skilled person; cf., e.g., Molecular Cloning: A Laboratory Manual, 4th Edition, M.R. Green and J. Sambrook eds., Cold Spring Harbor Laboratory Press, Cold Spring Harbor 2012. Furthermore, a variety of in vitro transcription kits is commercially available, e.g., from Thermo Fisher Scientific (such as TranscriptAid™ T7 kit, MEGAscript® T7 kit, MAXIscript®), New England BioLabs Inc. (such as HiScribe™ T7 kit, HiScribe™ T7 ARCA mRNA kit), Promega (such as RiboMAX™, HeLaScribe®, Riboprobe® systems), Jena Bioscience (such as SP6 or T7 transcription kits), and Epicentre (such as AmpliScribe™). For providing modified mRNA, correspondingly modified nucleotides, such as modified naturally occurring nucleotides, non-naturally occurring nucleotides and/or modified non-naturally occurring nucleotides, can be incorporated during synthesis (preferably in vitro transcription), or modifications can be effected in and/or added to the mRNA after transcription.
In some embodiments, RNA is in vitro transcribed RNA (IVT-RNA) and may be obtained by in vitro transcription of an appropriate DNA template. The promoter for controlling transcription can be any promoter for any RNA polymerase. Particular examples of RNA polymerases are the T7, T3, and SP6 RNA polymerases. Preferably, the in vitro transcription is controlled by a T7 or SP6 promoter. A DNA template for in vitro transcription may be obtained by cloning of a nucleic acid, in particular cDNA, and introducing it into an appropriate vector for in vitro transcription. The cDNA may be obtained by reverse transcription of RNA.
In some embodiments of the present disclosure, the RNA is "replicon RNA" or simply a "replicon", in particular "selfreplicating RNA" or "self-amplifying RNA". In certain embodiments, the replicon or self-replicating RNA is derived from or comprises elements derived from an ssRNA virus, in particular a positive-stranded ssRNA virus such as an alphavirus. Alphaviruses are typical representatives of positive-stranded RNA viruses. Alphaviruses replicate in the cytoplasm of infected cells (for review of the alphaviral life cycle see Jose et at, Future Microbiol., 2009, vol. 4, pp. 837-856). The total genome length of many alphaviruses typically ranges between 11,000 and 12,000 nucleotides, and the genomic RNA typically has a 5'-cap, and a 3' poly(A) tail. The genome of alphaviruses encodes non-structural proteins (involved in transcription, modification and replication of viral RNA and in protein modification) and structural proteins (forming the virus particle). There are typically two open reading frames (ORFs) in the genome. The four non-structural proteins (nsPl-nsP4) are typically encoded together by a first ORF beginning near the 5' terminus of the genome, while alphavirus structural proteins are encoded together by a second ORF which is found downstream of the first ORF and extends near the 3' terminus of the genome. Typically, the first ORF is larger than the second ORF, the ratio being roughly 2: 1. In cells infected by an alphavirus, only the nucleic acid sequence encoding non-structural proteins is translated from the genomic RNA, while the genetic information encoding structural proteins is translatable from a subgenomic transcript, which is an RNA molecule that resembles eukaryotic messenger RNA (mRNA; Gould et al, 2010, Antiviral Res., vol. 87 pp. 111-124). Following infection, i.e. at early stages of the viral life cycle, the (+) stranded genomic RNA directly acts like a messenger RNA for the translation of the open reading frame encoding the non- structural poly-protein (nsP1234).
Alphavirus-derived vectors have been proposed for delivery of foreign genetic information into target cells or target organisms. In simple approaches, the open reading frame encoding alphaviral structural proteins is replaced by an open reading frame encoding a protein of interest. Alphavirus-based trans-replication (trans-amplification) systems rely on alphavirus nucleotide sequence elements on two separate nucleic acid molecules: one nucleic acid molecule encodes a viral replicase, and the other nucleic acid molecule is capable of being replicated by said replicase in trans (hence the designation trans-replication system). Trans-replication requires the presence of both these nucleic acid molecules in a given host cell. The nucleic acid molecule capable of being replicated by the replicase in trans must comprise certain alphaviral sequence elements to allow recognition and RNA synthesis by the alphaviral replicase.
In some embodiments of the present disclosure, the RNA (in particular, mRNA) described herein (e.g., contained in the compositions/formulations of the present disclosure and/or used in the methods of the present disclosure) contains one or more modifications, e.g., in order to increase its stability and/or increase translation efficiency and/or decrease immunogenicity and/or decrease cytotoxicity. For example, in order to increase expression of the RNA (in particular, mRNA), it may be modified within the coding region, i.e., the sequence encoding the expressed peptide or polypeptide, preferably without altering the sequence of the expressed peptide or polypeptide. Such modifications are described, for example, in WO 2007/036366 and PCT/EP2019/056502, and include the following: a 5'-cap structure; an extension or truncation of the naturally occurring poly(A) tail; an alteration of the 5'- and/or 3'-untranslated regions (UTR) such as introduction of a UTR which is not related to the coding region of said RNA; the replacement of one or more naturally occurring nucleotides with synthetic nucleotides; and codon optimization (e.g, to alter, preferably increase, the GC content of the RNA). A combination of the above described modifications, i.e., incorporation of a 5'-cap structure, incorporation of a poly-A sequence, unmasking of a poly-A sequence, alteration of the 5'- and/or 3'-UTR (such as incorporation of one or more 3'-UTRs), replacing one or more naturally occurring nucleotides with synthetic nucleotides (e.g, 5-methylcytidine for cytidine and/or pseudouridine (QJ) or N(l)-methylpseudouridine (mlQJ) or 5-methyluridine (m5U) for uridine), and codon optimization, has a synergistic influence on the stability of RNA (preferably mRNA) and increase in translation efficiency. Thus, in some embodiments, the RNA (in particular, mRNA) described in the present disclosure contains a combination of at least two, at least three, at least four or all five of the above-mentioned modifications, i.e., (i) incorporation of a 5'-cap structure, (ii) incorporation of a poly-A sequence, unmasking of a poly- A sequence; (iii) alteration of the 5'- and/or 3'-UTR (such as incorporation of one or more 3'-UTRs); (iv) replacing one or more naturally occurring nucleotides with synthetic nucleotides (e.g, 5-methylcytidine for cytidine and/or pseudouridine (QJ) or N(l)-methylpseudouridine (mlQJ) or 5-methyluridine (m5U) for uridine), and (v) codon optimization.
5'-Cao
In some embodiments, the RNA (in particular, mRNA) described herein comprises a 5'-cap structure. In some embodiments, the RNA does not have uncapped 5'-triphosphates. In some embodiments, the RNA (in particular, mRNA) may comprise a conventional 5'-cap and/or a 5'-cap analog. The term "conventional 5'-cap" refers to a cap structure found on the 5'-end of an RNA molecule and generally comprises a guanosine 5'-triphosphate (Gppp) which is connected via its triphosphate moiety to the 5'-end of the next nucleotide of the RNA (Ze., the guanosine is connected via a 5' to 5' triphosphate linkage to the rest of the RNA). The guanosine may be methylated at position N7 (resulting in the cap structure m7Gppp). The term "5'-cap analog" includes a 5'-cap which is based on a conventional 5'-cap but which has been modified at either the 2'- or 3'-position of the m7guanosine structure in order to avoid an integration of the 5'-cap analog in the reverse orientation (such 5'-cap analogs are also called anti-reverse cap analogs (ARCAs)). Particularly preferred 5'-cap analogs are those having one or more substitutions at the bridging and non-bridging oxygen in the phosphate bridge, such as phosphorothioate modified 5'-cap analogs at the p-phosphate (such as m27'2 OG(5')ppSp(5')G (referred to as beta-S-ARCA or -S-ARCA)), as described in PCT/EP2019/056502. Providing an RNA (in particular, mRNA) with a 5'-cap structure as described herein may be achieved by in vitro transcription of a DNA template in presence of a corresponding 5'-cap compound, wherein said 5'-cap structure is co-transcriptionally incorporated into the generated RNA (in particular, mRNA) strand, or the RNA (in particular, mRNA) may be generated, for example, by in vitro transcription, and the 5'-cap structure may be attached to the RNA post-transcriptionally using capping enzymes, for example, capping enzymes of vaccinia virus.
In some embodiments, the RNA (in particular, mRNA) comprises a 5'-cap structure selected from the group consisting of m2 7'2 OG(5')ppSp(5')G (in particular its DI diastereomer), m27'3 OG(5')ppp(5')G, and m27'3 OGppp(mi2' °)ApG. In some embodiments, RNA comprises m27'2 OG(5')ppSp(5')G (in particular its DI diastereomer) as 5'-cap structure. In some embodiments, RNA comprises m27'3' 0Gppp(mi2' 0)ApG as 5'-cap structure.
In some embodiments, the RNA (in particular, mRNA) comprises a capO, capl, or cap2, preferably capl or cap2. According to the present disclosure, the term "capO" means the structure "m7GpppN", wherein N is any nucleoside bearing an OH moiety at position 2'. According to the present disclosure, the term "capl" means the structure "m7GpppNm", wherein Nm is any nucleoside bearing an OCH3 moiety at position 2'. According to the present disclosure, the term "cap2" means the structure "m7GpppNmNm", wherein each Nm is independently any nucleoside bearing an OCH3 moiety at position 2'.
The 5'-cap analog beta-S-ARCA (P-S-ARCA) has the following structure:
The "DI diastereomer of beta-S-ARCA" or "beta-S-ARCA(Dl)" is the diastereomer of beta-S-ARCA which elutes first on an HPLC column compared to the D2 diastereomer of beta-S-ARCA (beta-S-ARCA(D2)) and thus exhibits a shorter retention time. The HPLC preferably is an analytical HPLC. In some embodiments, a Supelcosil LC-18-T RP column, preferably of the format: 5 pm, 4.6 x 250 mm is used for separation, whereby a flow rate of 1.3 ml/min can be applied. In some embodiments, a gradient of methanol in ammonium acetate, for example, a 0-25% linear gradient of methanol in 0.05 M ammonium acetate, pH = 5.9, within 15 min is used. UV-detection (VWD) can be performed at 260 nm and fluorescence detection (FLD) can be performed with excitation at 280 nm and detection at 337 nm. The 5'-cap analog m2 7'3' 0Gppp(mi2, 0)ApG (also referred to as m2 7'30G(5')ppp(5')m2' 0ApG) which is a building block of a capl has the following structure:
An exemplary capO mRNA comprising p-S-ARCA and mRNA has the following structure:
An exemplary capO mRNA comprising m2 7'3 OG(5')ppp(5')G and mRNA has the following structure: An exemplary capl mRNA comprising m27'3 OGppp(mi2' °)ApG and mRNA has the following structure:
In some embodiments, the RNA is unmodified RNA and comprises a 5'-cap, which is capl. In further embodiments, the RNA comprises modified nucleotides, nucleosides or nucleobases and a 5'-cap, which is capl. For instance, such modified RNA comprises one or more modified uridines in place of unmodified uridines. In certain embodiments, the modified RNA comprising the capl structure comprises modified uridines in place of all uridines, the modified uridines preferably being Nl-methyl-pseudouridine. Polv-A tail
As used herein, the term "poly-A tail" or "poly-A sequence" refers to an uninterrupted or interrupted sequence of adenylate residues which is typically located at the 3'-end of an RNA (in particular, mRNA) molecule. Poly-A tails or poly-A sequences are known to those of skill in the art and may follow the 3'-UTR in the RNAs (in particular, mRNAs) described herein. An uninterrupted poly-A tail is characterized by consecutive adenylate residues. In nature, an uninterrupted poly-A tail is typical. RNAs (in particular, mRNAs) disclosed herein can have a poly-A tail attached to the free 3'-end of the RNA by a template-independent RNA polymerase after transcription or a poly-A tail encoded by DNA and transcribed by a template-dependent RNA polymerase.
It has been demonstrated that a poly-A tail of about 120 A nucleotides has a beneficial influence on the levels of RNA in transfected eukaryotic cells, as well as on the levels of protein that is translated from an open reading frame that is present upstream (S' of the poly-A tail (Holtkamp eta/., 2006, Blood, vol. 108, pp. 4009-4017).
The poly-A tail may be of any length. In some embodiments, a poly-A tail comprises, essentially consists of, or consists of at least 20, at least 30, at least 40, at least 80, or at least 100 and up to 500, up to 400, up to 300, up to 200, or up to 150 A nucleotides, and, in particular, about 120 A nucleotides. In this context, "essentially consists of" means that most nucleotides in the poly-A tail, typically at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% by number of nucleotides in the poly-A tail are A nucleotides, but permits that remaining nucleotides are nucleotides other than A nucleotides, such as U nucleotides (uridylate), G nucleotides (guanylate), or C nucleotides (cytidylate). In this context, "consists of" means that all nucleotides in the poly-A tail, i.e., 100% by number of nucleotides in the poly-A tail, are A nucleotides. The term "A nucleotide" or "A" refers to adenylate.
In some embodiments, a poly-A tail is attached during RNA transcription, e.g, during preparation of in vitro transcribed RNA, based on a DNA template comprising repeated dT nucleotides (deoxythymidylate) in the strand complementary to the coding strand. The DNA sequence encoding a poly-A tail (coding strand) is referred to as poly(A) cassette.
In some embodiments, the poly(A) cassette present in the coding strand of DNA essentially consists of dA nucleotides, but is interrupted by a random sequence of the four nucleotides (dA, dC, dG, and dT). Such random sequence may be 5 to 50, 10 to 30, or 10 to 20 nucleotides in length. Such a cassette is disclosed in WO 2016/005324 Al, hereby incorporated by reference. Any poly(A) cassette disclosed in WO 2016/005324 Al may be used in the present disclosure. A poly(A) cassette that essentially consists of dA nucleotides, but is interrupted by a random sequence having an equal distribution of the four nucleotides (dA, dC, dG, dT) and having a length of e.g., 5 to 50 nucleotides shows, on DNA level, constant propagation of plasmid DNA in £ co// and is still associated, on RNA level, with the beneficial properties with respect to supporting RNA stability and translational efficiency is encompassed. Consequently, in some embodiments, the poly-A tail contained in an RNA (in particular, mRNA) molecule described herein essentially consists of A nucleotides, but is interrupted by a random sequence of the four nucleotides (A, C, G, U). Such random sequence may be 5 to 50, 10 to 30, or 10 to 20 nucleotides in length.
In some embodiments, the poly(A) tail comprises 30 adenine nucleotides followed by 70 adenine nucleotides, wherein the 30 adenine nucleotides and 70 adenine nucleotides are separated by a linker sequence of 10 nucleotides.
In some embodiments, no nucleotides other than A nucleotides flank a poly-A tail at its 3'-end, i.e., the poly-A tail is not masked or followed at its 3'-end by a nucleotide other than A.
In some embodiments, a poly-A tail may comprise at least 20, at least 30, at least 40, at least 80, or at least 100 and up to 500, up to 400, up to 300, up to 200, or up to 150 nucleotides. In some embodiments, the poly-A tail may essentially consist of at least 20, at least 30, at least 40, at least 80, or at least 100 and up to 500, up to 400, up to 300, up to 200, or up to 150 nucleotides. In some embodiments, the poly-A tail may consist of at least 20, at least 30, at least 40, at least 80, or at least 100 and up to 500, up to 400, up to 300, up to 200, or up to 150 nucleotides. In some embodiments, the poly-A tail comprises the poly-A tail shown in SEQ ID NO: 55. In some embodiments, the poly- A tail comprises at least 100 nucleotides. In some embodiments, the poly-A tail comprises about 150 nucleotides. In some embodiments, the poly-A tail comprises about 120 nucleotides.
Untranslated regions (UTR)
In some embodiments, RNA (in particular, mRNA) described in present disclosure comprises a 5'-UTR and/or a 3'-UTR. The term "untranslated region" or "UTR" relates to a region in a DNA molecule which is transcribed but is not translated into an amino acid sequence, or to the corresponding region in an RNA molecule, such as an mRNA molecule. An untranslated region (UTR) can be present 5' (upstream) of an open reading frame (5'-UTR) and/or 3' (downstream) of an open reading frame (3'-UTR). A 5'-UTR, if present, is located at the 5'-end, upstream of the start codon of a proteinencoding region. A 5'-UTR is downstream of the 5'-cap (if present), e.g., directly adjacent to the 5'-cap. A 3'-UTR, if present, is located at the 3'-end, downstream of the termination codon of a protein-encoding region, but the term "3'- UTR" does generally not include the poly-A sequence. Thus, the 3'-UTR is upstream of the poly-A sequence (if present), e.g, directly adjacent to the poly-A sequence. Incorporation of a 3'-UTR into the 3'-non translated region of an RNA (preferably mRNA) molecule can result in an enhancement in translation efficiency. A synergistic effect may be achieved by incorporating two or more of such 3'-UTRs (which are preferably arranged in a head-to-tail orientation; cf., e.g, Holtkamp et al., Blood 108, 4009-4017 (2006)). The 3'-UTRs may be autologous or heterologous to the RNA (e.g., mRNA) into which they are introduced. In certain embodiments, the 3'-UTR is derived from a globin gene or mRNA, such as a gene or mRNA of alpha2-globin, alphal-globin, or beta-globin, e.g., beta-globin, e.g., human beta-globin. For example, the RNA (e.g., mRNA) may be modified by the replacement of the existing 3'-UTR with or the insertion of one or more, e.g., two copies of a 3'-UTR derived from a globin gene, such as alpha2-globin, alphal-globin, betaglobin, e.g., beta-globin, e.g., human beta-globin.
In some embodiments, a 5'-UTR is or comprises a modified human alpha-globin 5'-UTR. A particularly preferred 5'-UTR comprises the nucleotide sequence of SEQ ID NO: 53. In some embodiments, a 3'-UTR comprises a first sequence from the amino terminal enhancer of split (AES) messenger RNA and a second sequence from the mitochondrial encoded 12S ribosomal RNA. A particularly preferred 3'-UTR comprises the nucleotide sequence of SEQ ID NO: 54.
In some embodiments, RNA comprises a 5'-UTR comprising the nucleotide sequence of SEQ ID NO: 53, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 53.
In some embodiments, RNA comprises a 3'-UTR comprising the nucleotide sequence of SEQ ID NO: 54, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 54.
Table 1: Exemplary untranslated RNA sequences
Chemical modification
The RNA (in particular, mRNA) described herein may have modified ribonucleotides in order to increase its stability and/or decrease immunogenicity and/or decrease cytotoxicity. For example, in some embodiments, uridine in the RNA (in particular, mRNA) described herein is replaced (partially or completely, preferably completely) by a modified nucleoside. In some embodiments, the modified nucleoside is a modified uridine.
In some embodiments, the modified uridine replacing uridine is selected from the group consisting of pseudouridine (ip), Nl-methyl-pseudouridine (mlip), 5-methyl-uridine (m5U), and combinations thereof.
In some embodiments, the modified nucleoside replacing (partially or completely, preferably completely) uridine in the RNA may be any one or more of 3-methyl-uridine (m3U), 5-methoxy-uridine (mo5U), 5-aza-uridine, 6-aza-uridine, 2- thio-5-aza-uridine, 2-thio-uridine (s2U), 4-thio-uridine (s4U), 4-thio-pseudouridine, 2-thio-pseudouridine, 5-hydroxy- uridine (ho5U), 5-aminoallyl-uridine, 5-halo-uridine (e.g, 5-iodo-uridineor 5-bromo-uridine), uridine 5-oxyacetic acid (cmo5U), uridine 5-oxyacetic acid methyl ester (mcmo5U), 5-carboxymethyl-uridine (cm5U), 1-carboxymethyl- pseudouridine, 5-carboxyhydroxymethyl-uridine (chm5U), 5-carboxyhydroxymethyl-uridine methyl ester (mchm5U), 5- methoxycarbonylmethyl-uridine (mcm5U), 5-methoxycarbonylmethyl-2-thio-uridine (mcm5s2U), 5-aminomethyl-2- thio-uridine (nm5s2U), 5-methylaminomethyl-uridine (mnm5U), 1-ethyl-pseudouridine, 5-methylaminomethyl-2-thio- uridine (mnm5s2U), 5-methylaminomethyl-2-seleno-uridine (mnm5se2U), 5-carbamoylmethyl-uridine (ncm5U), 5- carboxymethylaminomethyl-uridine (cmnm5U), 5-carboxymethylaminomethyl-2-thio-uridine (cmnm5s2U), 5-propynyl- uridine, 1-propynyl-pseudouridine, 5-taurinomethyl-uridine (Tm5U), 1-taurinomethyl-pseudouridine, 5-taurinomethyl- 2-thio-uridine(Tm5s2U), l-taurinomethyl-4-thio-pseudouridine), 5-methyl-2-thio-uridine (m5s2U), l-methyl-4-thio- pseudouridine (mls4ip), 4-thio-l-methyl-pseudouridine, 3-methyl-pseudouridine (m3ip), 2-thio-l-methyl- pseudouridine, 1-methyl-l-deaza-pseudouridine, 2-thio-l-methyl-l-deaza-pseudouridine, dihydrouridine (D), dihydropseudouridine, 5,6-dihydrouridine, 5-methyl-dihydrouridine (m5D), 2-thio-dihydrouridine, 2-thio- dihydropseudouridine, 2-methoxy-uridine, 2-methoxy-4-thio-uridine, 4-methoxy-pseudouridine, 4-methoxy-2-thio- pseudouridine, Nl-methyl-pseudouridine, 3-(3-amino-3-carboxypropyl)uridine (acp3U), l-methyl-3-(3-amino-3- carboxypropyl)pseudouridine (acp3 ip), 5-(isopentenylaminomethyl)uridine (inm5U), 5-(isopentenylaminomethyl)-2- thio-uridine (inm5s2U), a-thio-uridine, 2'-O-methyl-uridine (Um), 5,2'-O-dimethyl-uridine (m5Um), 2'-O-methyl- pseudouridine (ipm), 2-thio-2'-O-methyl-uridine (s2Um), 5-methoxycarbonylmethyl-2'-O-methyl-uridine (mcm5Um), 5- carbamoylmethyl-2'-O-methyl-uridine (ncm5Um), 5-carboxymethylaminomethyl-2'-O-methyl-uridine (cmnm5Um), 3,2'-O-dimethyl-uridine (m3Um), 5-(isopentenylaminomethyl)-2'-O-methyl-uridine (inm5Um), 1-thio-uridine, deoxythymidine, 2'-F-ara-uridine, 2'-F-uridine, 2'-OH-ara-uridine, 5-(2-carbomethoxyvinyl) uridine, 5-[3-(l-E- propenylamino)uridine, or any other modified uridine known in the art.
An RNA (preferably mRNA) which is modified by pseudouridine (replacing partially or completely, preferably completely, uridine) is referred to herein as "QJ-modified", whereas the term "m li -modified" means that the RNA (preferably mRNA) contains N(l)-methylpseudouridine (replacing partially or completely, preferably completely, uridine). Furthermore, the term "m5U-modified" means that the RNA (preferably mRNA) contains 5-methyluridine (replacing partially or completely, preferably completely, uridine). Such i - or mlQJ- or m5U-modified RNAs usually exhibit decreased immunogenicity compared to their unmodified forms and, thus, are preferred in applications where the induction of an immune response is to be avoided or minimized. In some embodiments, the RNA (preferably mRNA) contains N(l)-methylpseudouridine replacing completely uridine.
Codon optimization and GC enrichment
The codons of the RNA (in particular, mRNA) described in the present disclosure may further be optimized, e.g., to increase the GC content of the RNA and/or to replace codons which are rare in the cell (or subject) in which the peptide or polypeptide of interest is to be expressed by codons which are synonymous frequent codons in said cell (or subject). In some embodiments, the amino acid sequence encoded by the RNA (in particular, mRNA) described in the present disclosure is encoded by a coding sequence which is codon-optimized and/or the G/C content of which is increased compared to wild type coding sequence. This also includes embodiments, wherein one or more sequence regions of the coding sequence are codon-optimized and/or increased in the G/C content compared to the corresponding sequence regions of the wild type coding sequence. In some embodiments, the codon-optimization and/or the increase in the G/C content preferably does not change the sequence of the encoded amino acid sequence.
The term "codon-optimized" refers to the alteration of codons in the coding region of a nucleic acid molecule to reflect the typical codon usage of a host organism without preferably altering the amino acid sequence encoded by the nucleic acid molecule. Within the context of the present disclosure, coding regions may be codon-optimized for optimal expression in a subject to be treated using the RNA (in particular, mRNA) described herein. Codon-optimization is based on the finding that the translation efficiency is also determined by a different frequency in the occurrence of tRNAs in cells. Thus, the sequence of RNA (in particular, mRNA) may be modified such that codons for which frequently occurring tRNAs are available are inserted in place of "rare codons".
In some embodiments, the guanosine/cytosine (G/C) content of the coding region of the RNA (in particular, mRNA) described herein is increased compared to the G/C content of the corresponding coding sequence of the wild type RNA, wherein the amino acid sequence encoded by the RNA is preferably not modified compared to the amino acid sequence encoded by the wild type RNA. This modification of the RNA sequence is based on the fact that the sequence of any RNA region to be translated is important for efficient translation of that RNA. Sequences having an increased G (guanosine)/C (cytosine) content are more stable than sequences having an increased A (adenosine)/U (uracil) content. In respect to the fact that several codons code for one and the same amino acid (so-called degeneration of the genetic code), the most favorable codons for the stability can be determined (so-called alternative codon usage). Depending on the amino acid to be encoded by the RNA, there are various possibilities for modification of the RNA sequence, compared to its wild type sequence. In particular, codons which contain A and/or U nucleotides can be modified by substituting these codons by other codons, which code for the same amino acids but contain no A and/or U or contain a lower content of A and/or U nucleotides.
In various embodiments, the G/C content of the coding region of the RNA (in particular, mRNA) described herein is increased by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 55%, or even more compared to the G/C content of the coding region of the wild type RNA. Non-immunoaenic RNA
The term "non-immunogenic RNA" (such as "non-immunogenic mRNA") as used herein refers to RNA that does not induce a response by the immune system upon administration, e.g, to a mammal, or induces a weaker response than would have been induced by the same RNA that differs only in that it has not been subjected to the modifications and treatments that render the non-immunogenic RNA non-immunogenic, i.e., than would have been induced by standard RNA (stdRNA). In certain embodiments, non-immunogenic RNA is rendered non-immunogenic by incorporating modified nucleosides suppressing RNA-mediated activation of innate immune receptors into the RNA and/or limiting the amount of double-stranded RNA (dsRNA), e.g., by limiting the formation of double-stranded RNA (dsRNA), e.g., during in vitro transcription, and/or by removing double-stranded RNA (dsRNA), e.g., following in vitro transcription. In certain embodiments, non-immunogenic RNA is rendered non-immunogenic by incorporating modified nucleosides suppressing RNA-mediated activation of innate immune receptors into the RNA and/or by removing double-stranded RNA (dsRNA), e.g., following in vitro transcription.
For rendering the non-immunogenic RNA (especially mRNA) non-immunogenic by the incorporation of modified nucleosides, any modified nucleoside may be used as long as it lowers or suppresses immunogenicity of the RNA. Particularly preferred are modified nucleosides that suppress RNA-mediated activation of innate immune receptors. In some embodiments, the modified nucleosides comprise a replacement of one or more uridines with a nucleoside comprising a modified nucleobase. In some embodiments, the modified nucleobase is a modified uracil. In some embodiments, the nucleoside comprising a modified nucleobase is selected from the group consisting of 3-methyl- uridine (m3U), 5-methoxy-uridine (mo5U), 5-aza-uridine, 6-aza-uridine, 2-thio-5-aza-uridine, 2-thio-uridine (s2U), 4- thio-uridine (s4U), 4-thio-pseudouridine, 2-thio-pseudouridine, 5-hydroxy-uridine (ho5U), 5-aminoallyl-uridine, 5-halo- uridine e.g, 5-iodo-uridine or 5-bromo-uridine), uridine 5-oxyacetic acid (cmo5U), uridine 5-oxyacetic acid methyl ester (mcmo5U), 5-carboxymethyl-uridine (cm5U), 1-carboxymethyl-pseudouridine, 5-carboxyhydroxymethyl-uridine (chm5U), 5-carboxyhydroxymethyl-uridine methyl ester (mchm5U), 5-methoxycarbonylmethyl-uridine (mcm5U), 5- methoxycarbonylmethyl-2-thio-uridine (mcm5s2U), 5-aminomethyl-2-thio-uridine (nm5s2U), 5-methylaminomethyl- uridine (mnm5U), 1-ethyl-pseudouridine, 5-methylaminomethyl-2-thio-uridine (mnm5s2U), 5-methylaminomethyl-2- seleno-uridine (mnm5se2U), 5-carbamoylmethyl-uridine (ncm5U), 5-carboxymethylaminomethyl-uridine (cmnm5U), 5- carboxymethylaminomethyl-2-thio-uridine (cmnm5s2U), 5-propynyl-uridine, 1-propynyl-pseudouridine, 5- taurinomethyl-uridine (Tm5U), 1-taurinomethyl-pseudouridine, 5-taurinomethyl-2-thio-uridine(Tm5s2U), 1- taurinomethyl-4-thio-pseudouridine), 5-methyl-2-thio-uridine (m5s2U), l-methyl-4-thio-pseudouridine (m^ip), 4-thio- 1-methyl-pseudouridine, 3-methyl-pseudouridine (m3ip), 2-thio-l-methyl-pseudouridine, 1-methyl-l-deaza- pseudouridine, 2-thio-l-methyl-l-deaza-pseudouridine, dihydrouridine (D), dihydropseudouridine, 5,6-dihydrouridine, 5-methyl-dihydrouridine (m5D), 2-thio-dihydrouridine, 2-thio-dihydropseudouridine, 2-methoxy-uridine, 2-methoxy-4- thio-uridine, 4-methoxy-pseudouridine, 4-methoxy-2-thio-pseudouridine, Nl-methyl-pseudouridine, 3-(3-amino-3- carboxypropyl)uridine (acp3U), l-methyl-3-(3-amino-3-carboxypropyl)pseudouridine (acp3 ip), 5- (isopentenylaminomethyl)uridine (inm5U), 5-(isopentenylaminomethyl)-2-thio-uridine (inm5s2U), a-thio-uridine, 2'-O- methyl-uridine (Um), 5,2'-O-dimethyl-uridine (m5Um), 2'-O-methyl-pseudouridine (ipm), 2-thio-2'-O-methyl-uridine (s2Um), 5-methoxycarbonylmethyl-2'-O-methyl-uridine (mcm5Um), 5-carbamoylmethyl-2'-O-methyl-uridine (ncm5Um), 5-carboxymethylaminomethyl-2'-O-methyl-uridine (cmnm5Um), 3,2'-O-dimethyl-uridine (m3Um), 5- (isopentenylaminomethyl)-2'-O-methyl-uridine (inm5Um), 1-thio-uridine, deoxythymidine, 2'-F-ara-uridine, 2'-F- uridine, 2'-OH-ara-uridine, 5-(2-carbomethoxyvinyl) uridine, and 5-[3-(l-E-propenylamino)uridine. In certain embodiments, the nucleoside comprising a modified nucleobase is pseudouridine (ip), Nl-methyl-pseudouridine (mlip) or 5-methyl-uridine (m5U), in particular Nl-methyl-pseudouridine. In some embodiments, the replacement of one or more uridines with a nucleoside comprising a modified nucleobase comprises a replacement of at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, at least 10%, at least 25%, at least 50%, at least 75%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% of the uridines.
During synthesis of mRNA by in vitro transcription (IVT) using T7 RNA polymerase significant amounts of aberrant products, including double-stranded RNA (dsRNA) are produced due to unconventional activity of the enzyme. dsRNA induces inflammatory cytokines and activates effector enzymes leading to protein synthesis inhibition. Formation of dsRNA can be limited during synthesis of mRNA by in vitro transcription (IVT), for example, by limiting the amount of uridine triphosphate (UTP) during synthesis. Optionally, UTP may be added once or several times during synthesis of mRNA. Also, dsRNA can be removed from RNA such as IVT RNA, for example, by ion-pair reversed phase HPLC using a non-porous or porous C-18 polystyrene-divinylbenzene (PS-DVB) matrix. Alternatively, an enzymatic based method using E. co//RNaseIII that specifically hydrolyzes dsRNA but not ssRNA, thereby eliminating dsRNA contaminants from IVT RNA preparations can be used. Furthermore, dsRNA can be separated from ssRNA by using a cellulose material. In some embodiments, an RNA preparation is contacted with a cellulose material and the ssRNA is separated from the cellulose material under conditions which allow binding of dsRNA to the cellulose material and do not allow binding of ssRNA to the cellulose material. Suitable methods for providing ssRNA are disclosed, for example, in WO 2017/182524.
As the term is used herein, "remove" or "removal" refers to the characteristic of a population of first substances, such as non-immunogenic RNA, being separated from the proximity of a population of second substances, such as dsRNA, wherein the population of first substances is not necessarily devoid of the second substance, and the population of second substances is not necessarily devoid of the first substance. However, a population of first substances characterized by the removal of a population of second substances has a measurably lower content of second substances as compared to the non-separated mixture of first and second substances.
In some embodiments, the amount of double-stranded RNA (dsRNA) is limited, e.g., dsRNA (especially dsmRNA) is removed from non-immunogenic RNA , such that less than 10%, less than 5%, less than 4%, less than 3%, less than 2%, less than 1%, less than 0.5%, less than 0.3%, less than 0.1%, less than 0.05%, less than 0.03%, less than 0.01%, less than 0.005%, less than 0.004%, less than 0.003%, less than 0.002%, less than 0.001%, or less than 0.0005% of the RNA in the non-immunogenic RNA composition is dsRNA. In some embodiments, the non-immunogenic RNA (especially mRNA) is free or essentially free of dsRNA. In some embodiments, the non-immunogenic RNA (especially mRNA) composition comprises a purified preparation of single-stranded nucleoside modified RNA. In some embodiments, the non-immunogenic RNA (especially mRNA) composition comprises single-stranded nucleoside modified RNA (especially mRNA) and is substantially free of double stranded RNA (dsRNA). In some embodiments, the non-immunogenic RNA (especially mRNA) composition comprises at least 90%, at least 91%, at least 92%, at least 93 %, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.9%, at least 99.99%, at least 99.991%, at least 99.992%, , at least 99.993%,, at least 99.994%, , at least 99.995%, at least 99.996%, at least 99.997%, or at least 99.998% single stranded nucleoside modified RNA, relative to all other nucleic acid molecules (DNA, dsRNA, etc.).
Various methods can be used to determine the amount of dsRNA. For example, a sample may be contacted with dsRNA-specific antibody and the amount of antibody binding to RNA may be taken as a measure for the amount of dsRNA in the sample. A sample containing a known amount of dsRNA may be used as a reference.
For example, RNA may be spotted onto a membrane, e.g., nylon blotting membrane. The membrane may be blocked, e.g., in TBS-T buffer (20 mM TRIS pH 7.4, 137 mM NaCI, 0.1% (v/v) TWEEN-20) containing 5% (w/v) skim milk powder. For detection of dsRNA, the membrane may be incubated with dsRNA-specific antibody, e.g., dsRNA-specific mouse mAb (English & Scientific Consulting, Szirak, Hungary). After washing, e.g., with TBS-T, the membrane may be incubated with a secondary antibody, e.g., HRP-conjugated donkey anti-mouse IgG (Jackson ImmunoResearch, Cat #715-035-150), and the signal provided by the secondary antibody may be detected.
In some embodiments, the non-immunogenic RNA (especially mRNA) is translated in a cell more efficiently than standard RNA with the same sequence. In some embodiments, translation is enhanced by a factor of 2-fold relative to its unmodified counterpart. In some embodiments, translation is enhanced by a 3-fold factor. In some embodiments, translation is enhanced by a 4-fold factor. In some embodiments, translation is enhanced by a 5-fold factor. In some embodiments, translation is enhanced by a 6-fold factor. In some embodiments, translation is enhanced by a 7-fold factor. In some embodiments, translation is enhanced by an 8-fold factor. In some embodiments, translation is enhanced by a 9-fold factor. In some embodiments, translation is enhanced by a 10-fold factor. In some embodiments, translation is enhanced by a 15-fold factor. In some embodiments, translation is enhanced by a 20-fold factor. In some embodiments, translation is enhanced by a 50-fold factor. In some embodiments, translation is enhanced by a 100- fold factor. In some embodiments, translation is enhanced by a 200-fold factor. In some embodiments, translation is enhanced by a 500-fold factor. In some embodiments, translation is enhanced by a 1000-fold factor. In some embodiments, translation is enhanced by a 2000-fold factor. In some embodiments, the factor is 10-1000-fold. In some embodiments, the factor is 10-100-fold. In some embodiments, the factor is 10-200-fold. In some embodiments, the factor is 10-300-fold. In some embodiments, the factor is 10-500-fold. In some embodiments, the factor is 20-1000- fold. In some embodiments, the factor is 30-1000-fold. In some embodiments, the factor is 50-1000-fold. In some embodiments, the factor is 100-1000-fold. In some embodiments, the factor is 200-1000-fold. In some embodiments, translation is enhanced by any other significant amount or range of amounts.
In some embodiments, the non-immunogenic RNA (especially mRNA) exhibits significantly less innate immunogenicity than standard RNA with the same sequence. In some embodiments, the non-immunogenic RNA (especially mRNA) exhibits an innate immune response that is 2-fold less than its unmodified counterpart. In some embodiments, innate immunogenicity is reduced by a 3-fold factor. In some embodiments, innate immunogenicity is reduced by a 4-fold factor. In some embodiments, innate immunogenicity is reduced by a 5-fold factor. In some embodiments, innate immunogenicity is reduced by a 6-fold factor. In some embodiments, innate immunogenicity is reduced by a 7-fold factor. In some embodiments, innate immunogenicity is reduced by an 8-fold factor. In some embodiments, innate immunogenicity is reduced by a 9-fold factor. In some embodiments, innate immunogenicity is reduced by a 10-fold factor. In some embodiments, innate immunogenicity is reduced by a 15-fold factor. In some embodiments, innate immunogenicity is reduced by a 20-fold factor. In some embodiments, innate immunogenicity is reduced by a 50-fold factor. In some embodiments, innate immunogenicity is reduced by a 100-fold factor. In some embodiments, innate immunogenicity is reduced by a 200-fold factor. In some embodiments, innate immunogenicity is reduced by a 500- fold factor. In some embodiments, innate immunogenicity is reduced by a 1000-fold factor. In some embodiments, innate immunogenicity is reduced by a 2000-fold factor.
The term "exhibits significantly less innate immunogenicity" refers to a detectable decrease in innate immunogenicity. In some embodiments, the term refers to a decrease such that an effective amount of the non-immunogenic RNA (especially mRNA) can be administered without triggering a detectable innate immune response. In some embodiments, the term refers to a decrease such that the non-immunogenic RNA (especially mRNA) can be repeatedly administered without eliciting an innate immune response sufficient to detectably reduce production of the protein encoded by the non-immunogenic RNA. In some embodiments, the decrease is such that the non-immunogenic RNA (especially mRNA) can be repeatedly administered without eliciting an innate immune response sufficient to eliminate detectable production of the protein encoded by the non-immunogenic RNA.
"Immunogenicity" is the ability of a foreign substance, such as RNA, to provoke an immune response in the body of a human or other animal. The innate immune system is the component of the immune system that is relatively unspecific and immediate. It is one of two main components of the vertebrate immune system, along with the adaptive immune system.
Antigen-coding RNA and use thereof for inducing an immune response
Generally, RNA (in particular, mRNA) described in the present disclosure comprises a nucleic acid sequence encoding a peptide or polypeptide comprising one or more Mycobacterium tuberculosis antigens, immunogenic variants or fragments thereof, for inducing an immune response against Mycobacterium tuberculosis in a subject. The peptide or polypeptide for inducing an immune response is also designated herein as "vaccine antigen" or simply "antigen".
In some embodiments, the RNA (in particular, mRNA) is translated into the respective protein upon entering cells of a subject being administered the RNA, e.g., muscle cells or antigen-presenting cells (APCs).
In some embodiments, the RNA encoding the vaccine antigen is expressed in cells of the subject to provide the vaccine antigen. In some embodiments, the RNA encoding the vaccine antigen is transiently expressed in cells of the subject. In some embodiments, the vaccine antigen is presented in the context of MHC. In some embodiments, the vaccine antigen is secreted by cells of the subject.
In some embodiments, the RNA encoding the vaccine antigen is administered intramuscularly.
In some embodiments, the RNA encoding the vaccine antigen is administered systemically, e.g., intravenously. In some embodiments, after systemic administration of the RNA encoding the vaccine antigen, expression of the RNA encoding the vaccine antigen in spleen occurs. In some embodiments, after systemic administration of the RNA encoding the vaccine antigen, expression of the RNA encoding the vaccine antigen in antigen presenting cells, preferably professional antigen presenting cells occurs. In some embodiments, the antigen presenting cells are selected from the group consisting of dendritic cells, macrophages and B cells. In some embodiments, after systemic administration of the RNA encoding the vaccine antigen, no or essentially no expression of the RNA encoding the vaccine antigen in lung and/or liver occurs. In some embodiments, after systemic administration of the RNA encoding the vaccine antigen, expression of the RNA encoding the vaccine antigen in spleen is at least 5-fold the amount of expression in lung.
A vaccine antigen comprises an epitope for inducing an immune response against a disease-associated antigen, e.g., a protein of an infectious agent (e.g., Mtb antigen), in a subject. Accordingly, the vaccine antigen comprises an antigenic sequence for inducing an immune response against a disease-associated antigen in a subject. Such antigenic sequence may correspond to a target antigen or disease-associated antigen, an immunogenic variant thereof, or an immunogenic fragment of the target antigen or disease-associated antigen or the immunogenic variant thereof. Thus, the antigenic sequence may comprise at least an epitope of a target antigen or disease-associated antigen or an immunogenic variant thereof.
The antigenic sequences, e.g., epitopes, suitable for use according to the disclosure typically may be derived from a target antigen, i.e. the antigen against which an immune response is to be elicited. For example, the antigenic sequences contained within the vaccine antigen may be a target antigen or a fragment or variant of a target antigen. The antigenic sequence or a procession product thereof, e.g., a fragment thereof, may bind to an antigen receptor such as TCR carried by immune effector cells. In some embodiments, the antigenic sequence is selected from the group consisting of the antigen expressed by a target cell to which the immune effector cells are targeted or a fragment thereof, or a variant of the antigenic sequence or the fragment.
A vaccine antigen which may be provided to a subject according to the present disclosure by administering RNA encoding the vaccine antigen, preferably results in the induction of an immune response, e.g., in the stimulation, priming and/or expansion of immune effector cells, in the subject being provided the vaccine antigen. Said immune response, e.g., stimulated, primed and/or expanded immune effector cells, is preferably directed against a target antigen, in particular a target antigen expressed in diseased cells, tissues and/or organs, i.e., a disease-associated antigen. Thus, a vaccine antigen may comprise the disease-associated antigen, or a fragment or variant thereof. In some embodiments, such fragment or variant is immunologically equivalent to the disease-associated antigen.
The term "immunologically equivalent" means that the immunologically equivalent molecule such as the immunologically equivalent amino acid sequence exhibits the same or essentially the same immunological properties and/or exerts the same or essentially the same immunological effects, e.g., with respect to the type of the immunological effect. In the context of the present disclosure, the term "immunologically equivalent" is preferably used with respect to the immunological effects or properties of antigens or antigen variants used for immunization. For example, an amino acid sequence is immunologically equivalent to a reference amino acid sequence if said amino acid sequence when exposed to the immune system of a subject induces an immune reaction having a specificity of reacting with the reference amino acid sequence. Thus, in some embodiments, a molecule which is immunologically equivalent to an antigen exhibits the same or essentially the same properties and/or exerts the same or essentially the same effects regarding the stimulation, priming and/or expansion of T cells as the antigen to which the T cells are targeted.
In the context of the present disclosure, the term "fragment of an antigen" or "variant of an antigen" means an agent which results in the induction of an immune response, e.g., in the stimulation, priming and/or expansion of immune effector cells, which immune response, e.g., stimulated, primed and/or expanded immune effector cells, targets the antigen, i.e. a disease-associated antigen, in particular when presented by diseased cells, tissues and/or organs. Thus, the vaccine antigen may correspond to or may comprise the disease-associated antigen, may correspond to or may comprise a fragment of the disease-associated antigen or may correspond to or may comprise an antigen which is homologous to the disease-associated antigen or a fragment thereof. If the vaccine antigen comprises a fragment of the disease-associated antigen or an amino acid sequence which is homologous to a fragment of the disease-associated antigen said fragment or amino acid sequence may comprise an epitope of the disease-associated antigen to which the antigen receptor of the immune effector cells is targeted or a sequence which is homologous to an epitope of the disease-associated antigen. Thus, according to the disclosure, a vaccine antigen may comprise an immunogenic fragment of a disease-associated antigen or an amino acid sequence being homologous to an immunogenic fragment of a disease-associated antigen. An "immunogenic fragment of an antigen" according to the disclosure preferably relates to a fragment of an antigen which is capable of inducing an immune response against, e.g., stimulating, priming and/or expanding immune effector cells carrying an antigen receptor binding to, the antigen or cells expressing the antigen. It is preferred that the vaccine antigen (similar to the disease-associated antigen) provides the relevant epitope for binding by the antigen receptor present on the immune effector cells. In some embodiments, the vaccine antigen or a fragment thereof (similar to the disease-associated antigen) is expressed on the surface of a cell such as an antigen-presenting cell (optionally in the context of MHC) so as to provide the relevant epitope for binding by immune effector cells. The vaccine antigen may be a recombinant antigen. In some embodiments of all aspects described herein, the RNA encoding the vaccine antigen is expressed in cells of a subject to provide the antigen or a procession product thereof for binding by the antigen receptor expressed by immune effector cells, said binding resulting in stimulation, priming and/or expansion of the immune effector cells.
An "antigen" according to the present disclosure covers any substance that will elicit an immune response and/or any substance against which an immune response or an immune mechanism such as a cellular response and/or humoral response is directed. This also includes situations wherein the antigen is processed into antigen peptides and an immune response or an immune mechanism is directed against one or more antigen peptides, in particular if presented in the context of MHC molecules. In particular, an "antigen" relates to any substance, such as a peptide or polypeptide, that reacts specifically with antibodies or T-lymphocytes (T-cells). The term "antigen" may comprise a molecule that comprises at least one epitope, such as a T cell epitope. In some embodiments, an antigen is a molecule which, optionally after processing, induces an immune reaction, which may be specific for the antigen (including cells expressing the antigen). In some embodiments, an antigen is a disease-associated antigen, such as an Mtb antigen.
In some embodiments, an antigen is presented or present on the surface of cells of the immune system such as antigen presenting cells like dendritic cells or macrophages. An antigen or a procession product thereof such as a T cell epitope is in some embodiments bound by an antigen receptor. Accordingly, an antigen or a procession product thereof may react specifically with immune effector cells such as T-lymphocytes (T cells).
According to the present disclosure, an antigen or a combination of antigens described herein may induce an immune response, wherein the immune response may comprise a humoral or cellular immune response, or both. In the context of some embodiments of the present disclosure, the antigen is presented by a cell, such as by an antigen presenting cell, in the context of MHC molecules, which results in an immune response against the antigen. An antigen may be a product which corresponds to or is derived from a naturally occurring antigen. According to the present disclosure, an antigen may correspond to a naturally occurring product.
The term "disease-associated antigen" is used in its broadest sense to refer to any antigen associated with a disease. In some embodiments, a disease-associated antigen is a molecule which contains epitopes that will stimulate a host's immune system to make a cellular antigen-specific immune response and/or a humoral antibody response against the disease. Disease-associated antigens include pathogen-associated antigens, i.e., antigens which are associated with infection by microbes, typically microbial antigens (such as bacterial or viral antigens, e.g., Mtb antigens), or antigens associated with cancer, typically tumors, such as tumor antigens.
The term "bacterial antigen" refers to any bacterial component having antigenic properties, i.e. being able to provoke an immune response in an individual. The bacterial antigen may be derived from the cell wall or cytoplasm membrane of the bacterium. The term "bacterial antigen" includes Mtb antigens, e.g., Mtb antigens as described herein.
The term "epitope" refers to an antigenic determinant in a molecule such as an antigen, i.e., to a part in or fragment of the molecule that is recognized by the immune system, for example, that is recognized by antibodies, T cells or B cells, in particular when presented in the context of MHC molecules. An epitope of a protein may comprises a continuous or discontinuous portion of said protein and, e.g., may be between about 5 and about 100, between about 5 and about 50, between about 8 and about 30, or about 10 and about 25 amino acids in length, for example, the epitope may be preferably 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids in length. In some embodiments, the epitope in the context of the present disclosure is a T cell epitope.
Terms such as "epitope", "fragment of an antigen", "immunogenic peptide" and "antigen peptide" are used interchangeably herein and, e.g., may relate to an incomplete representation of an antigen which is, e.g., capable of eliciting an immune response against the antigen or a cell expressing or comprising and presenting the antigen. In some embodiments, the terms relate to an immunogenic portion of an antigen. In some embodiments, it is a portion of an antigen that is recognized (Ze., specifically bound) by a T cell receptor, in particular if presented in the context of MHC molecules. Certain preferred immunogenic portions bind to an MHC class I or class II molecule. The term "epitope" refers to a part or fragment of a molecule such as an antigen that is recognized by the immune system. For example, the epitope may be recognized by T cells, B cells or antibodies. An epitope of an antigen may include a continuous or discontinuous portion of the antigen and may be between about 5 and about 100, such as between about 5 and about 50, between about 8 and about 30, or between about 8 and about 25 amino acids in length, for example, the epitope may be 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids in length. In some embodiments, an epitope is between about 10 and about 25 amino acids in length. The term "epitope" includes T cell epitopes.
The term "T cell epitope" refers to a part or fragment of a protein that is recognized by a T cell when presented in the context of MHC molecules, including epitopes predicted by bioinformatic means. The term "major histocompatibility complex" and the abbreviation "MHC" includes MHC class I and MHC class II molecules and relates to a complex of genes which is present in all vertebrates. MHC proteins or molecules are important for signaling between lymphocytes and antigen presenting cells or diseased cells in immune reactions, wherein the MHC proteins or molecules bind peptide epitopes and present them for recognition by T cell receptors on T cells. The proteins encoded by the MHC are expressed on the surface of cells, and display both self-antigens (peptide fragments from the cell itself) and non-self- antigens e.g, fragments of invading microorganisms) to a T cell. In the case of class I MHC/peptide complexes, the binding peptides are typically about 8 to about 10 amino acids long although longer or shorter peptides may be effective. In the case of class II MHC/peptide complexes, the binding peptides are typically about 10 to about 25 amino acids long and are in particular about 13 to about 18 amino acids long, whereas longer and shorter peptides may be effective.
In some embodiments, vaccine antigen, i.e., an antigen whose inoculation into a subject induces an immune response, is recognized by an immune effector cell. In some embodiments, the vaccine antigen if recognized by an immune effector cell is able to induce in the presence of appropriate co-stimulatory signals, stimulation, priming and/or expansion of the immune effector cell carrying an antigen receptor recognizing the vaccine antigen. In the context of the embodiments of the present disclosure, the vaccine antigen may be, e.g., presented or present on the surface of a cell, such as an antigen presenting cell.
In some embodiments, an antigen is expressed in a diseased cell (such as an infected cell).
In some embodiments, an antigen is presented by a diseased cell (such as an infected cell). In some embodiments, an antigen receptor is a TCR which binds to an epitope of an antigen presented in the context of MHC. In some embodiments, binding of a TCR when expressed by T cells and/or present on T cells to an antigen presented by cells such as antigen presenting cells results in stimulation, priming and/or expansion of said T cells. In some embodiments, binding of a TCR when expressed by T cells and/or present on T cells to an antigen presented on diseased cells results in cytolysis and/or apoptosis of the diseased cells, wherein said T cells release cytotoxic factors, e.g., perforins and granzymes.
In some embodiments, an antigen receptor is an antibody or B cell receptor which binds to an epitope in an antigen. In some embodiments, an antibody or B cell receptor binds to native epitopes of an antigen.
The terms "T cell" and 'T lymphocyte" are used interchangeably herein and include T helper cells (CD4+ T cells) and cytotoxic T cells (CTLs, CD8+ T cells) which comprise cytolytic T cells. The term "antigen-specific T cell" or similar terms relate to a T cell which recognizes the antigen to which the T cell is targeted, in particular when presented on the surface of antigen presenting cells or diseased cells in the context of MHC molecules and preferably exerts effector functions of T cells. T cells are considered to be specific for antigen if the cells kill target cells expressing an antigen. T cell specificity may be evaluated using any of a variety of standard techniques, for example, within a chromium release assay or proliferation assay. Alternatively, synthesis of lymphokines (such as interferon-y) can be measured.
In some embodiments, the term "target" shall mean an agent such as a cell or tissue which is a target for an immune response such as a cellular immune response. Targets include cells that present an antigen or an antigen epitope, i.e., a peptide fragment derived from an antigen. In some embodiments, the target cell is a cell expressing an antigen and presenting said antigen with class I MHC.
"Antigen processing" refers to the degradation of an antigen into processing products which are fragments of said antigen (e.g, the degradation of a polypeptide into peptides) and the association of one or more of these fragments e.g, via binding) with MHC molecules for presentation by cells, such as antigen-presenting cells to specific T-cells. Antigen-presenting cells can be distinguished in professional antigen presenting cells and non-professional antigen presenting cells.
The term "professional antigen presenting cells" relates to antigen presenting cells which constitutively express the Major Histocompatibility Complex class II (MHC class II) molecules required for interaction with naive T cells. If a T cell interacts with the MHC class II molecule complex on the membrane of the antigen presenting cell, the antigen presenting cell produces a co-stimulatory molecule inducing activation of the T cell. Professional antigen presenting cells comprise dendritic cells and macrophages.
The term "non-professional antigen presenting cells" relates to antigen presenting cells which do not constitutively express MHC class II molecules, but upon stimulation by certain cytokines such as interferon-gamma. Exemplary, non- professional antigen presenting cells include fibroblasts, thymic epithelial cells, thyroid epithelial cells, glial cells, pancreatic beta cells or vascular endothelial cells.
The term "dendritic cell" (DC) refers to a subtype of phagocytic cells belonging to the class of antigen presenting cells. In some embodiments, dendritic cells are derived from hematopoietic bone marrow progenitor cells. These progenitor cells initially transform into immature dendritic cells. These immature cells are characterized by high phagocytic activity and low T cell activation potential. Immature dendritic cells constantly sample the surrounding environment for pathogens such as viruses and bacteria. Once they have come into contact with a presentable antigen, they become activated into mature dendritic cells and begin to migrate to the spleen or to the lymph node. Immature dendritic cells phagocytose pathogens and degrade their proteins into small pieces and upon maturation present those fragments at their cell surface using MHC molecules. Simultaneously, they upregulate cell-surface receptors that act as co-receptors in T cell activation such as CD80, CD86, and CD40 greatly enhancing their ability to activate T cells. They also upregulate CCR7, a chemotactic receptor that induces the dendritic cell to travel through the blood stream to the spleen or through the lymphatic system to a lymph node. Here they act as antigen-presenting cells and activate helper T cells and killer T cells as well as B cells by presenting them antigens, alongside non-antigen specific co-stimulatory signals. Thus, dendritic cells can actively induce a T cell- or B cell-related immune response. In some embodiments, the dendritic cells are splenic dendritic cells.
The term "macrophage" refers to a subgroup of phagocytic cells produced by the differentiation of monocytes. Macrophages which are activated by inflammation, immune cytokines or microbial products nonspecifically engulf and kill foreign pathogens within the macrophage by hydrolytic and oxidative attack resulting in degradation of the pathogen. Peptides from degraded proteins are displayed on the macrophage cell surface where they can be recognized by T cells, and they can directly interact with antibodies on the B cell surface, resulting in T and B cell activation and further stimulation of the immune response. Macrophages belong to the class of antigen presenting cells. In some embodiments, the macrophages are splenic macrophages.
By "antigen-responsive CTL" is meant a CD8+ T-cell that is responsive to an antigen or a peptide derived from said antigen, which is presented with class I MHC on the surface of antigen presenting cells.
According to the disclosure, CTL responsiveness may include sustained calcium flux, cell division, production of cytokines such as IFN-y and TNF-a, up-regulation of activation markers such as CD44 and CD69, and specific cytolytic killing of tumor antigen expressing target cells. CTL responsiveness may also be determined using an artificial reporter that accurately indicates CTL responsiveness.
"Activation" or "stimulation", as used herein, refers to the state of a cell that has been sufficiently stimulated to induce detectable cellular proliferation, such as an immune effector cell such as T cell. Activation can also be associated with initiation of signaling pathways, induced cytokine production, and detectable effector functions. The term "activated immune effector cells" refers to, among other things, immune effector cells that are undergoing cell division.
The term "priming" refers to a process wherein an immune effector cell such as a T cell has its first contact with its specific antigen and causes differentiation into effector cells such as effector T cells.
The term "expansion" refers to a process wherein a specific entity is multiplied. In some embodiments, the term is used in the context of an immunological response in which immune effector cells are stimulated by an antigen, proliferate, and the specific immune effector cell recognizing said antigen is amplified. In some embodiments, expansion leads to differentiation of the immune effector cells.
The terms "immune response" and "immune reaction" are used herein interchangeably in their conventional meaning and refer to an integrated bodily response to an antigen and may refer to a cellular immune response, a humoral immune response, or both. According to the disclosure, the term "immune response to" or "immune response against" with respect to an agent such as an antigen, cell or tissue, relates to an immune response such as a cellular response directed against the agent. An immune response may comprise one or more reactions selected from the group consisting of developing antibodies against one or more antigens and expansion of antigen-specific T-lymphocytes, such as CD4+ and CD8+ T-lymphocytes, e.g. CD8+ T-lymphocytes, which may be detected in various proliferation or cytokine production tests in vitro.
The terms "inducing an immune response" and "eliciting an immune response" and similar terms in the context of the present disclosure refer to the induction of an immune response, such as the induction of a cellular immune response, a humoral immune response, or both. The immune response may be protective/preventive/prophylactic and/or therapeutic. The immune response may be directed against any immunogen or antigen or antigen peptide, such as against a pathogen-associated antigen e.g, an antigen of Mtb). "Inducing" in this context may mean that there was no immune response against a particular antigen or pathogen before induction, but it may also mean that there was a certain level of immune response against a particular antigen or pathogen before induction and after induction said immune response is enhanced. Thus, "inducing the immune response" in this context also includes "enhancing the immune response". In some embodiments, after inducing an immune response in an individual, said individual is protected from developing a disease such as an infectious disease or the disease condition is ameliorated by inducing an immune response.
The terms "cellular immune response", "cellular response", "cell-mediated immunity" or similar terms are meant to include a cellular response directed to cells characterized by expression of an antigen and/or presentation of an antigen with class I or class II MHC. The cellular response relates to cells called T cells or T lymphocytes which act as either "helpers" or "killers". The helper T cells (also termed CD4+ T cells) play a central role by regulating the immune response and the killer cells (also termed cytotoxic T cells, cytolytic T cells, CD8+ T cells or CTLs) kill cells such as diseased cells.
The term "humoral immune response" refers to a process in living organisms wherein antibodies are produced in response to agents and organisms, which they ultimately neutralize and/or eliminate. The specificity of the antibody response is mediated by T and/or B cells through membrane-associated receptors that bind antigen of a single specificity. Following binding of an appropriate antigen and receipt of various other activating signals, B lymphocytes divide, which produces memory B cells as well as antibody secreting plasma cell clones, each producing antibodies that recognize the identical antigenic epitope as was recognized by its antigen receptor. Memory B lymphocytes remain dormant until they are subsequently activated by their specific antigen. These lymphocytes provide the cellular basis of memory and the resulting escalation in antibody response when re-exposed to a specific antigen.
The term "antibody" as used herein, refers to an immunoglobulin molecule, which is able to specifically bind to an epitope on an antigen. In particular, the term "antibody" refers to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. The term "antibody" includes monoclonal antibodies, recombinant antibodies, human antibodies, humanized antibodies, chimeric antibodies and combinations of any of the foregoing. Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (CH). Each light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL). The variable regions and constant regions are also referred to herein as variable domains and constant domains, respectively. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The CDRs of a VH are termed HCDR1, HCDR2 and HCDR3, the CDRs of a VL are termed LCDR1, LCDR2 and LCDR3. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of an antibody comprise the heavy chain constant region (CH) and the light chain constant region (CL), wherein CH can be further subdivided into constant domain CHI, a hinge region, and constant domains CH2 and CH3 (arranged from amino-terminus to carboxy-terminus in the following order: CHI, CH2, CH3). The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system e.g, effector cells) and the first component (Clq) of the classical complement system. Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoactive portions of intact immunoglobulins. Antibodies are typically tetramers of immunoglobulin molecules. Antibodies may exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, Fv, Fab and F(ab)2, as well as single chain antibodies and humanized antibodies.
The term "immunoglobulin" relates to proteins of the immunoglobulin superfamily, such as to antigen receptors such as antibodies or the B cell receptor (BCR). The immunoglobulins are characterized by a structural domain, i.e., the immunoglobulin domain, having a characteristic immunoglobulin (Ig) fold. The term encompasses membrane bound immunoglobulins as well as soluble immunoglobulins. Membrane bound immunoglobulins are also termed surface immunoglobulins or membrane immunoglobulins, which are generally part of the BCR. Soluble immunoglobulins are generally termed antibodies. Immunoglobulins generally comprise several chains, typically two identical heavy chains and two identical light chains which are linked via disulfide bonds. These chains are primarily composed of immunoglobulin domains, such as the VL (variable light chain) domain, CL (constant light chain) domain, VH (variable heavy chain) domain, and the CH (constant heavy chain) domains CHI, CH2, CH3, and CH4. There are five types of mammalian immunoglobulin heavy chains, i.e., a, 8, E, y, and |j which account for the different classes of antibodies, i.e., IgA, IgD, IgE, IgG, and IgM. As opposed to the heavy chains of soluble immunoglobulins, the heavy chains of membrane or surface immunoglobulins comprise a transmembrane domain and a short cytoplasmic domain at their carboxy-terminus. In mammals there are two types of light chains, i.e., lambda and kappa. The immunoglobulin chains comprise a variable region and a constant region. The constant region is essentially conserved within the different isotypes of the immunoglobulins, wherein the variable part is highly divers and accounts for antigen recognition.
The terms "vaccination" and "immunization" describe the process of treating an individual for therapeutic or prophylactic reasons and relate to the procedure of administering one or more immunogen(s) or antigen(s) or derivatives thereof, in particular in the form of RNA (especially mRNA) coding therefor, as described herein to an individual and stimulating an immune response against said one or more immunogen(s) or antigen(s) or cells characterized by presentation of said one or more immunogen(s) or antigen(s).
By "cell characterized by presentation of an antigen" or "cell presenting an antigen" or "MHC molecules which present an antigen on the surface of an antigen presenting cell" or similar expressions is meant a cell such as a diseased cell, in particular an infected cell, or an antigen presenting cell presenting the antigen or an antigen peptide, either directly or following processing, in the context of MHC molecules, such as MHC class I and/or MHC class II molecules. In some embodiments, the MHC molecules are MHC class I molecules.
Embodiments of antigen-coding RNA
Generally, at least four formats useful for RNA pharmaceutical compositions may be used herein, namely non-modified uridine containing mRNA (uRNA), nucleoside modified mRNA (modRNA), self-amplifying RNA (saRNA), and transamplifying RNAs.
Features of modified uridine (e.g., pseudouridine) platform may include reduced adjuvant effect, blunted immune innate immune sensor activating capacity and thus augmented polypeptide {e.g., protein) expression.
Features of self-amplifying platform may include, for example, long duration of polypeptide e.g., protein) expression, good tolerability and safety, higher likelihood for efficacy with very low RNA dose.
In some embodiments, a self-amplifying platform {e.g., RNA) comprises two nucleic acid molecules, wherein one nucleic acid molecule encodes a replicase {e.g., a viral replicase) and the other nucleic acid molecule is capable of being replicated {e.g., a replicon) by said replicase in trans (f/a/zs-replication system). In some embodiments, a selfamplifying platform {e.g., RNA) comprises a plurality of nucleic acid molecules, wherein said nucleic acids encode a plurality of replicases and/or replicons.
In some embodiments, a /rans-replication system comprises the presence of both nucleic acid molecules in a single host cell.
In some such embodiments, a nucleic acid encoding a replicase {e.g., a viral replicase) is not capable of self-replication in a target cell and/or target organism. In some such embodiments, a nucleic acid encoding a replicase {e.g., a viral replicase) lacks at least one conserved sequence element important for (-) strand synthesis based on a (+) strand template and/or for (+) strand synthesis based on a (-) strand template.
In some embodiments, a self-amplifying RNA comprises a 3' untranslated region (UTR), a 5' UTR, a cap structure, a poly adenine (polyA) tail, and any combinations thereof. In some embodiments, a self-amplifying platform does not require propagation of virus particles e.g., is not associated with undesired virus-particle formation). In some embodiments, a self-amplifying platform is not capable of forming virus particles.
In some embodiments, RNA e.g., a single stranded RNA) described herein has a length of at least 500 ribonucleotides (such as, e.g., at least 600 ribonucleotides, at least 700 ribonucleotides, at least 800 ribonucleotides, at least 900 ribonucleotides, at least 1000 ribonucleotides, at least 1250 ribonucleotides, at least 1500 ribonucleotides, at least 1750 ribonucleotides, at least 2000 ribonucleotides, at least 2500 ribonucleotides, at least 3000 ribonucleotides, at least 3500 ribonucleotides, at least 4000 ribonucleotides, at least 4500 ribonucleotides, at least 5000 ribonucleotides, or longer). In some embodiments, RNA described herein is single-stranded RNA having a length of about 800 ribonucleotides to 5000 ribonucleotides.
In some embodiments, a relevant RNA includes a polypeptide-encoding portion or a plurality of polypeptide-encoding portions. In some particular embodiments, such a portion or portions encode one or more polypeptides which are not endogenous (i.e., it is foreign) to the subject treated.
In some embodiments, the RNA described herein (e.g., contained in the compositions/formulations of the present disclosure and/or used in the methods of the present disclosure) is single-stranded RNA (in particular, mRNA) that may be translated into the respective protein upon entering cells, e.g., cells of a recipient, e.g., muscle cells or antigen- presenting cells (APCs). In addition to wild-type or codon-optimized sequences encoding an antigen sequence, the RNA may contain one or more structural elements optimized for maximal efficacy of the RNA with respect to stability and translational efficiency (5' cap, 5' UTR, 3' UTR, poly(A)-tail). In some embodiments, the RNA contains all of these elements. In some embodiments, beta-S-ARCA(Dl) (m27'2' °GppSpG) or m27'3' °Gppp(mi2' °)ApG may be utilized as specific capping structure at the 5'-end of the RNA. As 5'-UTR sequence, the 5'-UTR sequence of the human alphaglobin mRNA, optionally with an optimized 'Kozak sequence' to increase translational efficiency may be used. As 3'- UTR sequence, a combination of two sequence elements (FI element) derived from the "amino terminal enhancer of split" (AES) mRNA (called F) and the mitochondrial encoded 12S ribosomal RNA (called I) placed between the coding sequence and the poly(A)-tail to assure higher maximum protein levels and prolonged persistence of the mRNA may be used (see WO 2017/060314, herein incorporated by reference). Furthermore, a poly(A)-tail measuring 110 nucleotides in length, consisting of a stretch of 30 adenosine residues, followed by a 10 nucleotide linker sequence (of random nucleotides) and another 70 adenosine residues may be used. In some embodiments, the 5'-UTR comprises the nucleotide sequence of SEQ ID NO: 53, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 53. In some embodiments, the 3'-UTR comprises the nucleotide sequence of SEQ ID NO: 54, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 54. In some embodiments, the poly(A) sequence comprises the nucleotide sequence of SEQ ID NO: 55, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 55.
In some embodiments, the RNA described herein is not chemically modified, i.e. it solely contains naturally occurring nucleosides, and preferably has the composition of naturally occurring RNA.
In some embodiments, the RNA described herein is modified for optimized efficacy of the RNA (e.g., increased translation efficacy, decreased immunogenicity, and/or decreased cytotoxicity) (e.g., by replacing (partially or completely, preferably completely) naturally occurring nucleosides (in particular uridine) with synthetic nucleosides (e.g., modified nucleosides, e.g., selected from the group consisting of pseudouridine (ip), Nl-methyl-pseudouridine (mlip), and 5-methyl-uridine); and/or codon-optimization). In some embodiments, the RNA comprises a modified nucleoside in place of uridine. In some embodiments, the modified nucleoside replacing (partially or completely, preferably completely) uridine is selected from the group consisting of pseudouridine (i ), Nl-methyl-pseudouridine (mli ), and 5-methyl-uridine. In some embodiments, the RNA encoding the vaccine antigen has a coding sequence (a) which is codon-optimized, (b) the G/C content of which is increased compared to the wild type coding sequence, or (c) both (a) and (b).
In some embodiments, the RNA described herein comprises a 5' cap, a 5' UTR, a 3' UTR, and a poly(A) sequence (e.g., as described above); is modified by replacing (partially or completely, preferably completely) uridine with modified nucleosides, e.g., selected from the group consisting of pseudouridine (i ), Nl-methyl-pseudouridine (mlip), and 5- methyl-uridine; and has a coding sequence which is codon-optimized, and the G/C content of which is increased compared to the wild type coding sequence.
In some embodiments, if the present disclosure provides for a mixture of different RNA molecules, a composition comprising different RNA molecules or an administration of different RNA molecules, these different RNA molecules are present in approximately the same amount. Such different RNA molecules may be formulated in individual particulate formulations, mixed particulate formulations, or combined particulate formulations as described herein.
The present disclosure provides RNA (in particular, mRNA) comprising a nucleic acid sequence encoding an Mtb antigen, an immunogenic variant thereof, or an immunogenic fragment of the Mtb antigen or the immunogenic variant thereof.
In some embodiments, RNA (in particular, mRNA) described in the present disclosure comprises a nucleic acid sequence encoding an Mtb antigen, an immunogenic variant thereof, or an immunogenic fragment of the Mtb antigen or the immunogenic variant thereof, and is capable of expressing said Mtb antigen, immunogenic variant, or immunogenic fragment, in particular if transferred into a cell or subject, preferably a human cell or subject. Thus, in some embodiments, the RNA (in particular, mRNA) described in the present disclosure contains a coding region (open reading frame (ORF)) encoding an Mtb antigen, an immunogenic variant thereof, or an immunogenic fragment of the Mtb antigen or the immunogenic variant thereof.
In some embodiments, RNA comprises a nucleic acid sequence encoding more than one Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof, e.g., two, three, four or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof. In some embodiments, two or more of such Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof are present as a fusion protein.
In some embodiments, the one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof encoded by the RNA may comprise or consist of naturally occurring sequences, may comprise or consist of variants of naturally occurring sequences, or may comprise or consist of sequences which are not naturally occurring, e.g., recombinant sequences. In some embodiments, the peptide or polypeptide encoded by the RNA described herein may consist of the one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof, or may comprise the one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof and may comprise additional sequences such as secretion signals, extended-PK groups, tags and any other sequences. In some embodiments, the additional sequences are fused to the one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof, in some embodiments, separated by a linker. In these embodiments, the one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof may be considered the pharmaceutically active peptide or polypeptide even if additional sequences support the function or effect of the one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof.
According to the present disclosure, the term "pharmaceutically active peptide or polypeptide" means a peptide or polypeptide that can be used in the treatment of an individual where the expression of the peptide or polypeptide would be of benefit, e.g., in ameliorating the symptoms of a disease. Preferably, a pharmaceutically active peptide or polypeptide has curative or palliative properties and may be administered to ameliorate, relieve, alleviate, reverse, delay onset of or lessen the severity of one or more symptoms of a disease. In some embodiments, a pharmaceutically active peptide or polypeptide has a positive or advantageous effect on the condition or disease state of an individual when administered to the individual in a therapeutically effective amount. A pharmaceutically active peptide or polypeptide may have prophylactic properties and may be used to delay the onset of a disease or to lessen the severity of such disease. The term "pharmaceutically active peptide or polypeptide" includes entire peptides or polypeptides, and can also refer to pharmaceutically active fragments thereof. It can also include pharmaceutically active variants and/or analogs of a peptide or polypeptide.
Specific examples of pharmaceutically active peptides and polypeptides include, but are not limited to, antigens for vaccination such as Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof.
Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof described herein can be prepared as fusion or chimeric polypeptides that include a portion which corresponds to three or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof and a heterologous polypeptide (i.e., a polypeptide that is not an Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof).
According to certain embodiments, a "signal peptide" (or signal sequence) is fused, either directly or through a linker, to the N-terminus of a chimeric protein described herein.
In some embodiments, an open reading frame of the RNA described herein encodes a polypeptide that includes a signal sequence, e.g., that is functional in mammalian cells.
In some embodiments, a utilized signal sequence is "intrinsic" in that it is, in nature, associated with (e.g., linked to) the full-length antigen or antigen fragment whose sequences are included in the encoded chimeric protein.
In some embodiments, a utilized signal sequence is non-native to the encoded polypeptide - e.g., is not naturally part of a full-length antigen or antigen fragment whose sequences are included in the encoded chimeric protein.
In some embodiments, signal peptides are sequences, which are typically characterized by a length of about 15 to 30 amino acids.
In many embodiments, signal peptides are positioned at the N-terminus of an encoded chimeric protein as described herein, without being limited thereto. In some embodiments, signal peptides preferably allow the transport of the polypeptide encoded by RNAs of the present disclosure with which they are associated into a defined cellular compartment, preferably the cell surface, the endoplasmic reticulum (ER) or the endosomal-lysosomal compartment.
In some embodiments, an RNA sequence encodes a peptidoglycan hydrolase, e.g., an endolysin, that may comprise or otherwise be linked to a signal sequence (e.g., secretory sequence), such as those listed in Table 2 and 3, or a sequence having 1, 2, 3, 4, or 5 amino acid differences relative thereto. In some embodiments, a signal sequence such as MRVMAPRTLILLLSGALALTETWAGS [SEQ ID NO: 17], or a sequence having 1, 2, 3, 4, or at the most 5 amino acid differences relative thereto is utilized.
In some embodiments, a signal peptide is selected from those included in the Table 2 below and/or those encoded by the sequences in Table 3 below or a sequence having 1, 2, 3, 4, or 5 amino acid differences relative thereto:
Table 2: Exemplary signal sequences
Table 3: Exemplary nucleotide sequences encoding signal sequences
According to some embodiments, an amino acid sequence enhancing antigen processing and/or presentation is fused, either directly or through a linker, to an antigenic peptide or polypeptide (antigenic sequence), e.g., one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof. Accordingly, in some embodiments, the RNA described herein comprises at least one coding region encoding an antigenic peptide or polypeptide and an amino acid sequence enhancing antigen processing and/or presentation.
In preferred embodiments, the transmembrane domain and/or trafficking signal is positioned at the C-terminus of a chimeric protein described herein.
In some embodiments, the amino acid sequence enhancing antigen processing and/or presentation includes, without being limited thereto, sequences derived from Human herpes simplex virus 1, envelope glycoprotein D (HSV-gDl), in particular a sequence comprising the amino acid sequence of SEQ ID NO: 140. Such sequence is designated herein as HSV-TMD. In some embodiments, an amino acid sequence enhancing antigen processing and/or presentation comprises the amino acid sequence of SEQ ID NO: 140, an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 140, or a functional fragment of the amino acid sequence of SEQ ID NO: 140, or the amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 140. In some embodiments, an amino acid sequence enhancing antigen processing and/or presentation comprises the amino acid sequence of SEQ ID NO: 140.
In some embodiments, the amino acid sequence enhancing antigen processing and/or presentation as defined herein includes, without being limited thereto, sequences derived from the human MHC class I complex (HLA-B51, haplotype A2, B27/B51, Cw2/Cw3), in particular a sequence comprising the amino acid sequence of SEQ ID NO: 52 or a functional variant thereof. Such sequence, which includes a transmembrane domain and a trafficking signal derived from human MHC class I, is designated herein as MITD.
In some embodiments, an amino acid sequence enhancing antigen processing and/or presentation comprises the amino acid sequence of SEQ ID NO: 52, an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 52, or a functional fragment of the amino acid sequence of SEQ ID NO: 52, or the amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 52. In some embodiments, an amino acid sequence enhancing antigen processing and/or presentation comprises the amino acid sequence of SEQ ID NO: 52.
Accordingly, in some embodiments, the RNA described herein comprises at least one coding region encoding an antigenic peptide or polypeptide and an amino acid sequence enhancing antigen processing and/or presentation, said amino acid sequence enhancing antigen processing and/or presentation preferably being fused to the antigenic peptide or polypeptide, more preferably to the C-terminus of the antigenic peptide or polypeptide as described herein.
Furthermore, a secretory sequence, e.g., a sequence comprising the amino acid sequence selected from SEQ ID NOs: 17 to 37 or 65 or encoded by the nucleotide sequence selected from SEQ ID NOs: 38 to 51, may be fused to the N- terminus of the antigenic peptide or polypeptide.
Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof may be fused to an extended-PK group, which increases circulation half-life. Non-limiting examples of extended-PK groups are described herein. It should be understood that other PK groups that increase the circulation half-life of peptides or polypeptides such as Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof are also applicable to the present disclosure. In certain embodiments, the extended-PK group is a serum albumin domain (e.g., mouse serum albumin, human serum albumin, or recombinant serum albumin).
As used herein, the term "PK" is an acronym for "pharmacokinetic" and encompasses properties of a compound including, by way of example, absorption, distribution, metabolism, and elimination by a subject. As used herein, an "extended-PK group" refers to a protein, peptide, or moiety that increases the circulation half-life of a biologically active molecule when fused to or administered together with the biologically active molecule. Examples of an extended-PK group include serum albumin (e.g., HSA), Immunoglobulin Fc or Fc fragments and variants thereof, transferrin and variants thereof, and human serum albumin (HSA) binders (as disclosed in U.S. Publication Nos. 2005/0287153 and 2007/0003549). Other exemplary extended-PK groups are disclosed in Kontermann, Expert Opin Biol Ther, 2016 Jul;16(7):903-15 which is herein incorporated by reference in its entirety. As used herein, an "extended-PK" polypeptide refers to a polypeptide moiety such as an Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof in combination with an extended-PK group. In some embodiments, the extended-PK polypeptide is a fusion protein in which a polypeptide moiety is linked or fused to an extended-PK group. In certain embodiments, the serum half-life of an extended-PK polypeptide is increased relative to the polypeptide alone (i.e., the polypeptide not fused to an extended-PK group). In certain embodiments, the serum half-life of the extended-PK polypeptide is at least 20%, at least 40%, at least 60%, at least 80%, at least 100%, at least 120%, at least 150%, at least 180%, at least 200%, at least 400%, at least 600%, at least 800%, or at least 1000% longer relative to the serum half-life of the polypeptide alone. In certain embodiments, the serum half-life of the extended- PK polypeptide is at least 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 6-fold, 7-fold, 8-fold, 10- fold, 12-fold, 13-fold, 15-fold, 17-fold, 20-fold, 22-fold, 25-fold, 27-fold, 30-fold, 35-fold, 40-fold, or 50-fold greater than the serum half-life of the polypeptide alone. In certain embodiments, the serum half-life of the extended-PK polypeptide is at least 10 hours, 15 hours, 20 hours, 25 hours, 30 hours, 35 hours, 40 hours, 50 hours, 60 hours, 70 hours, 80 hours, 90 hours, 100 hours, 110 hours, 120 hours, 130 hours, 135 hours, 140 hours, 150 hours, 160 hours, or 200 hours.
As used herein, "half-life" refers to the time taken for the serum or plasma concentration of a compound such as a peptide or polypeptide to reduce by 50%, in vivo, for example due to degradation and/or clearance or sequestration by natural mechanisms. An extended-PK polypeptide suitable for use herein is stabilized in vivo and its half-life increased by, e.g., fusion to serum albumin (e.g., human serum albumin (HSA) or mouse serum albumin (MSA)), which resist degradation and/or clearance or sequestration. The half-life can be determined in any manner known per se, such as by pharmacokinetic analysis. Suitable techniques will be clear to the person skilled in the art, and may for example generally involve the steps of suitably administering a suitable dose of the amino acid sequence or compound to a subject; collecting blood samples or other samples from said subject at regular intervals; determining the level or concentration of the amino acid sequence or compound in said blood sample; and calculating, from (a plot of) the data thus obtained, the time until the level or concentration of the amino acid sequence or compound has been reduced by 50% compared to the initial level upon dosing. Further details are provided in, e.g., standard handbooks, such as Kenneth, A. et al., Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists and in Peters et al., Pharmacokinetic Analysis: A Practical Approach (1996). Reference is also made to Gibaldi, M. et al., Pharmacokinetics, 2nd Rev. Edition, Marcel Dekker (1982).
In certain embodiments, the extended-PK group includes serum albumin, or fragments thereof or variants of the serum albumin or fragments thereof (all of which for the purpose of the present disclosure are comprised by the term "albumin"). Polypeptides described herein may be fused to albumin (or a fragment or variant thereof) to form albumin fusion proteins. Such albumin fusion proteins are described in U.S. Publication No. 20070048282.
As used herein, "albumin fusion protein" refers to a protein formed by the fusion of at least one molecule of albumin (or a fragment or variant thereof) to at least one molecule of a protein such as a therapeutic protein, in particular an Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof. The albumin fusion protein may be generated by translation of a nucleic acid in which a polynucleotide encoding a therapeutic protein is joined in-frame with a polynucleotide encoding an albumin. The therapeutic protein and albumin, once part of the albumin fusion protein, may each be referred to as a "portion", "region" or "moiety" of the albumin fusion protein (e.g., a "therapeutic protein portion" or an "albumin protein portion"). In a highly preferred embodiment, an albumin fusion protein comprises at least one molecule of a therapeutic protein (including, but not limited to a mature form of the therapeutic protein) and at least one molecule of albumin (including but not limited to a mature form of albumin). In some embodiments, an albumin fusion protein is processed by a host cell such as a cell of the target organ for administered RNA, e.g. a liver cell, and secreted into the circulation. Processing of the nascent albumin fusion protein that occurs in the secretory pathways of the host cell used for expression of the RNA may include, but is not limited to signal peptide cleavage; formation of disulfide bonds; proper folding; addition and processing of carbohydrates (such as for example, N- and O-linked glycosylation); specific proteolytic cleavages; and/or assembly into multimeric proteins. An albumin fusion protein is preferably encoded by RNA in a non-processed form which in particular has a signal peptide at its N-terminus and following secretion by a cell is preferably present in the processed form wherein in particular the signal peptide has been cleaved off. In a most preferred embodiment, the "processed form of an albumin fusion protein" refers to an albumin fusion protein product which has undergone N- terminal signal peptide cleavage, herein also referred to as a "mature albumin fusion protein".
In preferred embodiments, albumin fusion proteins comprising a therapeutic protein have a higher plasma stability compared to the plasma stability of the same therapeutic protein when not fused to albumin. Plasma stability typically refers to the time period between when the therapeutic protein is administered in //Vo and carried into the bloodstream and when the therapeutic protein is degraded and cleared from the bloodstream, into an organ, such as the kidney or liver, that ultimately clears the therapeutic protein from the body. Plasma stability is calculated in terms of the half-life of the therapeutic protein in the bloodstream. The half-life of the therapeutic protein in the bloodstream can be readily determined by common assays known in the art.
As used herein, "albumin" refers collectively to albumin protein or amino acid sequence, or an albumin fragment or variant, having one or more functional activities (e.g., biological activities) of albumin. In particular, "albumin" refers to human albumin or fragments or variants thereof especially the mature form of human albumin, or albumin from other vertebrates or fragments thereof, or variants of these molecules. The albumin may be derived from any vertebrate, especially any mammal, for example human, cow, sheep, or pig. Non-mammalian albumins include, but are not limited to, hen and salmon. The albumin portion of the albumin fusion protein may be from a different animal than the therapeutic protein portion.
In certain embodiments, the albumin is human serum albumin (HSA), or fragments or variants thereof, such as those disclosed in US 5,876,969, WO 2011/124718, WO 2013/075066, and WO 2011/0514789.
The terms, human serum albumin (HSA) and human albumin (HA) are used interchangeably herein. The terms, "albumin and "serum albumin" are broader, and encompass human serum albumin (and fragments and variants thereof) as well as albumin from other species (and fragments and variants thereof).
As used herein, a fragment of albumin sufficient to prolong the therapeutic activity or plasma stability of the therapeutic protein refers to a fragment of albumin sufficient in length or structure to stabilize or prolong the therapeutic activity or plasma stability of the protein so that the plasma stability of the therapeutic protein portion of the albumin fusion protein is prolonged or extended compared to the plasma stability in the non-fusion state.
The albumin portion of the albumin fusion proteins may comprise the full length of the albumin sequence, or may include one or more fragments thereof that are capable of stabilizing or prolonging the therapeutic activity or plasma stability. Such fragments may be of 10 or more amino acids in length or may include about 15, 20, 25, 30, 50, or more contiguous amino acids from the albumin sequence or may include part or all of specific domains of albumin. For instance, one or more fragments of HSA spanning the first two immunoglobulin-like domains may be used. In a preferred embodiment, the HSA fragment is the mature form of HSA.
Generally speaking, an albumin fragment or variant will be at least 100 amino acids long, preferably at least 150 amino acids long.
According to the disclosure, albumin may be naturally occurring albumin or a fragment or variant thereof. Albumin may be human albumin and may be derived from any vertebrate, especially any mammal. Preferably, the albumin fusion protein comprises albumin as the N-terminal portion, and a therapeutic protein as the C-terminal portion. Alternatively, an albumin fusion protein comprising albumin as the C-terminal portion, and a therapeutic protein as the N-terminal portion may also be used. In other embodiments, the albumin fusion protein has a therapeutic protein fused to both the N-terminus and the C-terminus of albumin. In a preferred embodiment, the therapeutic proteins fused at the N- and C-termini are the same therapeutic proteins. In another preferred embodiment, the therapeutic proteins fused at the N- and C-termini are different therapeutic proteins. In some embodiments, the different therapeutic proteins are both Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof.
In some embodiments, the therapeutic protein(s) is (are) joined to the albumin through (a) peptide linker(s). A peptide linker between the fused portions may provide greater physical separation between the moieties and thus maximize the accessibility of the therapeutic protein portion, for instance, for binding to its cognate receptor. The peptide linker may consist of amino acids such that it is flexible or more rigid. The linker sequence may be cleavable by a protease or chemically.
As used herein, the term "Fc region" refers to the portion of a native immunoglobulin formed by the respective Fc domains (or Fc moieties) of its two heavy chains. As used herein, the term "Fc domain" refers to a portion or fragment of a single immunoglobulin (Ig) heavy chain wherein the Fc domain does not comprise an Fv domain. In certain embodiments, an Fc domain begins in the hinge region just upstream of the papain cleavage site and ends at the C- terminus of the antibody. Accordingly, a complete Fc domain comprises at least a hinge domain, a CH2 domain, and a CH3 domain. In certain embodiments, an Fc domain comprises at least one of: a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, a CH4 domain, or a variant, portion, or fragment thereof. In certain embodiments, an Fc domain comprises a complete Fc domain (i.e., a hinge domain, a CH2 domain, and a CH3 domain). In certain embodiments, an Fc domain comprises a hinge domain (or portion thereof) fused to a CH3 domain (or portion thereof). In certain embodiments, an Fc domain comprises a CH2 domain (or portion thereof) fused to a CH3 domain (or portion thereof). In certain embodiments, an Fc domain consists of a CH3 domain or portion thereof. In certain embodiments, an Fc domain consists of a hinge domain (or portion thereof) and a CH3 domain (or portion thereof). In certain embodiments, an Fc domain consists of a CH2 domain (or portion thereof) and a CH3 domain. In certain embodiments, an Fc domain consists of a hinge domain (or portion thereof) and a CH2 domain (or portion thereof). In certain embodiments, an Fc domain lacks at least a portion of a CH2 domain (e.g., all or part of a CH2 domain). An Fc domain herein generally refers to a polypeptide comprising all or part of the Fc domain of an immunoglobulin heavy-chain. This includes, but is not limited to, polypeptides comprising the entire CHI, hinge, CH2, and/or CH3 domains as well as fragments of such peptides comprising only, e.g., the hinge, CH2, and CH3 domain. The Fc domain may be derived from an immunoglobulin of any species and/or any subtype, including, but not limited to, a human IgGl, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM antibody. The Fc domain encompasses native Fc and Fc variant molecules. As set forth herein, it will be understood by one of ordinary skill in the art that any Fc domain may be modified such that it varies in amino acid sequence from the native Fc domain of a naturally occurring immunoglobulin molecule. In certain embodiments, the Fc domain has reduced effector function (e.g., FcyR binding).
The Fc domains of a polypeptide described herein may be derived from different immunoglobulin molecules. For example, an Fc domain of a polypeptide may comprise a CH2 and/or CH3 domain derived from an IgGl molecule and a hinge region derived from an IgG3 molecule. In another example, an Fc domain can comprise a chimeric hinge region derived, in part, from an IgGl molecule and, in part, from an IgG3 molecule. In another example, an Fc domain can comprise a chimeric hinge derived, in part, from an IgGl molecule and, in part, from an IgG4 molecule. In certain embodiments, an extended-PK group includes an Fc domain or fragments thereof or variants of the Fc domain or fragments thereof (all of which for the purpose of the present disclosure are comprised by the term "Fc domain"). The Fc domain does not contain a variable region that binds to antigen. Fc domains suitable for use in the present disclosure may be obtained from a number of different sources. In certain embodiments, an Fc domain is derived from a human immunoglobulin. In certain embodiments, the Fc domain is from a human IgGl constant region. It is understood, however, that the Fc domain may be derived from an immunoglobulin of another mammalian species, including for example, a rodent (e.g. a mouse, rat, rabbit, guinea pig) or non-human primate (e.g. chimpanzee, macaque) species.
Moreover, the Fc domain (or a fragment or variant thereof) may be derived from any immunoglobulin class, including IgM, IgG, IgD, IgA, and IgE, and any immunoglobulin isotype, including IgGl, IgG2, IgG3, and IgG4.
A variety of Fc domain gene sequences (e.g., mouse and human constant region gene sequences) are available in the form of publicly accessible deposits. Constant region domains comprising an Fc domain sequence can be selected lacking a particular effector function and/or with a particular modification to reduce immunogenicity. Many sequences of antibodies and antibody-encoding genes have been published and suitable Fc domain sequences (e.g. hinge, CH2, and/or CH3 sequences, or fragments or variants thereof) can be derived from these sequences using art recognized techniques.
In certain embodiments, the extended-PK group is a serum albumin binding protein such as those described in US2005/0287153, US2007/0003549, US2007/0178082, US2007/0269422, US2010/0113339, W02009/083804, and W02009/133208, which are herein incorporated by reference in their entirety. In certain embodiments, the extended- PK group is transferrin, as disclosed in US 7,176,278 and US 8,158,579, which are herein incorporated by reference in their entirety. In certain embodiments, the extended-PK group is a serum immunoglobulin binding protein such as those disclosed in US2007/0178082, US2014/0220017, and US2017/0145062, which are herein incorporated by reference in their entirety. In certain embodiments, the extended-PK group is a fibronectin (Fn)-based scaffold domain protein that binds to serum albumin, such as those disclosed in US2012/0094909, which is herein incorporated by reference in its entirety. Methods of making fibronectin-based scaffold domain proteins are also disclosed in US2012/0094909. A non-limiting example of a Fn3-based extended-PK group is Fn3(HSA), i.e., a Fn3 protein that binds to human serum albumin.
In certain aspects, the extended-PK polypeptide, suitable for use according to the disclosure, can employ one or more peptide linkers. As used herein, the term "peptide linker" refers to a peptide or polypeptide sequence which connects two or more domains (e.g., the extended-PK moiety and a polypeptide moiety, e.g., an Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof) in a linear amino acid sequence of a polypeptide chain. For example, peptide linkers may be used to connect an Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof to a HSA domain.
Linkers suitable for fusing the extended-PK group to, e.g., an Mtb antigen, immunogenic variant thereof, or immunogenic fragment of the Mtb antigen or the immunogenic variant thereof are well known in the art and described herein above.
In the following, embodiments of vaccine RNAs are described, wherein certain terms used when describing elements thereof have the following meanings: cap: 5'-cap structure, e.g., selected from the group consisting of m27'2 OG(5')ppSp(5')G (in particular its DI diastereomer), m27'3 OG(5')ppp(5')G, and m27'3 OGppp(mi2' °)ApG. hAg-Kozak: 5'-UTR sequence of the human alpha-globin mRNA with an optimized 'Kozak sequence' to increase translational efficiency. sec/TMD: Fusion-protein tags derived from the sequence encoding the human MHC class I complex (HLA-B51, haplotype A2, B27/B51, Cw2/Cw3), which have been shown to improve antigen processing and presentation. Sec corresponds to the 78 bp fragment coding for the secretory signal peptide, which guides translocation of the nascent polypeptide chain into the endoplasmatic reticulum. The TMD comprises an amino acid sequence enhancing antigen processing and/or presentation. In some embodiments, the TMD comprises a trafficking signal. In some embodiments, the TMD is MITD. MITD corresponds to the transmembrane and cytoplasmic domain of the MHC class I molecule, also called MHC class I trafficking domain.
Antigen: Sequences encoding the respective vaccine antigen(s)/epitope(s), i.e., one or more Mtb antigens, immunogenic variants thereof, or immunogenic fragments of the Mtb antigens or the immunogenic variants thereof.
Glycine-serine linker (GS): Sequences coding for short peptide linkers predominantly consisting of the amino acids glycine (G) and serine (S), as commonly used for fusion proteins.
FI element: The 3'-UTR is a combination of two sequence elements derived from the "amino terminal enhancer of split" (AES) mRNA (called F) and the mitochondrial encoded 12S ribosomal RNA (called I). These were identified by an ex vivo selection process for sequences that confer RNA stability and augment total protein expression.
A30L70: A poly(A)-tail measuring 110 nucleotides in length, consisting of a stretch of 30 adenosine residues, followed by a 10 nucleotide linker sequence and another 70 adenosine residues designed to enhance RNA stability and translational efficiency in dendritic cells.
In some embodiments, vaccine RNA described herein has one of the following structures: cap-hAg-Kozak-Antigen(s)-FI-A30L70 cap-hAg-Kozak-sec-Antigen(s)-FI-A30L70 cap-hAg-Kozak-sec-Antigen(s)-TMD-FI-A30L70
In some embodiments, vaccine antigen described herein has the structure: sec-Antigen sec-Antigen-TMD
In some embodiments, hAg-Kozak comprises the nucleotide sequence of SEQ ID NO: 53. In some embodiments, sec of the encoded vaccine antigen/epitope comprises an amino acid sequence selected from SEQ ID NOs: 17 to 37 or 65 or encoded by the nucleotide sequence selected from SEQ ID NOs: 38 to 51. In some embodiments, the TMD of the encoded vaccine antigen/epitope is MITD comprising the amino acid sequence of SEQ ID NO: 52. In some embodiments, the TMD of the encoded vaccine antigen/epitope is a viral signal peptide, preferably a HSV-1 glycoprotein D signal peptide. In some embodiments, FI comprises the nucleotide sequence of SEQ ID NO: 54. In some embodiments, A30L70 comprises the nucleotide sequence of SEQ ID NO: 55.
In some embodiments, the different elements (sec, Antigen, TMD) may be linked by one or more GS linkers. In some embodiments, a GS linker of the encoded vaccine antigen/epitope comprises the amino acid sequence of SEQ ID NO: 56. In some embodiments, the sequence encoding the vaccine antigen/epitope comprises a modified nucleoside replacing (partially or completely, preferably completely) uridine, wherein the modified nucleoside is selected from the group consisting of pseudouridine (i ), Nl-methyl-pseudouridine (mli ), and 5-methyl-uridine.
In some embodiments, the sequence encoding the vaccine antigen/epitope is codon-optimized.
In some embodiments, the G/C content of the sequence encoding the vaccine antigen/epitope is increased compared to the wild type coding sequence.
In some embodiments, the RNA (in particular, mRNA) described herein comprises: a 5' UTR comprising the nucleotide sequence of SEQ ID NO: 53, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 53; a 3' UTR comprising the nucleotide sequence of SEQ ID NO: 54, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 54; and a poly-A sequence comprising the nucleotide sequence of SEQ ID NO: 55.
In some embodiments, the RNA (in particular, mRNA) described herein comprises: m27'3' °Gppp(mi2' 0) ApG as capping structure at the 5'-end of the mRNA; a 5' UTR comprising the nucleotide sequence of SEQ ID NO: 53, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 53; a 3' UTR comprising the nucleotide sequence of SEQ ID NO: 54, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 54; and a poly-A sequence comprising the nucleotide sequence of SEQ ID NO: 55.
In some embodiments, the RNA is unmodified. In some embodiments, the RNA is modified. In some embodiments, the RNA comprises Nl-methyl-pseudouridine (mli ) in place of at least one uridine (e.g., in place of each uridine).
In some embodiments, the RNA (in particular, mRNA) described herein comprises: m27'3' °Gppp(mi2' 0) ApG as capping structure at the 5'-end of the mRNA; a 5' UTR comprising the nucleotide sequence of SEQ ID NO: 53, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 53; a 3' UTR comprising the nucleotide sequence of SEQ ID NO: 54, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 54; and a poly-A sequence comprising the nucleotide sequence of SEQ ID NO: 55; and
Nl-methyl-pseudouridine (mli ) in place of at least one uridine (e.g., in place of each uridine).
In some embodiments, a vaccine antigen or epitope described herein is derived from Mycobacterium tuberculosis.
In some embodiments, a vaccine antigen or epitope described herein is derived from a Mycobacterium tuberculosis protein, an immunogenic variant thereof, or an immunogenic fragment of the Mycobacterium tuberculosis protein or the immunogenic variant thereof. Thus, in some embodiments, the RNA, e.g., mRNA, used in the present disclosure encodes an amino acid sequence comprising an Mtb protein, an immunogenic variant thereof, or an immunogenic fragment of the Mtb protein or the immunogenic variant thereof.
In some embodiments, a vaccine antigen or epitope described herein is derived from an Mtb protein from the acute phase of the Mtb life cycle, an immunogenic variant thereof, or an immunogenic fragment of the Mtb protein from the acute phase of the Mtb life cycle or the immunogenic variant thereof.
In some embodiments, a vaccine antigen or epitope described herein is derived from an Mtb protein from the latent phase of the Mtb life cycle, an immunogenic variant thereof, or an immunogenic fragment of the Mtb protein from the latent phase of the Mtb life cycle or the immunogenic variant thereof.
In some embodiments, a vaccine antigen or epitope described herein is derived from an Mtb protein from the resuscitation phase of the Mtb life cycle, an immunogenic variant thereof, or an immunogenic fragment of the Mtb protein from the resuscitation phase of the Mtb life cycle or the immunogenic variant thereof.
In some embodiments, RNA (in particular, mRNA) described herein (e.g., contained in the compositions/formulations of the present disclosure and/or used in the methods of the present disclosure) may be presented as a product containing the vaccine RNA as active substance and other ingredients comprising: ALC-0315 ((4- hydroxybutyl)azanediyl)bis(hexane-6,l-diyl)bis(2-hexyldecanoate), ALC-0159 (2-[(polyethylene glycol)-2000]-N,N- ditetradecylacetamide), l,2-Distearoyl-sn-glycero-3-phosphocholine (DSPC), and cholesterol.
In some embodiments, the RNA (in particular, mRNA) described herein is formulated or is to be formulated as a liquid, a solid, or a combination thereof.
In some embodiments, the RNA (in particular, mRNA) described herein is formulated or is to be formulated for injection.
In some embodiments, the RNA (in particular, mRNA) described herein is formulated or is to be formulated for intramuscular administration.
In some embodiments, the RNA (in particular, mRNA) described herein is formulated or is to be formulated as a composition, e.g., a pharmaceutical composition.
In some embodiments, the composition comprises a cationically ionizable lipid.
In some embodiments, the composition comprises a cationically ionizable lipid and one or more additional lipids. In some embodiments, the one or more additional lipids are selected from polymer-conjugated lipids, neutral lipids, and combinations thereof. In some embodiments, the neutral lipids include phospholipids, steroid lipids, and combinations thereof. In some embodiments, the one or more additional lipids are a combination of a polymer-conjugated lipid, a phospholipid, and a steroid lipid.
In some embodiments, the composition comprises a cationically ionizable lipid; a polymer-conjugated lipid which is a PEG-conjugated lipid; cholesterol; and a phospholipid. In some embodiments, the phospholipid is DSPC. In some embodiments, the phospholipid is DOPE.
In some embodiments, the composition comprises a cationically ionizable lipid; a polymer-conjugated lipid which is 2- [(polyethylene glycol)-2000]-N,N-ditetradecylacetamide; cholesterol; and a phospholipid. In some embodiments, the phospholipid is DSPC. In some embodiments, the phospholipid is DOPE.
In some embodiments, the composition comprises a cationically ionizable lipid which is ((4- hydroxybutyl)azanediyl)bis(hexane-6,l-diyl)bis(2-hexyldecanoate); a polymer-conjugated lipid which is 2- [(polyethylene glycol)-2000]-N,N-ditetradecylacetamide; cholesterol; and a phospholipid. In some embodiments, the phospholipid is DSPC. In some embodiments, the phospholipid is DOPE. In some embodiments, at least a portion of (i) the RNA, (ii) the cationically ionizable lipid, and if present, (iii) the one or more additional lipids is present in particles. In some embodiments, the particles are nanoparticles, such as lipid nanoparticles (LNPs).
In some embodiments, the composition, in particular the pharmaceutical composition, is a vaccine.
In some embodiments, the composition, in particular the pharmaceutical composition, further comprises one or more pharmaceutically acceptable carriers, diluents and/or excipients.
In some embodiments, the RNA and/or the composition, in particular the pharmaceutical composition, is/are a component of a kit.
In some embodiments, the kit further comprises instructions for use of the RNA for inducing an immune response against Mycobacterium tuberculosis in a subject.
In some embodiments, the kit further comprises instructions for use of the RNA for therapeutically or prophylactically treating a Mycobacterium tuberculosis infection in a subject.
In some embodiments, the subject is a human.
In some embodiments, the RNA (in particular, mRNA), e.g., RNA encoding vaccine antigen, described in the present disclosure is non-immunogenic. RNA encoding an immunostimulant may be administered according to the present disclosure to provide an adjuvant effect. The RNA encoding an immunostimulant may be standard RNA or non- immunogenic RNA.
Embodiments of Mycobacterium tuberculosis fMtbj antigens
The present disclosure describes Mtb antigens, immunogenic variants thereof, and immunogenic fragments of the Mtb antigens or the immunogenic variants thereof (referred to as "Mtb antigens" herein) and RNA encoding these antigens. Mtb antigens primarily described herein include Wbbll, PPE18 and PE13.
Wbbll
In some embodiments, the Mtb antigen Wbbll comprises the amino acid sequence according to SEQ ID NO: 1. A full- length antigen representing the antigen Wbbll is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 1, whereas an antigen fragment representing the antigen Wbbll is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 1 but which still is able to induce an immune reaction to Wbbll, when delivered to a subject.
An immunogenic variant of the Mtb antigen Wbbll comprises an amino acid sequence which is "immunologically equivalent" to Wbbll and thus, is able to induce an immune reaction to Wbbll, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen Wbbll comprises an amino acid sequence differing from SEQ ID NO: 1 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 1 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen Wbbll is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen Wbbll is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to Wbbll, when delivered to a subject.
In some embodiments, the Mtb antigen Wbbll is encoded by a nucleotide sequence according to SEQ ID NO: 147.
In some embodiments, an immunogenic variant of the Mtb antigen Wbbll is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 147 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
PPE18
In some embodiments, the Mtb antigen PPE18 comprises the amino acid sequence according to SEQ ID NO: 2. A full- length antigen representing the antigen PPE18 is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 2, whereas an antigen fragment representing the antigen PPE18 is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 2 but which still is able to induce an immune reaction to PPE18, when delivered to a subject.
An immunogenic variant of the Mtb antigen PPE18 comprises an amino acid sequence which is "immunologically equivalent" to PPE18 and thus, is able to induce an immune reaction to PPE18, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen PPE18 comprises an amino acid sequence differing from SEQ ID NO: 2 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 2 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen PPE18 is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen PPE18 is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to PPE18, when delivered to a subject.
In some embodiments, the Mtb antigen PPE18 is encoded by a nucleotide sequence according to SEQ ID NO: 148.
In some embodiments, an immunogenic variant of the Mtb antigen PPE18 is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 148 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
PE13
In some embodiments, the Mtb antigen PE13 comprises the amino acid sequence according to SEQ ID NO: 3. In other embodiments, the Mtb antigen PE13 comprises the amino acid sequence according to SEQ ID NO: 4. A full-length antigen representing the antigen PE13 is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 3 or 4, whereas an antigen fragment representing the antigen PE13 is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 3 or 4 but which still is able to induce an immune reaction to PE13, when delivered to a subject.
An immunogenic variant of the Mtb antigen PE13 comprises an amino acid sequence which is "immunologically equivalent" to PE13 and thus, is able to induce an immune reaction to PE13, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen PE13 comprises an amino acid sequence differing from SEQ ID NO: 3 or 4 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 3 or 4 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen PE13 is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen PE13 is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to PE13, when delivered to a subject.
In some embodiments, the Mtb antigen PE13 is encoded by a nucleotide sequence according to SEQ ID NO: 149 or SEQ ID NO: 150.
In some embodiments, an immunogenic variant of the Mtb antigen PE13 is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 149 or SEQ ID NO: 150 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
EsxA
In some embodiments, the Mtb antigen EsxA comprises the amino acid sequence according to SEQ ID NO: 5. A full- length antigen representing the antigen EsxA is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 5, whereas an antigen fragment representing the antigen EsxA is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 5 but which still is able to induce an immune reaction to EsxA, when delivered to a subject.
An immunogenic variant of the Mtb antigen EsxA comprises an amino acid sequence which is "immunologically equivalent" to EsxA and thus, is able to induce an immune reaction to EsxA, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen EsxA comprises an amino acid sequence differing from SEQ ID NO: 5 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 5 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen EsxA is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxA is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxA, when delivered to a subject. EsxA is also called ESAT-6 and both terms are used synonymously herein.
In some embodiments, the Mtb antigen EsxA is encoded by a nucleotide sequence according to SEQ ID NO: 151.
In some embodiments, an immunogenic variant of the Mtb antigen EsxA is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 151 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
EsxB
In some embodiments, the Mtb antigen EsxB comprises the amino acid sequence according to SEQ ID NO: 6. A full- length antigen representing the antigen EsxB is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 6, whereas an antigen fragment representing the antigen EsxB is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 6 but which still is able to induce an immune reaction to EsxB, when delivered to a subject. An immunogenic variant of the Mtb antigen EsxB comprises an amino acid sequence which is "immunologically equivalent" to EsxB and thus, is able to induce an immune reaction to EsxB, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen EsxB comprises an amino acid sequence differing from SEQ ID NO: 6 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 6 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen EsxB is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxB is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxB, when delivered to a subject. EsxB is also called CFP-10 and both terms are used synonymously herein.
In some embodiments, the Mtb antigen EsxB is encoded by a nucleotide sequence according to SEQ ID NO: 152.
In some embodiments, an immunogenic variant of the Mtb antigen EsxB is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 152 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
EsxG
In some embodiments, the Mtb antigen EsxG comprises the amino acid sequence according to SEQ ID NO: 7. A full- length antigen representing the antigen EsxG is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 7, whereas an antigen fragment representing the antigen EsxG is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 7 but which still is able to induce an immune reaction to EsxG, when delivered to a subject.
An immunogenic variant of the Mtb antigen EsxG comprises an amino acid sequence which is "immunologically equivalent" to EsxG and thus, is able to induce an immune reaction to EsxG, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen EsxG comprises an amino acid sequence differing from SEQ ID NO: 7 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 7 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen EsxG is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxG is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxG, when delivered to a subject.
In some embodiments, the Mtb antigen EsxG is encoded by a nucleotide sequence according to SEQ ID NO: 153.
In some embodiments, an immunogenic variant of the Mtb antigen EsxG is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 153 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
EsxH
In some embodiments, the Mtb antigen EsxH comprises the amino acid sequence according to SEQ ID NO: 8. A full- length antigen representing the antigen EsxH is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 8, whereas an antigen fragment representing the antigen EsxH is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 8 but which still is able to induce an immune reaction to EsxH, when delivered to a subject.
An immunogenic variant of the Mtb antigen EsxH comprises an amino acid sequence which is "immunologically equivalent" to EsxH and thus, is able to induce an immune reaction to EsxH, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen EsxH comprises an amino acid sequence differing from SEQ ID NO: 8 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 8 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen EsxH is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxH is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxH, when delivered to a subject.
In some embodiments, the Mtb antigen EsxH is encoded by a nucleotide sequence according to SEQ ID NO: 154.
In some embodiments, an immunogenic variant of the Mtb antigen EsxH is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 154 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
Esxl
In some embodiments, the Mtb antigen Esxl comprises the amino acid sequence according to SEQ ID NO: 9. A full- length antigen representing the antigen Esxl is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 9, whereas an antigen fragment representing the antigen Esxl is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 9 but which still is able to induce an immune reaction to Esxl, when delivered to a subject.
An immunogenic variant of the Mtb antigen Esxl comprises an amino acid sequence which is "immunologically equivalent" to Esxl and thus, is able to induce an immune reaction to Esxl, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen Esxl comprises an amino acid sequence differing from SEQ ID NO: 9 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 9 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen Esxl is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen Esxl is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to Esxl, when delivered to a subject.
In some embodiments, the Mtb antigen Esxl is encoded by a nucleotide sequence according to SEQ ID NO: 155.
In some embodiments, an immunogenic variant of the Mtb antigen Esxl is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 155 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN). EsxJ
In some embodiments, the Mtb antigen EsxJ comprises the amino acid sequence according to SEQ ID NO: 10. A full- length antigen representing the antigen EsxJ is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 10, whereas an antigen fragment representing the antigen EsxJ is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 10 but which still is able to induce an immune reaction to EsxJ, when delivered to a subject.
An immunogenic variant of the Mtb antigen EsxJ comprises an amino acid sequence which is "immunologically equivalent" to EsxJ and thus, is able to induce an immune reaction to EsxJ, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen EsxJ comprises an amino acid sequence differing from SEQ ID NO: 10 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 10 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen EsxJ is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxJ is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxJ, when delivered to a subject.
In some embodiments, the Mtb antigen EsxJ is encoded by a nucleotide sequence according to SEQ ID NO: 156.
In some embodiments, an immunogenic variant of the Mtb antigen EsxJ is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 156 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
EsxK
In some embodiments, the Mtb antigen EsxK comprises the amino acid sequence according to SEQ ID NO: 11. A full- length antigen representing the antigen EsxK is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 11, whereas an antigen fragment representing the antigen EsxK is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 11 but which still is able to induce an immune reaction to EsxK, when delivered to a subject.
An immunogenic variant of the Mtb antigen EsxK comprises an amino acid sequence which is "immunologically equivalent" to EsxK and thus, is able to induce an immune reaction to EsxK, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen EsxK comprises an amino acid sequence differing from SEQ ID NO: 11 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 11 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen EsxK is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxK is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxK, when delivered to a subject.
In some embodiments, the Mtb antigen EsxK is encoded by a nucleotide sequence according to SEQ ID NO: 157. In some embodiments, an immunogenic variant of the Mtb antigen EsxK is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 157 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
EsxL
In some embodiments, the Mtb antigen EsxL comprises the amino acid sequence according to SEQ ID NO: 12. A full- length antigen representing the antigen EsxL is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 12, whereas an antigen fragment representing the antigen EsxL is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 12 but which still is able to induce an immune reaction to EsxL, when delivered to a subject.
An immunogenic variant of the Mtb antigen EsxL comprises an amino acid sequence which is "immunologically equivalent" to EsxL and thus, is able to induce an immune reaction to EsxL, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen EsxL comprises an amino acid sequence differing from SEQ ID NO: 12 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 12 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen EsxL is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxL is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxL, when delivered to a subject.
In some embodiments, the Mtb antigen EsxL is encoded by a nucleotide sequence according to SEQ ID NO: 158.
In some embodiments, an immunogenic variant of the Mtb antigen EsxL is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 158 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
EsxM
In some embodiments, the Mtb antigen EsxM comprises the amino acid sequence according to SEQ ID NO: 13. A full- length antigen representing the antigen EsxM is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 13, whereas an antigen fragment representing the antigen EsxM is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 13 but which still is able to induce an immune reaction to EsxM, when delivered to a subject.
An immunogenic variant of the Mtb antigen EsxM comprises an amino acid sequence which is "immunologically equivalent" to EsxM and thus, is able to induce an immune reaction to EsxM, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen EsxM comprises an amino acid sequence differing from SEQ ID NO: 13 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 13 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen EsxM is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxM is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxM, when delivered to a subject.
In some embodiments, the Mtb antigen EsxM is encoded by a nucleotide sequence according to SEQ ID NO: 159.
In some embodiments, an immunogenic variant of the Mtb antigen EsxM is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 159 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
EsxN
In some embodiments, the Mtb antigen EsxN comprises the amino acid sequence according to SEQ ID NO: 14. A full- length antigen representing the antigen EsxN is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 14, whereas an antigen fragment representing the antigen EsxN is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 14 but which still is able to induce an immune reaction to EsxN, when delivered to a subject.
An immunogenic variant of the Mtb antigen EsxN comprises an amino acid sequence which is "immunologically equivalent" to EsxN and thus, is able to induce an immune reaction to EsxN, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen EsxN comprises an amino acid sequence differing from SEQ ID NO: 14 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 14 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen EsxN is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxN is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxN, when delivered to a subject.
In some embodiments, the Mtb antigen EsxN is encoded by a nucleotide sequence according to SEQ ID NO: 160.
In some embodiments, an immunogenic variant of the Mtb antigen EsxN is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 160 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
EsxV
In some embodiments, the Mtb antigen EsxV comprises the amino acid sequence according to SEQ ID NO: 15. A full- length antigen representing the antigen EsxV is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 15, whereas an antigen fragment representing the antigen EsxV is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 15 but which still is able to induce an immune reaction to EsxV, when delivered to a subject.
An immunogenic variant of the Mtb antigen EsxV comprises an amino acid sequence which is "immunologically equivalent" to EsxV and thus, is able to induce an immune reaction to EsxV, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen EsxV comprises an amino acid sequence differing from SEQ ID NO: 15 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 15 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen EsxV is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxV is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxV, when delivered to a subject.
In some embodiments, the Mtb antigen EsxV is encoded by a nucleotide sequence according to SEQ ID NO: 161.
In some embodiments, an immunogenic variant of the Mtb antigen EsxV is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 161 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
EsxW
In some embodiments, the Mtb antigen EsxW comprises the amino acid sequence according to SEQ ID NO: 16. A full- length antigen representing the antigen EsxW is characterized in that it comprises the full-length amino acid sequence according to SEQ ID NO: 16, whereas an antigen fragment representing the antigen EsxW is characterized in that it comprises an amino acid sequence which is only a part of SEQ ID NO: 16 but which still is able to induce an immune reaction to EsxW, when delivered to a subject.
An immunogenic variant of the Mtb antigen EsxW comprises an amino acid sequence which is "immunologically equivalent" to EsxW and thus, is able to induce an immune reaction to EsxW, when delivered to a subject. In some embodiments, an immunogenic variant of the Mtb antigen EsxW comprises an amino acid sequence differing from SEQ ID NO: 16 by one or more deletions, insertions or substitutions in the amino acid sequence while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 16 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). A full-length antigen representing an immunogenic variant of the antigen EsxW is characterized in that it comprises the full-length amino acid sequence of the immunogenic variant, whereas an antigen fragment representing an immunogenic variant of the antigen EsxW is characterized in that it comprises an amino acid sequence which is only a part of the full-length amino acid sequence of the immunogenic variant but which still is able to induce an immune reaction to EsxW, when delivered to a subject.
In some embodiments, the Mtb antigen EsxW is encoded by a nucleotide sequence according to SEQ ID NO: 162.
In some embodiments, an immunogenic variant of the Mtb antigen EsxW is encoded by a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 162 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
In some embodiments, amino acid sequences described herein comprise a secretory signal peptide as described herein above.
Strings
In some embodiments, the chimeric protein (also referred to as "string" herein) comprises one or more Mtb antigens and antigen fragments described above.
In some embodiments, the chimeric protein (named "string 1") comprises Wbbll, PPE18 and PE13. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PPE18 and PE13 and WbbLl as full- length antigen. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, three antigen fragments of PPE18, and a full-length antigen of WbbLl. In some embodiments, the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 57 or an amino acid sequence that differs from SEQ ID NO: 57 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 57 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). In some embodiments, the chimeric protein as shown in SEQ ID NO: 57 is modified with respect to the signal peptide, transmembrane domains and/or linkers. In some embodiments, the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of SEQ ID NO: 163 or 164 or a nucleotide that differs from SEQ ID NO: 163 or 164 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 163 or 164 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
In some embodiments, the chimeric protein (named "string 2") comprises EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises an antigen fragment of EsxJ and full length antigens of EsxG, EsxH, Esxl, EsxN and EsxW. In some embodiments, the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 59 or an amino acid sequence that differs from SEQ ID NO: 59 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 59 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). In some embodiments, the chimeric protein as shown in SEQ ID NO: 59 is modified with respect to the signal peptide, transmembrane domains and/or linkers. In some embodiments, the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of SEQ ID NO: 165 or 166 or a nucleotide that differs from SEQ ID NO: 165 or 166 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 165 or 166 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
In some embodiments, the chimeric protein (named "string 3") comprises EsxB, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises an antigen fragment of EsxB, an antigen fragment of EsxJ and full length antigens of EsxG, EsxH, Esxl, EsxN and EsxW. In some embodiments, the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 58 or an amino acid sequence that differs from SEQ ID NO: 58 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 58 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). In some embodiments, the chimeric protein as shown in SEQ ID NO: 58 is modified with respect to the signal peptide, transmembrane domains and/or linkers. In some embodiments, the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of SEQ ID NO: 167 or 168 or a nucleotide that differs from SEQ ID NO: 167 or 168 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 167 or 168 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
In some embodiments, the chimeric protein (named "string 4") comprises PE13, PPE18, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PPE18, PE13, EsxJ and EsxN and full length antigens of Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, three antigen fragments of PPE18, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of Esxl and EsxW. In some embodiments, the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 60 or 61 or an amino acid sequence that differs from SEQ ID NO: 60 or 61 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 60 or 61 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). In some embodiments, the chimeric protein as shown in SEQ ID NO: 60 or 61 is modified with respect to the signal peptide, transmembrane domains and/or linkers. In some embodiments, the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of any one of SEQ ID NOs: 169 to 172 or a nucleotide that differs from SEQ ID NOs: 169 to 172 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to any one of SEQ ID NOs: 169 to 172 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
In some embodiments, the chimeric protein (named "string 5") comprises PE13, PPE18, EsxG, EsxJ, and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PPE18, PE13 and EsxJ and full length antigens of EsxG and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, three antigen fragments of PPE18, one antigen fragment of EsxJ and full length antigens of EsxG and EsxW. In some embodiments, the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 62 or 66 or an amino acid sequence that differs from SEQ ID NO: 62 or 66 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 62 or 66 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). In some embodiments, the chimeric protein as shown in SEQ ID NO: 62 or 66 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
In some embodiments, the chimeric protein (named "string 6") comprises PE13, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, EsxJ and EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW. In some embodiments, the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 63 or 67 or an amino acid sequence that differs from SEQ ID NO: 63 or 67 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 63 or 67 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). In some embodiments, the chimeric protein as shown in SEQ ID NO: 63 or 67 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
In some embodiments, the chimeric protein (named "string 7") comprises PE13, EsxA, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, EsxA, EsxJ and EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, two antigen fragments of EsxA, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW. In some embodiments, the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 64 or 68 or an amino acid sequence that differs from SEQ ID NO: 64 or 68 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 64 or 68 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). In some embodiments, the chimeric protein as shown in SEQ ID NO: 64 or 68 is modified with respect to the signal peptide, transmembrane domains and/or linkers.
In some embodiments, the chimeric protein (named "string 8") comprises PE13, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, EsxJ and EsxN and full length antigens of Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of Esxl and EsxW. In some embodiments, the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 173 or 174 or an amino acid sequence that differs from SEQ ID NO: 173 or 174 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 173 or 174 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). In some embodiments, the chimeric protein as shown in SEQ ID NO: 173 or 174 is modified with respect to the signal peptide, transmembrane domains and/or linkers. In some embodiments, the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of SEQ ID NO: 175 or 176 or a nucleotide that differs from SEQ ID NO: 175 or 176 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 175 or 176 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
In some embodiments, the chimeric protein (named "string 9") comprises PE13, PPE18, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, PPE18, EsxJ and EsxN and full length antigens of Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, two antigen fragments of PPE18, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of Esxl and EsxW. In some embodiments, the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 177 or 178 or an amino acid sequence that differs from SEQ ID NO: 177 or 178 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 177 or 178 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). In some embodiments, the chimeric protein as shown in SEQ ID NO: 177 or 178 is modified with respect to the signal peptide, transmembrane domains and/or linkers. In some embodiments, the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of SEQ ID NO: 179 or 180 or a nucleotide that differs from SEQ ID NO: 179 or 180 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 179 or 180 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
In some embodiments, the chimeric protein (named "string 10" or "string 10_R") comprises PE13, PPE18, EsxG, Esxl and EsxN. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, PPE18 and EsxN and full length antigens of EsxG and Esxl. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, three antigen fragments of PPE18, one antigen fragment of EsxN and full length antigens of EsxG and Esxl. In some embodiments, the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 141 or 142 or an amino acid sequence that differs from SEQ ID NO: 141 or 142 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 141 or 142 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). In some embodiments, the chimeric protein as shown in SEQ ID NO: 141 or 142 is modified with respect to the signal peptide, transmembrane domains and/or linkers. In some embodiments, the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of any one of SEQ ID NO: 181 to 192 or a nucleotide that differs from SEQ ID NO: 181 to 192 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 181 to 192 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
In some embodiments, the chimeric protein (named "string 11" or "string 11_R") comprises PE13, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, EsxJ and EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW. In some embodiments, the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 143 or 144 or an amino acid sequence that differs from SEQ ID NO: 143 or 144 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 143 or 144 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). In some embodiments, the chimeric protein as shown in SEQ ID NO: 143 or 144 is modified with respect to the signal peptide, transmembrane domains and/or linkers. In some embodiments, the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of any one of SEQ ID NO: 193 to 204 or a nucleotide that differs from SEQ ID NO: 193 to 204 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 193 to 204 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
In some embodiments, the chimeric protein (named "string 12" or "string 12_R") comprises PE13, EsxA, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW. In some embodiments, the chimeric protein comprises one or more antigenic fragments of PE13, EsxA, EsxJ and EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW. In some embodiments, the chimeric protein comprises two antigen fragments of PE13, two antigen fragments of EsxA, one antigen fragment of EsxJ, one antigen fragment of EsxN and full length antigens of EsxG, EsxH, Esxl and EsxW. In some embodiments, the chimeric protein comprises an amino acid sequence with the sequence of SEQ ID NO: 145 or 146 or an amino acid sequence that differs from SEQ ID NO: 145 or 146 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 145 or 146 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTP). In some embodiments, the chimeric protein as shown in SEQ ID NO: 145 or 146 is modified with respect to the signal peptide, transmembrane domains and/or linkers. In some embodiments, the chimeric protein is encoded by a nucleic acid molecule comprising a nucleotide sequence with the sequence of any one of SEQ ID NO: 205 to 216 or a nucleotide that differs from SEQ ID NO: 205 to 216 by one or more deletions, insertions or substitutions while having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to SEQ ID NO: 205 to 216 (e.g. determined by sequence alignment using known sequence alignment algorithms such as BLASTN).
able 4: Native amino acid and nucleotide sequences of Mycobacterium tuberculosis antigens used ccgcaggccgcggtgcagcgctaccccaacgtgcggctgctgcccacaggggccaacctcgggtacggaaccgcggtgaatcggacgatcgcccagctcggtgaaatggcgggcgat gccggcgaaccctgggtcgatgactgggtgatcgtggccaacccggacgtgcaatggggcccgggcagtatcgatgcactactggacgccgcctcccgctggccccgcgcgggcgcgc tgggcccgctgattcgggaccccgacgggtcggtgtacccgtcggcgcggcagatgcccagcctgatccgcggcggcatgcacgcagtgctcgggccgttctggccgcgcaatccgtgg acgacggcctaccggcaggagcggctggagcccagtgaacggccggtgggttggttgtcggggtcttgcctactggtgcgccggtcggcgtttggccaggtcggcggattcgacgaacg ttacttcatgtacatggaggacgtcgaccttggcgaccggcttggcaaagccggttggctgtcggtgtatgtgccgtcagccgaggttctgcaccacaaggcgcattcgacgggtcgcgac ccggcaagccatctggccgcccatcacaaaagcacctatatcttcttagccgaccgacattctggttggtggcgggctccgctgcgctggaccctgcggggatcactggcgctgcgttccca cctcatggtgcgcagttcactgcgcaggtcccgcagacggaaactgaagctggtagaagggcggcactga [SEQ ID NO: 147]
MVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSWWGLTVGSWIGSSAGLMVAAASPYVAWMSVTAGQAELTAAQVRVA AAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAEYGEMWAQDAAAMFGYAAATATATATLLPFEEAPEMTSAGGLLEQAAAVEEA SDTAAANQLMNNVPQALQQLAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQTAAQN GVRAMSSLGSSLGSSGLGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAERGPGQMLGGLPVGQMGARAGGGLSGVLRVPP RPYVMPHSPAAG [SEQ ID NO: 2] atggtggatttcggggcgttaccaccggagatcaactccgcgaggatgtacgccggcccgggttcggcctcgctggtggccgcggctcagatgtgggacagcgtggcgagtgacctgttt
PPE18 tcggccgcgtcggcgtttcagtcggtggtctggggtctgacggtggggtcgtggataggttcgtcggcgggtctgatggtggcggcggcctcgccgtatgtggcgtggatgagcgtcacc gcggggcaggccgagctgaccgccgcccaggtccgggttgctgcggcggcctacgagacggcgtatgggctgacggtgcccccgccggtgatcgccgagaaccgtgctgaactgatg attctgatagcgaccaacctcttggggcaaaacaccccggcgatcgcggtcaacgaggccgaatacggcgagatgtgggcccaagacgccgccgcgatgtttggctacgccgcggcga cggcgacggcgacggcgacgttgctgccgttcgaggaggcgccggagatgaccagcgcgggtgggctcctcgagcaggccgccgcggtcgaggaggcctccgacaccgccgcggcg aaccagttgatgaacaatgtgccccaggcgctgcaacagctggcccagcccacgcagggcaccacgccttcttccaagctgggtggcctgtggaagacggtctcgccgcatcggtcgccg atcagcaacatggtgtcgatggccaacaaccacatgtcgatgaccaactcgggtgtgtcgatgaccaacaccttgagctcgatgttgaagggctttgctccggcggcggccgcccaggcc gtgcaaaccgcggcgcaaaacggggtccgggcgatgagctcgctgggcagctcgctgggttcttcgggtctgggcggtggggtggccgccaacttgggtcgggcggcctcggtcggttc gttgtcggtgccgcaggcctgggccgcggccaaccaggcagtcaccccggcggcgcgggcgctgccgctgaccagcctgaccagcgccgcggaaagagggcccgggcagatgctgg gcgggctgccggtggggcagatgggcgccagggccggtggtgggctcagtggtgtgctgcgtgttccgccgcgaccctatgtgatgccgcattctccggcggccggctag [SEQ ID NO: 148]
Antigen Amino acid sequence / nucleotide sequence
MSFVMAYPEMLAAAADTLQSIGATTVASNAAAAAPTTGWPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAA AAS [SEQ ID NO: 3] or MHVSFVMAYPEMLAAAADTLQSIGATTVASNAAAAAPTTGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVAN AAAAS [SEQ ID NO: 4]
PE13 gtgtctttcgtgatggcatacccagagatgttggcggcggcggctgacaccctgcagagcatcggtgctaccactgtggctagcaatgccgctgcggcggccccgacgactggggtggtg ccccccgctgccgatgaggtgtcggcgctgactgcggcgcacttcgccgcacatgcggcgatgtatcagtccgtgagcgctcgggctgctgcgattcatgaccagttcgtggccacccttgc cagcagcgccagctcgtatgcggccactgaagtcgccaatgcggcggcggccagctaa [SEQ ID NO: 149] or gtgcacgtgtctttcgtgatggcatacccagagatgttggcggcggcggctgacaccctgcagagcatcggtgctaccactgtggctagcaatgccgctgcggcggccccgacgactggg gtggtgccccccgctgccgatgaggtgtcggcgctgactgcggcgcacttcgccgcacatgcggcgatgtatcagtccgtgagcgctcgggctgctgcgattcatgaccagttcgtggcca cccttgccagcagcgccagctcgtatgcggccactgaagtcgccaatgcggcggcggccagctaa [SEQ ID NO: 150]
MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMF A [SEQ ID NO: 5] EsxA atgacagagcagcagtggaatttcgcgggtatcgaggccgcggcaagcgcaatccagggaaatgtcacgtccattcattccctccttgacgaggggaagcagtccctgaccaagctcgc agcggcctggggcggtagcggttcggaggcgtaccagggtgtccagcaaaaatgggacgccacggctaccgagctgaacaacgcgctgcagaacctggcgcggacgatcagcgaag ccggtcaggcaatggcttcgaccgaaggcaacgtcactgggatgttcgcatag [SEQ ID NO: 151]
MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAWRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQAL SSQMGF [SEQ ID NO: 6]
EsxB atggcagagatgaagaccgatgccgctaccctcgcgcaggaggcaggtaatttcgagcggatctccggcgacctgaaaacccagatcgaccaggtggagtcgacggcaggttcgttgc agggccagtggcgcggcgcggcggggacggccgcccaggccgcggtggtgcgcttccaagaagcagccaataagcagaagcaggaactcgacgagatctcgacgaatattcgtcag gccggcgtccaatactcgagggccgacgaggagcagcagcaggcgctgtcctcgcaaatgggcttctga [SEQ ID NO: 152]
MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYT GF [SEQ ID NO: 7]
EsxG atgagccttttggatgctcatatcccacagttggtggcctcccagtcggcgtttgccgccaaggcggggctgatgcggcacacgatcggtcaggccgagcaggcggcgatgtcggctcag gcgtttcaccagggggagtcgtcggcggcgtttcaggccgcccatgcccggtttgtggcggcggccgccaaagtcaacaccttgttggatgtcgcgcaggcgaatctgggtgaggccgcc ggtacctatgtggccgccgatgctgcggccgcgtcgacctataccgggttctga [SEQ ID NO: 153]
Antigen Amino acid sequence / nucleotide sequence
MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEA AKWGG [SEQ ID NO: 8]
EsxH atgtcgcaaatcatgtacaactaccccgcgatgttgggtcacgccggggatatggccggatatgccggcacgctgcagagcttgggtgccgagatcgccgtggagcaggccgcgttgca gagtgcgtggcagggcgataccgggatcacgtatcaggcgtggcaggcacagtggaaccaggccatggaagatttggtgcgggcctatcatgcgatgtccagcacccatgaagccaac accatggcgatgatggcccgcgacacggccgaagccgccaaatggggcggctag [SEQ ID NO: 154]
MTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSW
A [SEQ ID NO: 9]
Esxl atgaccatcaactatcaattcggggacgtcgacgctcacggcgccatgatccgcgctcaggccgggtcgctggaggccgagcatcaggccatcatttctgatgtgttgaccgcgagtgact tttggggcggcgccggttcggcggcctgccaggggttcattacccagctgggccgtaacttccaggtgatctacgagcaggccaacgcccacgggcagaaggtgcaggctgccggcaac aacatggcacaaaccgacagcgccgtcggctccagctgggcctaa [SEQ ID NO: 155] MASRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQA
SQQILSS [SEQ ID NO: 10]
EsxJ atggcctcgcgttttatgacggatccgcacgcgatgcgggacatggcgggccgttttgaggtgcacgcccagacggtggaggacgaggctcgccggatgtgggcgtccgcgcaaaacat ctcgggcgcgggctggagtggcatggccgaggcgacctcgctagacaccatgacccagatgaatcaggcgtttcgcaacatcgtgaacatgctgcacggggtgcgtgacgggctggttc gcgacgccaacaactacgaacagcaagagcaggcctcccagcagatcctcagcagctga [SEQ ID NO: 156]
MASRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMAQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQA SQQILSS [SEQ ID NO: 11]
EsxK atggcctcacgttttatgacggatccgcacgcgatgcgggacatggcgggccgttttgaggtgcacgcccagacggtggaggacgaggctcgccggatgtgggcgtccgcgcaaaacat ttccggtgcgggctggagtggcatggccgaggcgacctcgctagacaccatggcccagatgaatcaggcgtttcgcaacatcgtgaacatgctgcacggggtgcgtgacgggctggttc gcgacgccaacaactacgagcagcaagagcaggcctcccagcagatcctcagcagctaa [SEQ ID NO: 157]
Amino acid nucleotide
MTINYQFGDVDAHGAMIRAQAGLLEAEHQAIIRDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSW
A [SEQ ID NO: 12]
EsxL atgaccatcaactatcaattcggggatgtcgacgctcacggcgccatgatccgcgctcaggccgggttgctggaggccgagcatcaggccatcattcgtgatgtgttgaccgcgagtgact tttggggcggcgccggttcggcggcctgccaggggttcattacccagttgggccgtaacttccaggtgatctacgagcaggccaacgcccacgggcagaaggtgcaggctgccggcaac aacatggcgcaaaccgacagcgccgtcggctccagctgggcctga [SEQ ID NO: 158]
MASRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMT+MNQAFRNIVNMLHGVRDGLVRDANNYEQQEQA SQQILSS [SEQ ID NO: 13]
EsxM atggcctcacgttttatgacggatccgcatgcgatgcgggacatggcgggccgttttgaggtgcacgcccagacggtggaggacgaggctcgccggatgtgggcgtccgcgcaaaacat ttccggtgcgggctggagtggcatggccgaggcgacctcgctagacaccatgacctagatgaatcaggcgtttcgcaacatcgtgaacatgctgcacggggtgcgtgacgggctggttcg cgacgccaacaactacgaacagcaagagcaggcctcccagcagatcctgagcagctag [SEQ ID NO: 159]
MTINYQFGDVDAHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSW A [SEQ ID NO: 14]
EsxN atgacgattaattaccagttcggggacgtcgacgctcatggcgccatgatccgcgctcaggcggcgtcgcttgaggcggagcatcaggccatcgttcgtgatgtgttggccgcgggtgact tttggggcggcgccggttcggtggcttgccaggagttcattacccagttgggccgtaacttccaggtgatctacgagcaggccaacgcccacgggcagaaggtgcaggctgccggcaac aacatggcgcaaaccgacagcgccgtcggctccagctgggcctaa [SEQ ID NO: 160]
MTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSW A [SEQ ID NO: 15]
EsxV atgaccatcaactatcaattcggggacgtcgacgctcacggcgccatgatccgcgctcaggccgggtcgctggaggccgagcatcaggccatcatttctgatgtgttgaccgcgagtgact tttggggcggcgccggttcggcggcctgccaggggttcattacccagctgggccgtaacttccaggtgatctacgagcaggccaacgcccacgggcagaaggtgcaggctgccggcaac aacatggcacaaaccgacagcgccgtcggctccagctgggcctaa [SEQ ID NO: 161]
Amino acid nucleotide
MTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQA SQQILSS [SEQ ID NO: 16]
EsxW atgacctcgcgttttatgacggatccgcacgcgatgcgggacatggcgggccgttttgaggtgcacgcccagacggtggaggacgaggctcgccggatgtgggcgtccgcgcaaaacat ttccggcgcgggctggagtggcatggccgaggcgacctcgctagacaccatgacccagatgaatcaggcgtttcgcaacatcgtgaacatgctgcacggggtgcgtgacgggctggttc gcgacgccaacaactacgaacagcaagagcaggcctcccagcagatcctcagcagctga [SEQ ID NO: 162] able 5: Amino acid sequences of exemplary chimeric proteins
Chimeric . . . prot .e .in Amino acid sequence
MGGAAARLGAVILFWIVGLHGVRGMHMSFVMAYPEMLAAAADTLQSIGATTVAGGSGGGGSGGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAERGPGQ
MLGGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAGGGSGGGGSGGWAVTYSPGPHLERFLASLSLATERPVSVLLADNGSTDGTPQAAVQRYPNVRLLPTGANLGYGTAVNR
TIAQLGEMAGDAGEPWVDDWVIVANPDVQWGPGSIDALLDAASRWPRAGALGPLIRDPDGSVYPSARQMPSLIRGGMHAVLGPFWPRNPWTTAYRQERLEPSERPVGWLSGSCL
String 1 LVRRSAFGQVGGFDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKAHSTGRDPASHLAAHHKSTYIFLADRHSGWWRAPLRWTLRGSLALRSHLMVRSSLRRSRRRKLKLV
EGRHGGSGGGGSGGAAVEEASDTAAANQLMNNVPQALQQLAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQTAAQN
GVRAMSSLGSSLGGSGGGGSGGWPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAASGGSGGGGSGGMVDFGALPPEINSARMYAGPGSA SLVAAAQMWDSVASDLFSAASAFQSWWGLTVGSWIGSSAGLMVAAASPYVAWMSVTAGQAELTAAQVRVAAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAE YGEMWAQDAAAMFGYGGSGGGGSGGIVGIVAGLAVLAVWIGAWATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA* [SEQ ID NO: 57]
MGGAAARLGAVILFWIVGLHGVRGMSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAA
STYTGFGGSGGGGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSG
_ . ? GGGSGGMSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGGGGSGGGGS btring z GGMASRFMTDPHAMRDGGSGGGGSGGMTINYQFGDVDAHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTD
SAVGSSWAGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQ
QILSSGGSGGGGSGGIVGIVAGLAVLAWVIGAWATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA* [SEQ ID NO: 59]
MGGAAARLGAVILFVVIVGLHGVRGMAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADGGS GGGGSGGMSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGFGGSGGGGSGGM TINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGMSQIMYNYPA
String 3 MLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGGGGSGGGGSGGMASRFMTDPHAMRD
GGSGGGGSGGMTINYQFGDVDAHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSG GMTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGIVG IVAGLAVLAVWIGAVVATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA* [SEQ ID NO: 58]
Chim . e . ric A .m .ino ac .id . sequence protein
MGGAAARLGAVILFVVIVGLHGVRGMSFVMAYPEMLAAAADTLQSIGATTVAGGSGGGGSGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAERGPGQMLGG LPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAGGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIV NMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGGAAVEEASDTAAANQLMNNVPQALQQLAQPTQGTTPSSKLGGLWKTVSP String 4 HRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQTAAQNGVRAMSSLGSSLGGSGGGGSGGWPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATL
(HSV-TMD) ASSASSYAATEVANAAAGGSGGGGSGGMVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSWWGLTVGSWIGSSAGLMVAAASPYVAWMSVTAGQAELTA
AQVRVAAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAEYGEMWAQDAAAMFGYGGSGGGGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTAS DFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGVDAHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQL GRNFQVIYEQGGSGGGGSGGGLIAGAVGGSLLAALVICGIVYWMRRHTQKAPKRIRLPHIR* [SEQ ID NO: 60]
MGGAAARLGAVILFVVIVGLHGVRGMSFVMAYPEMLAAAADTLQSIGATTVAGGSGGGGSGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAERGPGQMLGG
LPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAGGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIV
NMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGGAAVEEASDTAAANQLMNNVPQALQQLAQPTQGTTPSSKLGGLWKTVSP
String 4 HRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQTAAQNGVRAMSSLGSSLGGSGGGGSGGWPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATL
(MITD) ASSASSYAATEVANAAAGGSGGGGSGGMVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSWWGLTVGSWIGSSAGLMVAAASPYVAWMSVTAGQAELTA
AQVRVAAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAEYGEMWAQDAAAMFGYGGSGGGGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTAS DFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGVDAHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQL GRNFQVIYEQGGSGGGGSGGIVGIVAGLAVLAWVIGAWATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA* [SEQ ID NO: 61]
MGGAAARLGAVILFVVIVGLHGVRGMHVSFVMAYPEMLAAAADTLQSIGATTVAGGSGGGGSGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAERGPGQML
GGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAGGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFR
NIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGMSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVA
String 5 QANLGEAAGTYVAADAAAASTYTGFGGSGGGGSGGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGGGGSGGAAVEEASDTAAA
(HSV-TMD) NQLMNNVPQALQQLAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQTAAQNGVRAMSSLGSSLGGSGGGGSGGMASR
FMTDPHAMRDGGSGGGGSGGMVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSWWGLTVGSWIGSSAGLMVAAASPYVAWMSVTAGQAELTAAQVRV
AAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAEYGEMWAQDAAAMFGYGGSGGGGSGGGLIAGAVGGSLLAALVICGIVYWMRRHTQKAPKRIRLPHIR* [SEQ ID NO: 62]
MGGAAARLGAVILFVVIVGLHGVRGMHVSFVMAYPEMLAAAADTLQSIGATTVAGGSGGGGSGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAERGPGQML GGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAGGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFR NIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGMSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVA String 5 QANLGEAAGTYVAADAAAASTYTGFGGSGGGGSGGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGGGGSGGAAVEEASDTAAA
(MITD) NQLMNNVPQALQQLAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQTAAQNGVRAMSSLGSSLGGSGGGGSGGMASR
FMTDPHAMRDGGSGGGGSGGMVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSWWGLTVGSWIGSSAGLMVAAASPYVAWMSVTAGQAELTAAQVRV AAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAEYGEMWAQDAAAMFGYGGSGGGGSGGIVGIVAGLAVLAWVIGAVVATVMCRRKSSGGKGGSYSQAASSDS AQGSDVSLTA* [SEQ ID NO: 66]
Chim . e . ric A .m .ino ac .id . sequence protein
MGGAAARLGAVILFVVIVGLHGVRGMHVSFVMAYPEMLAAAADTLQSIGATTVAGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMA
EATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGMSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAH
Strinq 6 ARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGFGGSGGGGSGGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGG rucv TMm GGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGVDAH
(HSV-TMD) GAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGGMSQIMYNYPAMLGHAGDMAGYAGTL
QSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGGGGSGGGGSGGGLIAGAVGGSLLAALVICGIVYWMRRHTQKA
PKRIRLPHIR* [SEQ ID NO: 63]
MGGAAARLGAVILFVVIVGLHGVRGMHVSFVMAYPEMLAAAADTLQSIGATTVAGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMA
EATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGMSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAH
Strinq 6 ARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGFGGSGGGGSGGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGG
GGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGVDAH
(MITD) GAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGGMSQIMYNYPAMLGHAGDMAGYAGTL
QSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGGGGSGGGGSGGIVGIVAGLAVLAWVIGAWATVMCRRKSSG GKGGSYSQAASSDSAQGSDVSLTA* [SEQ ID NO: 67]
MGGAAARLGAVILFVVIVGLHGVRGMHVSFVMAYPEMLAAAADTLQSIGATTVAGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMA
EATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGMSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAH
ARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGFGGSGGGGSGGHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQNLARTISEAGQGGSGGG
String 7 GSGGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGGGGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWG
(HSV-TMD) GAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSGGSGGGGSGGVDAHGA
MIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGGMSQIMYNYPAMLGHAGDMAGYAGTLQS LGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGGGGSGGGGSGGGLIAGAVGGSLLAALVICGIVYWMRRHTQKAPK RIRLPHIR* [SEQ ID NO: 64]
MGGAAARLGAVILFVVIVGLHGVRGMHVSFVMAYPEMLAAAADTLQSIGATTVAGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMA EATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGMSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAH ARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGFGGSGGGGSGGHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQNLARTISEAGQGGSGGG String 7 GSGGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGGGGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWG
(MITD) GAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSGGSGGGGSGGVDAHGA
MIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGGMSQIMYNYPAMLGHAGDMAGYAGTLQS LGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGGGGSGGGGSGGIVGIVAGLAVLAWVIGAWATVMCRRKSSGGK GGSYSQAASSDSAQGSDVSLTA* [SEQ ID NO: 68]
NYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGVDAHGAMIRAQA
ASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGG [SEQ ID NO: 173]
MGGAAARLGAVILFWIVGLHGVRGDYKDDDDKVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGGGGSGGMTSRFMTDPHAMR
DMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGMHVSFVMAYPEMLAAAA
String 8 (I) DTLQSIGATTVAGGSGGGGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSS
WAGGSGGGGSGGVDAHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGGIVGIVAGLA VLAVWIGAVVATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA— [SEQ ID NO: 174]
DYKDDDDKWPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASA
QNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGAAVEEASDTAAANQLMNNVPQALQQLAQPTQGTTPSSKLGGL
WKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQTAAQNGVRAMSSLGSSLGGSGGGGSGGMHVSFVMAYPEMLAAAADTLQSIGATTVAGGSGG
GGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGVDAH
GAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGGGVAANLGRAASVGSLSVPQAWAAAN
QAVTPAARALPLTSLTSAAERGPGQMLGGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAGGGSGGGGSGG [SEQ ID NO: 177]
MGGAAARLGAVILFWIVGLHGVRGDYKDDDDKVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGGGGSGGMTSRFMTDPHAMR DMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGAAVEEASDTAAANQLMN NVPQALQQLAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQTAAQNGVRAMSSLGSSLGGSGGGGSGGMHVSFVMAY String 9 (I) PEMLAAAADTLQSIGATTVAGGSGGGGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQ
TDSAVGSSWAGGSGGGGSGGVDAHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGG GVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAERGPGQMLGGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAGGGSGGGGSGGIVGIVAGLAVLAWVIGA WATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA [SEQ ID NO: 178]
Chim . e . ric A .m .ino ac .id . sequence protein
MGGAAARLGAVILFWIVGLHGVRGWPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGGGGSGGGVAANLGRAASVGSLSVPQAWA
AANQAVTPAARALPLTSLTSAAERGPGQMLGGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAGGGSGGGGSGGVDAHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGS
VACQEFITQLGRNFQVIYEQGGSGGGGSGGMSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAA
St no 10 DAAAASTYTGFGGSGGGGSGGMHVSFVMAYPEMLAAAADTLQSIGATTVAGGSGGGGSGGAAVEEASDTAAANQLMNNVPQALQQLAQPTQGTTPSSKLGGLWKTVSPHRSPISN
9 1U MVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQTAAQNGVRAMSSLGSSLGGSGGGGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGS
AACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGMVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSWWGLTVG SWIGSSAGLMVAAASPYVAWMSVTAGQAELTAAQVRVAAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAEYGEMWAQDAAAMFGYGGSGGGGSGGIVGIVAG LAVLAVWIGAVVATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA* [SEQ ID NO: 141]
MGGAAARLGAVILFWIVGLHGVRGWPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGGGGSGGMVDFGALPPEINSARMYAGPGSA SLVAAAQMWDSVASDLFSAASAFQSVVWGLTVGSWIGSSAGLMVAAASPYVAWMSVTAGQAELTAAQVRVAAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAE YGEMWAQDAAAMFGYGGSGGGGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSA _ no 10 R VGSSWAGGSGGGGSGGAAVEEASDTAAANQLMNNVPQALQQLAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQTAA
9 1U-K QNGVRAMSSLGSSLGGSGGGGSGGMHVSFVMAYPEMLAAAADTLQSIGATTVAGGSGGGGSGGMSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAF
QAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGFGGSGGGGSGGVDAHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQG GSGGGGSGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAERGPGQMLGGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAGGGSGGGGSGGIVGIVAGL AVLAWVIGAWATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA* [SEQ ID NO: 142]
MGGAAARLGAVILFVVIVGLHGVRGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEV
HAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGMSLLDAHIPQLVASQSAFAAKAGLMR
HTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGFGGSGGGGSGGMHVSFVMAYPEMLAAAADTLQSIGATTVAGGSGG
String 11 GGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGVDAH
GAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGGMSQIMYNYPAMLGHAGDMAGYAGTL QSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGGGGSGGGGSGGIVGIVAGLAVLAWVIGAWATVMCRRKSSG GKGGSYSQAASSDSAQGSDVSLTA* [SEQ ID NO: 143]
MGGAAARLGAVILFVVIVGLHGVRGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGGGGSGGMSQIMYNYPAMLGHAGDMAGYA
GTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGGGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGGVD
AHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQGGSGGGGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAA
String 11_R CQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGMHVSFVMAYPEMLAAAADTLQSIGATTVAGGSGGGGSGGMSLLDAHIPQLVASQSAFAA
KAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGFGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEVHAQTVE
DEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGIVGIVAGLAVLAWVIGAWATVMCRRKSSGGK
GGSYSQAASSDSAQGSDVSLTA* [SEQ ID NO: 144]
Amino acid sequence
MGGAAARLGAVILFWIVGLHGVRGWPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEV
HAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGMSLLDAHIPQLVASQSAFAAKAGLMR
HTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGFGGSGGGGSGGHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKW
DATATELNNALQNLARTISEAGQGGSGGGGSGGMHVSFVMAYPEMLAAAADTLQSIGATTVAGGSGGGGSGGMTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWG
String 12
GAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSGGSGGGGSGGVDAHGA
MIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGGMSQIMYNYPAMLGHAGDMAGYAGTLQS
LGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGGGGSGGGGSGGIVGIVAGLAVLAWVIGAWATVMCRRKSSGGK
GGSYSQAASSDSAQGSDVSLTA* [SEQ ID NO: 145]
MGGAAARLGAVILFWIVGLHGVRGWPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAGGSGGGGSGGMSQIMYNYPAMLGHAGDMAGYA
GTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGGGGSGGGGSGGMASRFMTDPHAMRDGGSGGGGSGGVD
AHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQGGSGGGGSGGMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSGGSGGGGSGGMTIN
YQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGGSGGGGSGGMHVSFVMAYPEML
String 12_R
AAAADTLQSIGATTVAGGSGGGGSGGHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQNLARTISEAGQGGSGGGGSGGMSLLDAHIPQLVASQSAFAAKAG
LMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGFGGSGGGGSGGMTSRFMTDPHAMRDMAGRFEVHAQTVEDEA
RRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSSGGSGGGGSGGIVGIVAGLAVLAVWIGAVVATVMCRRKSSGGKGGS
YSQAASSDSAQGSDVSLTA* [SEQ ID NO: 146] able 5: Nucleotide sequences of exemplary chimeric proteins
Chimeric protein Nucleotide sequence
ATGCACGTGTCCTTCGTGATGGCTTACCCCGAGATGCTGGCCGCTGCCGCTGATACACTCCAGTCTATCGGAGCCACAACAGTGGCTGGTGGATCTGGTGGCGGAGGATCTGG
CGGAGGCGGAGTTGCTGCTAATCTTGGCAGAGCCGCCTCTGTGGGCTCTCTGTCTGTTCCTCAAGCTTGGGCTGCCGCCAATCAGGCTGTTACACCAGCTGCTAGAGCCCTGCC
TCTGACCTCTCTGACATCTGCCGCAGAACGAGGCCCTGGACAGATGCTTGGAGGACTGCCTGTGGGACAGATGGGAGCTAGAGCAGGCGGAGGACTTTCTGGCGTGCTGAGAG
TTCCTCCTCGGCCTTACGTGATGCCTCATTCTCCTGCTGCTGGCGGTGGAAGTGGCGGTGGTGGATCAGGCGGTGTTGTGGCCGTGACATATAGCCCCGGACCTCACCTGGAA
CGGTTTCTGGCTTCTCTGAGCCTGGCCACCGAAAGACCTGTGTCTGTTCTGCTGGCCGACAACGGCAGCACAGATGGAACACCTCAGGCCGCCGTGCAGAGATACCCTAATGTT
String 1 (s) CGGCTGCTGCCCACCGGCGCCAATCTCGGATATGGAACCGCCGTGAACCGGACAATCGCTCAGCTGGGAGAAATGGCTGGCGACGCTGGCGAACCTTGGGTCGACGATTGGGT
CATCGTGGCCAATCCTGACGTGCAATGGGGCCCTGGATCTATCGATGCCCTGCTGGATGCCGCCTCCAGATGGCCTAGAGCTGGTGCTCTGGGACCCCTGATCAGAGATCCTG
ATGGCAGCGTGTACCCCAGCGCCAGACAAATGCCTAGCCTGATTAGAGGCGGAATGCACGCCGTGCTGGGCCCTTTCTGGCCTAGAAATCCTTGGACCACCGCCTACCGGCAAG
AGAGACTGGAACCTAGCGAAAGACCAGTCGGCTGGCTGAGCGGATCTTGTCTGCTTGTGCGGAGAAGCGCCTTTGGCCAAGTCGGCGGCTTCGACGAGCGGTACTTTATGTAC
ATGGAAGATGTGGACCTGGGCGACAGACTGGGCAAAGCTGGATGGCTGTCTGTGTACGTGCCAAGCGCCGAAGTGCTGCACCACAAGGCCCATAGCACAGGCAGAGATCCAGC
CTCTCATCTGGCCGCTCACCACAAGAGCACCTACATTTTTCTGGCCGACCGGCACAGCGGATGGTGGCGAGCACCTCTTAGATGGACCCTGAGAGGCTCTCTGGCCCTGAGAAG
CCATCTGATGGTTCGAAGCAGCCTGCGGCGGTCTAGAAGGCGGAAGCTGAAACTGGTGGAAGGCAGACATGGTGGTAGTGGTGGCGGCGGAAGCGGAGGTGCAGCTGTTGAG
GAAGCCTCTGATACCGCCGCTGCCAACCAGCTGATGAACAATGTGCCTCAGGCTCTCCAGCAGCTGGCCCAACCTACACAGGGCACAACACCTTCTAGCAAGCTCGGCGGACTG
. . Nucleotide sequence protein _ _
TGGAAAACCGTGTCTCCCCACAGATCCCCAATCAGCAACATGGTGTCCATGGCCAACAACCACATGAGCATGACCAACAGCGGCGTGTCCATGACAAACACCCTGTCCTCCATGC TGAAGGGCTTTGCTCCTGCCGCTGCTGCTCAGGCTGTGCAGACAGCTGCTCAGAATGGCGTGCGGGCTATGAGCAGCCTGGGAAGCTCTCTTGGAGGAAGCGGAGGCGGAGG TAGTGGCGGAGTTGTTCCACCAGCAGCTGACGAAGTGTCTGCCCTGACAGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCAAGAGCCGCCGCTATCCA CGATCAGTTCGTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGCCACTGAAGTGGCCAATGCCGCAGCAGCTTCTGGTGGTTCAGGCGGAGGTGGAAGCGGAGGAATGG TGGATTTTGGAGCCTTGCCTCCTGAGATCAACAGCGCCAGGATGTATGCCGGACCTGGATCTGCTTCTCTGGTGGCTGCTGCACAGATGTGGGATAGCGTGGCCAGCGACCTG TTTTCTGCTGCCTCCGCCTTTCAGAGCGTTGTGTGGGGACTGACAGTCGGCTCTTGGATCGGATCTTCTGCCGGCCTGATGGTGGCAGCTGCTTCTCCTTATGTGGCCTGGATG TCTGTGACAGCCGGACAGGCTGAACTGACAGCAGCACAAGTTCGAGTGGCCGCAGCCGCCTACGAAACAGCCTATGGACTTACCGTGCCTCCTCCAGTGATCGCCGAGAATAGA GCCGAGCTGATGATCCTGATCGCCACCAATCTGCTGGGCCAGAACACACCAGCCATTGCCGTGAATGAGGCCGAGTACGGCGAAATGTGGGCCCAAGATGCTGCTGCCATGTTT GGCTATGGTGGCTCAGGCGGCGGAGGTTCCGGTGGA [SEQ ID NO: 163]
ATGGGCGGAGCTGCTGCTAGACTGGGAGCCGTGATCCTGTTCGTGGTTATCGTGGGACTGCATGGCGTCAGAGGAATGCACGTGTCCTTCGTGATGGCTTACCCCGAGATGCT GGCCGCTGCCGCTGATACACTCCAGTCTATCGGAGCCACAACAGTGGCTGGTGGATCTGGTGGCGGAGGATCTGGCGGAGGCGGAGTTGCTGCTAATCTTGGCAGAGCCGCCT CTGTGGGCTCTCTGTCTGTTCCTCAAGCTTGGGCTGCCGCCAATCAGGCTGTTACACCAGCTGCTAGAGCCCTGCCTCTGACCTCTCTGACATCTGCCGCAGAACGAGGCCCTG GACAGATGCTTGGAGGACTGCCTGTGGGACAGATGGGAGCTAGAGCAGGCGGAGGACTTTCTGGCGTGCTGAGAGTTCCTCCTCGGCCTTACGTGATGCCTCATTCTCCTGCT GCTGGCGGTGGAAGTGGCGGTGGTGGATCAGGCGGTGTTGTGGCCGTGACATATAGCCCCGGACCTCACCTGGAACGGTTTCTGGCTTCTCTGAGCCTGGCCACCGAAAGACC TGTGTCTGTTCTGCTGGCCGACAACGGCAGCACAGATGGAACACCTCAGGCCGCCGTGCAGAGATACCCTAATGTTCGGCTGCTGCCCACCGGCGCCAATCTCGGATATGGAAC CGCCGTGAACCGGACAATCGCTCAGCTGGGAGAAATGGCTGGCGACGCTGGCGAACCTTGGGTCGACGATTGGGTCATCGTGGCCAATCCTGACGTGCAATGGGGCCCTGGAT CTATCGATGCCCTGCTGGATGCCGCCTCCAGATGGCCTAGAGCTGGTGCTCTGGGACCCCTGATCAGAGATCCTGATGGCAGCGTGTACCCCAGCGCCAGACAAATGCCTAGCC TGATTAGAGGCGGAATGCACGCCGTGCTGGGCCCTTTCTGGCCTAGAAATCCTTGGACCACCGCCTACCGGCAAGAGAGACTGGAACCTAGCGAAAGACCAGTCGGCTGGCTG AGCGGATCTTGTCTGCTTGTGCGGAGAAGCGCCTTTGGCCAAGTCGGCGGCTTCGACGAGCGGTACTTTATGTACATGGAAGATGTGGACCTGGGCGACAGACTGGGCAAAGC TGGATGGCTGTCTGTGTACGTGCCAAGCGCCGAAGTGCTGCACCACAAGGCCCATAGCACAGGCAGAGATCCAGCCTCTCATCTGGCCGCTCACCACAAGAGCACCTACATTTT
St no 1 m TCTGGCCGACCGGCACAGCGGATGGTGGCGAGCACCTCTTAGATGGACCCTGAGAGGCTCTCTGGCCCTGAGAAGCCATCTGATGGTTCGAAGCAGCCTGCGGCGGTCTAGAA
9 1 GGCGGAAGCTGAAACTGGTGGAAGGCAGACATGGTGGTAGTGGTGGCGGCGGAAGCGGAGGTGCAGCTGTTGAGGAAGCCTCTGATACCGCCGCTGCCAACCAGCTGATGAA
CAATGTGCCTCAGGCTCTCCAGCAGCTGGCCCAACCTACACAGGGCACAACACCTTCTAGCAAGCTCGGCGGACTGTGGAAAACCGTGTCTCCCCACAGATCCCCAATCAGCAA CATGGTGTCCATGGCCAACAACCACATGAGCATGACCAACAGCGGCGTGTCCATGACAAACACCCTGTCCTCCATGCTGAAGGGCTTTGCTCCTGCCGCTGCTGCTCAGGCTGT GCAGACAGCTGCTCAGAATGGCGTGCGGGCTATGAGCAGCCTGGGAAGCTCTCTTGGAGGAAGCGGAGGCGGAGGTAGTGGCGGAGTTGTTCCACCAGCAGCTGACGAAGTG TCTGCCCTGACAGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCAAGAGCCGCCGCTATCCACGATCAGTTCGTGGCCACACTGGCCAGCAGCGCCAGT TCTTATGCCGCCACTGAAGTGGCCAATGCCGCAGCAGCTTCTGGTGGTTCAGGCGGAGGTGGAAGCGGAGGAATGGTGGATTTTGGAGCCTTGCCTCCTGAGATCAACAGCGC CAGGATGTATGCCGGACCTGGATCTGCTTCTCTGGTGGCTGCTGCACAGATGTGGGATAGCGTGGCCAGCGACCTGTTTTCTGCTGCCTCCGCCTTTCAGAGCGTTGTGTGGG GACTGACAGTCGGCTCTTGGATCGGATCTTCTGCCGGCCTGATGGTGGCAGCTGCTTCTCCTTATGTGGCCTGGATGTCTGTGACAGCCGGACAGGCTGAACTGACAGCAGCA CAAGTTCGAGTGGCCGCAGCCGCCTACGAAACAGCCTATGGACTTACCGTGCCTCCTCCAGTGATCGCCGAGAATAGAGCCGAGCTGATGATCCTGATCGCCACCAATCTGCTG GGCCAGAACACACCAGCCATTGCCGTGAATGAGGCCGAGTACGGCGAAATGTGGGCCCAAGATGCTGCTGCCATGTTTGGCTATGGTGGCTCAGGCGGCGGAGGTTCCGGTG GAATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCGGAGGCAAGGGCGGCAGCTA CAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAGTAA [SEQ ID NO: 164]
Nucleotide sequence
ATGAGCCTGCTGGACGCCCATATTCCTCAGCTGGTGGCCAGCCAGTCTGCCTTTGCTGCTAAAGCCGGCCTGATGAGACACACCATTGGACAGGCTGAACAGGCCGCCATGTCT GCCCAGGCTTTTCACCAAGGCGAAAGCAGCGCCGCCTTTCAGGCTGCCCATGCCAGATTTGTTGCCGCCGCTGCCAAAGTGAACACCCTGCTGGATGTGGCCCAGGCCAATCTG GGAGAAGCCGCCGGAACTTATGTGGCCGCTGATGCTGCTGCCGCCAGCACCTATACAGGCTTTGGAGGATCTGGCGGAGGCGGCTCTGGCGGCATGACAATCAATTACCAGTT CGGCGACGTGGACGCTCACGGCGCTATGATTAGAGCCCAGGCCGGATCTCTGGAAGCCGAGCACCAGGCCATCATCTCCGATGTGCTGACCGCCTCCGATTTTTGGGGCGGAG CTGGATCTGCTGCCTGTCAGGGCTTTATCACACAGCTGGGCAGAAACTTCCAAGTGATCTACGAGCAGGCTAACGCCCACGGCCAGAAAGTGCAAGCCGCTGGCAACAATATGG CCCAGACCGATTCTGCCGTGGGAAGCTCTTGGGCTGGTGGTTCTGGTGGTGGTGGAAGCGGAGGCATGAGCCAGATCATGTACAACTACCCCGCCATGCTGGGACACGCCGGC GATATGGCTGGATATGCCGGAACACTCCAGTCTCTGGGCGCCGAGATTGCTGTGGAACAGGCTGCTCTGCAAAGTGCCTGGCAGGGCGATACCGGCATCACATATCAGGCTTG String 2 (s) GCAGGCCCAGTGGAATCAGGCCATGGAAGATCTCGTGCGGGCCTACCATGCCATGAGCAGCACACACGAGGCCAACACAATGGCCATGATGGCCCGGGATACAGCCGAAGCCG
CTAAATGGGGAGGCGGAGGAAGTGGTGGCGGAGGTAGCGGAGGAATGGCCTCCAGATTCATGACCGATCCTCACGCCATGAGAGATGGCGGATCAGGCGGCGGTGGTAGTGG CGGAATGACCATTAACTATCAGTTTGGAGATGTGGATGCCCACGGGGCCATGATCAGAGCACAAGCTGCTTCCCTGGAAGCTGAACATCAGGCTATCGTGCGGGATGTGCTGG CTGCTGGCGACTTTTGGGGTGGTGCAGGTTCTGTGGCCTGTCAAGAGTTCATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTATGAACAAGCCAATGCTCACGGACAGAAGG TGCAGGCTGCCGGAAACAACATGGCTCAGACAGATAGCGCTGTGGGCTCTAGTTGGGCTGGCGGTTCAGGCGGTGGCGGATCTGGTGGAATGACCAGCCGGTTCATGACAGAC CCACATGCTATGAGAGACATGGCCGGCAGATTCGAGGTGCACGCCCAGACAGTGGAAGATGAGGCTCGGAGAATGTGGGCCAGCGCTCAGAATATTAGCGGAGCAGGCTGGA GCGGAATGGCCGAAGCTACAAGCCTGGACACCATGACACAGATGAACCAGGCCTTCCGCAACATCGTGAACATGCTGCACGGCGTCAGAGATGGCCTCGTCAGGGACGCCAAC AATTACGAGCAGCAAGAGCAGGCCTCTCAGCAGATTCTGTCTAGCGGAGGTTCTGGCGGCGGAGGATCAGGTGGT [SEQ ID NO: 165] ATGGGCGGAGCTGCTGCTAGACTGGGAGCCGTGATCCTGTTCGTGGTTATCGTGGGACTGCATGGCGTCAGAGGAATGAGCCTGCTGGACGCCCATATTCCTCAGCTGGTGGC CAGCCAGTCTGCCTTTGCTGCTAAAGCCGGCCTGATGAGACACACCATTGGACAGGCTGAACAGGCCGCCATGTCTGCCCAGGCTTTTCACCAAGGCGAAAGCAGCGCCGCCTT TCAGGCTGCCCATGCCAGATTTGTTGCCGCCGCTGCCAAAGTGAACACCCTGCTGGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCCGGAACTTATGTGGCCGCTGATGCTG
CTGCCGCCAGCACCTATACAGGCTTTGGAGGATCTGGCGGAGGCGGCTCTGGCGGCATGACAATCAATTACCAGTTCGGCGACGTGGACGCTCACGGCGCTATGATTAGAGCC CAGGCCGGATCTCTGGAAGCCGAGCACCAGGCCATCATCTCCGATGTGCTGACCGCCTCCGATTTTTGGGGCGGAGCTGGATCTGCTGCCTGTCAGGGCTTTATCACACAGCT GGGCAGAAACTTCCAAGTGATCTACGAGCAGGCTAACGCCCACGGCCAGAAAGTGCAAGCCGCTGGCAACAATATGGCCCAGACCGATTCTGCCGTGGGAAGCTCTTGGGCTG GTGGTTCTGGTGGTGGTGGAAGCGGAGGCATGAGCCAGATCATGTACAACTACCCCGCCATGCTGGGACACGCCGGCGATATGGCTGGATATGCCGGAACACTCCAGTCTCTG GGCGCCGAGATTGCTGTGGAACAGGCTGCTCTGCAAAGTGCCTGGCAGGGCGATACCGGCATCACATATCAGGCTTGGCAGGCCCAGTGGAATCAGGCCATGGAAGATCTCGT String 2 (I) GCGGGCCTACCATGCCATGAGCAGCACACACGAGGCCAACACAATGGCCATGATGGCCCGGGATACAGCCGAAGCCGCTAAATGGGGAGGCGGAGGAAGTGGTGGCGGAGGT
AGCGGAGGAATGGCCTCCAGATTCATGACCGATCCTCACGCCATGAGAGATGGCGGATCAGGCGGCGGTGGTAGTGGCGGAATGACCATTAACTATCAGTTTGGAGATGTGGA TGCCCACGGGGCCATGATCAGAGCACAAGCTGCTTCCCTGGAAGCTGAACATCAGGCTATCGTGCGGGATGTGCTGGCTGCTGGCGACTTTTGGGGTGGTGCAGGTTCTGTGG CCTGTCAAGAGTTCATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTATGAACAAGCCAATGCTCACGGACAGAAGGTGCAGGCTGCCGGAAACAACATGGCTCAGACAGATA GCGCTGTGGGCTCTAGTTGGGCTGGCGGTTCAGGCGGTGGCGGATCTGGTGGAATGACCAGCCGGTTCATGACAGACCCACATGCTATGAGAGACATGGCCGGCAGATTCGA GGTGCACGCCCAGACAGTGGAAGATGAGGCTCGGAGAATGTGGGCCAGCGCTCAGAATATTAGCGGAGCAGGCTGGAGCGGAATGGCCGAAGCTACAAGCCTGGACACCATG ACACAGATGAACCAGGCCTTCCGCAACATCGTGAACATGCTGCACGGCGTCAGAGATGGCCTCGTCAGGGACGCCAACAATTACGAGCAGCAAGAGCAGGCCTCTCAGCAGATT CTGTCTAGCGGAGGTTCTGGCGGCGGAGGATCAGGTGGTATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGT GCAGACGGAAGTCCAGCGGAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAGTAA [SEQ ID NO: 166]
Nucleotide sequence
ATGGCCGAGATGAAGACCGATGCCGCCACACTGGCTCAAGAGGCCGGCAACTTTGAGAGAATCAGCGGCGACCTGAAAACCCAGATCGACCAGGTGGAATCTACCGCCGGCTC TCTGCAAGGACAATGGCGGGGAGCTGCTGGAACAGCTGCTCAAGCTGCCGTCGTGCGGTTTCAAGAAGCCGCCAACAAGCAGAAGCAAGAGCTGGACGAGATCAGCACCAACA TCAGACAGGCCGGCGTGCAGTACTCTAGAGCCGATGGTGGATCTGGCGGCGGTGGAAGCGGAGGAATGTCTCTGCTGGATGCCCACATTCCTCAGCTGGTGGCCAGCCAGTCT GCCTTTGCTGCTAAAGCCGGCCTGATGCGGCACACAATTGGACAGGCTGAACAGGCCGCCATGAGCGCCCAGGCTTTTCATCAAGGCGAAAGCAGCGCCGCCTTTCAGGCCGC TCATGCCAGATTTGTTGCCGCCGCTGCCAAAGTGAACACCCTGCTTGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCTGGAACATATGTGGCCGCTGATGCCGCTGCCGCCA GCACATATACAGGCTTTGGAGGTTCTGGCGGAGGCGGCTCTGGCGGCATGACAATCAATTACCAGTTCGGCGACGTGGACGCCCACGGCGCTATGATTAGAGCACAGGCCGGA
TCrCTGGAAGCCGAGCACCAGGCCATCATCTCCGATGTGCTGACCGCCAGCGATTTTTGGGGCGGAGCTGGATCTGCTGCCTGCCAGGGCTTTATCACACAGCrGGGCAGAAA CTTCCAAGTGATCTACGAGCAGGCCAACGCTCACGGCCAGAAAGTTCAGGCTGCCGGCAACAATATGGCCCAGACCGATTCTGCCGTGGGCAGTTCTTGGGCTGGTGGTAGTG GTGGCGGTGGTTCAGGTGGCATGTCCCAGATCATGTACAACTACCCCGCCATGCTGGGACACGCCGGCGATATGGCTGGATATGCCGGAACACTCCAGTCTCTGGGCGCCGAG ATTGCTGTGGAACAGGCAGCTCTGCAAAGTGCCTGGCAGGGCGATACCGGCATCACATATCAAGCTTGGCAGGCCCAGTGGAATCAGGCCATGGAAGATCTCGTGCGGGCCTA CCATGCCATGAGCAGCACACACGAGGCCAACACAATGGCCATGATGGCCCGGGATACAGCCGAGGCTGCTAAATGGGGAGGCGGAGGTAGTGGCGGCGGAGGATCTGGTGGA ATGGCCAGCAGATTCATGACCGATCCTCACGCCATGAGAGATGGCGGTAGCGGTGGTGGTGGCAGTGGCGGAATGACCATTAACTATCAGTTTGGGGATGTCGATGCCCACGG
GGCCATGATCAGGGCTCAAGCAGCTAGTCTGGAAGCTGAACATCAGGCTATCGTGCGGGACGTTCTGGCCGCTGGCGACTTTTGGGGTGGTGCAGGTTCTGTGGCCTGTCAAG AGTTCATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTATGAACAGGCTAATGCCCATGGCCAGAAGGTGCAGGCAGCTGGAAACAACATGGCTCAGACAGACAGCGCAGTGG GCTCATCTTGGGCAGGCGGATCAGGTGGTGGCGGATCAGGCGGAATGACAAGCCGGTTCATGACAGACCCACATGCTATGAGAGACATGGCCGGAAGATTCGAGGTGCACGCC CAGACAGTGGAAGATGAGGCTAGACGGATGTGGGCCAGCGCTCAGAATATTAGCGGAGCAGGCTGGAGCGGAATGGCCGAAGCTACAAGCCTGGACACCATGACACAGATGAA CCAGGCCTTCCGCAACATCGTGAACATGCTGCACGGCGTCAGAGATGGCCTTGTGCGGGATGCCAACAATTACGAGCAGCAAGAGCAGGCCTCTCAGCAAATCCTGTCTAGCGG AGGAAGCGGTGGCGGAGGCAGCGGAGGA [SEQ ID NO: 167]
ATGGGCGGAGCTGCTGCTAGACTGGGAGCCGTGATCCTGTTCGTGGTTATCGTGGGACTGCATGGCGTCAGAGGAATGGCCGAGATGAAGACCGATGCCGCCACACTGGCTCA
AGAGGCCGGCAACTTTGAGAGAATCAGCGGCGACCTGAAAACCCAGATCGACCAGGTGGAATCTACCGCCGGCTCTCTGCAAGGACAATGGCGGGGAGCTGCTGGAACAGCTG
CTCAAGCTGCCGTCGTGCGGTTTCAAGAAGCCGCCAACAAGCAGAAGCAAGAGCTGGACGAGATCAGCACCAACATCAGACAGGCCGGCGTGCAGTACTCTAGAGCCGATGGT
GGATCTGGCGGCGGTGGAAGCGGAGGAATGTCTCTGCTGGATGCCCACATTCCTCAGCTGGTGGCCAGCCAGTCTGCCTTTGCTGCTAAAGCCGGCCTGATGCGGCACACAAT
TGGACAGGCTGAACAGGCCGCCATGAGCGCCCAGGCTTTTCATCAAGGCGAAAGCAGCGCCGCCTTTCAGGCCGCTCATGCCAGATTTGTTGCCGCCGCTGCCAAAGTGAACAC
CCTGCTTGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCTGGAACATATGTGGCCGCTGATGCCGCTGCCGCCAGCACATATACAGGCTTTGGAGGTTCTGGCGGAGGCGGCT
CTGGCGGCATGACAATCAATTACCAGTTCGGCGACGTGGACGCCCACGGCGCTATGATTAGAGCACAGGCCGGATCTCTGGAAGCCGAGCACCAGGCCATCATCTCCGATGTG
CTGACCGCCAGCGATTTTTGGGGCGGAGCTGGATCTGCTGCCTGCCAGGGCTTTATCACACAGCTGGGCAGAAACTTCCAAGTGATCTACGAGCAGGCCAACGCTCACGGCCA
GAAAGTTCAGGCTGCCGGCAACAATATGGCCCAGACCGATTCTGCCGTGGGCAGTTCTTGGGCTGGTGGTAGTGGTGGCGGTGGTTCAGGTGGCATGTCCCAGATCATGTACA
ACTACCCCGCCATGCTGGGACACGCCGGCGATATGGCTGGATATGCCGGAACACTCCAGTCTCTGGGCGCCGAGATTGCTGTGGAACAGGCAGCTCTGCAAAGTGCCTGGCAG
GGCGATACCGGCATCACATATCAAGCTTGGCAGGCCCAGTGGAATCAGGCCATGGAAGATCTCGTGCGGGCCTACCATGCCATGAGCAGCACACACGAGGCCAACACAATGGC
CATGATGGCCCGGGATACAGCCGAGGCTGCTAAATGGGGAGGCGGAGGTAGTGGCGGCGGAGGATCTGGTGGAATGGCCAGCAGATTCATGACCGATCCTCACGCCATGAGA
GATGGCGGTAGCGGTGGTGGTGGCAGTGGCGGAATGACCATTAACTATCAGTTTGGGGATGTCGATGCCCACGGGGCCATGATCAGGGCTCAAGCAGCTAGTCTGGAAGCTG
AACATCAGGCTATCGTGCGGGACGTTCTGGCCGCTGGCGACTTTTGGGGTGGTGCAGGTTCTGTGGCCTGTCAAGAGTTCATCACCCAGCTCGGCCGGAATn CAAGTCATCT
ATGAACAGGCTAATGCCCATGGCCAGAAGGTGCAGGCAGCTGGAAACAACATGGCTCAGACAGACAGCGCAGTGGGCTCATCTTGGGCAGGCGGATCAGGTGGTGGCGGATCA
GGCGGAATGACAAGCCGGTTCATGACAGACCCACATGCTATGAGAGACATGGCCGGAAGATTCGAGGTGCACGCCCAGACAGTGGAAGATGAGGCTAGACGGATGTGGGCCAG
CGCTCAGAATATTAGCGGAGCAGGCTGGAGCGGAATGGCCGAAGCTACAAGCCTGGACACCATGACACAGATGAACCAGGCCTTCCGCAACATCGTGAACATGCTGCACGGCG
TCAGAGATGGCCTTGTGCGGGATGCCAACAATTACGAGCAGCAAGAGCAGGCCTCTCAGCAAATCCTGTCTAGCGGAGGAAGCGGTGGCGGAGGCAGCGGAGGAATCGTGGG
AATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCGGAGGCAAGGGCGGCAGCTACAGCCAGGCC
GCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAGTAA [SEQ ID NO: 168]
Nucleotide sequence
ATGAGCTTCGTGATGGCTTACCCTGAGATGCTGGCCGCTGCCGCCGATACACTCCAGTCTATTGGAGCCACAACAGTGGCTGGCGGATCTGGTGGTGGTGGATCTGGCGGCGG
AGTGGCTGCTAATCTTGGCAGAGCTGCCTCTGTGGGCAGCCTGTCTGTTCCTCAAGCTTGGGCTGCCGCCAATCAGGCTGTTACACCAGCTGCTAGAGCCCTGCCTCTGACCTC
TCTGACATCTGCCGCTGAGCGAGGACCTGGACAGATGCTTGGAGGACTGCCTGTGGGACAGATGGGAGCTAGAGCTGGCGGAGGACTTTCTGGCGTGCTGAGAGTTCCTCCTC
GGCCTTACGTGATGCCTCATTCTCCTGCTGCCGGCGGAGGAAGTGGCGGAGGCGGAAGCGGAGGAATGACCAGCAGATTCATGACCGATCCTCACGCCATGAGAGACATGGCC
GGCAGATTTGAAGTGCACGCCCAGACCGTGGAAGATGAGGCTAGAAGAATGTGGGCCAGCGCTCAGAACATTAGCGGAGCTGGCTGGAGCGGAATGGCCGAAGCTACAAGCCT
GGACACCATGACACAGATGAACCAGGCCTTCCGCAACATCGTGAACATGCTGCACGGCGTCAGAGATGGCCTTGTGCGGGACGCCAACAACTACGAGCAGCAAGAACAGGCCA
GCCAGCAGATCCTGTCTAGCGGAGGTTCAGGTGGTGGCGGTAGTGGTGGAATGGCCAGCCGGTTTATGACAGACCCACATGCTATGAGAGATGGCGGTTCAGGCGGCGGTGG
TAGCGGCGGAGCTGCTGTTGAAGAAGCCTCTGATACCGCCGCTGCCAACCAGCTGATGAACAATGTGCCTCAGGCTCTCCAGCAGCTGGCCCAACCTACACAGGGCACAACACC
TTCTAGCAAGCTCGGCGGCCTGTGGAAAACCGTGTCTCCTCACAGATCCCCAATCAGCAACATGGTGTCTATGGCCAACAACCACATGAGCATGACCAACAGCGGCGTGTCCAT
GACAAACACCCTGTCCTCCATGCTGAAGGGCTTTGCCCCAGCAGCAGCTGCACAGGCTGTTCAGACAGCAGCACAGAACGGCGTGCGGGCTATGTCTAGCCTGGGAAGCTCTCT
String 4 TGGAGGTTCAGGCGGAGGCGGATCTGGCGGAGTTGTTCCTCCTGCCGCTGATGAAGTGTCTGCCCTGACAGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGT
(HSV-TMD) (s) CTGCAAGAGCCGCCGCAATCCACGATCAGTTCGTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGCCACTGAAGTGGCCAATGCTGCCGCAGGCGGTAGCGGTGGCGGT
GGTTCCGGTGGAATGGTGGATTTTGGAGCCCTGCCACCTGAGATCAACAGCGCCAGGATGTATGCCGGACCTGGATCTGCTTCTCTGGTGGCTGCTGCTCAGATGTGGGATAG
CGTGGCCAGCGACCTGTTTTCTGCCGCAAGCGCCTTTCAGTCTGTCGTGTGGGGACTGACAGTCGGCTCTTGGATCGGATCTAGCGCCGGACTGATGGTGGCAGCCGCTTCTC
CTTATGTGGCCTGGATGTCTGTGACAGCCGGACAGGCTGAACTGACCGCTGCTCAAGTTCGAGTTGCCGCCGCAGCCTACGAGACAGCCTATGGACTTACAGTGCCTCCTCCAG
TGATCGCCGAGAACAGAGCCGAGCTGATGATCCTGATCGCCACCAACCTGCTGGGCCAGAACACACCAGCCATTGCCGTGAATGAGGCCGAGTACGGCGAGATGTGGGCCCAA
GATGCCGCTGCTATGTTTGGCTATGGTGGCAGCGGAGGCGGAGGTTCTGGCGGAATGACCATCAACTACCAGTTCGGCGACGTGGACGCCCACGGCGCTATGATTAGAGCACA
GGCCGGATCTCTGGAAGCCGAGCACCAGGCCATCATCTCCGATGTGCTGACCGCCAGCGATTTTTGGGGAGGTGCTGGCTCTGCTGCCTGCCAGGGCTTTATTACACAGCTGG
GCAGAAACTTCCAAGTGATCTATGAGCAGGCCAACGCTCACGGCCAGAAGGTGCAAGCCGCCGGAAACAATATGGCCCAGACAGATTCTGCCGTGGGCAGCTCTTGGGCAGGC
GGCTCCGGTGGCGGCGGAAGCGGCGGAGTTGATGCTCATGGCGCAATGATCAGAGCCCAAGCCGCCAGCCTGGAAGCTGAACATCAGGCTATCGTGCGCGACGTTCTGGCAGC
TGGGGATTTCTGGGGCGGAGCAGGTTCTGTGGCCTGCCAAGAGTTTATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTACGAGCAAGGCGGTAGTGGCGGCGGAGGCTCAG
GCGGT [SEQ ID NO: 169]
ATGGGCGGAGCTGCTGCTAGACTGGGAGCCGTGATCCTGTTCGTGGTTATCGTGGGACTGCATGGCGTCAGAGGAATGAGCTTCGTGATGGCTTACCCTGAGATGCTGGCCGC TGCCGCCGATACACTCCAGTCTATTGGAGCCACAACAGTGGCTGGCGGATCTGGTGGTGGTGGATCTGGCGGCGGAGTGGCTGCTAATCTTGGCAGAGCTGCCTCTGTGGGCA GCCTGTCTGTTCCTCAAGCTTGGGCTGCCGCCAATCAGGCTGTTACACCAGCTGCTAGAGCCCTGCCTCTGACCTCTCTGACATCTGCCGCTGAGCGAGGACCTGGACAGATGC TTGGAGGACTGCCTGTGGGACAGATGGGAGCTAGAGCTGGCGGAGGACTTTCTGGCGTGCTGAGAGTTCCTCCTCGGCCTTACGTGATGCCTCATTCTCCTGCTGCCGGCGGA GGAAGTGGCGGAGGCGGAAGCGGAGGAATGACCAGCAGATTCATGACCGATCCTCACGCCATGAGAGACATGGCCGGCAGATTTGAAGTGCACGCCCAGACCGTGGAAGATGA GGCTAGAAGAATGTGGGCCAGCGCTCAGAACATTAGCGGAGCTGGCTGGAGCGGAATGGCCGAAGCTACAAGCCTGGACACCATGACACAGATGAACCAGGCCTTCCGCAACA TCGTGAACATGCTGCACGGCGTCAGAGATGGCCTTGTGCGGGACGCCAACAACTACGAGCAGCAAGAACAGGCCAGCCAGCAGATCCTGTCTAGCGGAGGTTCAGGTGGTGGC GGTAGTGGTGGAATGGCCAGCCGGTTTATGACAGACCCACATGCTATGAGAGATGGCGGTTCAGGCGGCGGTGGTAGCGGCGGAGCTGCTGTTGAAGAAGCCTCTGATACCG
String 4 CCGCTGCCAACCAGCTGATGAACAATGTGCCTCAGGCTCTCCAGCAGCTGGCCCAACCTACACAGGGCACAACACCTTCTAGCAAGCTCGGCGGCCTGTGGAAAACCGTGTCTC
(HSV-TMD) (I) CTCACAGATCCCCAATCAGCAACATGGTGTCTATGGCCAACAACCACATGAGCATGACCAACAGCGGCGTGTCCATGACAAACACCCTGTCCTCCATGCTGAAGGGCTTTGCCCC AGCAGCAGCTGCACAGGCTGTTCAGACAGCAGCACAGAACGGCGTGCGGGCTATGTCTAGCCTGGGAAGCTCTCTTGGAGGTTCAGGCGGAGGCGGATCTGGCGGAGTTGTT CCTCCTGCCGCTGATGAAGTGTCTGCCCTGACAGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCAAGAGCCGCCGCAATCCACGATCAGTTCGTGGCC ACACTGGCCAGCAGCGCCAGTTCTTATGCCGCCACTGAAGTGGCCAATGCTGCCGCAGGCGGTAGCGGTGGCGGTGGTTCCGGTGGAATGGTGGATTTTGGAGCCCTGCCACC TGAGATCAACAGCGCCAGGATGTATGCCGGACCTGGATCTGCTTCTCTGGTGGCTGCTGCTCAGATGTGGGATAGCGTGGCCAGCGACCTGTTTTCTGCCGCAAGCGCCTTTC AGTCTGTCGTGTGGGGACTGACAGTCGGCTCTTGGATCGGATCTAGCGCCGGACTGATGGTGGCAGCCGCTTCTCCTTATGTGGCCTGGATGTCTGTGACAGCCGGACAGGCT GAACTGACCGCTGCTCAAGTTCGAGTTGCCGCCGCAGCCTACGAGACAGCCTATGGACTTACAGTGCCTCCTCCAGTGATCGCCGAGAACAGAGCCGAGCTGATGATCCTGATC GCCACCAACCTGCTGGGCCAGAACACACCAGCCATTGCCGTGAATGAGGCCGAGTACGGCGAGATGTGGGCCCAAGATGCCGCTGCTATGTTTGGCTATGGTGGCAGCGGAGG CGGAGGTTCTGGCGGAATGACCATCAACTACCAGTTCGGCGACGTGGACGCCCACGGCGCTATGATTAGAGCACAGGCCGGATCTCTGGAAGCCGAGCACCAGGCCATCATCT
Chimeric Nucleotide sequence protein
CCGATGTGCTGACCGCCAGCGATTTTTGGGGAGGTGCTGGCTCTGCTGCCTGCCAGGGCTTTATTACACAGCTGGGCAGAAACTTCCAAGTGATCTATGAGCAGGCCAACGCTC
ACGGCCAGAAGGTGCAAGCCGCCGGAAACAATATGGCCCAGACAGATTCTGCCGTGGGCAGCTCTTGGGCAGGCGGCTCCGGTGGCGGCGGAAGCGGCGGAGTTGATGCTCA
TGGCGCAATGATCAGAGCCCAAGCCGCCAGCCTGGAAGCTGAACATCAGGCTATCGTGCGCGACGTTCTGGCAGCTGGGGATTTCTGGGGCGGAGCAGGTTCTGTGGCCTGCC
AAGAGTTTATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTACGAGCAAGGCGGTAGTGGCGGCGGAGGCTCAGGCGGTGGACTTATTGCTGGTGCCGTTGGAGGATCTCTG
CTGGCAGCCCTGGTCATCTGCGGCATCGTGTACTGGATGCGGAGACACACACAGAAGGCCCCTAAGCGGATCAGACTGCCCCACATCAGATGATAA [SEQ ID NO: 170]
ATGAGCTTCGTGATGGCTTACCCTGAGATGCTGGCCGCTGCCGCCGATACACTCCAGTCTATTGGAGCCACAACAGTGGCTGGCGGATCTGGTGGTGGTGGATCTGGCGGCGG AGTGGCTGCTAATCTTGGCAGAGCTGCCTCTGTGGGCAGCCTGTCTGTTCCTCAAGCTTGGGCTGCCGCCAATCAGGCTGTTACACCAGCTGCTAGAGCCCTGCCTCTGACCTC TCTGACATCTGCCGCTGAGCGAGGACCTGGACAGATGCTTGGAGGACTGCCTGTGGGACAGATGGGAGCTAGAGCTGGCGGAGGACTTTCTGGCGTGCTGAGAGTTCCTCCTC GGCCTTACGTGATGCCTCATTCTCCTGCTGCCGGCGGAGGAAGTGGCGGAGGCGGAAGCGGAGGAATGACCAGCAGATTCATGACCGATCCTCACGCCATGAGAGACATGGCC GGCAGATTTGAAGTGCACGCCCAGACCGTGGAAGATGAGGCTAGAAGAATGTGGGCCAGCGCTCAGAACATTAGCGGAGCTGGCTGGAGCGGAATGGCCGAAGCTACAAGCCT GGACACCATGACACAGATGAACCAGGCCTTCCGCAACATCGTGAACATGCTGCACGGCGTCAGAGATGGCCTTGTGCGGGACGCCAACAACTACGAGCAGCAAGAACAGGCCA GCCAGCAGATCCTGTCTAGCGGAGGTTCAGGTGGTGGCGGTAGTGGTGGAATGGCCAGCCGGTTTATGACAGACCCACATGCTATGAGAGATGGCGGTTCAGGCGGCGGTGG TAGCGGCGGAGCTGCTGTTGAAGAAGCCTCTGATACCGCCGCTGCCAACCAGCTGATGAACAATGTGCCTCAGGCTCTCCAGCAGCTGGCCCAACCTACACAGGGCACAACACC TTCTAGCAAGCTCGGCGGCCTGTGGAAAACCGTGTCTCCTCACAGATCCCCAATCAGCAACATGGTGTCTATGGCCAACAACCACATGAGCATGACCAACAGCGGCGTGTCCAT GACAAACACCCTGTCCTCCATGCTGAAGGGCTTTGCCCCAGCAGCAGCTGCACAGGCTGTTCAGACAGCAGCACAGAACGGCGTGCGGGCTATGTCTAGCCTGGGAAGCTCTCT
String 4 TGGAGGTTCAGGCGGAGGCGGATCTGGCGGAGTTGTTCCTCCTGCCGCTGATGAAGTGTCTGCCCTGACAGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGT
(MITD) (s) CTGCAAGAGCCGCCGCAATCCACGATCAGTTCGTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGCCACTGAAGTGGCCAATGCTGCCGCAGGCGGTAGCGGTGGCGGT
GGTTCCGGTGGAATGGTGGATTTTGGAGCCCTGCCACCTGAGATCAACAGCGCCAGGATGTATGCCGGACCTGGATCTGCTTCTCTGGTGGCTGCTGCTCAGATGTGGGATAG CGTGGCCAGCGACCTGTTTTCTGCCGCAAGCGCCTTTCAGTCTGTCGTGTGGGGACTGACAGTCGGCTCTTGGATCGGATCTAGCGCCGGACTGATGGTGGCAGCCGCTTCTC CTTATGTGGCCTGGATGTCTGTGACAGCCGGACAGGCTGAACTGACCGCTGCTCAAGTTCGAGTTGCCGCCGCAGCCTACGAGACAGCCTATGGACTTACAGTGCCTCCTCCAG TGATCGCCGAGAACAGAGCCGAGCTGATGATCCTGATCGCCACCAACCTGCTGGGCCAGAACACACCAGCCATTGCCGTGAATGAGGCCGAGTACGGCGAGATGTGGGCCCAA GATGCCGCTGCTATGTTTGGCTATGGTGGCAGCGGAGGCGGAGGTTCTGGCGGAATGACCATCAACTACCAGTTCGGCGACGTGGACGCCCACGGCGCTATGATTAGAGCACA GGCCGGATCTCTGGAAGCCGAGCACCAGGCCATCATCTCCGATGTGCTGACCGCCAGCGATTTTTGGGGAGGTGCTGGCTCTGCTGCCTGCCAGGGCTTTATTACACAGCTGG GCAGAAACTTCCAAGTGATCTATGAGCAGGCCAACGCTCACGGCCAGAAGGTGCAAGCCGCCGGAAACAATATGGCCCAGACAGATTCTGCCGTGGGCAGCTCTTGGGCAGGC GGCTCCGGTGGCGGCGGAAGCGGCGGAGTTGATGCTCATGGCGCAATGATCAGAGCCCAAGCCGCCAGCCTGGAAGCTGAACATCAGGCTATCGTGCGCGACGTTCTGGCAGC TGGGGATTTCTGGGGCGGAGCAGGTTCTGTGGCCTGCCAAGAGTTTATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTACGAGCAAGGCGGTAGTGGCGGCGGAGGCTCAG GCGGA[SEQ ID NO: 171]
ATGGGCGGAGCTGCTGCTAGACTGGGAGCCGTGATCCTGTTCGTGGTTATCGTGGGACTGCATGGCGTCAGAGGAATGAGCTTCGTGATGGCTTACCCTGAGATGCTGGCCGC TGCCGCCGATACACTCCAGTCTATTGGAGCCACAACAGTGGCTGGCGGATCTGGTGGTGGTGGATCTGGCGGCGGAGTGGCTGCTAATCTTGGCAGAGCTGCCTCTGTGGGCA GCCTGTCTGTTCCTCAAGCTTGGGCTGCCGCCAATCAGGCTGTTACACCAGCTGCTAGAGCCCTGCCTCTGACCTCTCTGACATCTGCCGCTGAGCGAGGACCTGGACAGATGC String 4 TTGGAGGACTGCCTGTGGGACAGATGGGAGCTAGAGCTGGCGGAGGACTTTCTGGCGTGCTGAGAGTTCCTCCTCGGCCTTACGTGATGCCTCATTCTCCTGCTGCCGGCGGA rMTTD'i rn GGAAGTGGCGGAGGCGGAAGCGGAGGAATGACCAGCAGATTCATGACCGATCC CACGCCATGAGAGACATGGCCGGCAGATTTGAAGTGCACGCCCAGACCGTGGAAGATGA
(.1 11 (IJ GGCTAGAAGAATGTGGGCCAGCGCTCAGAACATTAGCGGAGCTGGCTGGAGCGGAATGGCCGAAGCTACAAGCCTGGACACCATGACACAGATGAACCAGGCCTTCCGCAACA
TCGTGAACATGCTGCACGGCGTCAGAGATGGCCTTGTGCGGGACGCCAACAACTACGAGCAGCAAGAACAGGCCAGCCAGCAGATCCTGTCTAGCGGAGGTTCAGGTGGTGGC GGTAGTGGTGGAATGGCCAGCCGGTTTATGACAGACCCACATGCTATGAGAGATGGCGGTTCAGGCGGCGGTGGTAGCGGCGGAGCTGCTGTTGAAGAAGCCTCTGATACCG CCGCTGCCAACCAGCTGATGAACAATGTGCCTCAGGCTCTCCAGCAGCTGGCCCAACCTACACAGGGCACAACACCTTCTAGCAAGCTCGGCGGCCTGTGGAAAACCGTGTCTC
. . Nucleotide sequence protein
CTCACAGATCCCCAATCAGCAACATGGTGTCTATGGCCAACAACCACATGAGCATGACCAACAGCGGCGTGTCCATGACAAACACCCTGTCCTCCATGCTGAAGGGCTTTGCCCC AGCAGCAGCTGCACAGGCTGTTCAGACAGCAGCACAGAACGGCGTGCGGGCTATGTCTAGCCTGGGAAGCTCTCTTGGAGGTTCAGGCGGAGGCGGATCTGGCGGAGTTGTT CCTCCTGCCGCTGATGAAGTGTCTGCCCTGACAGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCAAGAGCCGCCGCAATCCACGATCAGTTCGTGGCC ACACTGGCCAGCAGCGCCAGTTCTTATGCCGCCACTGAAGTGGCCAATGCTGCCGCAGGCGGTAGCGGTGGCGGTGGTTCCGGTGGAATGGTGGATTTTGGAGCCCTGCCACC TGAGATCAACAGCGCCAGGATGTATGCCGGACCTGGATCTGCTTCTCTGGTGGCTGCTGCTCAGATGTGGGATAGCGTGGCCAGCGACCTGTTTTCTGCCGCAAGCGCCTTTC AGTCTGTCGTGTGGGGACTGACAGTCGGCTCTTGGATCGGATCTAGCGCCGGACTGATGGTGGCAGCCGCTTCTCCTTATGTGGCCTGGATGTCTGTGACAGCCGGACAGGCT GAACTGACCGCTGCTCAAGTTCGAGTTGCCGCCGCAGCCTACGAGACAGCCTATGGACTTACAGTGCCTCCTCCAGTGATCGCCGAGAACAGAGCCGAGCTGATGATCCTGATC GCCACCAACCTGCTGGGCCAGAACACACCAGCCATTGCCGTGAATGAGGCCGAGTACGGCGAGATGTGGGCCCAAGATGCCGCTGCTATGTTTGGCTATGGTGGCAGCGGAGG CGGAGGTTCTGGCGGAATGACCATCAACTACCAGTTCGGCGACGTGGACGCCCACGGCGCTATGATTAGAGCACAGGCCGGATCTCTGGAAGCCGAGCACCAGGCCATCATCT CCGATGTGCTGACCGCCAGCGATTTTTGGGGAGGTGCTGGCTCTGCTGCCTGCCAGGGCTTTATTACACAGCTGGGCAGAAACTTCCAAGTGATCTATGAGCAGGCCAACGCTC ACGGCCAGAAGGTGCAAGCCGCCGGAAACAATATGGCCCAGACAGATTCTGCCGTGGGCAGCTCTTGGGCAGGCGGCTCCGGTGGCGGCGGAAGCGGCGGAGTTGATGCTCA TGGCGCAATGATCAGAGCCCAAGCCGCCAGCCTGGAAGCTGAACATCAGGCTATCGTGCGCGACGTTCTGGCAGCTGGGGATTTCTGGGGCGGAGCAGGTTCTGTGGCCTGCC AAGAGTTTATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTACGAGCAAGGCGGTAGTGGCGGCGGAGGCTCAGGCGGAATCGTGGGAATTGTGGCAGGACTGGCAGTGCTG GCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCGGAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCA GCGACGTGTCACTGACAGCCTGATAA[SEQ ID NO: 172]
GACTACAAGGACGATGACGACAAAGTCGTACCGCCAGCCGCCGATGAGGTGTCAGCTTTGACCGCAGCTCACTTTGCCGCTCACGCTGCTATGTACCAGTCTGTATCTGCCAGA GCAGCCGCAATTCACGATCAGTTTGTGGCCACACTGGCGAGTAGCGCCTCAAGCTATGCGGCCACCGAGGTTGCCAATGCCGCGGCTGGTGGTTCCGGTGGCGGAGGGTCCGG TGGCATGACTTCACGCTTCATGACAGATCCCCACGCTATGCGGGATATGGCAGGCAGATTCGAGGTCCATGCGCAAACCGTGGAGGATGAAGCGCGTAGGATGTGGGCTTCCG CTCAGAATATTAGCGGTGCCGGGTGGAGCGGGATGGCCGAAGCTACGTCCCTCGACACAATGACCCAGATGAACCAGGCATTTCGCAACATCGTGAATATGCTCCATGGGGTG AGGGATGGCCTGGTGAGGGATGCGAACAACTATGAGCAGCAGGAACAGGCGAGTCAACAGATTCTCTCCTCTGGTGGCTCTGGTGGCGGCGGGAGCGGTGGAATGCATGTGA St no 8 (O GCTTTGTTATGGCATATCCCGAAATGCTGGCCGCAGCTGCCGATACTCTCCAGAGTATTGGAGCTACGACTGTGGCCGGAGGCTCCGGTGGTGGCGGTAGCGGAGGCATGACC
9 a w ATCAACTACCAGTTTGGGGACGTAGATGCTCATGGGGCCATGATACGAGCACAAGCTGGCTCCCTCGAAGCTGAGCACCAGGCCATAATCTCTGACGTCCTGACTGCTTCCGAC
TTCTGGGGAGGCGCGGGAAGTGCAGCCTGTCAGGGATTCATAACGCAGCTTGGGAGGAACTTTCAGGTGATCTATGAGCAGGCCAATGCCCATGGCCAAAAGGTTCAGGCCGC TGGAAACAACATGGCACAGACAGACAGCGCTGTGGGGAGTTCATGGGCCGGCGGCTCCGGCGGAGGCGGCAGTGGAGGCGTGGACGCACACGGAGCTATGATCCGAGCCCAA GCAGCCAGCCTGGAAGCAGAGCACCAGGCAATAGTACGGGATGTGCTGGCTGCGGGCGACTTTTGGGGAGGGGCAGGAAGCGTTGCCTGCCAAGAGTTCATCACCCAGTTGG GCAGAAATTTCCAGGTCATTTACGAACAAGGCGGGTCAGGAGGAGGCGGCTCAGGAGGTATGGCCAGCCGGTTCATGACTGATCCTCACGCCATGCGGGATGGTGGAAGTGGC GGCGGCGGCTCTGGAGGG [SEQ ID NO: 175]
ATGGGAGGTGCGGCAGCCAGACTTGGGGCTGTGATCCTGTTCGTGGTCATTGTCGGCCTGCATGGGGTCAGAGGTGACTACAAGGACGATGACGACAAAGTCGTACCGCCAGC CGCCGATGAGGTGTCAGCTTTGACCGCAGCTCACTTTGCCGCTCACGCTGCTATGTACCAGTCTGTATCTGCCAGAGCAGCCGCAATTCACGATCAGTTTGTGGCCACACTGGC GAGTAGCGCCTCAAGCTATGCGGCCACCGAGGTTGCCAATGCCGCGGCTGGTGGTTCCGGTGGCGGAGGGTCCGGTGGCATGACTTCACGCTTCATGACAGATCCCCACGCTA TGCGGGATATGGCAGGCAGATTCGAGGTCCATGCGCAAACCGTGGAGGATGAAGCGCGTAGGATGTGGGCTTCCGCTCAGAATATTAGCGGTGCCGGGTGGAGCGGGATGGC CGAAGCTACGTCCCTCGACACAATGACCCAGATGAACCAGGCATTTCGCAACATCGTGAATATGCTCCATGGGGTGAGGGATGGCCTGGTGAGGGATGCGAACAACTATGAGC Strina 8 111 AGCAGGAACAGGCGAGTCAACAGATTCTCTCCTCTGGTGGCTCTGGTGGCGGCGGGAGCGGTGGAATGCATGTGAGCTTTGTTATGGCATATCCCGAAATGCTGGCCGCAGCT
9 GCCGATACTCTCCAGAGTATTGGAGCTACGACTGTGGCCGGAGGCTCCGGTGGTGGCGGTAGCGGAGGCATGACCATCAACTACCAGTTTGGGGACGTAGATGCTCATGGGGC
CATGATACGAGCACAAGCTGGCTCCCTCGAAGCTGAGCACCAGGCCATAATCTCTGACGTCCTGACTGCTTCCGACTTCTGGGGAGGCGCGGGAAGTGCAGCCTGTCAGGGAT TCATAACGCAGCTTGGGAGGAACTTTCAGGTGATCTATGAGCAGGCCAATGCCCATGGCCAAAAGGTTCAGGCCGCTGGAAACAACATGGCACAGACAGACAGCGCTGTGGGG AGTTCATGGGCCGGCGGCTCCGGCGGAGGCGGCAGTGGAGGCGTGGACGCACACGGAGCTATGATCCGAGCCCAAGCAGCCAGCCTGGAAGCAGAGCACCAGGCAATAGTAC GGGATGTGCTGGCTGCGGGCGACTTTTGGGGAGGGGCAGGAAGCGTTGCCTGCCAAGAGTTCATCACCCAGTTGGGCAGAAATTTCCAGGTCATTTACGAACAAGGCGGGTCA GGAGGAGGCGGCTCAGGAGGTATGGCCAGCCGGTTCATGACTGATCCTCACGCCATGCGGGATGGTGGAAGTGGCGGCGGCGGCTCTGGAGGGATCGTGGGAATTGTGGCAG
Nucleotide sequence
GACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCGGAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGA
TAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 176]
GACTATAAGGACGATGACGACAAAGTTGTGCCGCCAGCTGCTGATGAAGTGAGTGCCCTGACCGCCGCTCACTTTGCCGCACATGCGGCTATGTACCAGTCCGTTAGCGCTCGT GCAGCGGCTATTCACGACCAGTTTGTGGCTACACTTGCTTCCTCCGCCTCAAGTTATGCTGCAACTGAAGTCGCCAATGCAGCCGCTGGCGGTTCAGGTGGCGGTGGGAGTGG CGGGATGACAAGCCGGTTTATGACCGATCCCCATGCAATGCGCGACATGGCTGGGAGGTTTGAGGTCCACGCCCAGACTGTCGAGGACGAAGCCAGACGGATGTGGGCAAGCG CCCAGAACATTTCAGGCGCGGGGTGGTCCGGCATGGCAGAAGCCACGAGCTTGGATACTATGACCCAAATGAACCAGGCCTTTCGGAACATCGTGAATATGTTGCACGGCGTTA GGGATGGTCTGGTGAGGGATGCAAACAACTACGAACAACAGGAACAGGCCTCCCAGCAGATACTCAGCAGTGGTGGGAGTGGAGGAGGAGGGAGCGGCGGCGCAGCTGTAGA AGAAGCTTCTGATACAGCCGCTGCCAACCAACTTATGAACAATGTTCCCCAAGCCCTCCAACAGCTGGCACAACCGACTCAGGGCACTACCCCTAGCTCCAAACTGGGTGGCCTC TGGAAAACCGTAAGTCCGCACAGGAGTCCAATCAGCAACATGGTGTCCATGGCAAACAATCACATGTCAATGACCAACTCTGGAGTATCCATGACCAATACTCTGAGTTCCATGC TTAAAGGATTCGCACCCGCCGCGGCCGCTCAGGCAGTGCAAACAGCCGCTCAGAATGGTGTAAGAGCCATGAGTTCTCTCGGCAGTAGCCTTGGTGGGAGCGGCGGAGGAGGA St no 9 (O AGTGGAGGCATGCACGTGTCCTTCGTGATGGCATATCCAGAGATGCTTGCGGCCGCCGCAGATACCCTCCAATCCATTGGCGCAACCACGGTCGCCGGCGGAAGCGGCGGCGG btring y ( Sj TGGATCAGGTGGAATGACGATAAATTACCAATTCGGGGATGTGGATGCTCATGGCGCTATGATTCGAGCCCAAGCTGGCTCTCTCGAAGCAGAACATCAGGCCATCATCTCTGA
CGTTCTGACAGCATCCGATTTCTGGGGCGGGGCCGGCAGCGCCGCCTGCCAGGGATTCATAACACAGCTTGGGAGAAACTTTCAGGTCATCTATGAGCAAGCCAATGCCCATG GTCAAAAGGTACAGGCTGCGGGTAATAACATGGCTCAAACCGACTCAGCCGTCGGTTCAAGCTGGGCGGGCGGGTCTGGAGGAGGTGGGTCTGGCGGAGTGGATGCACACGG CGCCATGATTAGGGCCCAAGCTGCCTCTCTGGAGGCTGAACACCAGGCTATTGTCAGGGATGTACTTGCCGCAGGGGATTTTTGGGGAGGCGCAGGGAGTGTGGCCTGCCAGG AGTTCATCACACAGCTCGGACGCAACTTCCAGGTCATATACGAGCAAGGTGGTTCCGGGGGGGGAGGAAGCGGCGGCATGGCCAGTAGGTTCATGACGGACCCACATGCAATG CGGGATGGCGGCTCCGGCGGTGGCGGATCTGGTGGTGGGGTTGCGGCTAACCTGGGCAGGGCGGCAAGCGTGGGGAGCCTGAGTGTCCCTCAGGCCTGGGCAGCCGCGAAT CAGGCTGTTACCCCTGCTGCTCGTGCCCTTCCCTTGACCTCTCTCACCAGTGCCGCTGAAAGAGGGCCAGGTCAGATGTTGGGCGGCTTGCCCGTAGGACAGATGGGAGCTAG AGCCGGCGGAGGCCTGTCCGGTGTGTTGCGAGTTCCACCCCGACCTTACGTGATGCCGCACTCACCAGCCGCAGGCGGTGGATCTGGCGGTGGCGGATCAGGCGGA [SEQ ID NO: 179] ATGGGGGGGGCAGCTGCACGCCTCGGGGCTGTGATCCTTTTTGTGGTCATTGTGGGGCTTCACGGAGTACGGGGTGACTATAAGGACGATGACGACAAAGTTGTGCCGCCAG CTGCTGATGAAGTGAGTGCCCTGACCGCCGCTCACTTTGCCGCACATGCGGCTATGTACCAGTCCGTTAGCGCTCGTGCAGCGGCTATTCACGACCAGTTTGTGGCTACACTTG CTTCCTCCGCCTCAAGTTATGCTGCAACTGAAGTCGCCAATGCAGCCGCTGGCGGTTCAGGTGGCGGTGGGAGTGGCGGGATGACAAGCCGGTTTATGACCGATCCCCATGCA ATGCGCGACATGGCTGGGAGGTTTGAGGTCCACGCCCAGACTGTCGAGGACGAAGCCAGACGGATGTGGGCAAGCGCCCAGAACATTTCAGGCGCGGGGTGGTCCGGCATGG CAGAAGCCACGAGCTTGGATACTATGACCCAAATGAACCAGGCCTTTCGGAACATCGTGAATATGTTGCACGGCGTTAGGGATGGTCTGGTGAGGGATGCAAACAACTACGAAC AACAGGAACAGGCCTCCCAGCAGATACTCAGCAGTGGTGGGAGTGGAGGAGGAGGGAGCGGCGGCGCAGCTGTAGAAGAAGCTTCTGATACAGCCGCTGCCAACCAACTTATG String 9 (I) AACAATGTTCCCCAAGCCCTCCAACAGCTGGCACAACCGACTCAGGGCACTACCCCTAGCTCCAAACTGGGTGGCCTCTGGAAAACCGTAAGTCCGCACAGGAGTCCAATCAGC AACATGGTGTCCATGGCAAACAATCACATGTCAATGACCAACTCTGGAGTATCCATGACCAATACTCTGAGTTCCATGCTTAAAGGATTCGCACCCGCCGCGGCCGCTCAGGCA GTGCAAACAGCCGCTCAGAATGGTGTAAGAGCCATGAGTTCTCTCGGCAGTAGCCTTGGTGGGAGCGGCGGAGGAGGAAGTGGAGGCATGCACGTGTCCTTCGTGATGGCATA TCCAGAGATGCTTGCGGCCGCCGCAGATACCCTCCAATCCATTGGCGCAACCACGGTCGCCGGCGGAAGCGGCGGCGGTGGATCAGGTGGAATGACGATAAATTACCAATTCG GGGATGTGGATGCTCATGGCGCTATGATTCGAGCCCAAGCTGGCTCTCTCGAAGCAGAACATCAGGCCATCATCTCTGACGTTCTGACAGCATCCGATTTCTGGGGCGGGGCC GGCAGCGCCGCCTGCCAGGGATTCATAACACAGCTTGGGAGAAACTTTCAGGTCATCTATGAGCAAGCCAATGCCCATGGTCAAAAGGTACAGGCTGCGGGTAATAACATGGCT CAAACCGACTCAGCCGTCGGTTCAAGCTGGGCGGGCGGGTCTGGAGGAGGTGGGTCTGGCGGAGTGGATGCACACGGCGCCATGATTAGGGCCCAAGCTGCCTCTCTGGAGG
. . Nucleotide sequence protein _ _
CTGAACACCAGGCTATTGTCAGGGATGTACTTGCCGCAGGGGATTTTTGGGGAGGCGCAGGGAGTGTGGCCTGCCAGGAGTTCATCACACAGCTCGGACGCAACTTCCAGGTC ATATACGAGCAAGGTGGTTCCGGGGGGGGAGGAAGCGGCGGCATGGCCAGTAGGTTCATGACGGACCCACATGCAATGCGGGATGGCGGCTCCGGCGGTGGCGGATCTGGTG GTGGGGTTGCGGCTAACCTGGGCAGGGCGGCAAGCGTGGGGAGCCTGAGTGTCCCTCAGGCCTGGGCAGCCGCGAATCAGGCTGTTACCCCTGCTGCTCGTGCCCTTCCCTTG ACCTCTCTCACCAGTGCCGCTGAAAGAGGGCCAGGTCAGATGTTGGGCGGCTTGCCCGTAGGACAGATGGGAGCTAGAGCCGGCGGAGGCCTGTCCGGTGTGTTGCGAGTTC CACCCCGACCTTACGTGATGCCGCACTCACCAGCCGCAGGCGGTGGATCTGGCGGTGGCGGATCAGGCGGAATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGT GGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCGGAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTG TCACTGACAGCCTAATGA [SEQ ID NO: 180]
GTTGTGCCTCCTGCCGCTGATGAAGTGTCTGCCCTGACAGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCTAGAGCCGCCGCTATCCACGATCAGTTC GTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGCCACTGAAGTGGCCAATGCTGCCGCTGGTGGATCTGGTGGTGGCGGATCTGGCGGCGGAGTTGCAGCTAATCTTGG CAGAGCTGCCAGCGTGGGCTCTCTGTCTGTTCCTCAAGCTTGGGCCGCTGCCAATCAGGCTGTTACACCAGCTGCAAGAGCCCTGCCTCTGACCTCTCTGACATCTGCCGCAGA ACGAGGCCCTGGACAGATGCTTGGAGGACTGCCTGTGGGACAGATGGGAGCTAGAGCTGGCGGAGGACTTTCTGGCGTGCTGAGAGTTCCTCCTCGGCCTTACGTGATGCCTC ATTCTCCTGCTGCCGGCGGAGGAAGTGGCGGAGGCGGAAGCGGAGGTGTTGATGCTCATGGGGCCATGATTAGAGCCCAGGCCGCTTCTCTGGAAGCCGAGCATCAAGCCATT GTGCGGGATGTTCTGGCCGCTGGCGATTTTTGGGGAGGCGCTGGTTCTGTGGCCTGCCAAGAGTTTATCACACAGCTGGGCAGAAACTTCCAAGTGATCTACGAGCAAGGCGG TAGCGGTGGCGGTGGTTCTGGCGGAATGTCTCTGCTGGATGCCCACATTCCTCAGCTGGTGGCCAGCCAGTCTGCCTTTGCTGCTAAAGCCGGCCTGATGAGACACACCATTG GACAGGCTGAACAGGCCGCTATGAGCGCCCAGGCTTTTCACCAAGGCGAAAGCAGCGCCGCCTTTCAGGCTGCCCATGCCAGATTTGTTGCCGCTGCCGCCAAAGTGAACACCC TGCTTGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCCGGAACTTATGTGGCCGCAGATGCTGCTGCCGCCTCTACCTATACCGGCTTTGGAGGCTCAGGTGGCGGTGGAAGC
St inn 10 (-s') GGAGGCATGCATGTGTCCTTCGTGATGGCTTACCCCGAGATGCTGGCAGCCGCTGCTGATACACTCCAGTCTATCGGCGCCACAACAGTGGCAGGCGGCTCAGGCGGCGGAGG 9 U CTCTGGCGGAGCAGCTGTTGAAGAAGCCTCTGATACCGCCGCAGCCAACCAGCTGATGAACAATGTGCCTCAGGCTCTCCAGCAGCTGGCCCAACCTACACAGGGCACAACACC ntl ATCTTCTAAGCTCGGCGGCCTGTGGAAAACCGTGTCTCCTCACAGATCCCCAATCAGCAACATGGTGTCCATGGCCAACAACCACATGAGCATGACCAACAGCGGCGTGTCCAT
GACAAACACCCTGTCCTCCATGCTGAAGGGCTTTGCCCCTGCCGCAGCTGCTCAAGCTGTTCAGACAGCTGCACAGAATGGCGTGCGGGCCATGTCTAGCCTGGGAAGCTCTCT TGGTGGCAGCGGAGGCGGAGGTAGCGGAGGAATGACCATCAACTACCAGTTCGGCGACGTGGACGCCCACGGCGCTATGATAAGAGCACAGGCTGGAAGCCTGGAAGCTGAA CACCAGGCCATCATCAGCGACGTGCTGACCGCTTCTGATTTCTGGGGTGGCGCAGGATCTGCCGCCTGTCAGGGATTCATTACCCAGCTCGGCCGGAATTTTCAAGTCATCTAT GAGCAGGCCAACGCTCACGGCCAGAAGGTTCAAGCCGCTGGCAACAATATGGCCCAGACCGATTCTGCCGTGGGCAGTTCTTGGGCTGGTGGCTCAGGCGGAGGTGGCAGTG GTGGAATGGTGGATTTTGGCGCCCTGCCACCTGAAATCAACAGCGCCAGGATGTATGCCGGACCTGGATCTGCATCTCTGGTGGCCGCTGCTCAGATGTGGGATAGTGTGGCC TCCGACCTGTTTAGCGCCGCCAGCGCTTTTCAGTCTGTTGTGTGGGGCCTGACCGTCGGCTCTTGGATTGGATCTTCTGCCGGACTGATGGTGGCTGCTGCCTCTCCATATGTG GCCTGGATGTCTGTGACAGCCGGACAGGCAGAACTGACCGCTGCACAAGTTCGAGTGGCTGCCGCCGCTTACGAGACAGCCTATGGACTGACAGTGCCTCCTCCAGTGATCGC CGAGAATAGAGCCGAGCTGATGATCCTGATCGCCACCAATCTGCTGGGCCAGAATACCCCTGCCATTGCCGTGAATGAGGCCGAGTATGGCGAGATGTGGGCCCAAGATGCCG CCGCAATGTTTGGCTATGGTGGAAGTGGTGGCGGAGGCAGCGGTGGATAA [SEQ ID NO: 181]
GTTGTTCCACCAGCCGCAGATGAAGTCTCTGCTCTGACCGCAGCGCATTTCGCCGCTCATGCGGCGATGTACCAGTCAGTCTCCGCCAGAGCTGCGGCCATACACGACCAGTTT GTGGCCACACTGGCAAGTAGTGCCAGTTCTTATGCGGCGACAGAAGTGGCAAACGCAGCAGCCGGTGGCTCCGGCGGCGGTGGAAGCGGCGGTGGGGTGGCCGCAAATCTGG GGAGAGCTGCGTCTGTCGGCAGTCTTTCAGTCCCTCAGGCCTGGGCTGCTGCCAATCAGGCAGTCACACCCGCAGCCCGGGCTCTCCCACTCACTTCACTCACCAGCGCAGCCG AACGCGGCCCTGGCCAGATGCTGGGCGGCCTGCCAGTAGGTCAGATGGGCGCCCGAGCCGGAGGCGGGCTTTCCGGCGTTCTTAGGGTACCTCCCCGTCCCTATGTCATGCCC String 10 (s) CATAGTCCCGCAGCTGGCGGAGGTAGTGGTGGAGGTGGGAGTGGTGGAGTGGACGCTCACGGGGCCATGATTCGGGCGCAAGCTGCTAGTCTCGAAGCAGAGCACCAGGCAA nt2 TAGTCAGGGATGTGTTGGCCGCGGGAGATTTCTGGGGAGGAGCAGGGAGTGTGGCTTGCCAGGAGTTCATCACGCAATTGGGTCGGAACTTCCAAGTTATTTACGAGCAAGGG
GGCAGCGGAGGCGGCGGCTCCGGGGGAATGAGCCTCCTGGATGCCCACATTCCCCAGCTGGTTGCGAGCCAGAGCGCATTCGCAGCGAAAGCAGGACTGATGAGGCACACCAT TGGTCAGGCGGAACAAGCTGCCATGTCTGCTCAAGCGTTTCATCAGGGTGAATCTTCCGCGGCCTTTCAGGCTGCCCATGCACGCTTTGTCGCCGCCGCAGCAAAGGTGAATAC CCTTCTCGACGTAGCTCAGGCTAACCTGGGTGAGGCTGCTGGAACTTATGTGGCAGCAGATGCTGCTGCCGCATCCACTTATACGGGATTTGGAGGCTCTGGTGGCGGAGGAA GCGGAGGGATGCACGTGAGTTTCGTGATGGCTTACCCCGAAATGTTGGCTGCGGCTGCTGACACCCTCCAGTCAATTGGTGCAACTACTGTTGCAGGAGGATCTGGCGGCGGA
. . Nucleotide sequence protein _ _
GGTAGCGGCGGAGCGGCTGTCGAGGAAGCTTCCGATACGGCCGCAGCTAATCAGCTCATGAACAATGTGCCACAAGCCCTCCAGCAACTTGCTCAACCAACTCAGGGAACTACA CCTTCAAGCAAGCTCGGAGGGCTGTGGAAAACCGTGTCTCCTCACCGCTCCCCAATCTCTAACATGGTTTCTATGGCCAACAACCACATGTCCATGACCAATTCCGGTGTTTCCA TGACGAATACTCTGAGTAGTATGCTGAAGGGATTTGCGCCTGCGGCAGCGGCCCAAGCAGTGCAGACAGCTGCCCAGAACGGCGTACGGGCCATGTCAAGCCTGGGTAGCAGT CTGGGAGGGTCCGGTGGCGGCGGAAGCGGCGGCATGACCATAAACTACCAGTTTGGCGACGTCGATGCCCATGGCGCTATGATCAGGGCCCAGGCCGGTTCCCTGGAAGCAG AGCATCAGGCCATTATCTCCGATGTGCTGACTGCGAGCGACTTTTGGGGCGGTGCCGGGTCTGCCGCCTGTCAGGGATTCATTACCCAGCTGGGACGGAATTTCCAGGTCATA TACGAGCAAGCAAATGCACATGGGCAGAAAGTACAAGCGGCGGGCAACAATATGGCCCAGACCGACAGCGCTGTAGGCTCATCCTGGGCCGGCGGCTCAGGAGGTGGCGGTTC CGGTGGCATGGTGGACTTCGGAGCCTTGCCGCCAGAAATCAACTCTGCTAGAATGTATGCCGGCCCTGGCAGCGCCAGCCTGGTAGCTGCGGCACAGATGTGGGACTCAGTGG CTTCCGACTTGTTCTCTGCCGCATCAGCATTCCAGTCAGTGGTTTGGGGATTGACGGTCGGAAGCTGGATTGGTTCTAGCGCGGGTCTGATGGTGGCGGCCGCAAGCCCATAC GTCGCCTGGATGAGCGTAACTGCGGGCCAAGCTGAGCTGACGGCCGCCCAGGTGCGTGTGGCAGCCGCCGCTTACGAGACAGCCTATGGTTTGACAGTCCCACCTCCCGTGAT CGCAGAAAATCGTGCCGAGTTGATGATATTGATCGCAACTAACTTGCTGGGCCAGAACACCCCTGCTATTGCAGTTAATGAGGCTGAGTATGGGGAGATGTGGGCGCAAGATG CTGCCGCCATGTTTGGGTACGGTGGGTCCGGTGGCGGAGGGAGCGGCGGGTAATGA [SEQ ID NO: 182]
GTGGTGCCTCCTGCTGCTGATGAAGTGTCTGCTCTGACAGCTGCTCACTTTGCTGCTCATGCTGCCATGTACCAGTCTGTGTCTGCCAGAGCTGCTGCCATTCATGATCAGTTT GTGGCCACCCTGGCTTCTTCTGCTTCTTCTTATGCTGCCACAGAAGTGGCCAATGCCGCCGCCGGAGGCTCTGGCGGAGGTGGCAGTGGTGGCGGCGTGGCTGCCAATCTGGG CAGAGCTGCTTCTGTGGGATCTCTGTCTGTGCCTCAGGCTTGGGCTGCTGCCAATCAGGCTGTGACCCCTGCTGCCAGAGCCCTGCCTCTGACCTCTCTGACCTCTGCTGCTGA AAGAGGACCTGGACAGATGCTGGGAGGACTGCCTGTGGGACAGATGGGAGCCAGAGCTGGAGGAGGACTGTCTGGAGTGCTGAGAGTGCCTCCCAGACCTTATGTGATGCCT CACTCTCCTGCTGCTGGCGGTGGCTCCGGCGGAGGTGGCTCTGGCGGAGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGCTTCTCTGGAAGCTGAACACCAGGCCAT TGTGAGAGATGTGCTGGCTGCTGGAGATTTCTGGGGAGGAGCTGGATCTGTGGCTTGCCAGGAATTCATCACCCAGCTGGGCAGAAATTTCCAGGTGATCTATGAACAGGGCG GATCTGGCGGAGGTGGCAGCGGTGGAATGTCTCTGCTGGATGCTCACATCCCTCAGCTGGTGGCTTCTCAGTCTGCTTTTGCTGCCAAGGCTGGACTGATGAGACACACCATT GGACAGGCTGAACAGGCTGCCATGTCTGCTCAGGCTTTCCACCAGGGAGAATCTTCTGCTGCTTTCCAGGCTGCTCATGCCAGATTTGTGGCTGCTGCTGCCAAGGTGAACACC CTGCTGGATGTGGCTCAGGCCAATCTGGGAGAAGCTGCTGGAACCTATGTGGCTGCTGATGCTGCTGCTGCCAGCACCTACACAGGCTTTGGAGGCTCCGGCGGAGGTGGCTC Strinn i n (s') AGGTGGAATGCATGTGTCTTTTGTGATGGCTTACCCTGAAATGCTGGCTGCTGCTGCTGACACCCTCCAGAGCATTGGAGCCACCACAGTGGCTGGAGGCTCAGGAGGTGGCG
9 1 J GATCAGGAGGTGCTGCTGTGGAAGAAGCTTCTGACACAGCTGCTGCCAATCAGCTGATGAACAATGTGCCTCAGGCTCTCCAGCAGCTGGCTCAGCCCACCCAGGGAACCACCC ntJ CCAGCAGCAAACTGGGAGGACTGTGGAAGACAGTGTCTCCTCACAGATCTCCCATCAGCAACATGGTGAGCATGGCCAACAATCACATGAGCATGACCAATTCTGGAGTGAGCA
TGACCAACACCCTGAGCAGCATGCTGAAGGGATTTGCTCCTGCTGCTGCTGCTCAGGCTGTGCAGACAGCTGCTCAGAATGGAGTGAGAGCCATGTCTTCTCTGGGATCTTCTC TGGGAGGCAGTGGAGGTGGCGGATCAGGTGGAATGACCATCAATTACCAGTTTGGAGATGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGGATCTCTGGAAGCTGAA CACCAGGCCATCATTTCTGATGTGCTGACAGCTTCTGATTTCTGGGGAGGAGCTGGATCTGCTGCTTGCCAGGGATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTAT GAACAGGCCAATGCTCATGGACAGAAGGTGCAGGCTGCTGGAAACAACATGGCTCAGACAGATTCTGCTGTGGGATCTTCTTGGGCTGGTGGCTCAGGCGGAGGTGGCAGTGG TGGCATGGTGGATTTTGGAGCCCTGCCTCCTGAAATCAATTCTGCCAGAATGTATGCTGGACCTGGATCTGCTTCTCTGGTGGCTGCTGCTCAGATGTGGGATTCTGTGGCTTC TGACCTGTTCTCTGCTGCTH’CTGCTTTCCAGTCTGTGGTGTGGGGACTGACAGTGGGATCTTGGATTGGATCTTCTGCTGGACTGATGGTGGCTGCTGCTTCTCCTTATGTGGC TTGGATGTCTGTGACAGCTGGACAGGCTGAACTGACAGCTGCTCAGGTGAGAGTGGCTGCTGCTGCTTATGAAACAGCTTATGGACTGACAGTGCCTCCTCCTGTGATTGCTGA AAACAGAGCTGAACTGATGATTCTGATTGCCACCAATCTGCTGGGACAGAACACCCCTGCCATTGCTGTGAATGAAGCTGAATATGGAGAAATGTGGGCTCAGGATGCTGCTGC CATGTTTGGCTATGGTGGCAGTGGCGGTGGAGGCAGTGGTGGCTAATGA [SEQ ID NO: 183]
. . Nucleotide sequence protein
ATGGGCGGAGCTGCTGCTAGACTGGGAGCCGTGATCCTGTTCGTGGTTATCGTGGGACTGCACGGCGTTAGAGGCGTTGTGCCTCCTGCCGCTGATGAAGTGTCTGCCCTGAC AGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCTAGAGCCGCCGCTATCCACGATCAGTTCGTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGC CACTGAAGTGGCCAATGCTGCCGCTGGTGGATCTGGTGGTGGCGGATCTGGCGGCGGAGTTGCAGCTAATCTTGGCAGAGCTGCCAGCGTGGGCTCTCTGTCTGTTCCTCAAG CTTGGGCCGCTGCCAATCAGGCTGTTACACCAGCTGCAAGAGCCCTGCCTCTGACCTCTCTGACATCTGCCGCAGAACGAGGCCCTGGACAGATGCTTGGAGGACTGCCTGTGG GACAGATGGGAGCTAGAGCTGGCGGAGGACTTTCTGGCGTGCTGAGAGTTCCTCCTCGGCCTTACGTGATGCCTCATTCTCCTGCTGCCGGCGGAGGAAGTGGCGGAGGCGG AAGCGGAGGTGTTGATGCTCATGGGGCCATGATTAGAGCCCAGGCCGCTTCTCTGGAAGCCGAGCATCAAGCCATTGTGCGGGATGTTCTGGCCGCTGGCGATTTTTGGGGAG GCGCTGGTTCTGTGGCCTGCCAAGAGTTTATCACACAGCTGGGCAGAAACTTCCAAGTGATCTACGAGCAAGGCGGTAGCGGTGGCGGTGGTTCTGGCGGAATGTCTCTGCTG GATGCCCACATTCCTCAGCTGGTGGCCAGCCAGTCTGCCTTTGCTGCTAAAGCCGGCCTGATGAGACACACCATTGGACAGGCTGAACAGGCCGCTATGAGCGCCCAGGCTTTT CACCAAGGCGAAAGCAGCGCCGCCTTTCAGGCTGCCCATGCCAGATTTGTTGCCGCTGCCGCCAAAGTGAACACCCTGCTTGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCC GGAACTTATGTGGCCGCAGATGCTGCTGCCGCCTCTACCTATACCGGCTTTGGAGGCTCAGGTGGCGGTGGAAGCGGAGGCATGCATGTGTCCTTCGTGATGGCTTACCCCGA Strinn 10 in GATGCTGGCAGCCGCTGCTGATACACTCCAGTCTATCGGCGCCACAACAGTGGCAGGCGGCTCAGGCGGCGGAGGCTCTGGCGGAGCAGCTGTTGAAGAAGCCTCTGATACCG 9 U CCGCAGCCAACCAGCTGATGAACAATGTGCCTCAGGCTCTCCAGCAGCTGGCCCAACCTACACAGGGCACAACACCATCTTCTAAGCTCGGCGGCCTGTGGAAAACCGTGTCTC ntl CTCACAGATCCCCAATCAGCAACATGGTGTCCATGGCCAACAACCACATGAGCATGACCAACAGCGGCGTGTCCATGACAAACACCCTGTCCTCCATGCTGAAGGGCTTTGCCCC
TGCCGCAGCTGCTCAAGCTGTTCAGACAGCTGCACAGAATGGCGTGCGGGCCATGTCTAGCCTGGGAAGCTCTCTTGGTGGCAGCGGAGGCGGAGGTAGCGGAGGAATGACC ATCAACTACCAGTTCGGCGACGTGGACGCCCACGGCGCTATGATAAGAGCACAGGCTGGAAGCCTGGAAGCTGAACACCAGGCCATCATCAGCGACGTGCTGACCGCTTCTGAT TTCTGGGGTGGCGCAGGATCTGCCGCCTGTCAGGGATTCATTACCCAGCTCGGCCGGAATTTTCAAGTCATCTATGAGCAGGCCAACGCTCACGGCCAGAAGGTTCAAGCCGCT GGCAACAATATGGCCCAGACCGATTCTGCCGTGGGCAGTTCTTGGGCTGGTGGCTCAGGCGGAGGTGGCAGTGGTGGAATGGTGGATTTTGGCGCCCTGCCACCTGAAATCAA CAGCGCCAGGATGTATGCCGGACCTGGATCTGCATCTCTGGTGGCCGCTGCTCAGATGTGGGATAGTGTGGCCTCCGACCTGTTTAGCGCCGCCAGCGCTTTTCAGTCTGTTG TGTGGGGCCTGACCGTCGGCTCTTGGATTGGATCTTCTGCCGGACTGATGGTGGCTGCTGCCTCTCCATATGTGGCCTGGATGTCTGTGACAGCCGGACAGGCAGAACTGACC GCTGCACAAGTTCGAGTGGCTGCCGCCGCTTACGAGACAGCCTATGGACTGACAGTGCCTCCTCCAGTGATCGCCGAGAATAGAGCCGAGCTGATGATCCTGATCGCCACCAAT CTGCTGGGCCAGAATACCCCTGCCATTGCCGTGAATGAGGCCGAGTATGGCGAGATGTGGGCCCAAGATGCCGCCGCAATGTTTGGCTATGGTGGAAGTGGTGGCGGAGGCA GCGGTGGAATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCGGAGGCAAGGGCG GCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAA [SEQ ID NO: 184] ATGGGAGGGGCCGCCGCCAGACTTGGGGCTGTTATTCTGTTCGTCGTGATTGTGGGACTGCATGGCGTCCGTGGCGTTGTTCCACCAGCCGCAGATGAAGTCTCTGCTCTGAC CGCAGCGCATTTCGCCGCTCATGCGGCGATGTACCAGTCAGTCTCCGCCAGAGCTGCGGCCATACACGACCAGTTTGTGGCCACACTGGCAAGTAGTGCCAGTTCTTATGCGGC GACAGAAGTGGCAAACGCAGCAGCCGGTGGCTCCGGCGGCGGTGGAAGCGGCGGTGGGGTGGCCGCAAATCTGGGGAGAGCTGCGTCTGTCGGCAGTCTTTCAGTCCCTCAG GCCTGGGCTGCTGCCAATCAGGCAGTCACACCCGCAGCCCGGGCTCTCCCACTCACTTCACTCACCAGCGCAGCCGAACGCGGCCCTGGCCAGATGCTGGGCGGCCTGCCAGT AGGTCAGATGGGCGCCCGAGCCGGAGGCGGGCTTTCCGGCGTTCTTAGGGTACCTCCCCGTCCCTATGTCATGCCCCATAGTCCCGCAGCTGGCGGAGGTAGTGGTGGAGGTG GGAGTGGTGGAGTGGACGCTCACGGGGCCATGATTCGGGCGCAAGCTGCTAGTCTCGAAGCAGAGCACCAGGCAATAGTCAGGGATGTGTTGGCCGCGGGAGATTTCTGGGG AGGAGCAGGGAGTGTGGCTTGCCAGGAGTTCATCACGCAATTGGGTCGGAACTTCCAAGTTATTTACGAGCAAGGGGGCAGCGGAGGCGGCGGCTCCGGGGGAATGAGCCTC Strinq 10 fl) CTGGATGCCCACATTCCCCAGCTGGTTGCGAGCCAGAGCGCATTCGCAGCGAAAGCAGGACTGATGAGGCACACCATTGGTCAGGCGGAACAAGCTGCCATGTCTGCTCAAGC t2 9 GTTTCATCAGGGTGAATCTTCCGCGGCCTTTCAGGCTGCCCATGCACGCTTTGTCGCCGCCGCAGCAAAGGTGAATACCCTTCTCGACGTAGCTCAGGCTAACCTGGGTGAGGC TGCTGGAACTTATGTGGCAGCAGATGCTGCTGCCGCATCCACTTATACGGGATTTGGAGGCTCTGGTGGCGGAGGAAGCGGAGGGATGCACGTGAGTTTCGTGATGGCTTACC CCGAAATGTTGGCTGCGGCTGCTGACACCCTCCAGTCAATTGGTGCAACTACTGTTGCAGGAGGATCTGGCGGCGGAGGTAGCGGCGGAGCGGCTGTCGAGGAAGCTTCCGAT ACGGCCGCAGCTAATCAGCTCATGAACAATGTGCCACAAGCCCTCCAGCAACTTGCTCAACCAACTCAGGGAACTACACCTTCAAGCAAGCTCGGAGGGCTGTGGAAAACCGTG TCTCCTCACCGCTCCCCAATCTCTAACATGGTTTCTATGGCCAACAACCACATGTCCATGACCAATTCCGGTGTTTCCATGACGAATACTCTGAGTAGTATGCTGAAGGGATTTG CGCCTGCGGCAGCGGCCCAAGCAGTGCAGACAGCTGCCCAGAACGGCGTACGGGCCATGTCAAGCCTGGGTAGCAGTCTGGGAGGGTCCGGTGGCGGCGGAAGCGGCGGCAT GACCATAAACTACCAGTTTGGCGACGTCGATGCCCATGGCGCTATGATCAGGGCCCAGGCCGGTTCCCTGGAAGCAGAGCATCAGGCCATTATCTCCGATGTGCTGACTGCGAG CGACTTTTGGGGCGGTGCCGGGTCTGCCGCCTGTCAGGGATTCATTACCCAGCTGGGACGGAATTTCCAGGTCATATACGAGCAAGCAAATGCACATGGGCAGAAAGTACAAG CGGCGGGCAACAATATGGCCCAGACCGACAGCGCTGTAGGCTCATCCTGGGCCGGCGGCTCAGGAGGTGGCGGTTCCGGTGGCATGGTGGACTTCGGAGCCTTGCCGCCAGA
Chimeric Nucleotide sequence protein
AATCAACTCTGCTAGAATGTATGCCGGCCCTGGCAGCGCCAGCCTGGTAGCTGCGGCACAGATGTGGGACTCAGTGGCTTCCGACTTGTTCTCTGCCGCATCAGCATTCCAGTC
AGTGGTTTGGGGATTGACGGTCGGAAGCTGGATTGGTTCTAGCGCGGGTCTGATGGTGGCGGCCGCAAGCCCATACGTCGCCTGGATGAGCGTAACTGCGGGCCAAGCTGAG
CTGACGGCCGCCCAGGTGCGTGTGGCAGCCGCCGCTTACGAGACAGCCTATGGTTTGACAGTCCCACCTCCCGTGATCGCAGAAAATCGTGCCGAGTTGATGATATTGATCGCA
ACTAACTTGCTGGGCCAGAACACCCCTGCTATTGCAGTTAATGAGGCTGAGTATGGGGAGATGTGGGCGCAAGATGCTGCCGCCATGTTTGGGTACGGTGGGTCCGGTGGCGG
AGGGAGCGGCGGGATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCGGAGGCAA
GGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 185]
ATGGGAGGAGCTGCTGCCAGACTGGGAGCTGTGATTCTGTTTGTGGTGATTGTGGGACTGCATGGAGTGAGAGGAGTGGTGCCTCCTGCTGCTGATGAAGTGTCTGCTCTGAC AGCTGCTCACTTTGCTGCTCATGCTGCCATGTACCAGTCTGTGTCTGCCAGAGCTGCTGCCATTCATGATCAGTTTGTGGCCACCCTGGCTTCTTCTGCTTCTTCTTATGCTGCC ACAGAAGTGGCCAATGCCGCCGCCGGAGGCTCTGGCGGAGGTGGCAGTGGTGGCGGCGTGGCTGCCAATCTGGGCAGAGCTGCTTCTGTGGGATCTCTGTCTGTGCCTCAGG CTTGGGCTGCTGCCAATCAGGCTGTGACCCCTGCTGCCAGAGCCCTGCCTCTGACCTCTCTGACCTCTGCTGCTGAAAGAGGACCTGGACAGATGCTGGGAGGACTGCCTGTG GGACAGATGGGAGCCAGAGCTGGAGGAGGACTGTCTGGAGTGCTGAGAGTGCCTCCCAGACCTTATGTGATGCCTCACTCTCCTGCTGCTGGCGGTGGCTCCGGCGGAGGTG GCTCTGGCGGAGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGCTTCTCTGGAAGCTGAACACCAGGCCATTGTGAGAGATGTGCTGGCTGCTGGAGATTTCTGGGGA GGAGCTGGATCTGTGGCTTGCCAGGAATTCATCACCCAGCTGGGCAGAAATTTCCAGGTGATCTATGAACAGGGCGGATCTGGCGGAGGTGGCAGCGGTGGAATGTCTCTGCT GGATGCTCACATCCCTCAGCTGGTGGCTTCTCAGTCTGCTTTTGCTGCCAAGGCTGGACTGATGAGACACACCATTGGACAGGCTGAACAGGCTGCCATGTCTGCTCAGGCTTT CCACCAGGGAGAATCTTCTGCTGCTTTCCAGGCTGCTCATGCCAGATTTGTGGCTGCTGCTGCCAAGGTGAACACCCTGCTGGATGTGGCTCAGGCCAATCTGGGAGAAGCTGC TGGAACCTATGTGGCTGCTGATGCTGCTGCTGCCAGCACCTACACAGGCTTTGGAGGCTCCGGCGGAGGTGGCTCAGGTGGAATGCATGTGTCTTTTGTGATGGCTTACCCTG
Strinn 10 m AAATGCTGGCTGCTGCTGCTGACACCCTCCAGAGCATTGGAGCCACCACAGTGGCTGGAGGCTCAGGAGGTGGCGGATCAGGAGGTGCTGCTGTGGAAGAAGCTTCTGACACA 9 U GCTGCTGCCAATCAGCTGATGAACAATGTGCCTCAGGCTCTCCAGCAGCTGGCTCAGCCCACCCAGGGAACCACCCCCAGCAGCAAACTGGGAGGACTGTGGAAGACAGTGTCT ntJ CCTCACAGATCTCCCATCAGCAACATGGTGAGCATGGCCAACAATCACATGAGCATGACCAATTCTGGAGTGAGCATGACCAACACCCTGAGCAGCATGCTGAAGGGATTTGCT
CCTGCTGCTGCTGCTCAGGCTGTGCAGACAGCTGCTCAGAATGGAGTGAGAGCCATGTCTTCTCTGGGATCTTCTCTGGGAGGCAGTGGAGGTGGCGGATCAGGTGGAATGAC CATCAATTACCAGTTTGGAGATGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGGATCTCTGGAAGCTGAACACCAGGCCATCATTTCTGATGTGCTGACAGCTTCTGA TTTCTGGGGAGGAGCTGGATCTGCTGCTTGCCAGGGATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGCCAATGCTCATGGACAGAAGGTGCAGGCTG CTGGAAACAACATGGCTCAGACAGATTCTGCTGTGGGATCTTCTTGGGCTGGTGGCTCAGGCGGAGGTGGCAGTGGTGGCATGGTGGATTTTGGAGCCCTGCCTCCTGAAATC AATTCTGCCAGAATGTATGCTGGACCTGGATCTGCTH’CTCTGGTGGCTGCTGCTCAGATGTGGGATTCTGTGGCTTCTGACCTGTTCTCTGCTGCTTCTGCTTTCCAGTCTGTG GTGTGGGGACTGACAGTGGGATCTTGGATTGGATCTTCTGCTGGACTGATGGTGGCTGCTGCTTCTCCTTATGTGGCTTGGATGTCTGTGACAGCTGGACAGGCTGAACTGAC AGCTGCTCAGGTGAGAGTGGCTGCTGCTGCTTATGAAACAGCTTATGGACTGACAGTGCCTCCTCCTGTGATTGCTGAAAACAGAGCTGAACTGATGATTCTGATTGCCACCAA TCTGCTGGGACAGAACACCCCTGCCATTGCTGTGAATGAAGCTGAATATGGAGAAATGTGGGCTCAGGATGCTGCTGCCATGTTTGGCTATGGTGGCAGTGGCGGTGGAGGCA GTGGTGGCATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCGGAGGCAAGGGCG GCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 186]
Chimeric Nucleotide sequence protein
GTTGTGCCTCCTGCCGCTGATGAAGTGTCTGCCCTGACAGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCTAGAGCCGCCGCTATCCACGATCAGTTC GTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGCCACTGAAGTGGCCAATGCTGCCGCTGGTGGATCTGGTGGCGGAGGATCTGGCGGAATGGTGGATTTTGGAGCCCT GCCTCCTGAGATCAACAGCGCCAGGATGTATGCCGGACCTGGCTCTGCTTCTCTGGTGGCTGCTGCTCAGATGTGGGATAGCGTGGCCAGCGACCTGTTTTCTGCCGCCTCTG CCTTTCAGTCTGTCGTGTGGGGACTGACAGTCGGCTCTTGGATCGGATCTTCTGCCGGCCTGATGGTGGCAGCCGCTTCTCCTTATGTGGCCTGGATGTCTGTGACAGCCGGA CAGGCTGAACTGACCGCTGCTCAAGTTCGAGTGGCCGCTGCCGCTTACGAGACAGCCTATGGACTTACCGTGCCTCCTCCAGTGATCGCCGAGAATAGAGCCGAGCTGATGATC CTGATCGCCACCAATCTGCTGGGCCAGAACACACCAGCCATTGCCGTGAATGAGGCCGAGTACGGCGAAATGTGGGCCCAAGATGCCGCTGCCATGTTTGGCTATGGTGGATC AGGCGGAGGTGGCAGCGGAGGCATGACCATCAATTACCAGTTCGGCGACGTGGACGCCCACGGCGCTATGATTAGAGCACAGGCCGGATCTCTGGAAGCCGAGCACCAGGCCA TCATCTCCGATGTGCTGACCGCCAGCGATTTTTGGGGAGGCGCTGGATCTGCTGCCTGCCAGGGCTTTATTACACAGCTGGGCAGAAACTTCCAAGTGATCTACGAGCAGGCCA ACGCTCACGGCCAGAAAGTTCAGGCCGCTGGCAACAATATGGCCCAGACCGATTCTGCCGTGGGCAGTTCTTGGGCTGGCGGAAGCGGCGGAGGCGGTTCTGGCGGAGCAGC Strinn i n R (s') TGTTGAAGAAGCCAGCGATACAGCTGCCGCCAACCAGCTGATGAACAACGTGCCACAGGCTCTCCAGCAGCTGGCTCAACCTACACAGGGCACAACCCCATCTTCTAAGCTCGG
91 J CGGCCTGTGGAAAACCGTGTCTCCTCACAGATCCCCAATCAGCAACATGGTGTCCATGGCCAACAACCACATGAGCATGACCAACAGCGGCGTGTCCATGACAAACACCCTGTC ntl CTCCATGCTGAAGGGCTTTGCCCCAGCCGCTGCTGCACAGGCTGTTCAGACAGCTGCACAGAATGGCGTGCGGGCCATGTCTAGCCTGGGAAGCTCTCTTGGTGGCTCTGGCG
GTGGCGGCTCAGGTGGAATGCATGTGTCCTTCGTGATGGCTTACCCCGAGATGCTCGCCGCAGCCGCTGATACACTCCAGTCTATCGGAGCCACAACAGTGGCTGGCGGCTCT GGCGGCGGTGGAAGTGGTGGAATGTCTCTGCTGGACGCTCACATCCCTCAGCTGGTGGCTTCTCAGTCTGCCTTTGCCGCCAAAGCCGGACTGATGAGACACACAATTGGCCA GGCCGAGCAGGCAGCCATGTCTGCCCAAGCTTTTCACCAGGGCGAAAGCAGCGCCGCCTTTCAGGCTGCCCATGCCAGATTTGTTGCCGCCGCTGCTAAAGTGAACACCCTGCT GGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCCGGAACTTACGTGGCCGCAGATGCTGCTGCTGCCTCTACCTATACCGGCTTCGGAGGAAGCGGAGGCGGAGGCAGTGGC GGAGTTGATGCTCATGGCGCAATGATCAGAGCCCAAGCTGCCAGCCTGGAAGCTGAACATCAGGCTATCGTGCGGGATGTGCTGGCTGCTGGGGATTTCTGGGGCGGTGCAG GTTCTGTGGCCTGCCAAGAGTTTATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTATGAGCAAGGCGGCTCAGGCGGAGGCGGTAGTGGCGGCGGAGTTGCTGCAAATCTT GGCAGAGCTGCCTCCGTGGGCTCTCTGTCTGTTCCTCAAGCCTGGGCTGCCGCTAATCAGGCTGTTACACCAGCCGCTAGAGCACTGCCTCTGACCAGCCTTACATCTGCCGCC GAACGAGGACCTGGACAGATGCTTGGAGGACTGCCTGTGGGACAGATGGGAGCTAGAGCTGGCGGAGGTCTTAGCGGAGTGCTGAGAGTTCCTCCTCGGCCTTACGTGATGC CTCATTCTCCTGCTGCTGGTGGCGGATCTGGCGGAGGCGGATCAGGCGGTTAA [SEQ ID NO: 187]
GTAGTTCCACCCGCAGCCGACGAGGTGTCCGCACTCACAGCCGCACACTTCGCTGCCCATGCTGCTATGTATCAGAGCGTGTCTGCAAGAGCTGCTGCTATACACGACCAATTT GTGGCGACACTGGCCTCCTCTGCCTCATCATACGCTGCCACGGAGGTAGCAAATGCTGCGGCCGGAGGATCTGGAGGCGGAGGCAGCGGCGGTATGGTAGACTTTGGGGCGT TGCCTCCCGAGATCAACTCCGCAAGGATGTATGCTGGGCCCGGCAGCGCATCCCTCGTCGCAGCTGCCCAGATGTGGGATTCCGTGGCTAGTGACCTGTTCAGCGCCGCCTCC GCTTTCCAATCCGTAGTGTGGGGCCTCACTGTGGGCAGTTGGATAGGGTCCAGTGCAGGGCTTATGGTGGCCGCAGCGAGTCCCTATGTGGCATGGATGTCAGTCACAGCGGG CCAAGCAGAACTTACTGCCGCCCAGGTACGCGTCGCTGCTGCTGCATACGAGACTGCTTATGGCCTTACTGTCCCACCTCCAGTGATTGCCGAAAACCGTGCAGAGCTGATGAT ACTGATTGCGACTAATCTGCTTGGACAGAATACCCCTGCCATTGCCGTCAACGAAGCCGAGTACGGTGAAATGTGGGCTCAAGATGCGGCCGCCATGTTTGGCTATGGGGGATC TGGAGGTGGCGGATCTGGTGGAATGACGATTAACTACCAGTTTGGGGACGTCGACGCACATGGGGCCATGATCCGAGCGCAGGCCGGAAGTCTGGAAGCAGAGCATCAGGCA ATCATTAGCGATGTCCTGACAGCCTCTGACTTTTGGGGCGGGGCCGGCTCTGCGGCGTGTCAGGGATTCATCACACAGCTGGGCCGCAATTTCCAGGTCATCTACGAGCAGGC
Strinq 10 R (s') CAACGCGCATGGCCAAAAGGTGCAGGCCGCCGGTAACAACATGGCTCAAACCGATAGCGCCGTGGGCAGCTCCTGGGCCGGCGGGAGCGGGGGAGGTGGGTCAGGAGGCGCC t2 9k 1 GCTGTGGAAGAAGCCAGCGATACAGCTGCCGCTAACCAACTGATGAACAATGTGCCCCAGGCACTGCAACAGCTCGCCCAACCGACCCAGGGTACTACTCCTAGCAGCAAACTT
GGCGGGCTGTGGAAAACAGTTAGCCCGCACAGATCTCCTATTTCCAATATGGTGTCTATGGCGAATAACCACATGAGTATGACCAATTCAGGCGTGTCTATGACAAACACTCTG TCATCAATGTTGAAGGGGTTCGCCCCTGCTGCCGCTGCTCAGGCTGTGCAGACGGCCGCACAGAATGGTGTCCGCGCAATGTCCAGCCTTGGATCTTCACTGGGAGGTTCTGG CGGAGGCGGGAGTGGCGGAATGCACGTTTCCTTTGTCATGGCATACCCTGAGATGCTCGCAGCCGCCGCAGATACGTTGCAATCAATCGGCGCCACCACCGTAGCTGGTGGGA GCGGAGGAGGTGGATCAGGAGGGATGAGCCTGCTTGATGCCCACATTCCCCAGCTGGTGGCTTCCCAGTCAGCCTTTGCCGCCAAAGCCGGACTCATGCGTCACACAATTGGT CAGGCAGAGCAGGCGGCTATGAGCGCCCAGGCATTCCATCAAGGGGAGTCAAGCGCCGCATTTCAGGCAGCCCACGCAAGGTTCGTCGCAGCCGCTGCAAAGGTGAATACGTT GCTGGATGTCGCGCAGGCGAATCTCGGCGAAGCTGCCGGCACCTACGTCGCGGCGGATGCCGCGGCAGCATCCACCTATACTGGCTTTGGAGGCAGTGGAGGCGGCGGCTCC GGTGGGGTTGATGCTCACGGTGCTATGATTCGCGCGCAGGCCGCCAGCCTCGAAGCCGAACATCAGGCCATTGTGCGGGACGTTTTGGCGGCAGGGGACTTTTGGGGTGGAG CCGGTAGCGTCGCATGCCAGGAGTTCATCACCCAGTTGGGACGGAATTTCCAAGTGATATACGAGCAGGGCGGGTCAGGAGGAGGTGGCTCCGGCGGAGGGGTTGCGGCTAA
CCTGGGCCGGGCCGCCTCCGTTGGGAGTCTCTCTGTGCCGCAGGCATGGGCGGCTGCGAATCAGGCCGTGACACCCGCAGCAAGAGCCCTGCCCCTCACCAGTCTGACCAGCG
Chimeric Nucleotide sequence protein
CCGCCGAAAGGGGACCCGGTCAGATGCTGGGTGGACTGCCAGTTGGGCAAATGGGTGCTAGGGCTGGCGGTGGTTTGAGTGGGGTACTCCGCGTTCCACCAAGACCATACGT
GATGCCTCATTCTCCAGCAGCTGGAGGCGGGTCTGGCGGCGGCGGAAGTGGCGGATAATGA [SEQ ID NO: 188]
GTGGTGCCTCCTGCTGCTGATGAAGTGTCTGCTCTGACAGCTGCTCACTTTGCTGCTCATGCTGCCATGTACCAGTCTGTGTCTGCCAGAGCTGCTGCCATTCATGATCAGTTT GTGGCCACCCTGGCTTCTTCTGCTTCTTCTTATGCTGCCACAGAAGTGGCCAATGCTGCTGCTGGAGGCTCTGGCGGAGGTGGCAGTGGTGGCATGGTGGATTTTGGAGCCCT GCCTCCTGAAATCAATTCTGCCAGAATGTATGCTGGACCTGGATCTGCTTCTCTGGTGGCTGCTGCTCAGATGTGGGATTCTGTGGCTTCTGACCTGTTCTCTGCTGCTTCTGC TTTCCAGTCTGTGGTGTGGGGACTGACAGTGGGATCTTGGATTGGATCTTCTGCTGGACTGATGGTGGCTGCTGCTTCTCCTTATGTGGCTTGGATGTCTGTGACAGCTGGAC AGGCTGAACTGACAGCTGCTCAGGTGAGAGTGGCTGCTGCTGCTTATGAAACAGCTTATGGACTGACAGTGCCTCCTCCTGTGATTGCTGAAAACAGAGCTGAACTGATGATTC TGATTGCCACCAATCTGCTGGGACAGAACACCCCTGCCATTGCTGTGAATGAAGCTGAATATGGAGAAATGTGGGCTCAGGATGCTGCTGCCATGTTTGGATATGGTGGCTCCG GCGGAGGTGGCTCTGGCGGAATGACCATCAATTACCAGTTTGGAGATGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGGATCTCTGGAAGCTGAACACCAGGCCATC ATTTCTGATGTGCTGACAGCTTCTGATTTCTGGGGAGGAGCTGGATCTGCTGCTTGCCAGGGATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGCCAAT GCTCATGGACAGAAGGTGCAGGCTGCTGGAAACAACATGGCTCAGACAGATTCTGCTGTGGGATCTTCTTGGGCTGGCGGATCTGGCGGAGGTGGCAGCGGTGGAGCTGCTG St 10 R (-s') TGGAAGAAGCTTCTGATACAGCTGCTGCCAATCAGCTGATGAACAATGTGCCTCAGGCTCTCCAGCAGCTGGCTCAGCCCACCCAGGGAACCACCCCCAGCAGCAAACTGGGAG 9 “ 1 } GACTGTGGAAGACAGTGTCTCCTCACAGATCTCCCATCAGCAACATGGTGAGCATGGCCAACAATCACATGAGCATGACCAATTCTGGAGTGAGCATGACCAACACCCTGAGCA ntJ GCATGCTGAAGGGATTTGCTCCTGCTGCTGCTGCTCAGGCTGTGCAGACAGCTGCTCAGAATGGAGTGAGAGCCATGTCTTCTCTGGGATCTTCTCTGGGAGGCTCCGGCGGA
GGTGGCTCAGGTGGAATGCATGTGTCTTTTGTGATGGCTTACCCTGAAATGCTGGCTGCTGCTGCTGACACCCTCCAGAGCATTGGAGCCACCACAGTGGCTGGAGGCTCAGG AGGTGGCGGATCAGGAGGTATGTCTCTGCTGGATGCTCACATCCCTCAGCTGGTGGCTTCTCAGTCTGCTTTTGCTGCCAAGGCTGGACTGATGAGACACACCATTGGACAGG CTGAACAGGCTGCCATGTCTGCTCAGGCTTTCCACCAGGGAGAATCTTCTGCTGCTTTCCAGGCTGCTCATGCCAGATTTGTGGCTGCTGCTGCCAAGGTGAACACCCTGCTGG ATGTGGCTCAGGCCAATCTGGGAGAAGCTGCTGGAACCTATGTGGCTGCTGATGCTGCTGCTGCCAGCACCTACACAGGATTTGGAGGCAGTGGAGGTGGCGGATCAGGTGGA GTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGCTTCTCTGGAAGCTGAACACCAGGCCATTGTGAGAGATGTGCTGGCTGCTGGAGATTTCTGGGGAGGAGCTGGATC TGTGGCTTGCCAGGAATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGGTGGCTCAGGCGGAGGTGGCAGTGGTGGCGGAGTGGCTGCCAATCTGGGCA GAGCTGCTTCTGTGGGATCTCTGTCTGTGCCTCAGGCTTGGGCTGCTGCCAATCAGGCTGTGACCCCTGCTGCCAGAGCCCTGCCTCTGACCTCTCTGACCTCTGCTGCTGAAA GAGGACCTGGACAGATGCTGGGAGGACTGCCTGTGGGACAGATGGGAGCCAGAGCTGGAGGAGGACTGTCTGGAGTGCTGAGAGTGCCTCCCAGACCTTATGTGATGCCTCA CTCTCCTGCTGCTGGAGGTGGCAGTGGCGGTGGAGGCAGTGGTGGCTAATGA [SEQ ID NO: 189] ATGGGCGGAGCTGCTGCTAGACTGGGAGCCGTGATCCTGTTCGTGGTTATCGTGGGACTGCACGGCGTTAGAGGCGTTGTGCCTCCTGCCGCTGATGAAGTGTCTGCCCTGAC AGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCTAGAGCCGCCGCTATCCACGATCAGTTCGTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGC CACTGAAGTGGCCAATGCTGCCGCTGGTGGATCTGGTGGCGGAGGATCTGGCGGAATGGTGGATTTTGGAGCCCTGCCTCCTGAGATCAACAGCGCCAGGATGTATGCCGGAC CTGGCTCTGCTTCTCTGGTGGCTGCTGCTCAGATGTGGGATAGCGTGGCCAGCGACCTGTTTTCTGCCGCCTCTGCCTTTCAGTCTGTCGTGTGGGGACTGACAGTCGGCTCTT String 10_R (I) GGATCGGATCTTCTGCCGGCCTGATGGTGGCAGCCGCTTCTCCTTATGTGGCCTGGATGTCTGTGACAGCCGGACAGGCTGAACTGACCGCTGCTCAAGTTCGAGTGGCCGCT ntl GCCGCTTACGAGACAGCCTATGGACTTACCGTGCCTCCTCCAGTGATCGCCGAGAATAGAGCCGAGCTGATGATCCTGATCGCCACCAATCTGCTGGGCCAGAACACACCAGCC
ATTGCCGTGAATGAGGCCGAGTACGGCGAAATGTGGGCCCAAGATGCCGCTGCCATGTTTGGCTATGGTGGATCAGGCGGAGGTGGCAGCGGAGGCATGACCATCAATTACCA GTTCGGCGACGTGGACGCCCACGGCGCTATGATTAGAGCACAGGCCGGATCTCTGGAAGCCGAGCACCAGGCCATCATCTCCGATGTGCTGACCGCCAGCGATTTTTGGGGAG GCGCTGGATCTGCTGCCTGCCAGGGCTTTATTACACAGCTGGGCAGAAACTTCCAAGTGATCTACGAGCAGGCCAACGCTCACGGCCAGAAAGTTCAGGCCGCTGGCAACAATA TGGCCCAGACCGATTCTGCCGTGGGCAGTTCTTGGGCTGGCGGAAGCGGCGGAGGCGGTTCTGGCGGAGCAGCTGTTGAAGAAGCCAGCGATACAGCTGCCGCCAACCAGCT
. . Nucleotide sequence protein _ _
GATGAACAACGTGCCACAGGCTCTCCAGCAGCTGGCTCAACCTACACAGGGCACAACCCCATCTTCTAAGCTCGGCGGCCTGTGGAAAACCGTGTCTCCTCACAGATCCCCAAT CAGCAACATGGTGTCCATGGCCAACAACCACATGAGCATGACCAACAGCGGCGTGTCCATGACAAACACCCTGTCCTCCATGCTGAAGGGCTTTGCCCCAGCCGCTGCTGCACA GGCTGTTCAGACAGCTGCACAGAATGGCGTGCGGGCCATGTCTAGCCTGGGAAGCTCTCTTGGTGGCTCTGGCGGTGGCGGCTCAGGTGGAATGCATGTGTCCTTCGTGATGG CTTACCCCGAGATGCTCGCCGCAGCCGCTGATACACTCCAGTCTATCGGAGCCACAACAGTGGCTGGCGGCTCTGGCGGCGGTGGAAGTGGTGGAATGTCTCTGCTGGACGCT CACATCCCTCAGCTGGTGGCTTCTCAGTCTGCCTTTGCCGCCAAAGCCGGACTGATGAGACACACAATTGGCCAGGCCGAGCAGGCAGCCATGTCTGCCCAAGCTTTTCACCAG GGCGAAAGCAGCGCCGCCTTTCAGGCTGCCCATGCCAGATTTGTTGCCGCCGCTGCTAAAGTGAACACCCTGCTGGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCCGGAAC TTACGTGGCCGCAGATGCTGCTGCTGCCTCTACCTATACCGGCTTCGGAGGAAGCGGAGGCGGAGGCAGTGGCGGAGTTGATGCTCATGGCGCAATGATCAGAGCCCAAGCTG CCAGCCTGGAAGCTGAACATCAGGCTATCGTGCGGGATGTGCTGGCTGCTGGGGATTTCTGGGGCGGTGCAGGTTCTGTGGCCTGCCAAGAGTTTATCACCCAGCTCGGCCGG AATTTTCAAGTCATCTATGAGCAAGGCGGCTCAGGCGGAGGCGGTAGTGGCGGCGGAGTTGCTGCAAATCTTGGCAGAGCTGCCTCCGTGGGCTCTCTGTCTGTTCCTCAAGC CTGGGCTGCCGCTAATCAGGCTGTTACACCAGCCGCTAGAGCACTGCCTCTGACCAGCCTTACATCTGCCGCCGAACGAGGACCTGGACAGATGCTTGGAGGACTGCCTGTGG GACAGATGGGAGCTAGAGCTGGCGGAGGTCTTAGCGGAGTGCTGAGAGTTCCTCCTCGGCCTTACGTGATGCCTCATTCTCCTGCTGCTGGTGGCGGATCTGGCGGAGGCGG ATCAGGCGGTATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCGGAGGCAAGGGC GGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAA [SEQ ID NO: 190]
ATGGGCGGTGCTGCCGCCAGACTCGGCGCAGTGATCCTGTTCGTCGTGATCGTGGGTCTGCATGGGGTGCGGGGAGTAGTTCCACCCGCAGCCGACGAGGTGTCCGCACTCAC AGCCGCACACTTCGCTGCCCATGCTGCTATGTATCAGAGCGTGTCTGCAAGAGCTGCTGCTATACACGACCAATTTGTGGCGACACTGGCCTCCTCTGCCTCATCATACGCTGC CACGGAGGTAGCAAATGCTGCGGCCGGAGGATCTGGAGGCGGAGGCAGCGGCGGTATGGTAGACTTTGGGGCGTTGCCTCCCGAGATCAACTCCGCAAGGATGTATGCTGGG CCCGGCAGCGCATCCCTCGTCGCAGCTGCCCAGATGTGGGATTCCGTGGCTAGTGACCTGTTCAGCGCCGCCTCCGCTTTCCAATCCGTAGTGTGGGGCCTCACTGTGGGCAG TTGGATAGGGTCCAGTGCAGGGCTTATGGTGGCCGCAGCGAGTCCCTATGTGGCATGGATGTCAGTCACAGCGGGCCAAGCAGAACTTACTGCCGCCCAGGTACGCGTCGCTG CTGCTGCATACGAGACTGCTTATGGCCTTACTGTCCCACCTCCAGTGATTGCCGAAAACCGTGCAGAGCTGATGATACTGATTGCGACTAATCTGCTTGGACAGAATACCCCTG CCATTGCCGTCAACGAAGCCGAGTACGGTGAAATGTGGGCTCAAGATGCGGCCGCCATGTTTGGCTATGGGGGATCTGGAGGTGGCGGATCTGGTGGAATGACGATTAACTAC CAGTTTGGGGACGTCGACGCACATGGGGCCATGATCCGAGCGCAGGCCGGAAGTCTGGAAGCAGAGCATCAGGCAATCATTAGCGATGTCCTGACAGCCTCTGACTTTTGGGG CGGGGCCGGCTCTGCGGCGTGTCAGGGATTCATCACACAGCTGGGCCGCAATTTCCAGGTCATCTACGAGCAGGCCAACGCGCATGGCCAAAAGGTGCAGGCCGCCGGTAACA ACATGGCTCAAACCGATAGCGCCGTGGGCAGCTCCTGGGCCGGCGGGAGCGGGGGAGGTGGGTCAGGAGGCGCCGCTGTGGAAGAAGCCAGCGATACAGCTGCCGCTAACCA Strinn 10 R m ACTGATGAACAATGTGCCCCAGGCACTGCAACAGCTCGCCCAACCGACCCAGGGTACTACTCCTAGCAGCAAACTTGGCGGGCTGTGGAAAACAGTTAGCCCGCACAGATCTCC 9 - U TATTTCCAATATGGTGTCTATGGCGAATAACCACATGAGTATGACCAATTCAGGCGTGTCTATGACAAACACTCTGTCATCAATGTTGAAGGGGTTCGCCCCTGCTGCCGCTGCT ntZ CAGGCTGTGCAGACGGCCGCACAGAATGGTGTCCGCGCAATGTCCAGCCTTGGATCTTCACTGGGAGGTTCTGGCGGAGGCGGGAGTGGCGGAATGCACGTTTCCTTTGTCAT
GGCATACCCTGAGATGCTCGCAGCCGCCGCAGATACGTTGCAATCAATCGGCGCCACCACCGTAGCTGGTGGGAGCGGAGGAGGTGGATCAGGAGGGATGAGCCTGCTTGATG CCCACATTCCCCAGCTGGTGGCTTCCCAGTCAGCCTTTGCCGCCAAAGCCGGACTCATGCGTCACACAATTGGTCAGGCAGAGCAGGCGGCTATGAGCGCCCAGGCATTCCATC AAGGGGAGTCAAGCGCCGCATTTCAGGCAGCCCACGCAAGGTTCGTCGCAGCCGCTGCAAAGGTGAATACGTTGCTGGATGTCGCGCAGGCGAATCTCGGCGAAGCTGCCGGC ACCTACGTCGCGGCGGATGCCGCGGCAGCATCCACCTATACTGGCTTTGGAGGCAGTGGAGGCGGCGGCTCCGGTGGGGTTGATGCTCACGGTGCTATGATTCGCGCGCAGG CCGCCAGCCTCGAAGCCGAACATCAGGCCATTGTGCGGGACGTTTTGGCGGCAGGGGACTTTTGGGGTGGAGCCGGTAGCGTCGCATGCCAGGAGTTCATCACCCAGTTGGGA CGGAATTTCCAAGTGATATACGAGCAGGGCGGGTCAGGAGGAGGTGGCTCCGGCGGAGGGGTTGCGGCTAACCTGGGCCGGGCCGCCTCCGTTGGGAGTCTCTCTGTGCCGC AGGCATGGGCGGCTGCGAATCAGGCCGTGACACCCGCAGCAAGAGCCCTGCCCCTCACCAGTCTGACCAGCGCCGCCGAAAGGGGACCCGGTCAGATGCTGGGTGGACTGCCA GTTGGGCAAATGGGTGCTAGGGCTGGCGGTGGTTTGAGTGGGGTACTCCGCGTTCCACCAAGACCATACGTGATGCCTCATTCTCCAGCAGCTGGAGGCGGGTCTGGCGGCG GCGGAAGTGGCGGAATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCGGAGGCAA GGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 191]
Chimeric Nucleotide sequence protein
ATGGGAGGAGCTGCTGCCAGACTGGGAGCTGTGATTCTGTTTGTGGTGATTGTGGGACTGCATGGAGTGAGAGGAGTGGTGCCTCCTGCTGCTGATGAAGTGTCTGCTCTGAC AGCTGCTCACTTTGCTGCTCATGCTGCCATGTACCAGTCTGTGTCTGCCAGAGCTGCTGCCATTCATGATCAGTTTGTGGCCACCCTGGCTTCTTCTGCTTCTTCTTATGCTGCC ACAGAAGTGGCCAATGCTGCTGCTGGAGGCTCTGGCGGAGGTGGCAGTGGTGGCATGGTGGATTTTGGAGCCCTGCCTCCTGAAATCAATTCTGCCAGAATGTATGCTGGACC TGGATCTGCTTCTCTGGTGGCTGCTGCTCAGATGTGGGATTCTGTGGCTTCTGACCTGTTCTCTGCTGCTTCTGCTTTCCAGTCTGTGGTGTGGGGACTGACAGTGGGATCTTG GATTGGATCTTCTGCTGGACTGATGGTGGCTGCTGCTTCTCCTTATGTGGCTTGGATGTCTGTGACAGCTGGACAGGCTGAACTGACAGCTGCTCAGGTGAGAGTGGCTGCTG CTGCTTATGAAACAGCTTATGGACTGACAGTGCCTCCTCCTGTGATTGCTGAAAACAGAGCTGAACTGATGATTCTGATTGCCACCAATCTGCTGGGACAGAACACCCCTGCCAT TGCTGTGAATGAAGCTGAATATGGAGAAATGTGGGCTCAGGATGCTGCTGCCATGTTTGGATATGGTGGCTCCGGCGGAGGTGGCTCTGGCGGAATGACCATCAATTACCAGT TTGGAGATGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGGATCTCTGGAAGCTGAACACCAGGCCATCATTTCTGATGTGCTGACAGCTTCTGATTTCTGGGGAGGA GCTGGATCTGCTGCTTGCCAGGGATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGCCAATGCTCATGGACAGAAGGTGCAGGCTGCTGGAAACAACATG GCTCAGACAGATTCTGCTGTGGGATCTTCTTGGGCTGGCGGATCTGGCGGAGGTGGCAGCGGTGGAGCTGCTGTGGAAGAAGCTTCTGATACAGCTGCTGCCAATCAGCTGAT Strinn 10 R m GAACAATGTGCCTCAGGCTCTCCAGCAGCTGGCTCAGCCCACCCAGGGAACCACCCCCAGCAGCAAACTGGGAGGACTGTGGAAGACAGTGTCTCCTCACAGATCTCCCATCAG 9 - U CAACATGGTGAGCATGGCCAACAATCACATGAGCATGACCAATTCTGGAGTGAGCATGACCAACACCCTGAGCAGCATGCTGAAGGGATTTGCTCCTGCTGCTGCTGCTCAGGC ntJ TGTGCAGACAGCTGCTCAGAATGGAGTGAGAGCCATGTCTTCTCTGGGATCTTCTCTGGGAGGCTCCGGCGGAGGTGGCTCAGGTGGAATGCATGTGTCTTTTGTGATGGCTT
ACCCTGAAATGCTGGCTGCTGCTGCTGACACCCTCCAGAGCATTGGAGCCACCACAGTGGCTGGAGGCTCAGGAGGTGGCGGATCAGGAGGTATGTCTCTGCTGGATGCTCAC ATCCCTCAGCTGGTGGCTTCTCAGTCTGCTTTTGCTGCCAAGGCTGGACTGATGAGACACACCATTGGACAGGCTGAACAGGCTGCCATGTCTGCTCAGGCTTTCCACCAGGGA GAATCTTCTGCTGCTTTCCAGGCTGCTCATGCCAGATTTGTGGCTGCTGCTGCCAAGGTGAACACCCTGCTGGATGTGGCTCAGGCCAATCTGGGAGAAGCTGCTGGAACCTAT GTGGCTGCTGATGCTGCTGCTGCCAGCACCTACACAGGATTTGGAGGCAGTGGAGGTGGCGGATCAGGTGGAGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGCTTC TCTGGAAGCTGAACACCAGGCCATTGTGAGAGATGTGCTGGCTGCTGGAGATTTCTGGGGAGGAGCTGGATCTGTGGCTTGCCAGGAATTCATCACCCAGCTGGGAAGAAATT TCCAGGTGATCTATGAACAGGGTGGCTCAGGCGGAGGTGGCAGTGGTGGCGGAGTGGCTGCCAATCTGGGCAGAGCTGCTTCTGTGGGATCTCTGTCTGTGCCTCAGGCTTG GGCTGCTGCCAATCAGGCTGTGACCCCTGCTGCCAGAGCCCTGCCTCTGACCTCTCTGACCTCTGCTGCTGAAAGAGGACCTGGACAGATGCTGGGAGGACTGCCTGTGGGAC AGATGGGAGCCAGAGCTGGAGGAGGACTGTCTGGAGTGCTGAGAGTGCCTCCCAGACCTTATGTGATGCCTCACTCTCCTGCTGCTGGAGGTGGCAGTGGCGGTGGAGGCAG TGGTGGCATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCGGAGGCAAGGGCGG CAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 192]
GTTGTGCCTCCTGCCGCTGATGAAGTGTCTGCCCTGACAGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCTAGAGCCGCCGCTATCCACGATCAGTTC GTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGCCACTGAAGTGGCCAATGCTGCCGCTGGTGGATCTGGTGGCGGAGGATCTGGCGGAATGACCAGCCGGTTTATGAC CGATCCTCACGCCATGAGAGACATGGCCGGCAGATTTGAAGTGCACGCCCAGACCGTGGAAGATGAGGCTAGAAGAATGTGGGCCAGCGCTCAGAACATTAGCGGAGCTGGCT GGAGCGGAATGGCCGAAGCTACAAGCCTGGACACCATGACACAGATGAACCAGGCCTTCCGCAACATCGTGAACATGCTGCATGGCGTCAGAGATGGCCTTGTGCGGGACGCC AACAACTACGAGCAGCAAGAACAGGCCAGCCAGCAGATCCTGTCTAGCGGAGGAAGCGGCGGAGGCGGAAGCGGTGGAATGTCACTGCTGGATGCTCACATCCCTCAGCTGGT GGCCTCTCAGTCTGCCTTTGCTGCCAAAGCCGGCCTGATGAGACACACAATTGGACAGGCCGAGCAGGCCGCTATGTCTGCCCAGGCTTTTCACCAGGGCGAAAGCAGCGCAG
String l t CCTTTCAGGCTGCCCATGCCAGATTTGTGGCCGCTGCCGCCAAAGTGAACACCCTGCTTGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCCGGAACTTATGTGGCCGCAGAT ntl k 1 GCTGCTGCCGCCTCTACCTATACCGGATTTGGTGGTAGCGGAGGTGGTGGCTCAGGCGGCATGCATGTGTCCTTCGTGATGGCTTACCCCGAGATGCTGGCAGCCGCTGCTGA TACACTCCAGTCTATCGGCGCCACAACAGTGGCTGGCGGTTCTGGCGGTGGTGGCAGTGGCGGGATGACAATCAATTACCAGTTCGGCGACGTGGACGCCCACGGCGCTATGA TTAGAGCACAGGCCGGATCTCTGGAAGCCGAGCACCAGGCCATCATCTCCGATGTGCTGACCGCCAGCGATTTTTGGGGAGGCGCTGGTTCTGCTGCCTGCCAGGGCTTTATT ACACAGCTGGGCAGAAACTTCCAAGTGATCTATGAGCAGGCCAACGCTCACGGCCAGAAAGTGCAAGCCGCTGGCAACAATATGGCCCAGACAGATTCTGCCGTGGGCAGCTCT TGGGCAGGCGGCTCTGGCGGCGGAGGTTCAGGTGGTGTTGATGCTCATGGGGCCATGATCAGAGCCCAGGCTGCCAGTCTGGAAGCTGAACATCAGGCTATCGTGCGCGACG TTCTGGCCGCTGGGGACTTTTGGGGCGGAGCAGGCTCTGTGGCCTGCCAAGAGTTTATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTACGAGCAAGGTGGCAGCGGAGGC GGAGGTAGCGGAGGAATGGCTTCTCGGTTCATGACAGACCCACATGCTATGAGAGATGGCGGATCTGGCGGAGGTGGAAGCGGAGGCATGAGCCAGATCATGTACAACTACCC CGCCATGCTGGGACACGCCGGCGATATGGCTGGATATGCCGGCACACTGCAATCTCTGGGCGCCGAAATTGCCGTGGAACAGGCCGCTCTGCAATCTGCTTGGCAGGGCGATA
Chimeric Nucleotide sequence protein
CCGGCATCACCTATCAGGCTTGGCAAGCCCAGTGGAATCAGGCCATGGAAGATCTCGTGCGGGCCTACCATGCCATGAGCAGCACACACGAGGCCAACACAATGGCCATGATG
GCCCGGGATACAGCCGAAGCCGCTAAATGGGGAGGTGGTGGTTCTGGCGGAGGCGGCTCAGGTGGATAATGA [SEQ ID NO: 193]
GTTGTGCCTCCTGCCGCCGACGAGGTGTCCGCCCTGACCGCCGCTCACTTCGCTGCACATGCAGCGATGTACCAGAGCGTATCAGCCAGAGCAGCAGCAATTCATGACCAGTTC GTCGCAACGCTGGCAAGTTCCGCCAGCTCTTATGCTGCCACAGAAGTTGCTAACGCAGCTGCCGGAGGGTCAGGTGGAGGAGGAAGCGGTGGCATGACAAGCAGGTTTATGAC AGATCCCCACGCAATGCGGGATATGGCCGGTCGGTTTGAGGTGCATGCTCAAACAGTTGAAGATGAAGCGCGACGCATGTGGGCCAGTGCCCAGAACATAAGCGGGGCCGGCT GGTCTGGCATGGCCGAAGCTACCAGCTTGGACACAATGACTCAGATGAACCAGGCCTTTAGGAATATAGTCAATATGCTCCATGGCGTTCGCGATGGGCTGGTGAGGGATGCC AATAATTACGAGCAGCAGGAGCAAGCTTCACAGCAGATCCTGAGTTCTGGCGGCTCTGGAGGTGGTGGCTCTGGAGGAATGTCTCTGCTGGATGCACACATTCCGCAGCTCGT TGCGTCCCAAAGTGCCTTTGCGGCCAAAGCAGGGCTGATGAGGCATACTATAGGGCAGGCTGAGCAAGCCGCAATGTCTGCACAAGCCTTCCATCAGGGTGAGAGTAGCGCAG CCTTTCAAGCCGCGCATGCCAGGTTCGTGGCTGCCGCAGCCAAGGTCAATACTCTGCTCGATGTAGCTCAGGCGAATTTGGGTGAGGCCGCTGGTACCTATGTCGCAGCCGAC
Strina 11 (s') GCAGCTGCTGCCTCCACATACACCGGTTTTGGAGGGTCAGGCGGAGGAGGCAGTGGAGGTATGCACGTGTCTTTCGTGATGGCGTACCCCGAGATGCTTGCCGCAGCCGCCGA
9 CACCCTGCAAAGCATCGGGGCTACAACAGTGGCCGGCGGCAGTGGTGGCGGCGGCTCCGGCGGAATGACCATCAACTACCAGTTCGGGGACGTGGACGCTCACGGAGCAATGA ntZ TCAGAGCGCAGGCTGGGAGCCTGGAAGCCGAACATCAGGCAATCATAAGTGATGTCCTTACCGCCTCCGACTTTTGGGGCGGCGCAGGGAGCGCAGCTTGTCAGGGCTTCATC
ACCCAGTTGGGCAGAAACTTCCAGGTTATTTATGAGCAGGCCAACGCTCACGGGCAGAAAGTACAGGCGGCCGGCAATAACATGGCTCAGACGGACTCAGCTGTGGGCTCATC TTGGGCCGGCGGATCAGGTGGCGGCGGGAGCGGTGGGGTGGATGCTCACGGGGCTATGATCCGCGCCCAAGCGGCGAGCCTTGAAGCCGAGCACCAGGCAATTGTGCGGGAC GTGCTGGCCGCGGGTGACTTCTGGGGTGGCGCCGGTTCTGTAGCATGCCAGGAGTTCATCACTCAGCTGGGTCGTAATTTTCAGGTGATTTATGAACAGGGCGGGTCTGGTGG CGGAGGCAGCGGTGGAATGGCTTCCCGGTTCATGACTGACCCACATGCCATGCGCGATGGCGGTAGCGGCGGCGGCGGATCTGGCGGTATGTCTCAGATTATGTACAACTACC CAGCAATGCTCGGGCACGCAGGGGATATGGCTGGTTATGCTGGGACTCTGCAAAGCCTTGGGGCAGAAATCGCCGTAGAGCAAGCAGCCCTGCAATCCGCTTGGCAGGGTGAC
ACGGGAATAACCTATCAAGCTTGGCAAGCACAGTGGAATCAGGCAATGGAGGATCTCGTACGGGCTTATCACGCAATGTCCTCAACACATGAAGCCAATACGATGGCGATGATG GCTAGAGATACAGCCGAAGCTGCTAAGTGGGGTGGAGGGGGCTCCGGTGGCGGAGGAAGCGGAGGGTAATGA [SEQ ID NO: 194]
GTGGTGCCTCCTGCTGCTGATGAAGTGTCTGCTCTGACAGCTGCTCACTTTGCTGCTCATGCTGCCATGTACCAGTCTGTGTCTGCCAGAGCTGCTGCCATTCATGATCAGTTT GTGGCCACCCTGGCTTCTTCTGCTTCTTCTTATGCTGCCACAGAAGTGGCCAATGCTGCTGCTGGAGGCTCTGGCGGAGGTGGCAGTGGTGGCATGACCAGCAGATTCATGAC AGATCCTCATGCCATGAGAGACATGGCTGGAAGATTTGAAGTGCATGCTCAGACAGTGGAAGATGAAGCCAGAAGAATGTGGGCTTCTGCTCAGAACATTTCTGGAGCTGGAT GGTCTGGAATGGCTGAAGCCACCTCTCTGGACACCATGACCCAGATGAATCAGGCTTTCAGAAACATTGTGAACATGCTGCATGGAGTGAGAGATGGACTGGTGAGAGATGCC
AACAATTATGAACAGCAGGAACAGGCTTCTCAGCAGATCCTGTCTTCTGGTGGCTCCGGCGGAGGTGGCTCTGGCGGAATGTCTCTGCTGGATGCTCACATCCCTCAGCTGGTG GCTTCTCAGTCTGCTTTTGCTGCCAAGGCTGGACTGATGAGACACACCATTGGACAGGCTGAACAGGCTGCCATGTCTGCTCAGGCTTTCCACCAGGGAGAATCTTCTGCTGCT String 11 (s) TTCCAGGCTGCTCATGCCAGATTTGTGGCTGCTGCTGCCAAGGTGAACACCCTGCTGGATGTGGCTCAGGCCAATCTGGGAGAAGCTGCTGGAACCTATGTGGCTGCTGATGC nt3 TGCTGCTGCCAGCACCTACACAGGATTTGGCGGATCTGGCGGAGGTGGCAGCGGTGGAATGCATGTGTCTTTTGTGATGGCTTACCCTGAAATGCTGGCTGCTGCTGCTGACA
CCCTCCAGAGCATTGGAGCCACCACAGTGGCTGGAGGCTCCGGCGGAGGTGGCTCAGGTGGAATGACCATCAATTACCAGTTTGGAGATGTGGATGCTCATGGAGCCATGATC AGAGCCCAGGCTGGATCTCTGGAAGCTGAACACCAGGCCATCATTTCTGATGTGCTGACAGCTTCTGATTTCTGGGGAGGAGCTGGATCTGCTGCTTGCCAGGGATTCATCACC CAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGCCAATGCTCATGGACAGAAGGTGCAGGCTGCTGGAAACAACATGGCTCAGACAGATTCTGCTGTGGGATCTTCTTGG GCTGGAGGCTCAGGAGGTGGCGGATCAGGAGGTGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGCTTCTCTGGAAGCTGAACACCAGGCCATTGTGAGAGATGTGCT GGCTGCTGGAGATTTCTGGGGAGGAGCTGGATCTGTGGCTTGCCAGGAATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGGAGGCAGTGGAGGTGGC GGATCAGGTGGAATGGCCAGCAGATTCATGACAGATCCTCATGCCATGAGAGATGGTGGCTCAGGCGGAGGTGGCAGTGGTGGCATGTCTCAGATCATGTACAATTACCCTGC
Chimeric Nucleotide sequence protein
CATGCTGGGACATGCTGGAGACATGGCTGGATATGCTGGAACCCTCCAGTCTCTGGGAGCTGAAATTGCTGTGGAACAGGCTGCTCTCCAGTCTGCTTGGCAGGGAGACACAG
GAATCACCTACCAGGCTTGGCAGGCTCAGTGGAATCAGGCCATGGAAGATCTGGTGAGAGCTTACCATGCCATGAGCAGCACCCATGAAGCCAACACCATGGCCATGATGGCCA
GAGACACAGCTGAAGCTGCCAAATGGGGAGGAGGTGGCAGTGGCGGTGGAGGCAGTGGTGGCTAATGA [SEQ ID NO: 195]
ATGGGCGGAGCTGCTGCTAGACTGGGAGCCGTGATCCTGTTCGTGGTTATCGTGGGACTGCACGGCGTTAGAGGCGTTGTGCCTCCTGCCGCTGATGAAGTGTCTGCCCTGAC AGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCTAGAGCCGCCGCTATCCACGATCAGTTCGTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGC CACTGAAGTGGCCAATGCTGCCGCTGGTGGATCTGGTGGCGGAGGATCTGGCGGAATGACCAGCCGGTTTATGACCGATCCTCACGCCATGAGAGACATGGCCGGCAGATTTG AAGTGCACGCCCAGACCGTGGAAGATGAGGCTAGAAGAATGTGGGCCAGCGCTCAGAACATTAGCGGAGCTGGCTGGAGCGGAATGGCCGAAGCTACAAGCCTGGACACCATG ACACAGATGAACCAGGCCTTCCGCAACATCGTGAACATGCTGCATGGCGTCAGAGATGGCCTTGTGCGGGACGCCAACAACTACGAGCAGCAAGAACAGGCCAGCCAGCAGATC CTGTCTAGCGGAGGAAGCGGCGGAGGCGGAAGCGGTGGAATGTCACTGCTGGATGCTCACATCCCTCAGCTGGTGGCCTCTCAGTCTGCCTTTGCTGCCAAAGCCGGCCTGAT GAGACACACAATTGGACAGGCCGAGCAGGCCGCTATGTCTGCCCAGGCTTTTCACCAGGGCGAAAGCAGCGCAGCCTTTCAGGCTGCCCATGCCAGATTTGTGGCCGCTGCCG CCAAAGTGAACACCCTGCTTGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCCGGAACTTATGTGGCCGCAGATGCTGCTGCCGCCTCTACCTATACCGGATTTGGTGGTAGC
Strina 11 (D GGAGGTGGTGGCTCAGGCGGCATGCATGTGTCCTTCGTGATGGCTTACCCCGAGATGCTGGCAGCCGCTGCTGATACACTCCAGTCTATCGGCGCCACAACAGTGGCTGGCGG
9 U TTCTGGCGGTGGTGGCAGTGGCGGGATGACAATCAATTACCAGTTCGGCGACGTGGACGCCCACGGCGCTATGATTAGAGCACAGGCCGGATCTCTGGAAGCCGAGCACCAGG ntl CCATCATCTCCGATGTGCTGACCGCCAGCGATTTTTGGGGAGGCGCTGGTTCTGCTGCCTGCCAGGGCTTTATTACACAGCTGGGCAGAAACTTCCAAGTGATCTATGAGCAGG
CCAACGCTCACGGCCAGAAAGTGCAAGCCGCTGGCAACAATATGGCCCAGACAGATTCTGCCGTGGGCAGCTCTTGGGCAGGCGGCTCTGGCGGCGGAGGTTCAGGTGGTGTT GATGCTCATGGGGCCATGATCAGAGCCCAGGCTGCCAGTCTGGAAGCTGAACATCAGGCTATCGTGCGCGACGTTCTGGCCGCTGGGGACTTTTGGGGCGGAGCAGGCTCTGT GGCCTGCCAAGAGTTTATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTACGAGCAAGGTGGCAGCGGAGGCGGAGGTAGCGGAGGAATGGCTTCTCGGTTCATGACAGACC CACATGCTATGAGAGATGGCGGATCTGGCGGAGGTGGAAGCGGAGGCATGAGCCAGATCATGTACAACTACCCCGCCATGCTGGGACACGCCGGCGATATGGCTGGATATGCC GGCACACTGCAATCTCTGGGCGCCGAAATTGCCGTGGAACAGGCCGCTCTGCAATCTGCTTGGCAGGGCGATACCGGCATCACCTATCAGGCTTGGCAAGCCCAGTGGAATCA
GGCCATGGAAGATCTCGTGCGGGCCTACCATGCCATGAGCAGCACACACGAGGCCAACACAATGGCCATGATGGCCCGGGATACAGCCGAAGCCGCTAAATGGGGAGGTGGTG GTTCTGGCGGAGGCGGCTCAGGTGGAATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTC CAGCGGAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 196]
ATGGGTGGGGCGGCCGCACGTCTGGGAGCGGTGATTCTGTTTGTGGTCATTGTTGGGCTTCACGGCGTTCGAGGCGTTGTGCCTCCTGCCGCCGACGAGGTGTCCGCCCTGA CCGCCGCTCACTTCGCTGCACATGCAGCGATGTACCAGAGCGTATCAGCCAGAGCAGCAGCAATTCATGACCAGTTCGTCGCAACGCTGGCAAGTTCCGCCAGCTCTTATGCTG CCACAGAAGTTGCTAACGCAGCTGCCGGAGGGTCAGGTGGAGGAGGAAGCGGTGGCATGACAAGCAGGTTTATGACAGATCCCCACGCAATGCGGGATATGGCCGGTCGGTTT GAGGTGCATGCTCAAACAGTTGAAGATGAAGCGCGACGCATGTGGGCCAGTGCCCAGAACATAAGCGGGGCCGGCTGGTCTGGCATGGCCGAAGCTACCAGCTTGGACACAAT GACTCAGATGAACCAGGCCTTTAGGAATATAGTCAATATGCTCCATGGCGTTCGCGATGGGCTGGTGAGGGATGCCAATAATTACGAGCAGCAGGAGCAAGCTTCACAGCAGAT
String 11 (I) CCTGAGTTCTGGCGGCTCTGGAGGTGGTGGCTCTGGAGGAATGTCTCTGCTGGATGCACACATTCCGCAGCTCGTTGCGTCCCAAAGTGCCTTTGCGGCCAAAGCAGGGCTGA nt2 TGAGGCATACTATAGGGCAGGCTGAGCAAGCCGCAATGTCTGCACAAGCCTTCCATCAGGGTGAGAGTAGCGCAGCCTTTCAAGCCGCGCATGCCAGGTTCGTGGCTGCCGCA
GCCAAGGTCAATACTCTGCTCGATGTAGCTCAGGCGAATTTGGGTGAGGCCGCTGGTACCTATGTCGCAGCCGACGCAGCTGCTGCCTCCACATACACCGGTTTTGGAGGGTCA GGCGGAGGAGGCAGTGGAGGTATGCACGTGTCTTTCGTGATGGCGTACCCCGAGATGCTTGCCGCAGCCGCCGACACCCTGCAAAGCATCGGGGCTACAACAGTGGCCGGCG GCAGTGGTGGCGGCGGCTCCGGCGGAATGACCATCAACTACCAGTTCGGGGACGTGGACGCTCACGGAGCAATGATCAGAGCGCAGGCTGGGAGCCTGGAAGCCGAACATCA GGCAATCATAAGTGATGTCCTTACCGCCTCCGACTTTTGGGGCGGCGCAGGGAGCGCAGCTTGTCAGGGCTTCATCACCCAGTTGGGCAGAAACTTCCAGGTTATTTATGAGCA GGCCAACGCTCACGGGCAGAAAGTACAGGCGGCCGGCAATAACATGGCTCAGACGGACTCAGCTGTGGGCTCATCTTGGGCCGGCGGATCAGGTGGCGGCGGGAGCGGTGGG
. . Nucleotide sequence protein _ _
GTGGATGCTCACGGGGCTATGATCCGCGCCCAAGCGGCGAGCCTTGAAGCCGAGCACCAGGCAATTGTGCGGGACGTGCTGGCCGCGGGTGACTTCTGGGGTGGCGCCGGTT CTGTAGCATGCCAGGAGTTCATCACTCAGCTGGGTCGTAATTTTCAGGTGATTTATGAACAGGGCGGGTCTGGTGGCGGAGGCAGCGGTGGAATGGCTTCCCGGTTCATGACT GACCCACATGCCATGCGCGATGGCGGTAGCGGCGGCGGCGGATCTGGCGGTATGTCTCAGATTATGTACAACTACCCAGCAATGCTCGGGCACGCAGGGGATATGGCTGGTTA TGCTGGGACTCTGCAAAGCCTTGGGGCAGAAATCGCCGTAGAGCAAGCAGCCCTGCAATCCGCTTGGCAGGGTGACACGGGAATAACCTATCAAGCTTGGCAAGCACAGTGGA ATCAGGCAATGGAGGATCTCGTACGGGCTTATCACGCAATGTCCTCAACACATGAAGCCAATACGATGGCGATGATGGCTAGAGATACAGCCGAAGCTGCTAAGTGGGGTGGA GGGGGCTCCGGTGGCGGAGGAAGCGGAGGGATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGG AAGTCCAGCGGAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 197]
ATGGGAGGAGCTGCTGCCAGACTGGGAGCTGTGATTCTGTTTGTGGTGATTGTGGGACTGCATGGAGTGAGAGGAGTGGTGCCTCCTGCTGCTGATGAAGTGTCTGCTCTGAC AGCTGCTCACTTTGCTGCTCATGCTGCCATGTACCAGTCTGTGTCTGCCAGAGCTGCTGCCATTCATGATCAGTTTGTGGCCACCCTGGCTTCTTCTGCTTCTTCTTATGCTGCC ACAGAAGTGGCCAATGCTGCTGCTGGAGGCTCTGGCGGAGGTGGCAGTGGTGGCATGACCAGCAGATTCATGACAGATCCTCATGCCATGAGAGACATGGCTGGAAGATTTGA AGTGCATGCTCAGACAGTGGAAGATGAAGCCAGAAGAATGTGGGCTTCTGCTCAGAACATTTCTGGAGCTGGATGGTCTGGAATGGCTGAAGCCACCTCTCTGGACACCATGA CCCAGATGAATCAGGCTTTCAGAAACATTGTGAACATGCTGCATGGAGTGAGAGATGGACTGGTGAGAGATGCCAACAATTATGAACAGCAGGAACAGGCTTCTCAGCAGATCC TGTCTTCTGGTGGCTCCGGCGGAGGTGGCTCTGGCGGAATGTCTCTGCTGGATGCTCACATCCCTCAGCTGGTGGCTTCTCAGTCTGCTTTTGCTGCCAAGGCTGGACTGATG AGACACACCATTGGACAGGCTGAACAGGCTGCCATGTCTGCTCAGGCTTTCCACCAGGGAGAATCTTCTGCTGCTTTCCAGGCTGCTCATGCCAGATTTGTGGCTGCTGCTGCC AAGGTGAACACCCTGCTGGATGTGGCTCAGGCCAATCTGGGAGAAGCTGCTGGAACCTATGTGGCTGCTGATGCTGCTGCTGCCAGCACCTACACAGGATTTGGCGGATCTGG Strina 11 (D CGGAGGTGGCAGCGGTGGAATGCATGTGTCTTTTGTGATGGCTTACCCTGAAATGCTGGCTGCTGCTGCTGACACCCTCCAGAGCATTGGAGCCACCACAGTGGCTGGAGGCT 9 U CCGGCGGAGGTGGCTCAGGTGGAATGACCATCAATTACCAGTTTGGAGATGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGGATCTCTGGAAGCTGAACACCAGGCC ntJ ATCATTTCTGATGTGCTGACAGCTTCTGATTTCTGGGGAGGAGCTGGATCTGCTGCTTGCCAGGGATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGCC
AATGCTCATGGACAGAAGGTGCAGGCTGCTGGAAACAACATGGCTCAGACAGATTCTGCTGTGGGATCTTCTTGGGCTGGAGGCTCAGGAGGTGGCGGATCAGGAGGTGTGG ATGCTCATGGAGCCATGATCAGAGCCCAGGCTGCTTCTCTGGAAGCTGAACACCAGGCCATTGTGAGAGATGTGCTGGCTGCTGGAGATTTCTGGGGAGGAGCTGGATCTGTG GCTTGCCAGGAATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGGAGGCAGTGGAGGTGGCGGATCAGGTGGAATGGCCAGCAGATTCATGACAGATCC TCATGCCATGAGAGATGGTGGCTCAGGCGGAGGTGGCAGTGGTGGCATGTCTCAGATCATGTACAATTACCCTGCCATGCTGGGACATGCTGGAGACATGGCTGGATATGCTG GAACCCTCCAGTCTCTGGGAGCTGAAATTGCTGTGGAACAGGCTGCTCTCCAGTCTGCTTGGCAGGGAGACACAGGAATCACCTACCAGGCTTGGCAGGCTCAGTGGAATCAG GCCATGGAAGATCTGGTGAGAGCTTACCATGCCATGAGCAGCACCCATGAAGCCAACACCATGGCCATGATGGCCAGAGACACAGCTGAAGCTGCCAAATGGGGAGGAGGTGG CAGTGGCGGTGGAGGCAGTGGTGGCATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCC AGCGGAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 198]
GTTGTGCCTCCTGCCGCTGATGAAGTGTCTGCCCTGACAGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCTAGAGCCGCCGCTATCCACGATCAGTTC GTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGCCACTGAAGTGGCCAATGCTGCCGCTGGTGGATCTGGTGGCGGAGGATCTGGCGGAATGAGCCAGATCATGTACAA CTACCCCGCCATGCTGGGACACGCCGGCGATATGGCTGGATATGCCGGAACACTCCAGTCTCTGGGCGCCGAGATTGCTGTGGAACAGGCCGCACTTCAGTCTGCCTGGCAAG GCGATACCGGCATCACATATCAGGCCTGGCAGGCCCAGTGGAACCAGGCCATGGAAGATCTTGTGCGGGCCTACCACGCCATGAGCAGCACACATGAGGCCAACACAATGGCC ATGATGGCCCGGGATACAGCCGAAGCCGCTAAATGGGGCGGAGGCGGTAGTGGCGGTGGTGGAAGCGGAGGAATGGCCTCCAGATTCATGACCGATCCTCATGCCATGAGAG String 11_R (s) ATGGCGGTTCAGGCGGTGGCGGCTCTGGCGGAGTTGATGCACATGGCGCTATGATCAGAGCCCAGGCCGCTTCTCTGGAAGCCGAGCATCAAGCCATTGTGCGGGATGTTCTG ntl GCCGCTGGCGATTTTTGGGGAGGCGCTGGTTCTGTGGCCTGCCAAGAGTTTATCACACAGCTGGGCAGAAACTTCCAAGTGATCTACGAGCAAGGCGGATCAGGTGGCGGTGG
CAGCGGTGGAATGACCATCAATTACCAGTTCGGCGACGTGGACGCCCACGGGGCAATGATTAGAGCACAGGCTGGAAGCCTGGAAGCTGAACACCAGGCTATCATCAGCGACG TGCTGACCGCCTCTGATTTCTGGGGTGGTGCTGGATCTGCCGCTTGCCAGGGCTTTATTACCCAGCTCGGCCGGAATTTTCAAGTCATCTATGAGCAGGCCAACGCTCACGGCC AGAAAGTGCAAGCCGCCGGAAACAATATGGCCCAGACAGATTCTGCCGTGGGCAGCTCTTGGGCTGGCGGAAGTGGTGGTGGCGGTAGCGGTGGCATGCATGTGTCCTTCGT GATGGCTTACCCCGAGATGCTGGCCGCAGCCGCTGATACACTGCAATCTATCGGCGCCACAACAGTGGCAGGCGGAAGCGGCGGAGGCGGCAGCGGAGGGATGTCACTTCTG GATGCCCACATTCCTCAGCTGGTGGCCTCTCAGTCTGCTTTTGCCGCCAAAGCCGGCCTGATGAGACACACAATTGGACAGGCCGAGCAGGCCGCTATGTCTGCCCAGGCTTTT
Chimeric Nucleotide sequence protein
CACCAGGGCGAAAGCAGCGCAGCCTTTCAGGCTGCCCATGCCAGATTTGTGGCCGCTGCTGCCAAAGTGAACACCCTGCTGGATGTGGCCCAGGCCAATCTGGGAGAAGCCGC TGGAACATATGTGGCCGCAGATGCTGCTGCCGCCAGCACCTATACAGGCTTTGGAGGTAGCGGAGGTGGTGGCAGTGGCGGGATGACAAGCCGGTTTATGACAGACCCTCACG CTATGCGCGACATGGCCGGCAGATTTGAAGTGCACGCTCAGACCGTGGAAGATGAGGCCAGACGGATGTGGGCCTCCGCTCAGAATATTAGCGGAGCTGGCTGGAGCGGAATG GCCGAAGCTACAAGCCTGGACACCATGACACAGATGAATCAGGCCTTTCGGAACATCGTGAACATGCTCCACGGCGTCAGAGATGGCCTCGTCAGGGACGCCAACAACTACGAG
CAGCAAGAACAGGCCAGCCAGCAGATCCTGTCTAGCGGAGGTTCAGGTGGCGGAGGAAGCGGAGGATAATGA [SEQ ID NO: 199]
GTTGTACCACCGGCAGCAGATGAGGTGAGTGCCTTGACGGCTGCTCACTTTGCAGCGCACGCAGCCATGTATCAGAGCGTGTCAGCTAGGGCTGCCGCAATTCACGACCAATTC GTCGCTACGTTGGCATCCAGTGCATCCTCTTATGCCGCCACAGAAGTGGCCAATGCAGCAGCCGGCGGTAGCGGTGGAGGTGGGTCCGGCGGAATGAGCCAGATAATGTACAA CTATCCTGCTATGCTGGGGCATGCTGGTGACATGGCCGGATATGCTGGGACACTGCAAAGCCTGGGAGCTGAAATCGCAGTGGAACAGGCGGCCCTGCAAAGCGCTTGGCAGG GCGATACAGGAATTACCTACCAGGCTTGGCAGGCTCAGTGGAATCAGGCAATGGAGGATCTGGTTCGTGCTTACCATGCCATGTCATCCACTCACGAGGCCAATACCATGGCCA TGATGGCCCGTGACACAGCCGAAGCAGCAAAGTGGGGCGGCGGCGGTTCCGGTGGCGGTGGAAGCGGCGGAATGGCTAGTCGGTTCATGACCGATCCCCATGCTATGCGAGA TGGCGGCTCTGGAGGTGGCGGGAGCGGAGGGGTGGACGCGCATGGAGCGATGATAAGGGCTCAAGCGGCTTCCCTGGAAGCGGAACATCAGGCCATTGTCCGCGATGTGCTG GCAGCCGGCGATTTCTGGGGCGGAGCCGGAAGCGTTGCCTGCCAGGAATTCATCACCCAGCTGGGAAGGAACTTCCAGGTCATCTACGAACAAGGCGGCTCCGGCGGCGGAG Strinn i t R (-s') GCAGTGGCGGTATGACAATCAACTACCAGTTCGGTGACGTGGATGCCCACGGCGCAATGATACGCGCACAGGCAGGCAGCCTGGAAGCCGAGCATCAGGCCATAATCAGCGAC
91 J GTGCTTACTGCCTCAGACTTTTGGGGCGGTGCCGGCAGTGCGGCGTGTCAGGGCTTTATTACCCAGCTCGGACGGAACTTCCAAGTGATTTACGAACAAGCAAATGCACACGGC ntZ CAGAAGGTCCAGGCAGCTGGTAACAACATGGCTCAGACGGACAGCGCTGTGGGTTCTTCTTGGGCGGGAGGGTCAGGTGGAGGAGGATCTGGAGGGATGCATGTGAGCTTCG
TGATGGCCTATCCTGAGATGCTCGCCGCCGCTGCGGATACCCTCCAGTCCATTGGAGCTACAACAGTCGCTGGCGGCAGTGGAGGGGGTGGTTCCGGTGGCATGTCACTCTTG GACGCCCACATTCCACAACTGGTTGCCTCTCAGAGCGCCTTTGCCGCCAAAGCCGGTCTGATGAGACATACTATCGGGCAAGCGGAACAGGCCGCAATGTCTGCCCAGGCCTTT CACCAAGGGGAATCTAGCGCCGCATTCCAAGCGGCGCATGCACGGTTTGTCGCTGCTGCCGCTAAGGTAAATACTCTGCTGGACGTAGCGCAGGCTAACCTCGGCGAGGCTGC TGGTACGTATGTGGCCGCCGATGCCGCTGCCGCGTCCACGTATACGGGCTTCGGTGGTTCCGGCGGAGGCGGGAGTGGTGGGATGACAAGCCGATTCATGACAGACCCTCAC GCAATGCGGGATATGGCCGGGAGATTTGAGGTGCATGCTCAGACGGTCGAAGATGAAGCACGACGTATGTGGGCAAGCGCACAGAACATTAGTGGTGCCGGATGGTCTGGGA TGGCGGAAGCAACCTCTTTGGACACTATGACGCAAATGAACCAGGCATTTCGCAATATAGTCAATATGCTTCATGGCGTCAGAGATGGATTGGTGAGGGATGCCAATAACTATG AGCAGCAAGAACAGGCCTCACAGCAGATCCTTTCATCTGGTGGCAGTGGAGGCGGCGGAAGTGGAGGGTAATGA [SEQ ID NO: 200]
GTGGTGCCTCCTGCTGCTGATGAAGTGTCTGCTCTGACAGCTGCTCACTTTGCTGCTCATGCTGCCATGTACCAGTCTGTGTCTGCCAGAGCTGCTGCCATTCATGATCAGTTT GTGGCCACCCTGGCTTCTTCTGCTTCTTCTTATGCTGCCACAGAAGTGGCCAATGCTGCTGCTGGAGGCTCTGGCGGAGGTGGCAGTGGTGGCATGTCTCAGATCATGTACAAT TACCCTGCCATGCTGGGACATGCTGGAGACATGGCTGGATATGCTGGAACCCTCCAGTCTCTGGGAGCTGAAATTGCTGTGGAACAGGCTGCTCTCCAGTCTGCTTGGCAGGG AGACACAGGAATCACCTACCAGGCTTGGCAGGCTCAGTGGAATCAGGCCATGGAAGATCTGGTGAGAGCTTACCATGCCATGAGCAGCACCCATGAAGCCAACACCATGGCCAT GATGGCCAGAGACACAGCTGAAGCTGCCAAATGGGGAGGAGGTGGCTCCGGCGGAGGTGGCTCTGGCGGAATGGCCAGCAGATTCATGACAGATCCTCATGCCATGAGAGAT GGCGGATCTGGCGGAGGTGGCAGCGGTGGAGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGCTTCTCTGGAAGCTGAACACCAGGCCATTGTGAGAGATGTGCTGG
String 11_R (s) CTGCTGGAGATTTCTGGGGAGGAGCTGGATCTGTGGCTTGCCAGGAATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGGAGGCTCCGGCGGAGGTGGC nt3 TCAGGTGGAATGACCATCAATTACCAGTTTGGAGATGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGGATCTCTGGAAGCTGAACACCAGGCCATCATTTCTGATGTG
CTGACAGCTTCTGATTTCTGGGGAGGAGCTGGATCTGCTGCTTGCCAGGGATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGCCAATGCTCATGGACAG AAGGTGCAGGCTGCTGGAAACAACATGGCTCAGACAGATTCTGCTGTGGGATCTTCTTGGGCTGGAGGCTCAGGAGGTGGCGGATCAGGAGGTATGCATGTGTCTTTTGTGAT GGCTTACCCTGAAATGCTGGCTGCTGCTGCTGACACCCTCCAGAGCATTGGAGCCACCACAGTGGCTGGAGGCAGTGGAGGTGGCGGATCAGGTGGAATGTCTCTGCTGGATG CTCACATCCCTCAGCTGGTGGCTTCTCAGTCTGCTTTTGCTGCCAAGGCTGGACTGATGAGACACACCATTGGACAGGCTGAACAGGCTGCCATGTCTGCTCAGGCTTTCCACC AGGGAGAATCTTCTGCTGCTTTCCAGGCTGCTCATGCCAGATTTGTGGCTGCTGCTGCCAAGGTGAACACCCTGCTGGATGTGGCTCAGGCCAATCTGGGAGAAGCTGCTGGA ACCTATGTGGCTGCTGATGCTGCTGCTGCCAGCACCTACACAGGATTTGGTGGCTCAGGCGGAGGTGGCAGTGGTGGCATGACCAGCAGATTCATGACAGATCCTCATGCCAT
Chimeric Nucleotide sequence protein
GAGAGACATGGCTGGAAGATTTGAAGTGCATGCTCAGACAGTGGAAGATGAAGCCAGAAGAATGTGGGCTTCTGCTCAGAACATTTCTGGAGCTGGATGGTCTGGAATGGCTG
AAGCCACCTCTCTGGACACCATGACCCAGATGAATCAGGCTTTCAGAAACATTGTGAACATGCTGCATGGAGTGAGAGATGGACTGGTGAGAGATGCCAACAATTATGAACAGC
AGGAACAGGCTTCTCAGCAGATCCTGTCTTCTGGTGGCAGTGGCGGTGGAGGCAGTGGTGGCTAATGA [SEQ ID NO: 201]
ATGGGCGGAGCTGCTGCTAGACTGGGAGCCGTGATCCTGTTCGTGGTTATCGTGGGACTGCACGGCGTTAGAGGCGTTGTGCCTCCTGCCGCTGATGAAGTGTCTGCCCTGAC AGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCTAGAGCCGCCGCTATCCACGATCAGTTCGTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGC CACTGAAGTGGCCAATGCTGCCGCTGGTGGATCTGGTGGCGGAGGATCTGGCGGAATGAGCCAGATCATGTACAACTACCCCGCCATGCTGGGACACGCCGGCGATATGGCTG GATATGCCGGAACACTCCAGTCTCTGGGCGCCGAGATTGCTGTGGAACAGGCCGCACTTCAGTCTGCCTGGCAAGGCGATACCGGCATCACATATCAGGCCTGGCAGGCCCAG TGGAACCAGGCCATGGAAGATCTTGTGCGGGCCTACCACGCCATGAGCAGCACACATGAGGCCAACACAATGGCCATGATGGCCCGGGATACAGCCGAAGCCGCTAAATGGGG CGGAGGCGGTAGTGGCGGTGGTGGAAGCGGAGGAATGGCCTCCAGATTCATGACCGATCCTCATGCCATGAGAGATGGCGGTTCAGGCGGTGGCGGCTCTGGCGGAGTTGAT GCACATGGCGCTATGATCAGAGCCCAGGCCGCTTCTCTGGAAGCCGAGCATCAAGCCATTGTGCGGGATGTTCTGGCCGCTGGCGATTTTTGGGGAGGCGCTGGTTCTGTGGC CTGCCAAGAGTTTATCACACAGCTGGGCAGAAACTTCCAAGTGATCTACGAGCAAGGCGGATCAGGTGGCGGTGGCAGCGGTGGAATGACCATCAATTACCAGTTCGGCGACG Strina 11 R (D TGGACGCCCACGGGGCAATGATTAGAGCACAGGCTGGAAGCCTGGAAGCTGAACACCAGGCTATCATCAGCGACGTGCTGACCGCCTCTGATTTCTGGGGTGGTGCTGGATCT 9 - U GCCGCTTGCCAGGGCTTTATTACCCAGCTCGGCCGGAATTTTCAAGTCATCTATGAGCAGGCCAACGCTCACGGCCAGAAAGTGCAAGCCGCCGGAAACAATATGGCCCAGACA ntl GATTCTGCCGTGGGCAGCTCTTGGGCTGGCGGAAGTGGTGGTGGCGGTAGCGGTGGCATGCATGTGTCCTTCGTGATGGCTTACCCCGAGATGCTGGCCGCAGCCGCTGATA
CACTGCAATCTATCGGCGCCACAACAGTGGCAGGCGGAAGCGGCGGAGGCGGCAGCGGAGGGATGTCACTTCTGGATGCCCACATTCCTCAGCTGGTGGCCTCTCAGTCTGCT TTTGCCGCCAAAGCCGGCCTGATGAGACACACAATTGGACAGGCCGAGCAGGCCGCTATGTCTGCCCAGGCTTTTCACCAGGGCGAAAGCAGCGCAGCCTTTCAGGCTGCCCAT GCCAGATTTGTGGCCGCTGCTGCCAAAGTGAACACCCTGCTGGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCTGGAACATATGTGGCCGCAGATGCTGCTGCCGCCAGCAC CTATACAGGCTTTGGAGGTAGCGGAGGTGGTGGCAGTGGCGGGATGACAAGCCGGTTTATGACAGACCCTCACGCTATGCGCGACATGGCCGGCAGATTTGAAGTGCACGCTC AGACCGTGGAAGATGAGGCCAGACGGATGTGGGCCTCCGCTCAGAATATTAGCGGAGCTGGCTGGAGCGGAATGGCCGAAGCTACAAGCCTGGACACCATGACACAGATGAAT CAGGCCTTTCGGAACATCGTGAACATGCTCCACGGCGTCAGAGATGGCCTCGTCAGGGACGCCAACAACTACGAGCAGCAAGAACAGGCCAGCCAGCAGATCCTGTCTAGCGG AGGTTCAGGTGGCGGAGGAAGCGGAGGAATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAA GTCCAGCGGAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 202]
ATGGGCGGCGCGGCTGCTCGTCTTGGGGCCGTGATTCTGTTTGTAGTGATAGTGGGTCTGCACGGCGTCCGAGGCGTTGTACCACCGGCAGCAGATGAGGTGAGTGCCTTGA CGGCTGCTCACTTTGCAGCGCACGCAGCCATGTATCAGAGCGTGTCAGCTAGGGCTGCCGCAATTCACGACCAATTCGTCGCTACGTTGGCATCCAGTGCATCCTCTTATGCCG CCACAGAAGTGGCCAATGCAGCAGCCGGCGGTAGCGGTGGAGGTGGGTCCGGCGGAATGAGCCAGATAATGTACAACTATCCTGCTATGCTGGGGCATGCTGGTGACATGGCC GGATATGCTGGGACACTGCAAAGCCTGGGAGCTGAAATCGCAGTGGAACAGGCGGCCCTGCAAAGCGCTTGGCAGGGCGATACAGGAATTACCTACCAGGCTTGGCAGGCTCA GTGGAATCAGGCAATGGAGGATCTGGTTCGTGCTTACCATGCCATGTCATCCACTCACGAGGCCAATACCATGGCCATGATGGCCCGTGACACAGCCGAAGCAGCAAAGTGGG
String 11_R (I) GCGGCGGCGGTTCCGGTGGCGGTGGAAGCGGCGGAATGGCTAGTCGGTTCATGACCGATCCCCATGCTATGCGAGATGGCGGCTCTGGAGGTGGCGGGAGCGGAGGGGTGG nt2 ACGCGCATGGAGCGATGATAAGGGCTCAAGCGGCTTCCCTGGAAGCGGAACATCAGGCCATTGTCCGCGATGTGCTGGCAGCCGGCGATTTCTGGGGCGGAGCCGGAAGCGT
TGCCTGCCAGGAATTCATCACCCAGCTGGGAAGGAACTTCCAGGTCATCTACGAACAAGGCGGCTCCGGCGGCGGAGGCAGTGGCGGTATGACAATCAACTACCAGTTCGGTG ACGTGGATGCCCACGGCGCAATGATACGCGCACAGGCAGGCAGCCTGGAAGCCGAGCATCAGGCCATAATCAGCGACGTGCTTACTGCCTCAGACTTTTGGGGCGGTGCCGGC AGTGCGGCGTGTCAGGGCTTTATTACCCAGCTCGGACGGAACTTCCAAGTGATTTACGAACAAGCAAATGCACACGGCCAGAAGGTCCAGGCAGCTGGTAACAACATGGCTCAG ACGGACAGCGCTGTGGGTTCTTCTTGGGCGGGAGGGTCAGGTGGAGGAGGATCTGGAGGGATGCATGTGAGCTTCGTGATGGCCTATCCTGAGATGCTCGCCGCCGCTGCGG ATACCCTCCAGTCCATTGGAGCTACAACAGTCGCTGGCGGCAGTGGAGGGGGTGGTTCCGGTGGCATGTCACTCTTGGACGCCCACATTCCACAACTGGTTGCCTCTCAGAGC
. . Nucleotide sequence protein _ _
GCCTTTGCCGCCAAAGCCGGTCTGATGAGACATACTATCGGGCAAGCGGAACAGGCCGCAATGTCTGCCCAGGCCTTTCACCAAGGGGAATCTAGCGCCGCATTCCAAGCGGC GCATGCACGGTTTGTCGCTGCTGCCGCTAAGGTAAATACTCTGCTGGACGTAGCGCAGGCTAACCTCGGCGAGGCTGCTGGTACGTATGTGGCCGCCGATGCCGCTGCCGCGT CCACGTATACGGGCTTCGGTGGTTCCGGCGGAGGCGGGAGTGGTGGGATGACAAGCCGATTCATGACAGACCCTCACGCAATGCGGGATATGGCCGGGAGATTTGAGGTGCA
TGCTCAGACGGTCGAAGATGAAGCACGACGTATGTGGGCAAGCGCACAGAACATTAGTGGTGCCGGATGGTCTGGGATGGCGGAAGCAACCTCTTTGGACACTATGACGCAAA TGAACCAGGCATTTCGCAATATAGTCAATATGCTTCATGGCGTCAGAGATGGATTGGTGAGGGATGCCAATAACTATGAGCAGCAAGAACAGGCCTCACAGCAGATCCTTTCAT CTGGTGGCAGTGGAGGCGGCGGAAGTGGAGGGATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGAC
GGAAGTCCAGCGGAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 203]
ATGGGAGGAGCTGCTGCCAGACTGGGAGCTGTGATTCTGTTTGTGGTGATTGTGGGACTGCATGGAGTGAGAGGAGTGGTGCCTCCTGCTGCTGATGAAGTGTCTGCTCTGAC AGCTGCTCACTTTGCTGCTCATGCTGCCATGTACCAGTCTGTGTCTGCCAGAGCTGCTGCCATTCATGATCAGTTTGTGGCCACCCTGGCTTCTTCTGCTTCTTCTTATGCTGCC ACAGAAGTGGCCAATGCTGCTGCTGGAGGCTCTGGCGGAGGTGGCAGTGGTGGCATGTCTCAGATCATGTACAATTACCCTGCCATGCTGGGACATGCTGGAGACATGGCTGG ATATGCTGGAACCCTCCAGTCTCTGGGAGCTGAAATTGCTGTGGAACAGGCTGCTCTCCAGTCTGCTTGGCAGGGAGACACAGGAATCACCTACCAGGCTTGGCAGGCTCAGT GGAATCAGGCCATGGAAGATCTGGTGAGAGCTTACCATGCCATGAGCAGCACCCATGAAGCCAACACCATGGCCATGATGGCCAGAGACACAGCTGAAGCTGCCAAATGGGGA GGAGGTGGCTCCGGCGGAGGTGGCTCTGGCGGAATGGCCAGCAGATTCATGACAGATCCTCATGCCATGAGAGATGGCGGATCTGGCGGAGGTGGCAGCGGTGGAGTGGATG CTCATGGAGCCATGATCAGAGCCCAGGCTGCTTCTCTGGAAGCTGAACACCAGGCCATTGTGAGAGATGTGCTGGCTGCTGGAGATTTCTGGGGAGGAGCTGGATCTGTGGCT TGCCAGGAATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGGAGGCTCCGGCGGAGGTGGCTCAGGTGGAATGACCATCAATTACCAGTTTGGAGATGT
Strina 11 R ID GGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGGATCTCTGGAAGCTGAACACCAGGCCATCATTTCTGATGTGCTGACAGCTTCTGATTTCTGGGGAGGAGCTGGATCTG
9 - U CTGCTTGCCAGGGATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGCCAATGCTCATGGACAGAAGGTGCAGGCTGCTGGAAACAACATGGCTCAGACAG ntJ ATTCTGCTGTGGGATCTTCTTGGGCTGGAGGCTCAGGAGGTGGCGGATCAGGAGGTATGCATGTGTCTTTTGTGATGGCTTACCCTGAAATGCTGGCTGCTGCTGCTGACACC
CTCCAGAGCATTGGAGCCACCACAGTGGCTGGAGGCAGTGGAGGTGGCGGATCAGGTGGAATGTCTCTGCTGGATGCTCACATCCCTCAGCTGGTGGCTTCTCAGTCTGCTTT TGCTGCCAAGGCTGGACTGATGAGACACACCATTGGACAGGCTGAACAGGCTGCCATGTCTGCTCAGGCTTTCCACCAGGGAGAATCTTCTGCTGCTTTCCAGGCTGCTCATGC CAGATTTGTGGCTGCTGCTGCCAAGGTGAACACCCTGCTGGATGTGGCTCAGGCCAATCTGGGAGAAGCTGCTGGAACCTATGTGGCTGCTGATGCTGCTGCTGCCAGCACCT ACACAGGATTTGGTGGCTCAGGCGGAGGTGGCAGTGGTGGCATGACCAGCAGATTCATGACAGATCCTCATGCCATGAGAGACATGGCTGGAAGATTTGAAGTGCATGCTCAG ACAGTGGAAGATGAAGCCAGAAGAATGTGGGCTTCTGCTCAGAACATTTCTGGAGCTGGATGGTCTGGAATGGCTGAAGCCACCTCTCTGGACACCATGACCCAGATGAATCAG GCTTTCAGAAACATTGTGAACATGCTGCATGGAGTGAGAGATGGACTGGTGAGAGATGCCAACAATTATGAACAGCAGGAACAGGCTTCTCAGCAGATCCTGTCTTCTGGTGGC AGTGGCGGTGGAGGCAGTGGTGGCATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCA GCGGAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 204]
GTTGTGCCTCCTGCCGCTGATGAAGTGTCTGCCCTGACAGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCTAGAGCCGCCGCTATCCACGATCAGTTC GTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGCCACTGAAGTGGCCAATGCTGCCGCTGGTGGATCTGGTGGCGGAGGATCTGGCGGAATGACCAGCCGGTTTATGAC CGATCCTCACGCCATGAGAGACATGGCCGGCAGATTTGAAGTGCACGCCCAGACCGTGGAAGATGAGGCTAGAAGAATGTGGGCCAGCGCTCAGAACATTAGCGGAGCTGGCT GGAGCGGAATGGCCGAAGCTACAAGCCTGGACACCATGACACAGATGAACCAGGCCTTCCGCAACATCGTGAACATGCTGCATGGCGTCAGAGATGGCCTTGTGCGGGACGCC AACAACTACGAGCAGCAAGAACAGGCCAGCCAGCAGATCCTGTCTAGCGGAGGAAGCGGCGGAGGCGGAAGCGGTGGAATGTCACTGCTGGATGCTCACATCCCTCAGCTGGT String 12 (s) GGCCTCTCAGTCTGCCTTTGCTGCCAAAGCCGGCCTGATGAGACACACAATTGGACAGGCCGAGCAGGCCGCTATGTCTGCCCAGGCTTTTCACCAGGGCGAAAGCAGCGCAG ntl CCTTTCAGGCTGCCCATGCCAGATTTGTGGCCGCTGCCGCCAAAGTGAACACCCTGCTTGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCCGGAACTTATGTGGCCGCAGAT
GCTGCTGCCGCCTCTACCTATACCGGATTTGGTGGTAGTGGCGGTGGTGGCTCTGGCGGACATTCTTTGCTGGATGAGGGCAAGCAGAGCCTGACCAAACTGGCAGCTGCATG GGGCGGATCTGGCTCTGAAGCTTATCAGGGCGTGCAGCAGAAGTGGGACGCCACAGCTACCGAACTGAACAACGCCCTCCAGAACCTGGCCAGAACAATCTCTGAAGCCGGCC AAGGTGGAAGCGGAGGTGGTGGCAGCGGCGGCATGCATGTGTCTTTCGTGATGGCTTACCCCGAGATGCTGGCCGCAGCCGCTGATACACTCCAGTCTATCGGAGCCACAACA GTGGCTGGCGGTAGCGGAGGCGGAGGTAGCGGAGGAATGACCATCAACTACCAGTTCGGCGACGTGGACGCCCACGGCGCTATGATTAGAGCACAGGCCGGAAGCCTGGAAG CCGAGCACCAGGCCATCATCTCTGATGTGCTGACCGCCAGCGATTTCTGGGGAGGTGCTGGTTCTGCTGCCTGCCAGGGCTTTATCACACAGCTGGGCAGAAACTTCCAAGTGA
. . Nucleotide sequence protein _ _
TCTATGAGCAGGCCAACGCTCACGGCCAGAAAGTGCAAGCCGCTGGCAACAATATGGCCCAGACAGATTCTGCCGTGGGCAGCTCTTGGGCTGGCGGTTCTGGCGGAGGTGGT AGCGGTGGCATGACAGAGCAGCAGTGGAATTTCGCCGGAATCGAGGCCGCTGCAAGCGCCATTCAGGGCAATGTGACCAGCATCCACAGCCTGCTGGACGAGGGAAAACAGTC AGGCGGCTCTGGCGGCGGAGGCAGTGGCGGAGTTGATGCTCATGGCGCAATGATCAGAGCCCAAGCCGCCTCTCTGGAAGCTGAACATCAGGCTATCGTGCGCGACGTTCTGG CCGCTGGGGATTTTTGGGGCGGAGCAGGTTCTGTGGCCTGTCAAGAGTTCATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTACGAGCAAGGCGGCTCAGGTGGTGGCGGC TCCGGTGGAATGGCTTCCAGATTCATGACAGACCCACATGCTATGCGCGACGGCGGCTCAGGCGGAGGCGGATCAGGCGGCATGTCTCAGATCATGTACAACTACCCCGCCAT GCTGGGACACGCCGGCGATATGGCTGGATATGCCGGCACACTGCAATCTCTGGGCGCCGAAATTGCCGTGGAACAGGCCGCTCTGCAATCTGCTTGGCAGGGCGATACCGGCA TCACCTATCAGGCTTGGCAAGCCCAGTGGAATCAGGCCATGGAAGATCTCGTGCGGGCCTACCATGCCATGTCTAGCACACACGAGGCCAACACAATGGCCATGATGGCCCGGG ATACAGCCGAAGCCGCTAAATGGGGAGGTGGCGGTAGTGGTGGTGGCGGAAGTGGCGGATAATGA [SEQ ID NO: 205]
GTGGTTCCGCCAGCAGCCGACGAGGTTAGCGCATTGACAGCTGCCCACTTTGCCGCCCATGCTGCAATGTACCAGTCTGTGAGCGCTAGAGCGGCTGCTATTCACGACCAATTC GTAGCCACTCTGGCCTCAAGTGCGTCATCCTACGCTGCCACAGAAGTCGCTAACGCTGCGGCAGGAGGGTCAGGAGGCGGCGGGTCCGGTGGTATGACTAGCCGCTTCATGAC TGACCCTCACGCAATGAGAGACATGGCTGGGAGGTTCGAGGTGCATGCGCAGACTGTGGAGGACGAAGCTCGACGGATGTGGGCGAGTGCACAGAATATCAGTGGGGCCGGA TGGAGCGGGATGGCCGAAGCTACTTCCCTTGACACGATGACCCAGATGAACCAGGCCTTCAGAAACATCGTGAATATGCTGCATGGGGTAAGGGACGGCCTGGTGAGGGATGC CAATAACTATGAACAGCAGGAACAGGCCAGCCAACAGATCCTGTCCTCTGGAGGCTCAGGAGGAGGCGGGAGCGGTGGCATGTCACTTCTTGACGCCCATATACCGCAGCTGG TGGCATCCCAGTCAGCCTTTGCAGCGAAAGCCGGGCTCATGCGGCACACGATAGGCCAGGCAGAGCAAGCCGCCATGAGCGCACAGGCGTTTCACCAAGGGGAAAGCTCTGCG GCGTTCCAGGCCGCCCATGCACGTTTTGTAGCAGCAGCCGCAAAGGTGAATACACTGCTGGATGTGGCCCAAGCTAACCTGGGAGAGGCGGCAGGCACATATGTGGCTGCTGA CGCGGCGGCTGCCAGCACCTATACAGGCTTTGGGGGCAGCGGAGGAGGTGGGAGCGGAGGGCATTCACTCCTGGACGAAGGCAAGCAGTCTTTGACTAAACTGGCTGCCGCT TGGGGAGGGAGCGGTTCTGAGGCTTACCAAGGAGTTCAGCAAAAATGGGATGCAACCGCTACTGAGCTGAATAACGCACTTCAGAATCTCGCTAGGACGATTAGTGAGGCTGG
String 12 (s) TCAGGGCGGGAGCGGTGGAGGCGGGTCCGGCGGGATGCACGTCAGCTTTGTCATGGCATATCCCGAGATGTTGGCAGCCGCTGCCGATACTCTGCAATCTATTGGCGCCACCA nt2 CCGTTGCCGGTGGGAGCGGAGGCGGCGGATCTGGCGGTATGACCATCAACTACCAATTCGGCGATGTGGATGCCCACGGCGCAATGATCCGCGCTCAGGCCGGCAGCCTGGA
AGCTGAACATCAAGCTATAATTTCCGATGTTCTGACAGCTAGTGACTTCTGGGGAGGCGCAGGCAGTGCCGCATGCCAAGGGTTCATCACACAACTCGGACGCAACTTTCAAGT CATCTATGAGCAGGCAAATGCACACGGCCAGAAGGTACAGGCAGCTGGAAACAACATGGCACAGACCGACAGTGCCGTTGGCTCTAGTTGGGCCGGAGGATCTGGTGGCGGAG GGAGCGGGGGTATGACAGAGCAGCAGTGGAATTTTGCAGGCATAGAAGCCGCGGCCTCCGCCATTCAGGGTAATGTCACGAGTATTCACTCACTGTTGGACGAGGGCAAACAA TCTGGCGGTAGCGGTGGCGGTGGCTCTGGTGGAGTGGACGCCCATGGGGCCATGATCAGAGCACAGGCAGCTTCTTTGGAGGCCGAGCATCAGGCCATTGTCAGAGATGTCC TGGCTGCGGGTGATTTCTGGGGAGGAGCCGGTTCCGTGGCCTGTCAGGAATTCATCACGCAGTTGGGGAGGAACTTCCAGGTGATCTACGAGCAGGGCGGCTCCGGCGGCGG AGGGAGCGGCGGCATGGCAAGTCGGTTCATGACAGATCCCCATGCAATGCGTGACGGAGGGTCCGGCGGTGGAGGCAGCGGAGGTATGTCCCAAATTATGTACAACTATCCTG CAATGCTGGGGCATGCCGGCGATATGGCAGGGTATGCCGGCACCCTCCAGTCCCTCGGTGCTGAAATCGCCGTGGAACAAGCCGCGCTGCAAAGTGCATGGCAGGGCGATACC GGAATAACCTATCAGGCCTGGCAAGCACAGTGGAATCAAGCAATGGAAGATCTGGTCCGAGCCTACCACGCAATGTCCTCTACACACGAGGCTAATACCATGGCTATGATGGCA CGGGACACCGCCGAAGCGGCGAAATGGGGCGGTGGCGGTAGTGGAGGAGGAGGTTCAGGCGGGTAATGA [SEQ ID NO: 206]
GTGGTGCCTCCTGCTGCTGATGAAGTGTCTGCTCTGACAGCTGCTCACTTTGCTGCTCATGCTGCCATGTACCAGTCTGTGTCTGCCAGAGCTGCTGCCATTCATGATCAGTTT GTGGCCACCCTGGCTTCTTCTGCTTCTTCTTATGCTGCCACAGAAGTGGCCAATGCTGCTGCTGGAGGCTCTGGCGGAGGTGGCAGTGGTGGCATGACCAGCAGATTCATGAC AGATCCTCATGCCATGAGAGACATGGCTGGAAGATTTGAAGTGCATGCTCAGACAGTGGAAGATGAAGCCAGAAGAATGTGGGCTTCTGCTCAGAACATTTCTGGAGCTGGAT GGTCTGGAATGGCTGAAGCCACCTCTCTGGACACCATGACCCAGATGAATCAGGCTTTCAGAAACATTGTGAACATGCTGCATGGAGTGAGAGATGGACTGGTGAGAGATGCC String 12 (s') AACAATTATGAACAGCAGGAACAGGCTTCTCAGCAGATCCTGTCTTCTGGTGGCTCCGGCGGAGGTGGCTCTGGCGGAATGTCTCTGCTGGATGCTCACATCCCTCAGCTGGTG t3 9 k 1 GmCTCAGTCTGCTTTTGCTGCCAAGGCTGGACTGATGAGACACACCATTGGACAGGCTGAACAGGCTGCCATGTCTGCTCAGGCTTTCCACCAGGGAGAATCTTCTGCTGCT
TTCCAGGCTGCTCATGCCAGATTTGTGGCTGCTGCTGCCAAGGTGAACACCCTGCTGGATGTGGCTCAGGCCAATCTGGGAGAAGCTGCTGGAACCTATGTGGCTGCTGATGC TGCTGCTGCCAGCACCTACACAGGATTTGGCGGATCTGGCGGAGGTGGCAGCGGTGGACACTCTCTGCTGGATGAAGGAAAACAGTCTCTGACCAAACTGGCTGCTGCTTGGG GAGGATCTGGATCTGAAGCTTACCAGGGAGTGCAGCAGAAATGGGATGCCACAGCCACAGAACTGAACAATGCTCTCCAGAATCTGGCCAGAACCATCTCTGAAGCTGGACAGG GAGGCTCCGGCGGAGGTGGCTCAGGTGGAATGCATGTGTCTTTTGTGATGGCTTACCCTGAAATGCTGGCTGCTGCTGCTGACACCCTCCAGAGCATTGGAGCCACCACAGTG GCTGGAGGCTCAGGAGGTGGCGGATCAGGAGGTATGACCATCAATTACCAGTTTGGAGATGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGGATCTCTGGAAGCTGA
. . Nucleotide sequence protein _ _ > >
ACACCAGGCCATCATTTCTGATGTGCTGACAGCTTCTGATTTCTGGGGAGGAGCTGGATCTGCTGCTTGCCAGGGATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTA TGAACAGGCCAATGCTCATGGACAGAAGGTGCAGGCTGCTGGAAACAACATGGCTCAGACAGATTCTGCTGTGGGATCTTCTTGGGCTGGAGGCAGTGGAGGTGGCGGATCAG GTGGAATGACAGAACAGCAGTGGAATTTTGCTGGAATTGAAGCTGCTGCTTCTGCCATCCAGGGAAATGTGACCAGCATTCACTCTCTGCTGGATGAAGGAAAACAGTCTGGTG GCTCAGGCGGAGGTGGCAGTGGTGGCGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGCTTCTCTGGAAGCTGAACACCAGGCCATTGTGAGAGATGTGCTGGCTGCT GGAGATTTCTGGGGAGGAGCTGGATCTGTGGCTTGCCAGGAATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGGTGGCAGTGGCGGTGGAGGCAGTG GTGGCATGGCCAGCAGATTCATGACAGATCCTCATGCCATGAGAGATGGCGGTTCTGGCGGAGGTGGCAGTGGTGGCATGTCTCAGATCATGTACAATTACCCTGCCATGCTG GGACATGCTGGAGACATGGCTGGATATGCTGGAACCCTCCAGTCTCTGGGAGCTGAAATTGCTGTGGAACAGGCTGCTCTCCAGTCTGCTTGGCAGGGAGACACAGGAATCAC CTACCAGGCTTGGCAGGCTCAGTGGAATCAGGCCATGGAAGATCTGGTGAGAGCTTACCATGCCATGAGCAGCACCCATGAAGCCAACACCATGGCCATGATGGCCAGAGACAC AGCTGAAGCTGCCAAATGGGGAGGAGGTGGCTCTGGAGGCGGTGGATCAGGTGGATAATGA [SEQ ID NO: 207] ATGGGCGGAGCTGCTGCTAGACTGGGAGCCGTGATCCTGTTCGTGGTTATCGTGGGACTGCACGGCGTTAGAGGCGTTGTGCCTCCTGCCGCTGATGAAGTGTCTGCCCTGAC AGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCTAGAGCCGCCGCTATCCACGATCAGTTCGTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGC CACTGAAGTGGCCAATGCTGCCGCTGGTGGATCTGGTGGCGGAGGATCTGGCGGAATGACCAGCCGGTTTATGACCGATCCTCACGCCATGAGAGACATGGCCGGCAGATTTG AAGTGCACGCCCAGACCGTGGAAGATGAGGCTAGAAGAATGTGGGCCAGCGCTCAGAACATTAGCGGAGCTGGCTGGAGCGGAATGGCCGAAGCTACAAGCCTGGACACCATG ACACAGATGAACCAGGCCTTCCGCAACATCGTGAACATGCTGCATGGCGTCAGAGATGGCCTTGTGCGGGACGCCAACAACTACGAGCAGCAAGAACAGGCCAGCCAGCAGATC CTGTCTAGCGGAGGAAGCGGCGGAGGCGGAAGCGGTGGAATGTCACTGCTGGATGCTCACATCCCTCAGCTGGTGGCCTCTCAGTCTGCCTTTGCTGCCAAAGCCGGCCTGAT GAGACACACAATTGGACAGGCCGAGCAGGCCGCTATGTCTGCCCAGGCTTTTCACCAGGGCGAAAGCAGCGCAGCCTTTCAGGCTGCCCATGCCAGATTTGTGGCCGCTGCCG CCAAAGTGAACACCCTGCTTGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCCGGAACTTATGTGGCCGCAGATGCTGCTGCCGCCTCTACCTATACCGGATTTGGTGGTAGT GGCGGTGGTGGCTCTGGCGGACATTCTTTGCTGGATGAGGGCAAGCAGAGCCTGACCAAACTGGCAGCTGCATGGGGCGGATCTGGCTCTGAAGCTTATCAGGGCGTGCAGC AGAAGTGGGACGCCACAGCTACCGAACTGAACAACGCCCTCCAGAACCTGGCCAGAACAATCTCTGAAGCCGGCCAAGGTGGAAGCGGAGGTGGTGGCAGCGGCGGCATGCAT String 12 (I) GTGTCTTTCGTGATGGCTTACCCCGAGATGCTGGCCGCAGCCGCTGATACACTCCAGTCTATCGGAGCCACAACAGTGGCTGGCGGTAGCGGAGGCGGAGGTAGCGGAGGAAT ntl GACCATCAACTACCAGTTCGGCGACGTGGACGCCCACGGCGCTATGATTAGAGCACAGGCCGGAAGCCTGGAAGCCGAGCACCAGGCCATCATCTCTGATGTGCTGACCGCCA
GCGATTTCTGGGGAGGTGCTGGTTCTGCTGCCTGCCAGGGCTTTATCACACAGCTGGGCAGAAACTTCCAAGTGATCTATGAGCAGGCCAACGCTCACGGCCAGAAAGTGCAA GCCGCTGGCAACAATATGGCCCAGACAGATTCTGCCGTGGGCAGCTCTTGGGCTGGCGGTTCTGGCGGAGGTGGTAGCGGTGGCATGACAGAGCAGCAGTGGAATTTCGCCG GAATCGAGGCCGCTGCAAGCGCCATTCAGGGCAATGTGACCAGCATCCACAGCCTGCTGGACGAGGGAAAACAGTCAGGCGGCTCTGGCGGCGGAGGCAGTGGCGGAGTTGA TGCTCATGGCGCAATGATCAGAGCCCAAGCCGCCTCTCTGGAAGCTGAACATCAGGCTATCGTGCGCGACGTTCTGGCCGCTGGGGATTTTTGGGGCGGAGCAGGTTCTGTGG CCTGTCAAGAGTTCATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTACGAGCAAGGCGGCTCAGGTGGTGGCGGCTCCGGTGGAATGGCTTCCAGATTCATGACAGACCCAC ATGCTATGCGCGACGGCGGCTCAGGCGGAGGCGGATCAGGCGGCATGTCTCAGATCATGTACAACTACCCCGCCATGCTGGGACACGCCGGCGATATGGCTGGATATGCCGGC ACACTGCAATCTCTGGGCGCCGAAATTGCCGTGGAACAGGCCGCTCTGCAATCTGCTTGGCAGGGCGATACCGGCATCACCTATCAGGCTTGGCAAGCCCAGTGGAATCAGGC CATGGAAGATCTCGTGCGGGCCTACCATGCCATGTCTAGCACACACGAGGCCAACACAATGGCCATGATGGCCCGGGATACAGCCGAAGCCGCTAAATGGGGAGGTGGCGGTA GTGGTGGTGGCGGAAGTGGCGGAATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCA GCGGAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 208]
ATGGGCGGTGCAGCTGCTCGCCTCGGGGCAGTTATTCTGTTCGTGGTCATAGTGGGATTGCACGGGGTGAGAGGCGTGGTTCCGCCAGCAGCCGACGAGGTTAGCGCATTGA
CAGCTGCCCACTTTGCCGCCCATGCTGCAATGTACCAGTCTGTGAGCGCTAGAGCGGCTGCTATTCACGACCAATTCGTAGCCACTCTGGCCTCAAGTGCGTCATCCTACGCTG
CCACAGAAGTCGCTAACGCTGCGGCAGGAGGGTCAGGAGGCGGCGGGTCCGGTGGTATGACTAGCCGCTTCATGACTGACCCTCACGCAATGAGAGACATGGCTGGGAGGTTC
String 12 (I) GAGGTGCATGCGCAGACTGTGGAGGACGAAGCTCGACGGATGTGGGCGAGTGCACAGAATATCAGTGGGGCCGGATGGAGCGGGATGGCCGAAGCTACTTCCCTTGACACGA nt2 TGACCCAGATGAACCAGGCCTTCAGAAACATCGTGAATATGCTGCATGGGGTAAGGGACGGCCTGGTGAGGGATGCCAATAACTATGAACAGCAGGAACAGGCCAGCCAACAG
ATCCTGTCCTCTGGAGGCTCAGGAGGAGGCGGGAGCGGTGGCATGTCACTTCTTGACGCCCATATACCGCAGCTGGTGGCATCCCAGTCAGCCTTTGCAGCGAAAGCCGGGCT
CATGCGGCACACGATAGGCCAGGCAGAGCAAGCCGCCATGAGCGCACAGGCGTTTCACCAAGGGGAAAGCTCTGCGGCGTTCCAGGCCGCCCATGCACGTTTTGTAGCAGCAG
CCGCAAAGGTGAATACACTGCTGGATGTGGCCCAAGCTAACCTGGGAGAGGCGGCAGGCACATATGTGGCTGCTGACGCGGCGGCTGCCAGCACCTATACAGGCTTTGGGGGC
. . Nucleotide sequence protein _ _
AGCGGAGGAGGTGGGAGCGGAGGGCATTCACTCCTGGACGAAGGCAAGCAGTCTTTGACTAAACTGGCTGCCGCTTGGGGAGGGAGCGGTTCTGAGGCTTACCAAGGAGTTC AGCAAAAATGGGATGCAACCGCTACTGAGCTGAATAACGCACTTCAGAATCTCGCTAGGACGATTAGTGAGGCTGGTCAGGGCGGGAGCGGTGGAGGCGGGTCCGGCGGGAT GCACGTCAGCTTTGTCATGGCATATCCCGAGATGTTGGCAGCCGCTGCCGATACTCTGCAATCTATTGGCGCCACCACCGTTGCCGGTGGGAGCGGAGGCGGCGGATCTGGCG GTATGACCATCAACTACCAATTCGGCGATGTGGATGCCCACGGCGCAATGATCCGCGCTCAGGCCGGCAGCCTGGAAGCTGAACATCAAGCTATAATTTCCGATGTTCTGACAG CTAGTGACTTCTGGGGAGGCGCAGGCAGTGCCGCATGCCAAGGGTTCATCACACAACTCGGACGCAACTTTCAAGTCATCTATGAGCAGGCAAATGCACACGGCCAGAAGGTAC AGGCAGCTGGAAACAACATGGCACAGACCGACAGTGCCGTTGGCTCTAGTTGGGCCGGAGGATCTGGTGGCGGAGGGAGCGGGGGTATGACAGAGCAGCAGTGGAATTTTGC AGGCATAGAAGCCGCGGCCTCCGCCATTCAGGGTAATGTCACGAGTATTCACTCACTGTTGGACGAGGGCAAACAATCTGGCGGTAGCGGTGGCGGTGGCTCTGGTGGAGTGG ACGCCCATGGGGCCATGATCAGAGCACAGGCAGCTTCTTTGGAGGCCGAGCATCAGGCCATTGTCAGAGATGTCCTGGCTGCGGGTGATTTCTGGGGAGGAGCCGGTTCCGTG GCCTGTCAGGAATTCATCACGCAGTTGGGGAGGAACTTCCAGGTGATCTACGAGCAGGGCGGCTCCGGCGGCGGAGGGAGCGGCGGCATGGCAAGTCGGTTCATGACAGATC CCCATGCAATGCGTGACGGAGGGTCCGGCGGTGGAGGCAGCGGAGGTATGTCCCAAATTATGTACAACTATCCTGCAATGCTGGGGCATGCCGGCGATATGGCAGGGTATGCC GGCACCCTCCAGTCCCTCGGTGCTGAAATCGCCGTGGAACAAGCCGCGCTGCAAAGTGCATGGCAGGGCGATACCGGAATAACCTATCAGGCCTGGCAAGCACAGTGGAATCA AGCAATGGAAGATCTGGTCCGAGCCTACCACGCAATGTCCTCTACACACGAGGCTAATACCATGGCTATGATGGCACGGGACACCGCCGAAGCGGCGAAATGGGGCGGTGGCG GTAGTGGAGGAGGAGGTTCAGGCGGGATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGT CCAGCGGAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 209] ATGGGAGGAGCTGCTGCCAGACTGGGAGCTGTGATTCTGTTTGTGGTGATTGTGGGACTGCATGGAGTGAGAGGAGTGGTGCCTCCTGCTGCTGATGAAGTGTCTGCTCTGAC AGCTGCTCACTTTGCTGCTCATGCTGCCATGTACCAGTCTGTGTCTGCCAGAGCTGCTGCCATTCATGATCAGTTTGTGGCCACCCTGGCTTCTTCTGCTTCTTCTTATGCTGCC ACAGAAGTGGCCAATGCTGCTGCTGGAGGCTCTGGCGGAGGTGGCAGTGGTGGCATGACCAGCAGATTCATGACAGATCCTCATGCCATGAGAGACATGGCTGGAAGATTTGA AGTGCATGCTCAGACAGTGGAAGATGAAGCCAGAAGAATGTGGGCTTCTGCTCAGAACATTTCTGGAGCTGGATGGTCTGGAATGGCTGAAGCCACCTCTCTGGACACCATGA CCCAGATGAATCAGGCTTTCAGAAACATTGTGAACATGCTGCATGGAGTGAGAGATGGACTGGTGAGAGATGCCAACAATTATGAACAGCAGGAACAGGCTTCTCAGCAGATCC TGTCTTCTGGTGGCTCCGGCGGAGGTGGCTCTGGCGGAATGTCTCTGCTGGATGCTCACATCCCTCAGCTGGTGGCTTCTCAGTCTGCTTTTGCTGCCAAGGCTGGACTGATG AGACACACCATTGGACAGGCTGAACAGGCTGCCATGTCTGCTCAGGCTTTCCACCAGGGAGAATCTTCTGCTGCTTTCCAGGCTGCTCATGCCAGATTTGTGGCTGCTGCTGCC AAGGTGAACACCCTGCTGGATGTGGCTCAGGCCAATCTGGGAGAAGCTGCTGGAACCTATGTGGCTGCTGATGCTGCTGCTGCCAGCACCTACACAGGATTTGGCGGATCTGG CGGAGGTGGCAGCGGTGGACACTCTCTGCTGGATGAAGGAAAACAGTCTCTGACCAAACTGGCTGCTGCTTGGGGAGGATCTGGATCTGAAGCTTACCAGGGAGTGCAGCAGA AATGGGATGCCACAGCCACAGAACTGAACAATGCTCTCCAGAATCTGGCCAGAACCATCTCTGAAGCTGGACAGGGAGGCTCCGGCGGAGGTGGCTCAGGTGGAATGCATGTG String 12 (I) TCTTTTGTGATGGCTTACCCTGAAATGCTGGCTGCTGCTGCTGACACCCTCCAGAGCATTGGAGCCACCACAGTGGCTGGAGGCTCAGGAGGTGGCGGATCAGGAGGTATGAC nt3 CATCAATTACCAGTTTGGAGATGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGGATCTCTGGAAGCTGAACACCAGGCCATCATTTCTGATGTGCTGACAGCTTCTGA
TTTCTGGGGAGGAGCTGGATCTGCTGCTTGCCAGGGATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGCCAATGCTCATGGACAGAAGGTGCAGGCTG CTGGAAACAACATGGCTCAGACAGATTCTGCTGTGGGATCTTCTTGGGCTGGAGGCAGTGGAGGTGGCGGATCAGGTGGAATGACAGAACAGCAGTGGAATTTTGCTGGAATT GAAGCTGCTGCTTCTGCCATCCAGGGAAATGTGACCAGCATTCACTCTCTGCTGGATGAAGGAAAACAGTCTGGTGGCTCAGGCGGAGGTGGCAGTGGTGGCGTGGATGCTCA TGGAGCCATGATCAGAGCCCAGGCTGCTTCTCTGGAAGCTGAACACCAGGCCATTGTGAGAGATGTGCTGGCTGCTGGAGATTTCTGGGGAGGAGCTGGATCTGTGGCTTGCC AGGAATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGGTGGCAGTGGCGGTGGAGGCAGTGGTGGCATGGCCAGCAGATTCATGACAGATCCTCATGCC ATGAGAGATGGCGGTTCTGGCGGAGGTGGCAGTGGTGGCATGTCTCAGATCATGTACAATTACCCTGCCATGCTGGGACATGCTGGAGACATGGCTGGATATGCTGGAACCCT CCAGTCTCTGGGAGCTGAAATTGCTGTGGAACAGGCTGCTCTCCAGTCTGCTTGGCAGGGAGACACAGGAATCACCTACCAGGCTTGGCAGGCTCAGTGGAATCAGGCCATGG AAGATCTGGTGAGAGCTTACCATGCCATGAGCAGCACCCATGAAGCCAACACCATGGCCATGATGGCCAGAGACACAGCTGAAGCTGCCAAATGGGGAGGAGGTGGCTCTGGA GGCGGTGGATCAGGTGGAATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCGGA GGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 210]
. . Nucleotide sequence protein
GTTGTGCCTCCTGCCGCTGATGAAGTGTCTGCCCTGACAGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCTAGAGCCGCCGCTATCCACGATCAGTTC GTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGCCACTGAAGTGGCCAATGCTGCCGCTGGTGGATCTGGTGGCGGAGGATCTGGCGGAATGAGCCAGATCATGTACAA CTACCCCGCCATGCTGGGACACGCCGGCGATATGGCTGGATATGCCGGAACACTCCAGTCTCTGGGCGCCGAGATTGCTGTGGAACAGGCCGCACTTCAGTCTGCCTGGCAAG GCGATACCGGCATCACATATCAGGCCTGGCAGGCCCAGTGGAACCAGGCCATGGAAGATCTTGTGCGGGCCTACCACGCCATGAGCAGCACACATGAGGCCAACACAATGGCC ATGATGGCCCGGGATACAGCCGAAGCCGCTAAATGGGGCGGAGGCGGTAGTGGCGGTGGTGGAAGCGGAGGAATGGCCTCCAGATTCATGACCGATCCTCATGCCATGAGAG ATGGCGGTTCAGGCGGTGGCGGCTCTGGCGGAGTTGATGCACATGGCGCTATGATCAGAGCCCAGGCCGCTTCTCTGGAAGCCGAGCATCAAGCCATTGTGCGGGATGTTCTG GCCGCTGGCGATTTTTGGGGAGGCGCTGGTTCTGTGGCCTGCCAAGAGTTTATCACACAGCTGGGCAGAAACTTCCAAGTGATCTACGAGCAAGGCGGATCAGGTGGCGGTGG CAGCGGTGGAATGACAGAGCAGCAGTGGAATTTCGCCGGCATTGAAGCTGCCGCCAGCGCCATTCAGGGCAACGTGACATCTATCCACAGCCTGCTGGACGAGGGCAAGCAGT CTGGTGGTTCTGGCGGAGGCGGCAGCGGAGGCATGACAATCAATTACCAGTTCGGCGACGTGGACGCCCACGGGGCAATGATTAGAGCACAGGCTGGAAGCCTGGAAGCTGA String 12_R (s) ACACCAGGCTATCATCAGCGACGTGCTGACAGCCAGCGATTTCTGGGGCGGTGCAGGATCAGCTGCCTGTCAGGGATTCATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTA ntl TGAGCAGGCCAACGCTCACGGCCAGAAAGTGCAAGCCGCCGGAAACAATATGGCCCAGACAGATTCTGCCGTGGGCAGCTCTTGGGCTGGTGGTAGCGGAGGTGGTGGCAGT
GGCGGAATGCATGTGTCCTTCGTGATGGCTTACCCCGAGATGCTGGCCGCAGCCGCTGATACACTGCAATCTATCGGCGCCACAACAGTGGCTGGTGGCTCAGGCGGCGGAGG TAGCGGAGGACATTCTCTGCTGGATGAGGGAAAACAGAGCCTGACCAAACTGGCTGCCGCTTGGGGCGGATCTGGATCTGAAGCTTATCAGGGCGTGCAGCAGAAGTGGGACG CCACAGCTACCGAGCTGAACAACGCCCTGCAAAACCTGGCTCGGACAATCTCTGAAGCCGGCCAAGGCGGAAGTGGTGGTGGCGGTTCCGGTGGCATGTCTCTGCTCGATGCC CACATTCCTCAGCTGGTGGCCTCTCAGTCTGCTTTTGCCGCCAAAGCCGGCCTGATGAGACACACAATTGGACAGGCCGAGCAGGCCGCTATGTCTGCCCAGGCTTTTCACCAG GGCGAAAGCAGCGCAGCCTTTCAGGCTGCCCATGCCAGATTTGTGGCCGCTGCTGCCAAAGTGAACACCCTCCTGGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCTGGAAC ATATGTGGCCGCAGATGCTGCTGCTGCCTCTACCTATACCGGCTTCGGAGGCTCAGGCGGAGGCGGTTCCGGCGGAATGACTAGCCGGTTTATGACAGACCCTCACGCTATGC GCGACATGGCCGGCAGATTTGAAGTGCACGCTCAGACCGTGGAAGATGAGGCCAGACGGATGTGGGCCAGCGCTCAGAATATTAGCGGAGCTGGCTGGAGCGGAATGGCCGA AGCTACAAGCCTGGACACCATGACACAGATGAATCAGGCCTTTCGGAACATCGTGAACATGCTCCACGGCGTCAGAGATGGCCTCGTTAGGGACGCCAACAATTACGAGCAGCA AGAACAGGCCAGCCAGCAGATCCTTAGCAGCGGAGGAAGTGGCGGCGGAGGCAGTGGTGGATAATGA [SEQ ID NO: 211]
GTCGTCCCACCAGCCGCTGACGAAGTTAGCGCACTCACTGCCGCGCATTTTGCCGCACATGCGGCTATGTACCAGAGCGTGAGTGCCAGGGCAGCTGCAATCCACGACCAGTTC GTCGCTACTCTTGCATCATCTGCTTCCAGTTACGCGGCAACTGAGGTGGCCAATGCTGCCGCCGGTGGGAGCGGAGGCGGTGGTTCCGGCGGGATGTCACAGATAATGTACAA TTACCCAGCCATGCTGGGGCATGCCGGAGATATGGCAGGCTATGCTGGGACCTTGCAATCTCTTGGGGCCGAAATAGCCGTGGAGCAGGCTGCACTGCAAAGCGCTTGGCAGG GTGACACGGGCATAACGTACCAGGCATGGCAGGCTCAGTGGAATCAAGCCATGGAGGATCTCGTGCGGGCCTACCACGCTATGTCCTCTACACACGAGGCGAATACCATGGCA ATGATGGCGAGAGACACTGCGGAGGCCGCCAAATGGGGCGGCGGCGGAAGCGGCGGTGGCGGATCTGGAGGGATGGCATCTAGATTTATGACTGATCCGCATGCCATGAGAG ATGGCGGGAGCGGAGGCGGTGGGTCTGGAGGAGTGGACGCCCACGGCGCCATGATTAGAGCACAGGCTGCCTCCCTGGAGGCCGAACATCAGGCGATTGTTCGGGACGTTTT GGCCGCTGGTGACTTTTGGGGTGGCGCCGGCTCCGTAGCTTGCCAGGAGTTTATCACCCAACTTGGACGGAACTTTCAGGTGATCTATGAACAGGGCGGAAGCGGAGGCGGAG GATCAGGCGGTATGACAGAGCAGCAATGGAATTTTGCCGGCATAGAGGCCGCCGCCTCCGCCATCCAAGGAAATGTGACAAGCATCCATTCACTGCTGGATGAAGGGAAACAAA String 12_R (s) GCGGCGGCTCAGGTGGAGGTGGGTCTGGTGGAATGACCATAAACTACCAGTTCGGGGACGTTGACGCTCATGGGGCTATGATTCGTGCTCAAGCCGGGTCTTTGGAGGCCGA nt2 GCACCAGGCAATCATTTCTGATGTTCTGACAGCGTCAGACTTCTGGGGAGGAGCCGGCTCAGCAGCTTGTCAAGGGTTCATCACACAGCTTGGACGCAATTTTCAGGTCATCTA
TGAGCAAGCGAATGCGCATGGTCAGAAGGTGCAAGCGGCCGGTAATAACATGGCACAGACTGACTCAGCAGTCGGAAGCAGCTGGGCAGGCGGTTCAGGTGGTGGCGGTTCC GGTGGCATGCATGTCTCCTTCGTCATGGCGTATCCCGAAATGCTTGCAGCCGCTGCGGATACACTCCAGTCCATCGGTGCTACAACAGTTGCGGGCGGGTCCGGTGGTGGAGG CAGCGGAGGGCATAGCCTCCTGGACGAGGGAAAGCAGAGTCTTACGAAGCTGGCTGCTGCATGGGGAGGCTCCGGGTCTGAAGCCTATCAAGGAGTGCAGCAGAAGTGGGAT GCTACTGCGACTGAACTGAACAACGCCCTGCAAAATCTCGCCCGCACCATCTCAGAGGCCGGGCAGGGTGGGTCTGGCGGCGGCGGCTCTGGCGGAATGTCACTCCTGGACGC ACACATTCCTCAGCTGGTGGCCTCCCAGTCTGCGTTTGCAGCAAAAGCCGGGCTGATGCGGCATACCATTGGGCAAGCAGAACAAGCCGCTATGAGTGCGCAGGCTTTCCACCA GGGAGAAAGCAGCGCTGCCTTTCAGGCAGCCCATGCTCGCTTCGTGGCAGCAGCGGCTAAGGTGAACACACTGCTCGATGTGGCTCAGGCCAATCTGGGTGAGGCCGCTGGCA CCTATGTGGCTGCCGATGCCGCGGCGGCGTCCACTTACACAGGGTTTGGCGGCAGCGGAGGGGGCGGCAGCGGCGGGATGACCTCACGGTTCATGACCGACCCACACGCCAT GAGGGACATGGCTGGCCGCTTCGAGGTGCACGCCCAGACTGTCGAAGATGAAGCAAGGCGAATGTGGGCCTCTGCCCAGAACATTTCCGGCGCCGGCTGGAGTGGAATGGCT
Chimeric Nucleotide sequence protein
GAAGCAACATCTCTGGACACAATGACCCAGATGAACCAGGCATTTCGCAACATCGTCAACATGCTGCATGGCGTTCGTGATGGTCTGGTGAGGGATGCCAACAATTATGAACAG
CAGGAACAGGCAAGTCAGCAGATCCTTAGTAGCGGAGGATCTGGCGGCGGAGGTAGTGGAGGGTAATGA [SEQ ID NO: 212]
GTGGTGCCTCCTGCTGCTGATGAAGTGTCTGCTCTGACAGCTGCTCACTTTGCTGCTCATGCTGCCATGTACCAGTCTGTGTCTGCCAGAGCTGCTGCCATTCATGATCAGTTT GTGGCCACCCTGGCTTCTTCTGCTTCTTCTTATGCTGCCACAGAAGTGGCCAATGCTGCTGCTGGAGGCTCTGGCGGAGGTGGCAGTGGTGGCATGTCTCAGATCATGTACAAT TACCCTGCCATGCTGGGACATGCTGGAGACATGGCTGGATATGCTGGAACCCTCCAGTCTCTGGGAGCTGAAATTGCTGTGGAACAGGCTGCTCTCCAGTCTGCTTGGCAGGG AGACACAGGAATCACCTACCAGGCTTGGCAGGCTCAGTGGAATCAGGCCATGGAAGATCTGGTGAGAGCTTACCATGCCATGAGCAGCACCCATGAAGCCAACACCATGGCCAT GATGGCCAGAGACACAGCTGAAGCTGCCAAATGGGGAGGAGGTGGCTCCGGCGGAGGTGGCTCTGGCGGAATGGCCAGCAGATTCATGACAGATCCTCATGCCATGAGAGAT GGCGGATCTGGCGGAGGTGGCAGCGGTGGAGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGCTTCTCTGGAAGCTGAACACCAGGCCATTGTGAGAGATGTGCTGG CTGCTGGAGATTTCTGGGGAGGAGCTGGATCTGTGGCTTGCCAGGAATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGGAGGCTCCGGCGGAGGTGGC TCAGGTGGAATGACAGAACAGCAGTGGAATTTTGCTGGAATTGAAGCTGCTGCTTCTGCCATCCAGGGAAATGTGACCAGCATTCACTCTCTGCTGGATGAAGGAAAACAGTCT GGAGGCTCAGGAGGTGGCGGATCAGGAGGTATGACCATCAATTACCAGTTTGGAGATGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGGATCTCTGGAAGCTGAACA String 12_R (s) CCAGGCCATCATTTCTGATGTGCTGACAGCTTCTGATTTCTGGGGAGGAGCTGGATCTGCTGCTTGCCAGGGATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGA nt3 ACAGGCCAATGCTCATGGACAGAAGGTGCAGGCTGCTGGAAACAACATGGCTCAGACAGATTCTGCTGTGGGATCTTCTTGGGCTGGAGGCAGTGGAGGTGGCGGATCAGGTG
GAATGCATGTGTCTTTTGTGATGGCTTACCCTGAAATGCTGGCTGCTGCTGCTGACACCCTCCAGAGCATTGGAGCCACCACAGTGGCTGGTGGCTCAGGCGGAGGTGGCAGT GGTGGCCACTCTCTGCTGGATGAAGGAAAACAGTCTCTGACCAAACTGGCTGCTGCTTGGGGAGGATCTGGATCTGAAGCTTACCAGGGAGTGCAGCAGAAATGGGATGCCAC AGCCACAGAACTGAACAATGCTCTCCAGAATCTGGCCAGAACCATCTCTGAAGCTGGACAGGGTGGCAGTGGCGGTGGAGGCAGTGGTGGCATGTCTCTGCTGGATGCTCACA TCCCTCAGCTGGTGGCTTCTCAGTCTGCTTTTGCTGCCAAGGCTGGACTGATGAGACACACCATTGGACAGGCTGAACAGGCTGCCATGTCTGCTCAGGCTTTCCACCAGGGAG AATCTTCTGCTGCTTTCCAGGCTGCTCATGCCAGATTTGTGGCTGCTGCTGCCAAGGTGAACACCCTGCTGGATGTGGCTCAGGCCAATCTGGGAGAAGCTGCTGGAACCTATG TGGCTGCTGATGCTGCTGCTGCCAGCACCTACACAGGATTTGGCGGTTCTGGCGGAGGTGGCAGTGGTGGCATGACCAGCAGATTCATGACAGATCCTCATGCCATGAGAGAC ATGGCTGGAAGATTTGAAGTGCATGCTCAGACAGTGGAAGATGAAGCCAGAAGAATGTGGGCTTCTGCTCAGAACATTTCTGGAGCTGGATGGTCTGGAATGGCTGAAGCCAC CTCTCTGGACACCATGACCCAGATGAATCAGGCTTTCAGAAACATTGTGAACATGCTGCATGGAGTGAGAGATGGACTGGTGAGAGATGCCAACAATTATGAACAGCAGGAACA GGCTTCTCAGCAGATCCTGTCTTCTGGTGGCTCTGGAGGCGGTGGATCAGGTGGATAATGA [SEQ ID NO: 213]
ATGGGCGGAGCTGCTGCTAGACTGGGAGCCGTGATCCTGTTCGTGGTTATCGTGGGACTGCACGGCGTTAGAGGCGTTGTGCCTCCTGCCGCTGATGAAGTGTCTGCCCTGAC AGCCGCTCACTTTGCCGCTCATGCCGCCATGTACCAGTCCGTGTCTGCTAGAGCCGCCGCTATCCACGATCAGTTCGTGGCCACACTGGCCAGCAGCGCCAGTTCTTATGCCGC CACTGAAGTGGCCAATGCTGCCGCTGGTGGATCTGGTGGCGGAGGATCTGGCGGAATGAGCCAGATCATGTACAACTACCCCGCCATGCTGGGACACGCCGGCGATATGGCTG GATATGCCGGAACACTCCAGTCTCTGGGCGCCGAGATTGCTGTGGAACAGGCCGCACTTCAGTCTGCCTGGCAAGGCGATACCGGCATCACATATCAGGCCTGGCAGGCCCAG
String 12 R fl) TGGAACCAGGCCATGGAAGATCTTGTGCGGGCCTACCACGCCATGAGCAGCACACATGAGGCCAACACAATGGCCATGATGGCCCGGGATACAGCCGAAGCCGCTAAATGGGG tl 9 “ CGGAGGCGGTAGTGGCGGTGGTGGAAGCGGAGGAATGGCCTCCAGATTCATGACCGATCCTCATGCCATGAGAGATGGCGGTTCAGGCGGTGGCGGCTCTGGCGGAGTTGAT
GCACATGGCGCTATGATCAGAGCCCAGGCCGCTTCTCTGGAAGCCGAGCATCAAGCCATTGTGCGGGATGTTCTGGCCGCTGGCGATTTTTGGGGAGGCGCTGGTTCTGTGGC CTGCCAAGAGTTTATCACACAGCTGGGCAGAAACTTCCAAGTGATCTACGAGCAAGGCGGATCAGGTGGCGGTGGCAGCGGTGGAATGACAGAGCAGCAGTGGAATTTCGCCG GCATTGAAGCTGCCGCCAGCGCCATTCAGGGCAACGTGACATCTATCCACAGCCTGCTGGACGAGGGCAAGCAGTCTGGTGGTTCTGGCGGAGGCGGCAGCGGAGGCATGACA ATCAATTACCAGTTCGGCGACGTGGACGCCCACGGGGCAATGATTAGAGCACAGGCTGGAAGCCTGGAAGCTGAACACCAGGCTATCATCAGCGACGTGCTGACAGCCAGCGA
TTTCTGGGGCGGTGCAGGATCAGCTGCCTGTCAGGGATTCATCACCCAGCTCGGCCGGAATTTTCAAGTCATCTATGAGCAGGCCAACGCTCACGGCCAGAAAGTGCAAGCCGC
. . Nucleotide sequence protein _ _
CGGAAACAATATGGCCCAGACAGATTCTGCCGTGGGCAGCTCTTGGGCTGGTGGTAGCGGAGGTGGTGGCAGTGGCGGAATGCATGTGTCCTTCGTGATGGCTTACCCCGAGA TGCTGGCCGCAGCCGCTGATACACTGCAATCTATCGGCGCCACAACAGTGGCTGGTGGCTCAGGCGGCGGAGGTAGCGGAGGACATTCTCTGCTGGATGAGGGAAAACAGAGC CTGACCAAACTGGCTGCCGCTTGGGGCGGATCTGGATCTGAAGCTTATCAGGGCGTGCAGCAGAAGTGGGACGCCACAGCTACCGAGCTGAACAACGCCCTGCAAAACCTGGC TCGGACAATCTCTGAAGCCGGCCAAGGCGGAAGTGGTGGTGGCGGTTCCGGTGGCATGTCTCTGCTCGATGCCCACATTCCTCAGCTGGTGGCCTCTCAGTCTGCTTTTGCCG CCAAAGCCGGCCTGATGAGACACACAATTGGACAGGCCGAGCAGGCCGCTATGTCTGCCCAGGCTTTTCACCAGGGCGAAAGCAGCGCAGCCTTTCAGGCTGCCCATGCCAGAT TTGTGGCCGCTGCTGCCAAAGTGAACACCCTCCTGGATGTGGCCCAGGCCAATCTGGGAGAAGCCGCTGGAACATATGTGGCCGCAGATGCTGCTGCTGCCTCTACCTATACCG GCTTCGGAGGCTCAGGCGGAGGCGGTTCCGGCGGAATGACTAGCCGGTTTATGACAGACCCTCACGCTATGCGCGACATGGCCGGCAGATTTGAAGTGCACGCTCAGACCGTG GAAGATGAGGCCAGACGGATGTGGGCCAGCGCTCAGAATATTAGCGGAGCTGGCTGGAGCGGAATGGCCGAAGCTACAAGCCTGGACACCATGACACAGATGAATCAGGCCTT TCGGAACATCGTGAACATGCTCCACGGCGTCAGAGATGGCCTCGTTAGGGACGCCAACAATTACGAGCAGCAAGAACAGGCCAGCCAGCAGATCCTTAGCAGCGGAGGAAGTG GCGGCGGAGGCAGTGGTGGAATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCG GAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 214] ATGGGGGGAGCCGCCGCACGATTGGGCGCAGTGATACTGTTCGTGGTCATCGTAGGGTTGCACGGAGTAAGAGGGGTCGTCCCACCAGCCGCTGACGAAGTTAGCGCACTCAC TGCCGCGCATTTTGCCGCACATGCGGCTATGTACCAGAGCGTGAGTGCCAGGGCAGCTGCAATCCACGACCAGTTCGTCGCTACTCTTGCATCATCTGCTTCCAGTTACGCGGC AACTGAGGTGGCCAATGCTGCCGCCGGTGGGAGCGGAGGCGGTGGTTCCGGCGGGATGTCACAGATAATGTACAATTACCCAGCCATGCTGGGGCATGCCGGAGATATGGCA GGCTATGCTGGGACCTTGCAATCTCTTGGGGCCGAAATAGCCGTGGAGCAGGCTGCACTGCAAAGCGCTTGGCAGGGTGACACGGGCATAACGTACCAGGCATGGCAGGCTCA GTGGAATCAAGCCATGGAGGATCTCGTGCGGGCCTACCACGCTATGTCCTCTACACACGAGGCGAATACCATGGCAATGATGGCGAGAGACACTGCGGAGGCCGCCAAATGGG GCGGCGGCGGAAGCGGCGGTGGCGGATCTGGAGGGATGGCATCTAGATTTATGACTGATCCGCATGCCATGAGAGATGGCGGGAGCGGAGGCGGTGGGTCTGGAGGAGTGG ACGCCCACGGCGCCATGATTAGAGCACAGGCTGCCTCCCTGGAGGCCGAACATCAGGCGATTGTTCGGGACGTTTTGGCCGCTGGTGACTTTTGGGGTGGCGCCGGCTCCGTA GCTTGCCAGGAGTTTATCACCCAACTTGGACGGAACTTTCAGGTGATCTATGAACAGGGCGGAAGCGGAGGCGGAGGATCAGGCGGTATGACAGAGCAGCAATGGAATTTTGC CGGCATAGAGGCCGCCGCCTCCGCCATCCAAGGAAATGTGACAAGCATCCATTCACTGCTGGATGAAGGGAAACAAAGCGGCGGCTCAGGTGGAGGTGGGTCTGGTGGAATGA CCATAAACTACCAGTTCGGGGACGTTGACGCTCATGGGGCTATGATTCGTGCTCAAGCCGGGTCTTTGGAGGCCGAGCACCAGGCAATCATTTCTGATGTTCTGACAGCGTCAG String 12_R (I) ACTTCTGGGGAGGAGCCGGCTCAGCAGCTTGTCAAGGGTTCATCACACAGCTTGGACGCAATTTTCAGGTCATCTATGAGCAAGCGAATGCGCATGGTCAGAAGGTGCAAGCG nt2 GCCGGTAATAACATGGCACAGACTGACTCAGCAGTCGGAAGCAGCTGGGCAGGCGGTTCAGGTGGTGGCGGTTCCGGTGGCATGCATGTCTCCTTCGTCATGGCGTATCCCGA
AATGCTTGCAGCCGCTGCGGATACACTCCAGTCCATCGGTGCTACAACAGTTGCGGGCGGGTCCGGTGGTGGAGGCAGCGGAGGGCATAGCCTCCTGGACGAGGGAAAGCAG AGTCTTACGAAGCTGGCTGCTGCATGGGGAGGCTCCGGGTCTGAAGCCTATCAAGGAGTGCAGCAGAAGTGGGATGCTACTGCGACTGAACTGAACAACGCCCTGCAAAATCT CGCCCGCACCATCTCAGAGGCCGGGCAGGGTGGGTCTGGCGGCGGCGGCTCTGGCGGAATGTCACTCCTGGACGCACACATTCCTCAGCTGGTGGCCTCCCAGTCTGCGTTTG CAGCAAAAGCCGGGCTGATGCGGCATACCATTGGGCAAGCAGAACAAGCCGCTATGAGTGCGCAGGCTTTCCACCAGGGAGAAAGCAGCGCTGCCTTTCAGGCAGCCCATGCT CGCTTCGTGGCAGCAGCGGCTAAGGTGAACACACTGCTCGATGTGGCTCAGGCCAATCTGGGTGAGGCCGCTGGCACCTATGTGGCTGCCGATGCCGCGGCGGCGTCCACTTA CACAGGGTTTGGCGGCAGCGGAGGGGGCGGCAGCGGCGGGATGACCTCACGGTTCATGACCGACCCACACGCCATGAGGGACATGGCTGGCCGCTTCGAGGTGCACGCCCAG ACTGTCGAAGATGAAGCAAGGCGAATGTGGGCCTCTGCCCAGAACATTTCCGGCGCCGGCTGGAGTGGAATGGCTGAAGCAACATCTCTGGACACAATGACCCAGATGAACCA GGCATTTCGCAACATCGTCAACATGCTGCATGGCGTTCGTGATGGTCTGGTGAGGGATGCCAACAATTATGAACAGCAGGAACAGGCAAGTCAGCAGATCCTTAGTAGCGGAG GATCTGGCGGCGGAGGTAGTGGAGGGATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGT CCAGCGGAGGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 215]
Chimeric Nucleotide sequence protein
ATGGGAGGAGCTGCTGCCAGACTGGGAGCTGTGATTCTGTTTGTGGTGATTGTGGGACTGCATGGAGTGAGAGGAGTGGTGCCTCCTGCTGCTGATGAAGTGTCTGCTCTGAC AGCTGCTCACTTTGCTGCTCATGCTGCCATGTACCAGTCTGTGTCTGCCAGAGCTGCTGCCATTCATGATCAGTTTGTGGCCACCCTGGCTTCTTCTGCTTCTTCTTATGCTGCC ACAGAAGTGGCCAATGCTGCTGCTGGAGGCTCTGGCGGAGGTGGCAGTGGTGGCATGTCTCAGATCATGTACAATTACCCTGCCATGCTGGGACATGCTGGAGACATGGCTGG ATATGCTGGAACCCTCCAGTCTCTGGGAGCTGAAATTGCTGTGGAACAGGCTGCTCTCCAGTCTGCTTGGCAGGGAGACACAGGAATCACCTACCAGGCTTGGCAGGCTCAGT GGAATCAGGCCATGGAAGATCTGGTGAGAGCTTACCATGCCATGAGCAGCACCCATGAAGCCAACACCATGGCCATGATGGCCAGAGACACAGCTGAAGCTGCCAAATGGGGA
GGAGGTGGCTCCGGCGGAGGTGGCTCTGGCGGAATGGCCAGCAGATTCATGACAGATCCTCATGCCATGAGAGATGGCGGATCTGGCGGAGGTGGCAGCGGTGGAGTGGATG CTCATGGAGCCATGATCAGAGCCCAGGCTGCTTCTCTGGAAGCTGAACACCAGGCCATTGTGAGAGATGTGCTGGCTGCTGGAGATTTCTGGGGAGGAGCTGGATCTGTGGCT TGCCAGGAATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGGAGGCTCCGGCGGAGGTGGCTCAGGTGGAATGACAGAACAGCAGTGGAATTTTGCTGG AATTGAAGCTGCTGCTTCTGCCATCCAGGGAAATGTGACCAGCATTCACTCTCTGCTGGATGAAGGAAAACAGTCTGGAGGCTCAGGAGGTGGCGGATCAGGAGGTATGACCA TCAATTACCAGTTTGGAGATGTGGATGCTCATGGAGCCATGATCAGAGCCCAGGCTGGATCTCTGGAAGCTGAACACCAGGCCATCATTTCTGATGTGCTGACAGCTTCTGATT
String 12_R (I) TCTGGGGAGGAGCTGGATCTGCTGCTTGCCAGGGATTCATCACCCAGCTGGGAAGAAATTTCCAGGTGATCTATGAACAGGCCAATGCTCATGGACAGAAGGTGCAGGCTGCT nt3 GGAAACAACATGGCTCAGACAGATTCTGCTGTGGGATCTTCTTGGGCTGGAGGCAGTGGAGGTGGCGGATCAGGTGGAATGCATGTGTCTTTTGTGATGGCTTACCCTGAAAT
GCTGGCTGCTGCTGCTGACACCCTCCAGAGCATTGGAGCCACCACAGTGGCTGGTGGCTCAGGCGGAGGTGGCAGTGGTGGCCACTCTCTGCTGGATGAAGGAAAACAGTCTC TGACCAAACTGGCTGCTGCTTGGGGAGGATCTGGATCTGAAGCTTACCAGGGAGTGCAGCAGAAATGGGATGCCACAGCCACAGAACTGAACAATGCTCTCCAGAATCTGGCC AGAACCATCTCTGAAGCTGGACAGGGTGGCAGTGGCGGTGGAGGCAGTGGTGGCATGTCTCTGCTGGATGCTCACATCCCTCAGCTGGTGGCTTCTCAGTCTGCTTTTGCTGC CAAGGCTGGACTGATGAGACACACCATTGGACAGGCTGAACAGGCTGCCATGTCTGCTCAGGCTTTCCACCAGGGAGAATCTTCTGCTGCTTTCCAGGCTGCTCATGCCAGATT TGTGGCTGCTGCTGCCAAGGTGAACACCCTGCTGGATGTGGCTCAGGCCAATCTGGGAGAAGCTGCTGGAACCTATGTGGCTGCTGATGCTGCTGCTGCCAGCACCTACACAG
GATTTGGCGGTTCTGGCGGAGGTGGCAGTGGTGGCATGACCAGCAGATTCATGACAGATCCTCATGCCATGAGAGACATGGCTGGAAGATTTGAAGTGCATGCTCAGACAGTG GAAGATGAAGCCAGAAGAATGTGGGCTTCTGCTCAGAACATTTCTGGAGCTGGATGGTCTGGAATGGCTGAAGCCACCTCTCTGGACACCATGACCCAGATGAATCAGGCTTTC AGAAACATTGTGAACATGCTGCATGGAGTGAGAGATGGACTGGTGAGAGATGCCAACAATTATGAACAGCAGGAACAGGCTTCTCAGCAGATCCTGTCTTCTGGTGGCTCTGGA GGCGGTGGATCAGGTGGAATCGTGGGAATTGTGGCAGGACTGGCAGTGCTGGCCGTGGTGGTGATCGGAGCCGTGGTGGCTACCGTGATGTGCAGACGGAAGTCCAGCGGA GGCAAGGGCGGCAGCTACAGCCAGGCCGCCAGCTCTGATAGCGCCCAGGGCAGCGACGTGTCACTGACAGCCTAATGA [SEQ ID NO: 216]
RNA delivery
RNA described herein may be delivered for therapeutic applications described herein using any appropriate methods known in the art, including, e.g., delivery as naked RNA, or delivery mediated by delivery vehicles.
Some aspects of the disclosure involve the targeted delivery of the RNA disclosed herein to certain cells or tissues. In some embodiments, after administration of the RNA (in particular, mRNA) compositions/formulations described herein, at least a portion of the RNA is delivered to a target cell or target organ. In some embodiments, at least a portion of the RNA is delivered to the cytosol of the target cell. In some embodiments, the RNA (in particular, mRNA) is translated by the target cell to produce the encoded peptide or polypeptide. In some embodiments, the target cell is a muscle cell. In some embodiments, the target cell is a cell in the liver. In some embodiments, the target cell is a cell in the lung. In some embodiments, the disclosure involves targeting the lymphatic system, in particular secondary lymphoid organs, more specifically spleen. In some embodiments, the target cell is a cell in the lymph nodes. In some embodiments, the target cell is a spleen cell. In some embodiments, the target cell is an antigen presenting cell such as a professional antigen presenting cell in the spleen. In some embodiments, the target cell is a dendritic cell in the spleen. Thus, RNA (in particular, mRNA) compositions/formulations described herein may be used for delivering RNA to such target cell. The "lymphatic system" is part of the circulatory system and an important part of the immune system, comprising a network of lymphatic vessels that carry lymph. The lymphatic system consists of lymphatic organs, a conducting network of lymphatic vessels, and the circulating lymph. The primary or central lymphoid organs generate lymphocytes from immature progenitor cells. The thymus and the bone marrow constitute the primary lymphoid organs. Secondary or peripheral lymphoid organs, which include lymph nodes and the spleen, maintain mature naive lymphocytes and initiate an adaptive immune response.
Lipid-based RNA delivery systems have an inherent preference to the liver, where, depending on the composition of the RNA delivery systems used, RNA expression in the liver can be obtained. Liver accumulation is caused by the discontinuous nature of the hepatic vasculature or the lipid metabolism (liposomes and lipid or cholesterol conjugates). In some embodiments, the target organ for RNA expression is liver and the target tissue is liver tissue. The delivery to such target tissue is preferred, in particular, if presence of RNA or of the encoded peptide or polypeptide in this organ or tissue is desired and/or if it is desired to express large amounts of the encoded peptide or polypeptide and/or if systemic presence of the encoded peptide or polypeptide, in particular in significant amounts, is desired or required.
Delivery vehicles
To overcome the barriers to safe and effective RNA delivery, RNA may be administered with one or more delivery vehicles that protect the RNA from degradation, maximize delivery to on-target cells and minimize exposure to off- target cells. Such RNA delivery vehicles may complex or encapsulate RNA and include a range of materials, including polymers and lipids. In some embodiments, such RNA delivery vehicles may form particles with RNA.
RNA, in particular mRNA, described herein may be present in particles comprising (i) the RNA, and (ii) at least one cationic or cationically ionizable compound such as a polymer or lipid complexing the RNA. Electrostatic interactions between positively charged molecules such as polymers and lipids and negatively charged RNA are involved in particle formation. This results in complexation and spontaneous formation of RNA particles. Different types of RNA containing particles have been described previously to be suitable for delivery of RNA in particulate form (cf., e.g., Kaczmarek, J. C. et a!., 2017, Genome Medicine 9, 60). For non-viral RNA delivery vehicles, nanoparticle encapsulation of RNA physically protects RNA from degradation and, depending on the specific chemistry, can aid in cellular uptake and endosomal escape.
In the context of the present disclosure, the term "particle" relates to a structured entity formed by molecules or molecule complexes, in particular particle forming compounds. In some embodiments, the particle contains an envelope (e.g, one or more layers or lamellas) made of one or more types of amphiphilic substances e.g, amphiphilic lipids). In this context, the expression "amphiphilic substance" means that the substance possesses both hydrophilic and lipophilic properties. The envelope may also comprise additional substances (e.g, additional lipids) which do not have to be amphiphilic. Thus, the particle may be a monolamellar or multilamellar structure, wherein the substances constituting the one or more layers or lamellas comprise one or more types of amphiphilic substances (in particular selected from the group consisting of amphiphilic lipids) optionally in combination with additional substances (e.g, additional lipids) which do not have to be amphiphilic. In some embodiments, the term "particle" relates to a micro- or nano-sized structure, such as a micro- or nano-sized compact structure. According to the present disclosure, the term "particle" includes nanoparticles.
An "RNA particle" can be used to deliver RNA to a target site of interest (e.g, cell, tissue, organ, and the like). An RNA particle may be formed from lipids comprising at least one cationic or cationically ionizable lipid. Without intending to be bound by any theory, it is believed that the cationic or cationically ionizable lipid combines together with the RNA to form aggregates, and this aggregation results in colloidally stable particles.
RNA particles described herein include lipid nanoparticle (LNP)-based and lipoplex (LPX)-based formulations.
A lipoplex (LPX) described herein is obtainable from mixing two aqueous phases, namely a phase comprising RNA and a phase comprising a dispersion of lipids. In some embodiments, the lipid phase comprises liposomes.
In some embodiments, liposomes are self-closed unilamellar or multilamellar vesicular particles wherein the lamellae comprise lipid bilayers and the encapsulated lumen comprises an aqueous phase. A prerequisite for using liposomes for nanoparticle formation is that the lipids in the mixture as required are able to form lamellar (bilayer) phases in the applied aqueous environment.
In some embodiments, liposomes comprise unilamellar or multilamellar phospholipid bilayers enclosing an aqueous core (also referred to herein as an aqueous lumen). They may be prepared from materials possessing polar head (hydrophilic) groups and nonpolar tail (hydrophobic) groups. In some embodiments, cationic lipids employed in formulating liposomes designed for the delivery of RNA are amphiphilic in nature and consist of a positively charged (cationic) amine head group linked to a hydrocarbon chain or cholesterol derivative via glycerol.
In some embodiments, lipoplexes are multilamellar liposome-based formulations that form upon electrostatic interaction of cationic liposomes with RNAs. In some embodiments, formed lipoplexes possess distinct internal arrangements of molecules that arise due to the transformation from liposomal structure into compact RNA- lipoplexes. In some embodiments, an LPX particle comprises an amphiphilic lipid, in particular cationic or cationically ionizable amphiphilic lipid, and RNA (especially mRNA) as described herein. In some embodiments, electrostatic interactions between positively charged liposomes (made from one or more amphiphilic lipids, in particular cationic or cationically ionizable amphiphilic lipids) and negatively charged RNA (especially mRNA) results in complexation and spontaneous formation of RNA lipoplex particles. Positively charged liposomes may be generally synthesized using a cationic or cationically ionizable amphiphilic lipid, such as DOTMA and/or DODMA, and optionally additional lipids, such as DOPE or DSPC. In some embodiments, an RNA (especially mRNA) lipoplex particle is a nanoparticle.
In general, a lipid nanoparticle (LNP) is obtainable from direct mixing of RNA in an aqueous phase with lipids in a phase comprising an organic solvent, such as ethanol. In that case, lipids or lipid mixtures can be used for particle formation, which do not form lamellar (bilayer) phases in water.
In some embodiments, LNPs comprise or consist of a cationic/cationically ionizable lipid and helper lipids such as phospholipids, cholesterol, and/or polymer-conjugated lipids (e.g., polyethylene glycol (PEG) lipids). In some embodiments, in the RNA LNPs described herein the RNA (in particular, mRNA) is bound by cationically ionizable lipid that occupies the central core of the LNP. In some embodiments, polymer-conjugated lipid forms the surface of the LNP, along with phospholipids. In some embodiments, the surface comprises a bilayer. In some embodiments, cholesterol and cationically ionizable lipid in charged and uncharged forms can be distributed throughout the LNP.
In some embodiments, RNA e.g., mRNA) described herein may be noncovalently associated with a particle as described herein. In embodiments, the RNA (especially mRNA) may be adhered to the outer surface of the particle (surface RNA (especially surface mRNA)) and/or may be contained in the particle (encapsulated RNA (especially encapsulated mRNA)).
In some embodiments, the particles (e.g., LNPs and LPXs) described herein have a size (such as a diameter) in the range of about 10 to about 2000 nm, such as at least about 15 nm (e.g., at least about 20 nm, at least about 25 nm, at least about 30 nm, at least about 35 nm, at least about 40 nm, at least about 45 nm, at least about 50 nm, at least about 55 nm, at least about 60 nm, at least about 65 nm, at least about 70 nm, at least about 75 nm, at least about 80 nm, at least about 85 nm, at least about 90 nm, at least about 95 nm, or at least about 100 nm) and/or at most about 1900 nm (e.g., at most about 1800 nm, at most about 1700 nm, at most about 1600 nm, at most about 1500 nm, at most about 1400 nm, at most about 1300 nm, at most about 1200 nm, at most about 1100 nm, at most about 1000 nm, at most about 950 nm, at most about 900 nm, at most about 850 nm, at most about 800 nm, at most about 750 nm, at most about 700 nm, at most about 650 nm, at most about 600 nm, at most about 550 nm, or at most about 500 nm), such as in the range of about 20 to about 1500 nm, such as about 30 to about 1200 nm, about 40 to about 1100 nm, about 50 to about 1000 nm, about 60 to about 900 nm, about 70 to about 800 nm, about 80 to about 700 nm, about 90 to about 600 nm, or about 50 to about 500 nm or about 100 to about 500 nm, such as in the range of 10 to 1000 nm, 15 to 500 nm, 20 to 450 nm, 25 to 400 nm, 30 to 350 nm, 40 to 300 nm, 50 to 250 nm, 60 to 200 nm, 70 to 150 nm, or 80 to 150 nm. In some embodiments, the particles (e.g., LNPs and LPXs) described herein have a size (such as a diameter) in the range of from about 40 nm to about 200 nm, such as from about 50 nm to about 180 nm, from about 60 nm to about 160 nm, from about 80 nm to about 150 nm or from about 80 nm to about 120 nm.
In some embodiments, the particles (e.g., LNPs and LPXs) described herein have an average diameter that in some embodiments ranges from about 50 nm to about 1000 nm, from about 50 nm to about 800 nm, from about 50 nm to about 700 nm, from about 50 nm to about 600 nm, from about 50 nm to about 500 nm, from about 50 nm to about 450 nm, from about 50 nm to about 400 nm, from about 50 nm to about 350 nm, from about 50 nm to about 300 nm, from about 50 nm to about 250 nm, from about 50 nm to about 200 nm, from about 100 nm to about 1000 nm, from about 100 nm to about 800 nm, from about 100 nm to about 700 nm, from about 100 nm to about 600 nm, from about 100 nm to about 500 nm, from about 100 nm to about 450 nm, from about 100 nm to about 400 nm, from about 100 nm to about 350 nm, from about 100 nm to about 300 nm, from about 100 nm to about 250 nm, from about 100 nm to about 200 nm, from about 150 nm to about 1000 nm, from about 150 nm to about 800 nm, from about 150 nm to about 700 nm, from about 150 nm to about 600 nm, from about 150 nm to about 500 nm, from about 150 nm to about 450 nm, from about 150 nm to about 400 nm, from about 150 nm to about 350 nm, from about 150 nm to about 300 nm, from about 150 nm to about 250 nm, from about 150 nm to about 200 nm, from about 200 nm to about 1000 nm, from about 200 nm to about 800 nm, from about 200 nm to about 700 nm, from about 200 nm to about 600 nm, from about 200 nm to about 500 nm, from about 200 nm to about 450 nm, from about 200 nm to about 400 nm, from about 200 nm to about 350 nm, from about 200 nm to about 300 nm, from about 200 nm to about 250 nm, or from about 80 to about 150 nm. In some embodiments, the particles (e.g., LNPs and LPXs) described herein have an average diameter that in some embodiments ranges from about 40 nm to about 200 nm, such as from about 50 nm to about 180 nm, from about 60 nm to about 160 nm, from about 80 nm to about 150 nm or from about 80 nm to about 120 nm.
In some embodiments, the particles described herein are nanoparticles. The term "nanoparticle" relates to a nanosized particle comprising nucleic acid (especially mRNA) as described herein and at least one cationic or cationically ionizable lipid, wherein all three external dimensions of the particle are in the nanoscale, i.e., at least about 1 nm and below about 1000 nm. Preferably, the size of a particle is its diameter.
RNA particles (especially mRNA particles) described herein may exhibit a polydispersity index (PDI) less than about 0.5, less than about 0.4, less than about 0.3, less than about 0.2, less than about 0.1, or less than about 0.05. By way of example, the RNA particles can exhibit a polydispersity index in a range of about 0.01 to about 0.4 or about 0.1 to about 0.3.
The N/P ratio gives the ratio of the nitrogen groups in the lipid to the number of phosphate groups in the RNA. It is correlated to the charge ratio, as the nitrogen atoms (depending on the pH) are usually positively charged and the phosphate groups are negatively charged. The N/P ratio, where a charge equilibrium exists, depends on the pH. Lipid formulations are frequently formed at N/P ratios larger than four up to twelve, because positively charged nanoparticles are considered favorable for transfection. In that case, RNA is considered to be completely bound to nanoparticles. RNA particles (especially mRNA particles) described herein can be prepared using a wide range of methods that may involve obtaining a colloid from at least one cationic or cationically ionizable lipid and mixing the colloid with RNA to obtain RNA particles.
The term "colloid" as used herein relates to a type of homogeneous mixture in which dispersed particles do not settle out. The insoluble particles in the mixture are microscopic, with particle sizes between 1 and 1000 nanometers. The mixture may be termed a colloid or a colloidal suspension. Sometimes the term "colloid" only refers to the particles in the mixture and not the entire suspension.
For the preparation of colloids comprising at least one cationic or cationically ionizable lipid methods are applicable herein that are conventionally used for preparing liposomal vesicles and are appropriately adapted. The most commonly used methods for preparing liposomal vesicles share the following fundamental stages: (i) lipids dissolution in organic solvents, (ii) drying of the resultant solution, and (iii) hydration of dried lipid (using various aqueous media).
In the film hydration method, lipids are firstly dissolved in a suitable organic solvent, and dried down to yield a thin film at the bottom of the flask. The obtained lipid film is hydrated using an appropriate aqueous medium to produce a liposomal dispersion. Furthermore, an additional downsizing step may be included.
Reverse phase evaporation is an alternative method to the film hydration for preparing liposomal vesicles that involves formation of a water-in-oil emulsion between an aqueous phase and an organic phase containing lipids. A brief sonication of this mixture is required for system homogenization. The removal of the organic phase under reduced pressure yields a milky gel that turns subsequently into a liposomal suspension.
The term "ethanol injection technique" refers to a process, in which an ethanol solution comprising lipids is rapidly injected into an aqueous solution through a needle. This action disperses the lipids throughout the solution and promotes lipid structure formation, for example lipid vesicle formation such as liposome formation. Generally, the RNA (especially mRNA) lipoplex particles described herein are obtainable by adding RNA (especially mRNA) to a colloidal liposome dispersion. Using the ethanol injection technique, such colloidal liposome dispersion is, in some embodiments, formed as follows: an ethanol solution comprising lipids, such as cationic or cationically ionizable lipids (like DOTMA and/or DODMA) and additional lipids, is injected into an aqueous solution under stirring. In some embodiments, the RNA (especially mRNA) lipoplex particles described herein are obtainable without a step of extrusion.
The term "extruding" or "extrusion" refers to the creation of particles having a fixed, cross-sectional profile. In particular, it refers to the downsizing of a particle, whereby the particle is forced through filters with defined pores.
Other methods having organic solvent free characteristics may also be used according to the present disclosure for preparing a colloid.
In some embodiments, LNPs comprise four components: cationically ionizable lipids, neutral lipids such as phospholipids, a steroid such as cholesterol, and a polymer-conjugated lipid. In some embodiments, LNPs may be prepared by mixing lipids dissolved in ethanol rapidly with RNA in an aqueous buffer. While RNA particles described herein may comprise polymer-conjugated lipids such as PEG lipids, provided herein are also RNA particles which do not comprise PEG lipids, or do not comprise any polymer-conjugated lipids.
In some embodiments, the LNPs comprising RNA and at least one cationic or cationically ionizable lipid described herein are prepared by (a) preparing an RNA solution containing water and a buffering system; (b) preparing an ethanolic solution comprising the cationic or cationically ionizable lipid and, if present, one or more additional lipids; and (c) mixing the RNA solution prepared under (a) with the ethanolic solution prepared under (b), thereby preparing the formulation comprising LNPs. After step (c) one or more steps selected from diluting and filtrating, such as tangential flow filtrating, can follow.
In some embodiments, the LNPs comprising RNA and at least one cationic or cationically ionizable lipid described herein are prepared by (a7) preparing liposomes or a colloidal preparation of the cationic or cationically ionizable lipid and, if present, one or more additional lipids in an aqueous phase; and (b') preparing an RNA solution containing water and a buffering system; and (c') mixing the liposomes or colloidal preparation prepared under (a7) with the RNA solution prepared under (b7). After step (c') one or more steps selected from diluting and filtrating, such as tangential flow filtrating, can follow.
The present disclosure describes compositions comprising RNA (especially mRNA) and at least one cationic or cationically ionizable lipid which associates with the RNA to form RNA particles and formulations comprising such particles. The RNA particles may comprise RNA which is complexed in different forms by non-covalent interactions to the particle. The particles described herein are not viral particles, in particular infectious viral particles, i.e., they are not able to virally infect cells.
Suitable cationic or cationically ionizable lipids are those that form RNA particles and are included by the term "particle forming components" or "particle forming agents". The term "particle forming components" or "particle forming agents" relates to any components which associate with RNA to form RNA particles. Such components include any component which can be part of RNA particles.
In some embodiments, RNA particles (especially mRNA particles) comprise more than one type of RNA molecules, where the molecular parameters of the RNA molecules may be similar or different from each other, like with respect to molar mass or fundamental structural elements such as molecular architecture, capping, coding regions or other features,
In particulate formulation, it is possible that each RNA species is separately formulated as an individual particulate formulation. In that case, each individual particulate formulation will comprise one RNA species. The individual particulate formulations may be present as separate entities, e.g. in separate containers. Such formulations are obtainable by providing each RNA species separately (typically each in the form of an RNA-containing solution) together with a particle-forming agent, thereby allowing the formation of particles. Respective particles will contain exclusively the specific RNA species that is being provided when the particles are formed (individual particulate formulations). In some embodiments, a composition such as a pharmaceutical composition comprises more than one individual particle formulation. Respective pharmaceutical compositions are referred to as mixed particulate formulations. Mixed particulate formulations according to the present disclosure are obtainable by forming, separately, individual particulate formulations, followed by a step of mixing of the individual particulate formulations. By the step of mixing, a formulation comprising a mixed population of RNA-containing particles is obtainable. Individual particulate populations may be together in one container, comprising a mixed population of individual particulate formulations. Alternatively, it is possible that all RNA species of the pharmaceutical composition are formulated together as a combined particulate formulation. Such formulations are obtainable by providing a combined formulation (typically combined solution) of all RNA species together with a particle-forming agent, thereby allowing the formation of particles. As opposed to a mixed particulate formulation, a combined particulate formulation will typically comprise particles which comprise more than one RNA species. In a combined particulate composition different RNA species are typically present together in a single particle.
Polymers
Given their high degree of chemical flexibility, polymers are commonly used materials for nanoparticle-based delivery. Typically, cationic polymers are used to electrostatically condense the negatively charged RNA into nanoparticles. These positively charged groups often consist of amines that change their state of protonation in the pH range between 5.5 and 7.5, thought to lead to an ion imbalance that results in endosomal rupture. Polymers such as poly-L-lysine, polyamidoamine, protamine and polyethyleneimine, as well as naturally occurring polymers such as chitosan have all been applied to nucleic acid delivery and are suitable as cationic polymers herein. In addition, some investigators have synthesized polymers specifically for nucleic acid delivery. Poly(P-amino esters), in particular, have gained widespread use in nucleic acid delivery owing to their ease of synthesis and biodegradability. Such synthetic polymers are also suitable as cationic polymers herein.
A "polymer," as used herein, is given its ordinary meaning, i.e., a molecular structure comprising one or more repeat units (monomers), connected by covalent bonds. The repeat units can all be identical, or in some cases, there can be more than one type of repeat unit present within the polymer. In some cases, the polymer is biologically derived, i.e., a biopolymer such as a protein. In some cases, additional moieties can also be present in the polymer, for example targeting moieties.
If more than one type of repeat unit is present within the polymer, then the polymer is said to be a "copolymer." It is to be understood that the polymer being employed herein can be a copolymer. The repeat units forming the copolymer can be arranged in any fashion. For example, the repeat units can be arranged in a random order, in an alternating order, or as a "block" copolymer, i.e., comprising one or more regions each comprising a first repeat unit (e.g., a first block), and one or more regions each comprising a second repeat unit (e.g., a second block), etc. Block copolymers can have two (a diblock copolymer), three (a triblock copolymer), or more numbers of distinct blocks.
In certain embodiments, the polymer is biocompatible. Biocompatible polymers are polymers that typically do not result in significant cell death at moderate concentrations. In certain embodiments, the biocompatible polymer is biodegradable, i.e., the polymer is able to degrade, chemically and/or biologically, within a physiological environment, such as within the body.
In certain embodiments, polymer may be protamine or polyalkyleneimine. The term "protamine" refers to any of various strongly basic proteins of relatively low molecular weight that are rich in arginine and are found associated especially with DNA in place of somatic histones in the sperm cells of various animals (as fish). In particular, the term "protamine" refers to proteins found in fish sperm that are strongly basic, are soluble in water, are not coagulated by heat, and yield chiefly arginine upon hydrolysis. In purified form, they are used in a long-acting formulation of insulin and to neutralize the anticoagulant effects of heparin.
According to the disclosure, the term "protamine" as used herein is meant to comprise any protamine amino acid sequence obtained or derived from natural or biological sources including fragments thereof and multimeric forms of said amino acid sequence or fragment thereof as well as (synthesized) polypeptides which are artificial and specifically designed for specific purposes and cannot be isolated from native or biological sources.
In one embodiment, the polyalkyleneimine comprises polyethylenimine and/or polypropylenimine, preferably polyethyleneimine. A preferred polyalkyleneimine is polyethyleneimine (PEI). The average molecular weight of PEI is preferably 0.75-102 to 107 Da, preferably 1000 to 105 Da, more preferably 10000 to 40000 Da, more preferably 15000 to 30000 Da, even more preferably 20000 to 25000 Da.
Preferred according to the disclosure is linear polyalkyleneimine such as linear polyethyleneimine (PEI).
Cationic polymers (including polycationic polymers) contemplated for use herein include any cationic polymers which are able to electrostatically bind nucleic acid. In one embodiment, cationic polymers contemplated for use herein include any cationic polymers with which nucleic acid can be associated, e.g. by forming complexes with the nucleic acid or forming vesicles in which the nucleic acid is enclosed or encapsulated.
Particles described herein may also comprise polymers other than cationic polymers, i.e., non-cationic polymers and/or anionic polymers. Collectively, anionic and neutral polymers are referred to herein as non-cationic polymers.
Lipids
The terms "lipid" and "lipid-like material" are broadly defined herein as molecules which comprise one or more hydrophobic moieties or groups and optionally also one or more hydrophilic moieties or groups. Molecules comprising hydrophobic moieties and hydrophilic moieties are also frequently denoted as amphiphiles. Lipids are usually insoluble or poorly soluble in water, but soluble in many organic solvents. In an aqueous environment, the amphiphilic nature allows the molecules to self-assemble into organized structures and different phases. One of those phases consists of lipid bilayers, as they are present in vesicles, multilamellar/unilamellar liposomes, or membranes in an aqueous environment. Hydrophobicity can be conferred by the inclusion of apolar groups that include, but are not limited to, long-chain saturated and unsaturated aliphatic hydrocarbon groups and such groups substituted by one or more aromatic, cycloaliphatic, or heterocyclic group(s). The hydrophilic groups may comprise polar and/or charged groups and include carbohydrates, phosphate, carboxylic, sulfate, amino, sulfhydryl, nitro, hydroxyl, and other like groups.
As used herein, the term "hydrophobic" refers to any a molecule, moiety or group which is substantially immiscible or insoluble in aqueous solution. The term hydrophobic group includes hydrocarbons having at least 6 carbon atoms. The monovalent radical of a hydrocarbon is referred to as hydrocarbyl herein. The hydrophobic group can have functional groups (e.g., ether, ester, halide, etc.) and atoms other than carbon and hydrogen as long as the group satisfies the condition of being substantially immiscible or insoluble in aqueous solution.
The term "hydrocarbon" includes non-cyclic, e.g., linear (straight) or branched, hydrocarbyl groups, such as alkyl, alkenyl, or alkynyl as defined herein. It should be appreciated that one or more of the hydrogen atoms in alkyl, alkenyl, or alkynyl may be substituted with other atoms, e.g., halogen, oxygen or sulfur. Unless stated otherwise, hydrocarbon groups can also include a cyclic (alkyl, alkenyl or alkynyl) group or an aryl group, provided that the overall polarity of the hydrocarbon remains relatively nonpolar.
The term "alkyl" refers to a saturated linear or branched monovalent hydrocarbon moiety which may have one to thirty, typically one to twenty, often six to eighteen carbon atoms. Exemplary nonpolar alkyl groups include, but are not limited to, methyl, ethyl, propyl, isopropyl, hexyl, decyl, dodecyl, tetradecyl, hexadecyl, octadecyl, and the like.
The term "alkenyl" refers to a linear or branched monovalent hydrocarbon moiety having at least one carboncarbon double bond in which the total carbon atoms may be six to thirty, typically six to twenty often six to eighteen. Generally, the maximal number of carbon-carbon double bonds in the alkenyl group can be equal to the integer which is calculated by dividing the number of carbon atoms in the alkenyl group by 2 and, if the number of carbon atoms in the alkenyl group is uneven, rounding the result of the division down to the next integer. For example, for an alkenyl group having 9 carbon atoms, the maximum number of carbon-carbon double bonds is 4. Preferably, the alkenyl group has 1 to 6 (such as 1 to 4), i.e., 1, 2, 3, 4, 5, or 6, carbon-carbon double bonds.
The term "alkynyl" refers to a linear or branched monovalent hydrocarbon moiety having at least one carboncarbon triple bond in which the total carbon atoms may be six to thirty, typically six to twenty, often six to eighteen. Alkynyl groups can optionally have one or more carbon-carbon double bonds. Generally, the maximal number of carbon-carbon triple bonds in the alkynyl group can be equal to the integer which is calculated by dividing the number of carbon atoms in the alkynyl group by 2 and, if the number of carbon atoms in the alkynyl group is uneven, rounding the result of the division down to the next integer. For example, for an alkynyl group having 9 carbon atoms, the maximum number of carbon-carbon triple bonds is 4. Preferably, the alkynyl group has 1 to 6 (such as 1 to 4), i.e., 1, 2, 3, 4, 5, or 6, more preferably 1 or 2 carbon-carbon triple bonds.
The term "alkylene" refers to a saturated linear or branched divalent hydrocarbon moiety which may have one to thirty, typically two to twenty, often four to twelve carbon atoms. Exemplary nonpolar alkylene groups include, but are not limited to, methylene, ethylene, trimethylene, hexamethylene, decamethylene, dodecamethylene, tetradeca methylene, hexadeca methylene, octadecmethylene, and the like.
The term "alkenylene" refers to a linear or branched divalent hydrocarbon moiety having at least one carbon-carbon double bond in which the total carbon atoms may be two to thirty, typically two to twenty, often four to twelve. Generally, the maximal number of carbon-carbon double bonds in the alkenylene group can be equal to the integer which is calculated by dividing the number of carbon atoms in the alkenylene group by 2 and, if the number of carbon atoms in the alkenylene group is uneven, rounding the result of the division down to the next integer. For example, for an alkenylene group having 9 carbon atoms, the maximum number of carbon-carbon double bonds is 4. Preferably, the alkenylene group has 1 to 6 (such as 1 to 4), i.e., 1, 2, 3, 4, 5, or 6, carbon-carbon double bonds. The term "cycloalkyl" represents cyclic non-aromatic versions of "alkyl" and "alkenyl" with preferably 3 to 14 carbon atoms, such as 3 to 12 or 3 to 10 carbon atoms, i.e., 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 carbon atoms (such as 3, 4, 5, 6, 7, 8, 9, or 10 carbon atoms), more preferably 3 to 7 carbon atoms. Exemplary cycloalkyl groups include cyclopropyl, cyclopropenyl, cyclobutyl, cyclobutenyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl, cycloheptenyl, cyclooctyl, cyclooctenyl, cyclononyl, cyclononenyl, cylcodecyl, cylcodecenyl, and adamantyl. The cycloalkyl group may consist of one ring (monocyclic), two rings (bicyclic), or more than two rings (polycyclic).
The term "aryl" refers to a monoradical of an aromatic cyclic hydrocarbon. Preferably, the aryl group contains 3 to 14 (e.g., 5, 6, 7, 8, 9, or 10, such as 5, 6, or 10) carbon atoms which can be arranged in one ring (e.g., phenyl) or two or more condensed rings (e.g., naphthyl). Exemplary aryl groups include cyclopropenylium, cyclopentadienyl, phenyl, indenyl, naphthyl, azulenyl, fluorenyl, anthryl, and phenanthryl. Preferably, "aryl" refers to a monocyclic ring containing 6 carbon atoms or an aromatic bicyclic ring system containing 10 carbon atoms. Preferred examples are phenyl and naphthyl. Aryl does not encompass fullerenes.
The term "aromatic" as used in the context of hydrocarbons means that the whole molecule has to be aromatic. For example, if a monocyclic aryl is hydrogenated (either partially or completely) the resulting hydrogenated cyclic structure is classified as cycloalkyl for the purposes of the present disclosure. Likewise, if a bi- or polycyclic aryl (such as naphthyl) is hydrogenated the resulting hydrogenated bi- or polycyclic structure (such as 1,2- dihydronaphthyl) is classified as cycloalkyl for the purposes of the present disclosure (even if one ring, such as in 1,2-dihydronaphthyl, is still aromatic).
As used herein, the term "amphiphilic" refers to a molecule having both a polar portion and a non-polar portion. Often, an amphiphilic compound has a polar head attached to a long hydrophobic tail. In some embodiments, the polar portion is soluble in water, while the non-polar portion is insoluble in water. In addition, the polar portion may have either a formal positive charge, or a formal negative charge. Alternatively, the polar portion may have both a formal positive and a negative charge, and be a zwitterion or inner salt. For purposes of the disclosure, the amphiphilic compound can be, but is not limited to, one or a plurality of natural or non-natural lipids and lipid-like compounds.
The term "lipid-like material", "lipid-like compound" or "lipid-like molecule" relates to substances, in particular amphiphilic substances, that structurally and/or functionally relate to lipids but may not be considered as lipids in a strict sense. For example, the term includes compounds that are able to form amphiphilic layers as they are present in vesicles, multilamellar/unilamellar liposomes, or membranes in an aqueous environment and includes surfactants, or synthesized compounds with both hydrophilic and hydrophobic moieties. Generally speaking, the term includes molecules, which comprise hydrophilic and hydrophobic moieties with different structural organization, which may or may not be similar to that of lipids. Examples of lipid-like compounds capable of spontaneous integration into cell membranes include functional lipid constructs such as synthetic function-spacer- lipid constructs (FSL), synthetic function-spacer-sterol constructs (FSS) as well as artificial amphipathic molecules. Lipids comprising two long alkyl chains and a polar head group are generally cylindrical. The area occupied by the two alkyl chains is similar to the area occupied by the polar head group. Such lipids have low solubility as monomers and tend to aggregate into planar bilayers that are water insoluble. Traditional surfactant monomers comprising only one linear alkyl chain and a hydrophilic head group are generally cone shaped. The hydrophilic head group tends to occupy more molecular space than the linear alkyl chain. In some embodiments, surfactants tend to aggregate into spherical or elliptoid micelles that are water soluble. While lipids also have the same general structure as surfactants - a polar hydrophilic head group and a nonpolar hydrophobic tail - lipids differ from surfactants in the shape of the monomers, in the type of aggregates formed in solution, and in the concentration range required for aggregation. As used herein, the term "lipid" is to be construed to cover both lipids and lipid-like materials unless otherwise indicated herein or clearly contradicted by context.
Generally, lipids may be divided into eight categories: fatty acids, glycerolipids, glycerophospholipids, sphingolipids, saccharolipids, polyketides (derived from condensation of ketoacyl subunits), sterol lipids and prenol lipids (derived from condensation of isoprene subunits). Although the term "lipid" is sometimes used as a synonym for fats, fats are a subgroup of lipids called triglycerides. Lipids also encompass molecules such as fatty acids and their derivatives (including tri-, di-, monoglycerides, and phospholipids), as well as steroids, i.e., sterol-containing metabolites such as cholesterol or a derivative thereof. Examples of cholesterol derivatives include, but are not limited to, cholestanol, cholestanone, cholestenone, coprostanol, cholesteryl-2'-hydroxyethyl ether, cholesteryl-4'-hydroxybutyl ether, tocopherol and derivatives thereof, and mixtures thereof.
Fatty acids, or fatty acid residues are a diverse group of molecules made of a hydrocarbon chain that terminates with a carboxylic acid group; this arrangement confers the molecule with a polar, hydrophilic end, and a nonpolar, hydrophobic end that is insoluble in water. The carbon chain, typically between four and 24 carbons long, may be saturated or unsaturated, and may be attached to functional groups containing oxygen, halogens, nitrogen, and sulfur. If a fatty acid contains a double bond, there is the possibility of either a cis or trans geometric isomerism, which significantly affects the molecule's configuration. Cis-double bonds cause the fatty acid chain to bend, an effect that is compounded with more cis double bonds in the chain. Other major lipid classes in the fatty acid category are the fatty esters and fatty amides.
Glycerolipids are composed of mono-, di-, and tri-substituted glycerols, the best-known being the fatty acid triesters of glycerol, called triglycerides. The word "triacylglycerol" is sometimes used synonymously with "triglyceride". In these compounds, the three hydroxyl groups of glycerol are each esterified, typically by different fatty acids. Additional subclasses of glycerolipids are represented by glycosylglycerols, which are characterized by the presence of one or more sugar residues attached to glycerol via a glycosidic linkage.
The glycerophospholipids are amphipathic molecules (containing both hydrophobic and hydrophilic regions) that contain a glycerol core linked to two fatty acid-derived "tails" by ester linkages and to one "head" group by a phosphate ester linkage. Examples of glycerophospholipids, usually referred to as phospholipids (though sphingomyelins are also classified as phospholipids) are phosphatidylcholine (also known as PC, GPCho or lecithin), phosphatidylethanolamine (PE or GPEtn) and phosphatidylserine (PS or GPSer).
Sphingolipids are a complex family of compounds that share a common structural feature, a sphingoid base backbone. The major sphingoid base in mammals is commonly referred to as sphingosine. Ceramides (N-acyl- sphingoid bases) are a major subclass of sphingoid base derivatives with an amide-linked fatty acid. The fatty acids are typically saturated or mono-unsaturated with chain lengths from 16 to 26 carbon atoms. The major phosphosphingolipids of mammals are sphingomyelins (ceramide phosphocholines), whereas insects contain mainly ceramide phosphoethanolamines and fungi have phytoceramide phosphoinositols and mannose-containing headgroups. The glycosphingolipids are a diverse family of molecules composed of one or more sugar residues linked via a glycosidic bond to the sphingoid base. Examples of these are the simple and complex glycosphingolipids such as cerebrosides and gangliosides.
Sterol lipids, such as cholesterol and its derivatives, or tocopherol and its derivatives, are an important component of membrane lipids, along with the glycerophospholipids and sphingomyelins.
Saccharolipids describe compounds in which fatty acids are linked directly to a sugar backbone, forming structures that are compatible with membrane bilayers. In the saccharolipids, a monosaccharide substitutes for the glycerol backbone present in glycerolipids and glycerophospholipids. The most familiar saccharolipids are the acylated glucosamine precursors of the Lipid A component of the lipopolysaccharides in Gram-negative bacteria. Typical lipid A molecules are disaccharides of glucosamine, which are derivatized with as many as seven fatty-acyl chains. The minimal lipopolysaccharide required for growth in E. coli is Kdo2-Lipid A, a hexa-acylated disaccharide of glucosamine that is glycosylated with two 3-deoxy-D-manno-octulosonic acid (Kdo) residues.
Polyketides are synthesized by polymerization of acetyl and propionyl subunits by classic enzymes as well as iterative and multimodular enzymes that share mechanistic features with the fatty acid synthases. They comprise a large number of secondary metabolites and natural products from animal, plant, bacterial, fungal and marine sources, and have great structural diversity. Many polyketides are cyclic molecules whose backbones are often further modified by glycosylation, methylation, hydroxylation, oxidation, or other processes.
According to the disclosure, lipids and lipid-like materials may be cationic, anionic or neutral. Neutral lipids or lipid- like materials exist in an uncharged or neutral zwitterionic form at a selected pH.
Cationic/Cationicallv ionizable lipids
In some embodiments, the RNA compositions and formulations and RNA particles described herein comprise at least one cationic or cationically ionizable lipid as particle forming agent. Cationic or cationically ionizable lipids contemplated for use herein include any cationic or cationically ionizable lipids (including lipid-like materials) which are able to electrostatically bind nucleic acid. In some embodiments, cationic or cationically ionizable lipids contemplated for use herein can be associated with nucleic acid, e.g. by forming complexes with the nucleic acid or forming vesicles in which the nucleic acid is enclosed or encapsulated.
As used herein, a "cationic lipid" refers to a lipid or lipid-like material having a net positive charge. Cationic lipids bind negatively charged nucleic acid by electrostatic interaction. Generally, cationic lipids possess a lipophilic moiety, such as a sterol, an acyl chain, a diacyl or more acyl chains, and the head group of the lipid typically carries the positive charge.
In some embodiments, a cationic lipid has a net positive charge only at certain pH, in particular acidic pH, while it has preferably no net positive charge, preferably has no charge, i.e., it is neutral, at a different, preferably higher pH such as physiological pH. This ionizable behavior is thought to enhance efficacy through helping with endosomal escape and reducing toxicity as compared with particles that remain cationic at physiological pH.
As used herein, a "cationically ionizable lipid" refers to a lipid or lipid-like material which has a net positive charge or is neutral, i.e., which is not permanently cationic. Thus, depending on the pH of the composition in which the cationically ionizable lipid is solved, the cationically ionizable lipid is either positively charged or neutral. For purposes of the present disclosure, cationically ionizable lipids are covered by the term "cationic lipid" unless contradicted by the circumstances.
In some embodiments, the cationic or cationically ionizable lipid comprises a head group which includes at least one nitrogen atom (N) which is positive charged or capable of being protonated, e.g., under physiological conditions.
Examples of cationic or cationically ionizable lipids include, but are not limited to N,N-dimethyl-2,3- dioleyloxypropylamine (DODMA), l,2-dioleoyl-3-trimethylammonium propane (DOTAP); l,2-di-O-octadecenyl-3- trimethylammonium propane (DOTMA), 3-(N— (N',N'-dimethylaminoethane)-carbamoyl)cholesterol (DC-Chol), dimethyldioctadecylammonium (DDAB); l,2-dioleoyl-3-dimethylammonium-propane (DODAP); l,2-diacyloxy-3- dimethylammonium propanes; l,2-dialkyloxy-3-dimethylammonium propanes; dioctadecyldimethyl ammonium chloride (DODAC), l,2-distearyloxy-N,N-dimethyl-3-aminopropane (DSDMA), 2,3-di(tetradecoxy)propyl-(2- hydroxyethyl)-dimethylazanium (DMRIE), l,2-dimyristoyl-sn-glycero-3-ethylphosphocholine (DMEPC), 1,2- dimyristoyl-3-trimethylammonium propane (DMTAP), l,2-dioleyloxypropyl-3-dimethyl-hydroxyethyl ammonium bromide (DORIE), and 2,3-dioleoyloxy- N-[2(spermine carboxamide)ethyl]-N,N-dimethyl-l-propanamium trifluoroacetate (DOSPA), l,2-dilinoleyloxy-N,N-dimethylaminopropane (DLinDMA), l,2-dilinolenyloxy-N,N- dimethylaminopropane (DLenDMA), dioctadecylamidoglycyl spermine (DOGS), 3-dimethylamino-2-(cholest-5-en-3- beta-oxybutan-4-oxy)-l-(cis,cis-9,12-oc-tadecadienoxy)propane (CLinDMA), 2-[5'-(cholest-5-en-3-beta-oxy)-3'- oxapentoxy)-3-dimethyl-l-(cis,cis-9',12'-octadecadienoxy)propane (CpLinDMA), N,N-dimethyl-3,4- dioleyloxybenzylamine (DMOBA), l,2-N,N'-dioleylcarbamyl-3-dimethylaminopropane (DOcarbDAP), 2,3-
Dilinoleoyloxy-N,N-dimethylpropylamine (DLinDAP), l,2-N,N'-Dilinoleylcarbamyl-3-dimethylaminopropane
(DLincarbDAP), l,2-Dilinoleoylcarbamyl-3-dimethylaminopropane (DLinCDAP), 2,2-dilinoleyl-4- dimethylaminomethyl-[l,3]-dioxolane (DLin-K-DMA), 2,2-dilinoleyl-4-dimethylaminoethyl-[l,3]-dioxolane (DLin-K-
XTC2-DMA), 2,2-dilinoleyl-4-(2-dimethylaminoethyl)-[l,3]-dioxolane (DLin-KC2-DMA), heptatriaconta-6, 9,28,31- tetraen-19-yl-4-(dimethylamino)butanoate (DLin-MC3-DMA), N-(2-Hydroxyethyl)-N,N-dimethyl-2,3- bis(tetradecyloxy)-l-propanaminium bromide (DMRIE), (±)-N-(3-aminopropyl)-N,N-dimethyl-2,3-bis(cis-9- tetradecenyloxy)-l-propanaminium bromide (GAP-DMORIE), (±)-N-(3-aminopropyl)-N,N-dimethyl-2,3 bis(dodecyloxy)-l-propanaminium bromide (GAP-DLRIE), (±)-N-(3-aminopropyl)-N,N-dimethyl-2,3 bis(tetradecyloxy)-l-propanaminium bromide (GAP-DMRIE), N-(2-Aminoethyl)-N,N-dimethyl-2,3 bis(tetradecyloxy)-l-propanaminium bromide (PAE-DMRIE), N-(4-carboxybenzyl)-N,N-dimethyl-2,3 bis(oleoyloxy)propan-l-aminium (DOBAQ), 2-({8-[(3P)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)- octadeca-9,12-dien-l-yloxy]propan-l-amine (Octyl-CLinDMA), l,2-dimyristoyl-3-dimethylammonium-propane (DMDAP), l,2-dipalmitoyl-3-dimethylammonium-propane (DPDAP), Nl-[2-((lS)-l-[(3-aminopropyl)amino]-4-[di(3- amino-propyl)amino]butylcarboxamido)ethyl]-3,4-di[oleyloxy]-benzamide (MVL5), l,2-dioleoyl-sn-glycero-3- ethylphosphocholine (DOEPC), 2,3-bis(dodecyloxy)-N-(2-hydroxyethyl)-N,N-dimethylpropan-l-amonium bromide (DLRIE), N-(2-aminoethyl)-N,N-dimethyl-2,3-bis(tetradecyloxy)propan-l-aminium bromide (DMORIE), di((Z)-non- 2-en-l-yl) 8,8'-((((2(dimethylamino)ethyl)thio)carbonyl)azanediyl)dioctanoate (ATX), N,N-dimethyl-2,3- bis(dodecyloxy)propan-l-amine (DLDMA), N,N-dimethyl-2,3-bis(tetradecyloxy)propan-l-amine (DMDMA), Di((Z)- non-2-en-l-yl)-9-((4-(dimethylaminobutanoyl)oxy)heptadecanedioate (L319), N-Dodecyl-3-((2-dodecylcarbamoyl- ethyl)-{2-[(2-dodecylcarbamoyl-ethyl)-2-{(2-dodecylcarbamoyl-ethyl)-[2-(2-dodecylcarbamoyl-ethylamino)-ethyl]- amino}-ethylamino)propionamide (lipidoid 98N12-5), l-[2-[bis(2-hydroxydodecyl)amino]ethyl-[2-[4-[2-[bis(2 hydroxydodecyl)amino]ethyl]piperazin-l-yl]ethyl]amino]dodecan-2-ol (lipidoid C12-200).
In some embodiments, the cationic or cationically ionizable lipid is DOTMA. In some embodiments, the cationic or cationically ionizable lipid is DODMA.
DOTMA is a cationic lipid with a quaternary amine headgroup. The structure of DOTMA may be represented as follows:
DODMA is an ionizable cationic lipid with a tertiary amine headgroup. The structure of DODMA may be represented as follows:
In some embodiments, the cationic or cationically ionizable lipid may comprise from about 10 mol % to about 95 mol %, from about 20 mol % to about 95 mol %, from about 20 mol % to about 90 mol %, from about 30 mol % to about 90 mol %, from about 40 mol % to about 90 mol %, or from about 40 mol % to about 80 mol % of the total lipid present in the particle.
Additional lipids
The RNA compositions and formulations and RNA particles described herein may also comprise lipids (including lipid-like materials) other than cationic or cationically ionizable lipids (also collectively referred to herein as cationic lipids), i.e., non-cationic lipids (including non-cationic or non-cationically ionizable lipids or lipid-like materials). Collectively, anionic and neutral lipids or lipid-like materials are referred to herein as non-cationic lipids. Optimizing the formulation of RNA particles by addition of other hydrophobic moieties, such as cholesterol and lipids, in addition to a cationic or cationically ionizable lipid may enhance particle stability and efficacy of RNA delivery. One or more additional lipids may or may not affect the overall charge of the RNA particles. In some embodiments, the one or more additional lipids are a non-cationic lipid or lipid-like material. The non-cationic lipid may comprise, e.g., one or more anionic lipids and/or neutral lipids. As used herein, an "anionic lipid" refers to any lipid that is negatively charged at a selected pH. As used herein, a "neutral lipid" refers to any of a number of lipid species that exist either in an uncharged or neutral zwitterionic form at a selected pH.
In some embodiments, the RNA compositions and formulations and RNA particles described herein comprise a cationic or cationically ionizable lipid and one or more additional lipids.
Without wishing to be bound by theory, the amount of the cationic or cationically ionizable lipid compared to the amount of the one or more additional lipids may affect important RNA particle characteristics, such as charge, particle size, stability, tissue selectivity, and bioactivity of the RNA. Accordingly, in some embodiments, the molar ratio of the cationic or cationically ionizable lipid to the one or more additional lipids is from about 10:0 to about 1:9, about 4: 1 to about 1:2, about 4: 1 to about 1: 1, about 3: 1 to about 1: 1, or about 3: 1 to about 2: 1.
In some embodiments, the one or more additional lipids comprised in the RNA compositions and formulations and RNA particles described herein comprise one or more of the following: neutral lipids, steroids, and combinations thereof.
In some embodiments, the one or more additional lipids comprise a neutral lipid which is a phospholipid. In some embodiments, the phospholipid is selected from the group consisting of phosphatidylcholines, phosphatidylethanolamines, phosphatidylglycerols, phosphatidic acids, phosphatidylserines and sphingomyelins. Specific phospholipids that can be used include, but are not limited to, phosphatidylcholines, phosphatidylethanolamines, phosphatidylglycerols, phosphatidic acids, phosphatidylserines or sphingomyelin. Such phospholipids include in particular diacylphosphatidylcholines, such as distearoylphosphatidylcholine (DSPC), dioleoylphosphatidylcholine (DOPC), dimyristoylphosphatidylcholine (DMPC), dipentadecanoylphosphatidylcholine, dilauroylphosphatidylcholine, dipalmitoylphosphatidylcholine (DPPC), diarachidoylphosphatidylcholine (DAPC), dibehenoylphosphatidylcholine (DBPC), ditricosanoylphosphatidylcholine (DTPC), dilignoceroylphatidylcholine (DLPC), palmitoyloleoyl-phosphatidylcholine (POPC), l,2-di-O-octadecenyl-sn-glycero-3-phosphocholine (18:0 Diether PC), l-oleoyl-2-cholesterylhemisuccinoyl-sn-glycero-3-phosphocholine (OChemsPC), 1-hexadecyl-sn- glycero-3-phosphocholine (C16 Lyso PC) and phosphatidylethanolamines, in particular diacylphosphatidylethanolamines, such as dioleoylphosphatidylethanolamine (DOPE), distearoyl- phosphatidylethanolamine (DSPE), dipalmitoyl-phosphatidylethanolamine (DPPE), dimyristoyl- phosphatidylethanolamine (DMPE), dilauroyl-phosphatidylethanolamine (DLPE), diphytanoyl- phosphatidylethanolamine (DPyPE), l,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine (DOPG), 1,2- dipalmitoyl-sn-glycero-3-phospho-(l'-rac-glycerol) (DPPG), l-palmitoyl-2-oleoyl-sn-glycero-3- phosphoethanolamine (POPE), N-palmitoyl-D-erythro-sphingosylphosphorylcholine (SM), and further phosphatidylethanolamine lipids with different hydrophobic chains. In some embodiments, the neutral lipid is selected from the group consisting of DSPC, DOPC, DMPC, DPPC, POPC, DOPE, DOPG, DPPG, POPE, DPPE, DMPE, DSPE, and SM. In some embodiments, the neutral lipid is selected from the group consisting of DSPC, DPPC, DMPC, DOPC, POPC, DOPE and SM. In some embodiments, the neutral lipid is DSPC. In some embodiments, the neutral lipid is DOPE.
In some embodiments, the additional lipid comprises one of the following: (1) a phospholipid, (2) cholesterol or a derivative thereof; or (3) a mixture of a phospholipid and cholesterol or a derivative thereof. Examples of cholesterol derivatives include, but are not limited to, cholestanol, cholestanone, cholestenone, coprostanol, cholesteryl-2'- hydroxyethyl ether, cholesteryl-4'-hydroxybutyl ether, tocopherol and derivatives thereof, and mixtures thereof.
Thus, in some embodiments, the RNA compositions and formulations and RNA particles described herein comprise (1) a cationic or cationically ionizable lipid, and a phospholipid such as DSPC or DOPE or (2) a cationic or cationically ionizable lipid and a phospholipid such as DSPC or DOPE and cholesterol.
In some embodiments, the RNA particles (especially the particles comprising mRNA) described herein comprise (1) DOTMA and DOPE, (2) DOTMA, DOPE and cholesterol, (3) DODMA and DOPE or (4) DODMA, DOPE and cholesterol.
DSPC is a neutral phospholipid. The structure of DSPC may be represented as follows:
DOPE is a neutral phospholipid. The structure of DOPE may be represented as follows:
The structure of cholesterol may be represented as follows: In some embodiments, RNA compositions and formulations and RNA particles described herein do not include a polymer conjugated lipid such as a pegylated lipid. The term "pegylated lipid" refers to a molecule comprising both a lipid portion and a polyethylene glycol portion. Pegylated lipids are known in the art.
In some embodiments, the additional lipid (e.g., one or more phospholipids and/or cholesterol) may comprise from about 0 mol % to about 90 mol %, from about 0 mol % to about 80 mol %, from about 2 mol % to about 80 mol %, from about 5 mol % to about 80 mol %, from about 5 mol % to about 60 mol %, from about 5 mol % to about 50 mol %, from about 7.5 mol % to about 50 mol %, or from about 10 mol % to about 40 mol % of the total lipid present in the particle. In some embodiments, the additional lipid (e.g., one or more phospholipids and/or cholesterol) comprises about 10 mol %, about 15 mol %, or about 20 mol % of the total lipid present in the particle.
In some embodiments, the additional lipid comprises a mixture of: (i) a phospholipid such as DOPE; and (ii) cholesterol or a derivative thereof. In some embodiments, the molar ratio of the phospholipid such as DOPE to the cholesterol or a derivative thereof is from about 9:0 to about 1: 10, about 2: 1 to about 1:4, about 1: 1 to about 1:4, or about 1: 1 to about 1:3.
Polvmer-coniuaated lipids
In some embodiments, RNA compositions and formulations and RNA particles described herein may comprise at least one polymer-conjugated lipid. A polymer-conjugated lipid is typically a molecule comprising a lipid portion and a polymer portion conjugated thereto. In some embodiments, a polymer-conjugated lipid is a PEG-conjugated lipid, also referred to herein as pegylated lipid or PEG-lipid. The term "pegylated lipid" refers to a molecule comprising both a lipid portion and a polyethylene glycol portion. Pegylated lipids are known in the art. In some embodiments, a polymer-conjugated lipid is a polysarcosine-conjugated lipid, also referred to herein as sarcosinylated lipid or pSar-lipid. The term "sarcosinylated lipid" refers to a molecule comprising both a lipid portion and a polysarcosine portion.
In some embodiments, a polymer-conjugated lipid is designed to sterically stabilize a lipid particle by forming a protective hydrophilic layer that shields the hydrophobic lipid layer. In some embodiments, a polymer-conjugated lipid can reduce its association with serum proteins and/or the resulting uptake by the reticuloendothelial system when such lipid particles are administered in vivo.
Polyethylenealycol (PEG)-coniuaated lipids
In some embodiments, RNA compositions/formulations and RNA particles described herein comprise a PEG- conjugated lipid.
In some embodiments, the PEG-conjugated lipid (pegylated lipid) is a lipid having the structure of the following general formula: or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, wherein: each of R12 and R13 is each independently a straight or branched, alkyl or alkenyl chain containing from 10 to 30 carbon atoms, wherein the alkyl/alkenyl chain is optionally interrupted by one or more ester bonds; and w has a mean value ranging from 30 to 60.
In some embodiments of this formula, each of R12 and R13 is independently a straight alkyl chain containing from 10 to 18 carbon atoms, preferably from 12 to 16 carbon atoms.
In some embodiments of this formula, R12 and R13 are identical. In some embodiments, each of R12 and R13 is a straight alkyl chain containing 12 carbon atoms. In some embodiments, each of R12 and R13 is a straight alkyl chain containing 14 carbon atoms. In some embodiments, each of R12 and R13 is a straight alkyl chain containing 16 carbon atoms.
In some embodiments of this formula, R12 and R13 are different. In some embodiments, one of R12 and R13 is a straight alkyl chain containing 12 carbon atoms and the other of R12 and R13 is a straight alkyl chain containing 14 carbon atoms.
In some embodiments of this formula, w has a mean value ranging from 40 to 50, such as a mean value of 45.
In some embodiments of this formula, w is within a range such that the PEG portion of the pegylated lipid has an average molecular weight of from about 400 to about 6000 g/mol, such as from about 1000 to about 5000 g/mol, from about 1500 to about 4000 g/mol, or from about 2000 to about 3000 g/mol. In some embodiments, each of R12 and R13 is a straight alkyl chain containing 14 carbon atoms and w has a mean value of 45.
Various PEG-conjugated lipids are known in the art and include, but are not limited to pegylated diacylglycerol (PEG-DAG) such as l-(monomethoxy-polyethyleneglycol)-2,3-dimyristoylglycerol (PEG-DMG), a pegylated phosphatidylethanoloamine (PEG-PE), a PEG succinate diacylglycerol (PEG-S-DAG) such as 4-O-(2' ,3 di(tetradecanoyloxy)propyl-l-O-(ro-methoxy(polyethoxy)ethyl)butanedioate (PEG-S-DMG), a pegylated ceramide (PEG-cer), or a PEG dialkoxypropylcarbamate such as ro-methoxy(polyethoxy)ethyl-N-(2,3- di(tetradecanoxy)propyl)carbamate or 2,3-di(tetradecanoxy)propyl-N-(ro methoxy(polyethoxy)ethyl)carbamate, and the like.
In some embodiments, the PEG-conjugated lipid (pegylated lipid) is or comprises 2-[(polyethylene glycol)-2000]- N,N-ditetradecylacetamide. In some embodiments, the pegylated lipid has the following structure: In some embodiments, the PEG-conjugated lipid (pegylated lipid) is DMG-PEG 2000, e.g., having the following structure:
In some embodiments, the PEG-conjugated lipid (pegylated lipid) has the following structure: wherein n has a mean value ranging from 30 to 60, such as about 50. In one embodiment, the PEG-conjugated lipid (pegylated lipid) is PEG2000-C-DMA which preferably refers to 3-N-[(co-methoxy poly(ethylene glycol)2000)carbamoyl]-l,2-dimyristyloxy-propylamine (MPEG-(2 kDa)-C-DMA) or methoxy-polyethylene glycol-
2,3-bis(tetradecyloxy)propylcarbamate (2000).
In some embodiments, RNA compositions/formulations described herein may comprise one or more PEG- conjugated lipids or pegylated lipids as described in WO 2017/075531 and WO 2018/081480, the entire contents of each of which are incorporated herein by reference for the purposes described herein.
In some embodiments, the pegylated lipid comprises from about 1 mol % to about 10 mol %, preferably from about 1 mol % to about 5 mol %, more preferably from about 1 mol % to about 2.5 mol % of the total lipid present in the RNA compositions/formulations and RNA particles described herein.
Embodiments of Lipoplex Particles
In some embodiments of the present disclosure, the RNA described herein may be present in RNA lipoplex particles.
Lipoplexes (LPX) are electrostatic complexes which are generally formed by mixing preformed cationic lipid liposomes with anionic RNA. Formed lipoplexes possess distinct internal arrangements of molecules that arise due to the transformation from liposomal structure into compact RNA-lipoplexes.
In certain embodiments, the RNA lipoplex particles include both a cationic lipid and an additional lipid. In an exemplary embodiment, the cationic lipid is DOTMA and the additional lipid is DOPE.
In some embodiments, the molar ratio of the at least one cationic lipid to the at least one additional lipid is from about 10:0 to about 1:9, about 4: 1 to about 1:2, or about 3: 1 to about 1: 1. In specific embodiments, the molar ratio may be about 3: 1, about 2.75: 1, about 2.5: 1, about 2.25: 1, about 2: 1, about 1.75: 1, about 1.5: 1, about 1.25: 1, or about 1: 1. In an exemplary embodiment, the molar ratio of the at least one cationic lipid to the at least one additional lipid is about 2: 1. RNA lipoplex particles described herein have an average diameter that in some embodiments ranges from about 200 nm to about 1000 nm, from about 200 nm to about 800 nm, from about 250 to about 700 nm, from about 400 to about 600 nm, from about 300 nm to about 500 nm, or from about 350 nm to about 400 nm. In specific embodiments, the RNA lipoplex particles have an average diameter of about 200 nm, about 225 nm, about 250 nm, about 275 nm, about 300 nm, about 325 nm, about 350 nm, about 375 nm, about 400 nm, about 425 nm, about 450 nm, about 475 nm, about 500 nm, about 525 nm, about 550 nm, about 575 nm, about 600 nm, about 625 nm, about 650 nm, about 675 nm, about 700 nm, about 725 nm, about 750 nm, about 775 nm, about 800 nm, about 825 nm, about 850 nm, about 875 nm, about 900 nm, about 925 nm, about 950 nm, about 975 nm, or about 1000 nm. In some embodiments, the RNA lipoplex particles have an average diameter that ranges from about 250 nm to about 700 nm. In some embodiments, the RNA lipoplex particles have an average diameter that ranges from about 300 nm to about 500 nm. In an exemplary embodiment, the RNA lipoplex particles have an average diameter of about 400 nm.
The RNA lipoplex particles and compositions comprising RNA lipoplex particles described herein are useful for delivery of RNA to a target tissue after parenteral administration, in particular after intravenous administration.
Spleen targeting RNA lipoplex particles are described in WO 2013/143683, herein incorporated by reference. It has been found that RNA lipoplex particles having a net negative charge may be used to preferentially target spleen tissue or spleen cells such as antigen-presenting cells, in particular dendritic cells. Accordingly, following administration of the RNA lipoplex particles, RNA accumulation and/or RNA expression in the spleen occurs. Thus, RNA lipoplex particles of the disclosure may be used for expressing RNA in the spleen. In an embodiment, after administration of the RNA lipoplex particles, no or essentially no RNA accumulation and/or RNA expression in the lung and/or liver occurs. In some embodiments, after administration of the RNA lipoplex particles, RNA accumulation and/or RNA expression in antigen presenting cells, such as professional antigen presenting cells in the spleen occurs. Thus, RNA lipoplex particles of the disclosure may be used for targeting RNA, e.g., RNA encoding an antigen or at least one epitope, to the lymphatic system, in particular secondary lymphoid organs, more specifically spleen. Targeting the lymphatic system, in particular secondary lymphoid organs, more specifically spleen is in particular preferred if the RNA administered is RNA encoding vaccine antigen. In some embodiments, the target cell is a spleen cell. In some embodiments, the target cell is an antigen presenting cell such as a professional antigen presenting cell in the spleen. In some embodiments, the target cell is a dendritic cell in the spleen.
The electric charge of the RNA lipoplex particles of the present disclosure is the sum of the electric charges present in the at least one cationic lipid and the electric charges present in the RNA. The charge ratio is the ratio of the positive charges present in the at least one cationic lipid to the negative charges present in the RNA. The charge ratio of the positive charges present in the at least one cationic lipid to the negative charges present in the RNA is calculated by the following equation: charge ratio= [(cationic lipid concentration (mol)) * (the total number of positive charges in the cationic lipid)] / [(RNA concentration (mol)) * (the total number of negative charges in RNA)]. The concentration of RNA and the at least one cationic lipid amount can be determined using routine methods by one skilled in the art. In some embodiments, at physiological pH the charge ratio of positive charges to negative charges in the RNA lipoplex particles is from about 1.6:2 to about 1:2, or about 1.6:2 to about 1.1:2. In specific embodiments, the charge ratio of positive charges to negative charges in the RNA lipoplex particles at physiological pH is about 1.6:2.0, about 1.5:2.0, about 1.4:2.0, about 1.3:2.0, about 1.2:2.0, about 1.1:2.0, or about 1:2.0.
Embodiments of Lipid nanooarticles fLNPsj
In some embodiments, RNA described herein is present in the form of lipid nanoparticles (LNPs). The LNP may comprise any lipid capable of forming a particle to which the one or more RNA molecules are attached, or in which the one or more RNA molecules are encapsulated.
LNPs typically comprise four components: cationically ionizable lipid, neutral lipids such as phospholipids, a steroid such as cholesterol, and a polymer-conjugated lipid such as PEG-lipid. LNPs may be prepared by mixing lipids dissolved in ethanol with RNA in an aqueous buffer.
In some embodiments, in the RNA LNPs described herein the RNA is bound by cationically ionizable lipid that occupies the central core of the LNP. Polymer-conjugated lipid forms the surface of the LNP, along with phospholipids. In some embodiments, the surface comprises a bilayer. In some embodiments, cholesterol and cationically ionizable lipid in charged and uncharged forms can be distributed throughout the LNP.
In some embodiments, the LNP comprises one or more cationically ionizable lipids, and one or more stabilizing lipids. Stabilizing lipids include neutral lipids and polymer-conjugated lipids.
In some embodiments, the LNP comprises a cationically ionizable lipid, a neutral lipid, a steroid, a polymer- conjugated lipid; and the RNA, encapsulated within or associated with the lipid nanoparticle.
In some embodiments, the LNP comprises from 40 to 60 mol percent, 40 to 55 mol percent, from 45 to 55 mol percent, or from 45 to 50 mol percent of the cationically ionizable lipid.
In some embodiments, the neutral lipid is present in a concentration ranging from 5 to 15 mol percent, from 7 to 13 mol percent, or from 9 to 11 mol percent.
In some embodiments, the steroid is present in a concentration ranging from 30 to 50 mol percent, from 30 to 45 mol percent, from 35 to 45 mol percent or from 35 to 43 mol percent.
In some embodiments, the LNP comprises from 1 to 10 mol percent, from 1 to 5 mol percent, or from 1 to 2.5 mol percent of the polymer-conjugated lipid.
In some embodiments, the LNP comprises from 45 to 55 mol percent of a cationically ionizable lipid; from 5 to 15 mol percent of a neutral lipid; from 30 to 45 mol percent of a steroid; from 1 to 5 mol percent of a polymer- conjugated lipid; and the RNA, encapsulated within or associated with the lipid nanoparticle.
In some embodiments, the mol percent is determined based on total mol of lipid present in the lipid nanoparticle. In some embodiments, the mol percent is determined based on total mol of cationically ionizable lipid, neutral lipid, steroid and polymer-conjugated lipid present in the lipid nanoparticle. In some embodiments, the neutral lipid is selected from the group consisting of DSPC, DPPC, DMPC, DOPC, POPC, DOPE, DOPG, DPPG, POPE, DPPE, DMPE, DSPE, and SM. In some embodiments, the neutral lipid is selected from the group consisting of DSPC, DPPC, DMPC, DOPC, POPC, DOPE and SM. In some embodiments, the neutral lipid is DSPC.
In some embodiments, the steroid is cholesterol.
In some embodiments, the polymer conjugated lipid is a pegylated lipid, e.g., a pegylated lipid as described above.
In some embodiments, the cationically ionizable lipid component of the LNPs has the structure of Formula (III):
(HI) or a pharmaceutically acceptable salt, tautomer, prodrug or stereoisomer thereof, wherein: one of L1 or L2 is -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)X-, -S-S-, -C(=O)S-, SC(=O)-, -NRaC(=O)-, -C(=O)NRa- , NRaC(=O)NRa-, -OC(=O)NRa- or -NRaC(=O)O-, and the other of L1 or L2 is -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, - S(O)X-, -S-S-, -C(=O)S-, SC(=O)-, -NRaC(=O)-, -C(=O)NRa-, NRaC(=O)NRa-, -OC(=O)NRa- or -NRaC(=O)O- or a direct bond;
G1 and G2 are each independently unsubstituted C1-C12 alkylene or C1-C12 alkenylene;
G3 is C1-C24 alkylene, C1-C24 alkenylene, C3-C8 cycloalkylene, C3-C8 cycloalkenylene;
Ra is H or C1-C12 alkyl;
R1 and R2 are each independently C6-C24 alkyl or C6-C24 alkenyl;
R3 is H, OR5, CN, -C(=O)OR4, -OC(=O)R4 or -NR5C(=O)R4;
R4 is C1-C12 alkyl;
R5 is H or Ci-Ce alkyl; and x is 0, 1 or 2.
In some of the foregoing embodiments of Formula (III), the lipid has one of the following structures (IIIA) or (IIIB): (IIIA) (IIIB) wherein:
A is a 3 to 8-membered cycloalkyl or cycloalkylene ring;
R5 is, at each occurrence, independently H, OH or C1-C24 alkyl; n is an integer ranging from 1 to 15.
In some of the foregoing embodiments of Formula (III), the lipid has structure (IIIA), and in other embodiments, the lipid has structure (IIIB).
In other embodiments of Formula (III), the lipid has one of the following structures (IIIC) or (HID): CHIC) (HID) wherein y and z are each independently integers ranging from 1 to 12.
In any of the foregoing embodiments of Formula (III), one of L1 or L2 is -O(C=O)-. For example, in some embodiments each of L1 and L2 are -O(C=O)-. In some different embodiments of any of the foregoing, L1 and L2 are each independently -(C=O)O- or -O(C=O)-. For example, in some embodiments each of L1 and L2 is -(C=O)O-. In some different embodiments of Formula (III), the lipid has one of the following structures (HIE) or (IIIF):
(HIE) (IIIF)
In some of the foregoing embodiments of Formula (III), the lipid has one of the following structures (IIIG), (IIIH),
(IIII), or (IIIJ):
(ini) (HU)
In some of the foregoing embodiments of Formula (III), n is an integer ranging from 2 to 12, for example from 2 to 8 or from 2 to 4. For example, in some embodiments, n is 3, 4, 5 or 6. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, n is 6.
In some other of the foregoing embodiments of Formula (III), y and z are each independently an integer ranging from 2 to 10. For example, in some embodiments, y and z are each independently an integer ranging from 4 to 9 or from 4 to 6.
In some of the foregoing embodiments of Formula (III), R5 is H. In other of the foregoing embodiments, R5 is Ci- C24 alkyl. In other embodiments, R5 is OH.
In some embodiments of Formula (III), G3 is unsubstituted. In other embodiments, G3 is substituted. In various different embodiments, G3 is linear C1-C24 alkylene or linear C1-C24 alkenylene.
In some other foregoing embodiments of Formula (III), R1 or R2, or both, is C6-C24 alkenyl. For example, in some embodiments, R1 and R2 each, independently have the following structure: wherein:
R7a and R7b are, at each occurrence, independently H or C1-C12 alkyl; and a is an integer from 2 to 12, wherein R7a, R7b and a are each selected such that R1 and R2 each independently comprise from 6 to 20 carbon atoms. For example, in some embodiments a is an integer ranging from 5 to 9 or from 8 to 12.
In some of the foregoing embodiments of Formula (III), at least one occurrence of R7a is H. For example, in some embodiments, R7a is H at each occurrence. In other different embodiments of the foregoing, at least one occurrence of R7b is Ci-Cs alkyl. For example, in some embodiments, C Cs alkyl is methyl, ethyl, n-propyl, iso-propyl, n-butyl, iso-butyl, tert-butyl, n-hexyl or n-octyl.
In different embodiments of Formula (III), R1 or R2, or both, has one of the following structures:
In some of the foregoing embodiments of Formula (III), R3 is OH, CN, -C(=O)OR4, -OC(=O)R4 or -NHC(=O)R4. In some embodiments, R4 is methyl or ethyl.
In various different embodiments, the cationic lipid of Formula (III) has one of the structures set forth in the table below. Table 6: Representative Compounds of Formula (III)
Table 7: Further representative cationically ionizable lipids
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid, e.g., a cationically ionizable lipid as shown above, a neutral lipid, a steroid, and a polymer conjugated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid of Formula III, a neutral lipid, a steroid, and a polymer conjugated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid shown in the above tables, a neutral lipid, a steroid, and a polymer conjugated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising 3D-P-DMA, a neutral lipid, a steroid, and a polymer conjugated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising ALC-0366, a neutral lipid, a steroid, and a polymer conjugated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising ALC-0315, a neutral lipid, a steroid, and a polymer conjugated lipid.
In some embodiments, the neutral lipid is DSPC. In some embodiments, the steroid is cholesterol. In some embodiments, the polymer conjugated lipid is a pegylated lipid, e.g., DMG-PEG 2000, PEG2000-C-DMA, or ALC-0159.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid, e.g., a cationically ionizable lipid as shown above, a neutral lipid, a steroid, and a pegylated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid of Formula III, a neutral lipid, a steroid, and a pegylated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid shown in the above tables, a neutral lipid, a steroid, and a pegylated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising 3D-P-DMA, a neutral lipid, a steroid, and a pegylated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising ALC-0366, a neutral lipid, a steroid, and a pegylated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising ALC-0315, a neutral lipid, a steroid, and a pegylated lipid. In some embodiments, the neutral lipid is DSPC. In some embodiments, the steroid is cholesterol. In some embodiments, the pegylated lipid is DMG-PEG 2000, PEG2000-C-DMA, or ALC-0159.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid, e.g., a cationically ionizable lipid as shown above, DSPC, cholesterol, and a pegylated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid of Formula III, DSPC, cholesterol, and a pegylated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid shown in the above tables, DSPC, cholesterol, and a pegylated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising 3D-P-DMA, DSPC, cholesterol, and a pegylated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising ALC-0366, DSPC, cholesterol, and a pegylated lipid.
In some embodiments, RNA described herein is formulated in an LNP composition comprising ALC-0315, DSPC, cholesterol, and a pegylated lipid.
In some embodiments, the pegylated lipid is DMG-PEG 2000, PEG2000-C-DMA, or ALC-0159.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid, e.g., a cationically ionizable lipid as shown above, DSPC, cholesterol, and DMG-PEG 2000.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid of Formula III, DSPC, cholesterol, and DMG-PEG 2000.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid shown in the above tables, DSPC, cholesterol, and DMG-PEG 2000.
In some embodiments, RNA described herein is formulated in an LNP composition comprising 3D-P-DMA, DSPC, cholesterol, and DMG-PEG 2000.
In some embodiments, RNA described herein is formulated in an LNP composition comprising ALC-0366, DSPC, cholesterol, and DMG-PEG 2000.
In some embodiments, RNA described herein is formulated in an LNP composition comprising ALC-0315, DSPC, cholesterol, and DMG-PEG 2000.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid, e.g., a cationically ionizable lipid as shown above, DSPC, cholesterol, and PEG2000-C-DMA.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid of Formula III, DSPC, cholesterol, and PEG2000-C-DMA. In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid shown in the above tables, DSPC, cholesterol, and PEG2000-C-DMA.
In some embodiments, RNA described herein is formulated in an LNP composition comprising 3D-P-DMA, DSPC, cholesterol, and PEG2000-C-DMA.
In some embodiments, RNA described herein is formulated in an LNP composition comprising ALC-0366, DSPC, cholesterol, and PEG2000-C-DMA.
In some embodiments, RNA described herein is formulated in an LNP composition comprising ALC-0315, DSPC, cholesterol, and PEG2000-C-DMA.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid, e.g., a cationically ionizable lipid as shown above, DSPC, cholesterol, and ALC-0159.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid of Formula III, DSPC, cholesterol, and ALC-0159.
In some embodiments, RNA described herein is formulated in an LNP composition comprising a cationically ionizable lipid shown in the above tables, DSPC, cholesterol, and ALC-0159.
In some embodiments, RNA described herein is formulated in an LNP composition comprising 3D-P-DMA, DSPC, cholesterol, and ALC-0159.
In some embodiments, RNA described herein is formulated in an LNP composition comprising ALC-0366, DSPC, cholesterol, and ALC-0159.
In some embodiments, RNA described herein is formulated in an LNP composition comprising ALC-0315, DSPC, cholesterol, and ALC-0159.
3D-P-DMA: (6Z,16Z)-12-((Z)-dec-4-en-l-yl)docosa-6,16-dien-ll-yl 5-(dimethylamino)pentanoate
ALC-0366: ((3-hydroxypropyl)azanediyl)bis(nonane-9,l-diyl) bis(2-butyloctanoate) ALC-0315: ((4-hydroxybutyl)azanediyl)bis(hexane-6,l-diyl)bis(2-hexyldecanoate) / 6-[N-6-(2- hexyldecanoyloxy)hexyl-N-(4-hydroxybutyl)amino]hexyl 2-hexyldecanoate
PEG2000-C-DMA: 3-N-[(co-Methoxy polyethylene glycol)2000) carbamoyl]-!., 2-dimyristyloxy-propylamine (MPEG-(2 kDa)-C-DMA or Methoxy-polyethylene glycol-2,3-bis(tetradecyloxy)propylcarbamate (2000)) wherein n has a mean value ranging from 30 to 60, such as about 50.
ALC-0159: 2-[(polyethylene glycol)-2000]-A(/y-ditetradecylacetamide / 2-[2-(co-methoxy (polyethyleneglycol2000) ethoxy]-N,N-ditetradecylacetamide
DSPC: l,2-Distearoyl-57?-glycero-3-phosphocholine
The N/P value is preferably at least about 4. In some embodiments, the N/P value ranges from 4 to 20, 4 to 12, 4 to 10, 4 to 8, or 5 to 7. In some embodiments, the N/P value is about 6.
Doses
The term "dose" as used herein refers in general to a "dose amount" which relates to the amount of RNA administered per administration, i.e., per dosing.
In some embodiments, administration of RNA of the present disclosure may be performed by single administration or boosted by multiple administrations.
In some embodiments, an amount the RNA described herein from 0.1 pg to 300 pg, 0.5 pg to 200 pg, or 1 pg to 100 pg, such as about 1 pg, about 3 pg, about 10 pg, about 30 pg, about 50 pg, or about 100 pg may be administered per dose.
In some embodiments, a regimen described herein includes at least one dose. In some embodiments, a regimen includes a first dose and at least one subsequent dose. In some embodiments, a regimen includes a first dose and two subsequent doses. In some embodiments, the first dose is the same amount as at least one subsequent dose. In some embodiments, the first dose is the same amount as all subsequent doses. In some embodiments, the first dose is a different amount as at least one subsequent dose. In some embodiments, the first dose is a different amount than all subsequent doses. In some embodiments, a regimen comprises two doses. In some embodiments, a regimen consists of two doses. In some embodiments, a regimen comprises three doses. In some embodiments, a regimen consists of three doses.
In one embodiment, the disclosure envisions administration of a single dose. In one embodiment, the disclosure envisions administration of a priming dose followed by one or more booster doses. The booster dose or the first booster dose may be administered 7 to 90 days, 14 to 60 days, or 30 to 60 days following administration of the priming dose. For example, the booster dose or the first booster dose may be administered about 56 days following administration of the priming dose. The second booster dose may be administered 120 to 270 days, or 150 to 210 days following administration of the priming dose. For example, the second booster dose may be administered about 180 days following administration of the priming dose.
In some embodiments, an amount of the RNA described herein of 60 pg or lower, 50 pg or lower, or 40 pg or lower may be administered per dose.
In some embodiments, an amount of the RNA described herein of at least 0.25 pg, at least 0.5 pg, at least 1 pg, at least 2 pg, at least 3 pg, at least 4 pg, at least 5 pg, at least 10 pg, at least 20 pg, at least 30 pg, or at least 40 pg may be administered per dose.
In some embodiments, an amount of the RNA described herein of 0.25 pg to 60 pg, 0.5 pg to 55 pg, 1 pg to 50 pg, 5 pg to 40 pg, or 10 pg to 30 pg may be administered per dose.
In some embodiments, a regimen administered to a subject may comprise a plurality of doses (e.g., at least two doses, at least three doses, or more). In some embodiments, a regimen administered to a subject may comprise a first dose and at least one further dose (e.g., a second or a second and a third dose), which doses are given at least 2 weeks apart, at least 3 weeks apart, at least 4 weeks apart, or more. In some embodiments, such doses may be at least 1 month, at least 2 months, at least 3 months, at least 4 months, at least 5 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, at least 12 months, or more apart. In some embodiments, doses may be administered days apart, such as 1, 2, 3, 4, 5, 6, 7, 8, 9 ,10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60 or more days apart. In some embodiments, doses may be administered about 1 to about 3 weeks apart, or about 1 to about 4 weeks apart, or about 1 to about 5 weeks apart, or about 1 to about 6 weeks apart, or about 1 to more than 6 weeks apart. In some embodiments, a minimum number of days between doses may be about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 or more.
In some embodiments, a first dose and a second dose (and/or other subsequent doses) may be administered by intramuscular injection. In some embodiments, a first dose and a second dose (and/or other subsequent doses) may be administered in the deltoid muscle. In some embodiments, a first dose and a second dose (and/or other subsequent doses) may be administered in the same arm. In some embodiments, an mRNA composition described herein is administered (e.g., by intramuscular injection) as a series of three doses. In some embodiments, each dose is about 30 pg. In some embodiments, each dose is about 10 pg. In some embodiments, each dose is about 3 pg. In some embodiments, each dose is about 1 pg.
In some such embodiments, an mRNA composition described herein is administered to subjects of age 12 or older. In some such embodiments, an mRNA composition described herein is administered to subjects of age 5 to 11. In some such embodiments, an mRNA composition described herein is administered to subjects of age 2 to less than 5. In some such embodiments, an mRNA composition described herein is administered to subjects of age 12 or older and each dose is about 30 ug. In some such embodiments, an mRNA composition described herein is administered to subjects of age 5 to 11 and each dose is about 10 ug. In some such embodiments, an mRNA composition described herein is administered to subjects of age 2 to less than 5 and each dose is about 3 pg.
Compositions comprising nucleic acid
A composition comprising one or more RNAs described herein, e.g., in the form of RNA particles, may comprise salts, buffers, or other components as further described below.
In some embodiments, a salt for use in the compositions described herein comprises sodium chloride. Without wishing to be bound by theory, sodium chloride functions as an ionic osmolality agent for preconditioning RNA prior to mixing with lipids. In some embodiments, the compositions described herein may comprise alternative organic or inorganic salts. Alternative salts include, without limitation, potassium chloride, dipotassium phosphate, monopotassium phosphate, potassium acetate, potassium bicarbonate, potassium sulfate, disodium phosphate, monosodium phosphate, sodium acetate, sodium bicarbonate, sodium sulfate, lithium chloride, magnesium chloride, magnesium phosphate, calcium chloride, and sodium salts of ethylenediaminetetraacetic acid (EDTA).
Generally, compositions for storing RNA particles such as for freezing RNA particles comprise low sodium chloride concentrations, or comprises a low ionic strength. In some embodiments, the sodium chloride is at a concentration from 0 mM to about 50 mM, from 0 mM to about 40 mM, or from about 10 mM to about 50 mM.
According to the present disclosure, the RNA particle compositions described herein have a pH suitable for the stability of the RNA particles and, in particular, for the stability of the RNA. Without wishing to be bound by theory, the use of a buffer system maintains the pH of the particle compositions described herein during manufacturing, storage and use of the compositions. In some embodiments of the present disclosure, the buffer system may comprise a solvent (in particular, water, such as deionized water, in particular water for injection) and a buffering substance. The buffering substance may be selected from 2-[4-(2-hydroxyethyl)piperazin-l-yl]ethanesulfonic acid (HEPES), 2-amino-2-(hydroxymethyl)propane-l,3-diol (Tris), acetate, and histidine. In some embodiments, the buffering substance is HEPES. In some embodiments, the buffering substance is Tris.
Compositions (in particular, RNA compositions/formulations) described herein may also comprise a cryoprotectant and/or a surfactant as stabilizer to avoid substantial loss of the product quality and, in particular, substantial loss of RNA activity during storage, freezing, and/or lyophilization, for example to reduce or prevent aggregation, particle collapse, RNA degradation and/or other types of damage.
In some embodiments, the cryoprotectant is a carbohydrate. The term "carbohydrate", as used herein, refers to and encompasses monosaccharides, disaccharides, trisaccharides, oligosaccharides and polysaccharides.
In some embodiments, the cryoprotectant is a monosaccharide. The term "monosaccharide", as used herein refers to a single carbohydrate unit e.g, a simple sugar) that cannot be hydrolyzed to simpler carbohydrate units. Exemplary monosaccharide cryoprotectants include glucose, fructose, galactose, xylose, ribose and the like. In some embodiments, the cryoprotectant is a disaccharide. The term "disaccharide", as used herein refers to a compound or a chemical moiety formed by 2 monosaccharide units that are bonded together through a glycosidic linkage, for example through 1-4 linkages or 1-6 linkages. A disaccharide may be hydrolyzed into two monosaccharides. Exemplary disaccharide cryoprotectants include sucrose, trehalose, lactose, maltose and the like. In some embodiments, the cryoprotectant is sucrose.
The term "trisaccharide" means three sugars linked together to form one molecule. Examples of a trisaccharides include raffinose and melezitose.
In some embodiments, the cryoprotectant is an oligosaccharide. The term "oligosaccharide", as used herein refers to a compound or a chemical moiety formed by 3 to about 15, such as 3 to about 10 monosaccharide units that are bonded together through glycosidic linkages, for example through 1-4 linkages or 1-6 linkages, to form a linear, branched or cyclic structure. Exemplary oligosaccharide cryoprotectants include cyclodextrins, raffinose, melezitose, maltotriose, stachyose, acarbose, and the like. An oligosaccharide can be oxidized or reduced.
In an embodiment, the cryoprotectant is a cyclic oligosaccharide. The term "cyclic oligosaccharide", as used herein refers to a compound or a chemical moiety formed by 3 to about 15, such as 6, 7, 8, 9, or 10 monosaccharide units that are bonded together through glycosidic linkages, for example through 1-4 linkages or 1-6 linkages, to form a cyclic structure. Exemplary cyclic oligosaccharide cryoprotectants include cyclic oligosaccharides that are discrete compounds, such as a cyclodextrin, p cyclodextrin, or y cyclodextrin.
Other exemplary cyclic oligosaccharide cryoprotectants include compounds which include a cyclodextrin moiety in a larger molecular structure, such as a polymer that contains a cyclic oligosaccharide moiety. A cyclic oligosaccharide can be oxidized or reduced, for example, oxidized to dicarbonyl forms. The term "cyclodextrin moiety", as used herein refers to cyclodextrin e.g, an a, , or y cyclodextrin) radical that is incorporated into, or a part of, a larger molecular structure, such as a polymer. A cyclodextrin moiety can be bonded to one or more other moieties directly, or through an optional linker. A cyclodextrin moiety can be oxidized or reduced, for example, oxidized to dicarbonyl forms.
Carbohydrate cryoprotectants, e.g, cyclic oligosaccharide cryoprotectants, can be derivatized carbohydrates. For example, in an embodiment, the cryoprotectant is a derivatized cyclic oligosaccharide, e.g., a derivatized cyclodextrin, e.g, 2-hydroxypropyl-p-cyclodextrin, e.g, partially etherified cyclodextrins (e.g., partially etherified p cyclodextrins).
An exemplary cryoprotectant is a polysaccharide. The term "polysaccharide", as used herein refers to a compound or a chemical moiety formed by at least 16 monosaccharide units that are bonded together through glycosidic linkages, for example through 1-4 linkages or 1-6 linkages, to form a linear, branched or cyclic structure, and includes polymers that comprise polysaccharides as part of their backbone structure. In backbones, the polysaccharide can be linear or cyclic. Exemplary polysaccharide cryoprotectants include glycogen, amylase, cellulose, dextran, maltodextrin and the like.
In some embodiments, RNA particle compositions may include sucrose. Without wishing to be bound by theory, sucrose functions to promote cryoprotection of the compositions, thereby preventing RNA (especially mRNA) particle aggregation and maintaining chemical and physical stability of the composition. In some embodiments, RNA particle compositions may include alternative cryoprotectants to sucrose. Alternative stabilizers include, without limitation, trehalose and glucose. In a specific embodiment, an alternative stabilizer to sucrose is trehalose or a mixture of sucrose and trehalose.
A preferred cryoprotectant is selected from the group consisting of sucrose, trehalose, glucose, and a combination thereof, such as a combination of sucrose and trehalose. In a preferred embodiment, the cryoprotectant is sucrose.
Some embodiments of the present disclosure contemplate the use of a chelating agent in an RNA composition described herein. Chelating agents refer to chemical compounds that are capable of forming at least two coordinate covalent bonds with a metal ion, thereby generating a stable, water-soluble complex. Without wishing to be bound by theory, chelating agents reduce the concentration of free divalent ions, which may otherwise induce accelerated RNA degradation in the present disclosure. Examples of suitable chelating agents include, without limitation, ethylenediaminetetraacetic acid (EDTA), a salt of EDTA, desferrioxamine B, deferoxamine, dithiocarb sodium, penicillamine, pentetate calcium, a sodium salt of pentetic acid, succimer, trientine, nitrilotriacetic acid, transdiaminocyclohexanetetraacetic acid (DCTA), diethylenetriaminepentaacetic acid (DTPA), and bis(aminoethyl)glycolether-N,N,N',N'-tetraacetic acid. In some embodiments, the chelating agent is EDTA or a salt of EDTA. In some embodiments, the chelating agent is EDTA disodium dihydrate. In some embodiments, the EDTA is at a concentration from about 0.05 mM to about 5 mM, from about 0.1 mM to about 2.5 mM or from about 0.25 mM to about 1 mM.
In an alternative embodiment, the RNA particle compositions described herein do not comprise a chelating agent.
Pharmaceutical compositions
The agents described herein may be administered in pharmaceutical compositions or medicaments and may be administered in the form of any suitable pharmaceutical composition. In some embodiments, the pharmaceutical composition is for therapeutic or prophylactic treatments, e.g., for use in treating or preventing a disease involving an antigen, in particular tuberculosis.
The term "pharmaceutical composition" relates to a composition comprising a therapeutically effective agent, preferably together with pharmaceutically acceptable carriers, diluents and/or excipients. Said pharmaceutical composition is useful for treating, preventing, or reducing the severity of a disease by administration of said pharmaceutical composition to a subject.
The pharmaceutical compositions of the present disclosure may comprise one or more adjuvants or may be administered with one or more adjuvants. The term "adjuvant" relates to a compound which prolongs, enhances or accelerates an immune response. Adjuvants comprise a heterogeneous group of compounds such as oil emulsions (e.g., Freund's adjuvants), mineral compounds (such as alum), bacterial products (such as Bordetella pertussis toxin), or immune-stimulating complexes. Examples of adjuvants include, without limitation, LPS, GP96, CpG oligodeoxynucleotides, growth factors, and cytokines, such as monokines, lymphokines, interleukins, chemokines. The chemokines may be IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-12, INFa, INF-y, GM-CSF, LT-a. Further known adjuvants are aluminum hydroxide, Freund's adjuvant or oil such as Montanide® ISA51. Other suitable adjuvants for use in the present disclosure include lipopeptides, such as Pam3Cys, as well as lipophilic components, such as saponins, trehalose-6,6-dibehenate (TDB), monophosphoryl lipid-A (MPL), monomycoloyl glycerol (MMG), or glucopyranosyl lipid adjuvant (GLA).
The pharmaceutical compositions of the present disclosure may be in a storable form (e.g., in a frozen or lyophilized/freeze-dried form) or in a "ready-to-use form" (Ze., in a form which can be immediately administered to a subject, e.g, without any processing such as diluting). Thus, prior to administration of a storable form of a pharmaceutical composition, this storable form has to be processed or transferred into a ready-to-use or administrable form. E.g, a frozen pharmaceutical composition has to be thawed, or a freeze-dried pharmaceutical composition has to be reconstituted, e.g. by using a suitable solvent (e.g, deionized water, such as water for injection) or liquid e.g, an aqueous solution).
The pharmaceutical compositions according to the present disclosure are generally applied in a "pharmaceutically effective amount" and in "a pharmaceutically acceptable preparation".
The term "pharmaceutically acceptable" refers to the non-toxicity of a material which does not interact with the action of the active component of the pharmaceutical composition.
The term "pharmaceutically effective amount" refers to the amount which achieves a desired reaction or a desired effect alone or together with further doses. In some embodiments relating to the treatment of a particular disease, the desired reaction may relate to inhibition of the course of the disease. This comprises slowing down the progress of the disease and, in some embodiments, interrupting or reversing the progress of the disease. The desired reaction in a treatment of a disease may also be delay of the onset or a prevention of the onset of said disease or said condition, or symptoms thereof. An effective amount of the pharmaceutical compositions described herein will depend on the condition to be treated, the severeness of the disease, the individual parameters of the patient, including age, physiological condition, size and weight, the duration of treatment, the type of an accompanying therapy (if present), the specific route of administration and similar factors. Accordingly, the doses administered of the pharmaceutical compositions described herein may depend on various of such parameters. In the case that a reaction in a patient is insufficient with an initial dose, higher doses (or effectively higher doses achieved by a different, more localized route of administration) may be used.
The pharmaceutical compositions of the present disclosure may contain buffers, preservatives, and optionally other therapeutic agents. In some embodiments, the pharmaceutical compositions of the present disclosure comprise one or more pharmaceutically acceptable carriers, diluents and/or excipients.
Suitable preservatives for use in the pharmaceutical compositions of the present disclosure include, without limitation, benzalkonium chloride, chlorobutanol, paraben and thimerosal.
The term "excipient" as used herein refers to a substance which may be present in a pharmaceutical composition of the present disclosure but is not an active ingredient. Examples of excipients, include without limitation, carriers, binders, diluents, lubricants, thickeners, surface active agents, preservatives, stabilizers, emulsifiers, buffers, flavoring agents, or colorants The term "diluent" relates a diluting and/or thinning agent. Moreover, the term "diluent" includes any one or more of fluid, liquid or solid suspension and/or mixing media. Examples of suitable diluents include ethanol, glycerol and water.
The term "carrier" refers to a component which may be natural, synthetic, organic, inorganic in which the active component is combined in order to facilitate, enhance or enable administration of the pharmaceutical composition. A carrier as used herein may be one or more compatible solid or liquid fillers, diluents or encapsulating substances, which are suitable for administration to subject. Suitable carriers include, without limitation, sterile water, Ringer, Ringer lactate, sterile sodium chloride solution, isotonic saline, polyalkylene glycols, hydrogenated naphthalenes and, in particular, biocompatible lactide polymers, lactide/glycolide copolymers or polyoxyethylene/polyoxy- propylene copolymers. In some embodiments, the pharmaceutical composition of the present disclosure includes isotonic saline.
Pharmaceutically acceptable carriers, excipients or diluents for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remington's Pharmaceutical Sciences, Mack Publishing Co. (A. R Gennaro edit. 1985).
Pharmaceutical carriers, excipients or diluents can be selected with regard to the intended route of administration and standard pharmaceutical practice.
Routes of administration of pharmaceutical compositions
In some embodiments, the pharmaceutical compositions described herein may be administered intravenously, intraarterially, subcutaneously, intradermally, dermally, intranodally, or intramuscularly. In some embodiments, the pharmaceutical compositions described herein may be administered intramuscularly. In some embodiments, the pharmaceutical composition is formulated for local administration or systemic administration. Systemic administration may include enteral administration, which involves absorption through the gastrointestinal tract, or parenteral administration. As used herein, "parenteral administration" refers to the administration in any manner other than through the gastrointestinal tract, such as by intravenous injection. In some embodiments, the pharmaceutical compositions are formulated for systemic administration. In some embodiments, the systemic administration is by intravenous administration. In some embodiments, the pharmaceutical compositions are formulated for intramuscular administration.
In some embodiments, intramuscular administration comprises administration into the upper arm, in particular into the musculus deltoideus. If more than one dose, e.g., three doses, of a pharmaceutical composition described herein is administered, the different administrations may be into the same arm.
Use of compositions
Compositions described herein may be used in the therapeutic or prophylactic treatment of diseases wherein provision of one or more peptides or polypeptides, i.e., vaccine antigens, described herein to a subject results in a therapeutic or prophylactic effect. In some embodiments, the disease is infection with Mycobacterium tuberculosis. In some embodiments, the disease is tuberculosis.
The term "disease" (also referred to as "disorder" herein) refers to an abnormal condition that affects the body of an individual. A disease is often construed as a medical condition associated with specific symptoms and signs. A disease may be caused by factors originally from an external source, such as infectious disease, or it may be caused by internal dysfunctions, such as autoimmune diseases. In humans, "disease" is often used more broadly to refer to any condition that causes pain, dysfunction, distress, social problems, or death to the individual afflicted, or similar problems for those in contact with the individual. In this broader sense, it sometimes includes injuries, disabilities, disorders, syndromes, infections, isolated symptoms, deviant behaviors, and atypical variations of structure and function, while in other contexts and for other purposes these may be considered distinguishable categories. Diseases usually affect individuals not only physically, but also emotionally, as contracting and living with many diseases can alter one's perspective on life, and one's personality.
The term "disease involving an antigen" refers to any disease which implicates an antigen, e.g. a disease which is characterized by the presence of an antigen. The disease involving an antigen can be an infectious disease. The antigen may be a disease-associated antigen, such as a bacterial antigen. In some embodiments, a disease involving an antigen is a disease involving cells comprising and/or expressing an antigen, and preferably presenting the antigen on the cell surface, e.g., in the context of MHC.
The term "infectious disease" refers to any disease which can be transmitted from individual to individual or from organism to organism, and is caused by a microbial agent (e.g. common cold). Infectious diseases are known in the art and include, for example, a viral disease, a bacterial disease, or a parasitic disease, which diseases are caused by a virus, a bacterium, and a parasite, respectively. In this regard, the infectious disease can be, for example, hepatitis, sexually transmitted diseases (e.g. chlamydia or gonorrhea), tuberculosis, HIV/acquired immune deficiency syndrome (AIDS), diphtheria, hepatitis B, hepatitis C, cholera, severe acute respiratory syndrome (SARS), the bird flu, and influenza.
In the present context, the term "treatment", "treating" or "therapeutic intervention" relates to the management and care of a subject for the purpose of combating a condition such as a disease. The term is intended to include the full spectrum of treatments for a given condition from which the subject is suffering, such as administration of the therapeutically effective compound to alleviate the symptoms or complications, to delay the progression of the disease, disorder or condition, to alleviate or relief the symptoms and complications, and/or to cure or eliminate the disease, disorder or condition as well as to prevent the condition, wherein prevention is to be understood as the management and care of an individual for the purpose of combating the disease, condition or disorder and includes the administration of the active compounds to prevent the onset of the symptoms or complications.
The term "therapeutic treatment" relates to any treatment which improves the health status and/or prolongs (increases) the lifespan of an individual. Said treatment may eliminate the disease in an individual, arrest or slow the development of a disease in an individual, inhibit or slow the development of a disease in an individual, decrease the frequency or severity of symptoms in an individual, and/or decrease the recurrence in an individual who currently has or who previously has had a disease. The terms "prophylactic treatment" or "preventive treatment" relate to any treatment that is intended to prevent a disease from occurring in an individual. The terms "prophylactic treatment" or "preventive treatment" are used herein interchangeably.
The terms "individual" and "subject" are used herein interchangeably. They refer to a human or another mammal e.g, mouse, rat, rabbit, dog, cat, cattle, swine, sheep, horse or primate), or any other non-mammal-animal, including birds (chicken), fish or any other animal species that can be afflicted with or is susceptible to a disease e.g, cancer, infectious diseases) but may or may not have the disease, or may have a need for prophylactic intervention such as vaccination, or may have a need for interventions such as by protein replacement. In many embodiments, the individual is a human being. Unless otherwise stated, the terms "individual" and "subject" do not denote a particular age, and thus encompass adults, elderlies, children, and newborns. In some embodiments of the present disclosure, the "individual" or "subject" is a "patient". In some embodiments, the terms "individual" and "subject" relate to pregnant women and immunocompromised persons.
The term "patient" means an individual or subject for treatment, in particular a diseased individual or subject.
RNA described herein may be administered to a subject for delivering the RNA to cells of the subject.
RNA described herein may be administered to a subject for delivering a therapeutic or prophylactic peptide or polypeptide (e.g., a pharmaceutically active peptide or polypeptide) to the subject, wherein the RNA encodes a therapeutic or prophylactic peptide or polypeptide.
RNA described herein may be administered to a subject for treating or preventing a disease in a subject, wherein delivering the RNA to cells of the subject is beneficial in treating or preventing the disease.
RNA described herein may be administered to a subject for treating or preventing a disease in a subject, wherein the RNA encodes a therapeutic or prophylactic peptide or polypeptide and wherein delivering the therapeutic or prophylactic peptide or polypeptide to the subject is beneficial in treating or preventing the disease.
In some embodiments of the disclosure, the aim is to induce an immune response by providing RNA described herein.
A person skilled in the art will know that one of the principles of immunotherapy and vaccination is based on the fact that an immunoprotective reaction to a disease is produced by immunizing a subject with an antigen or an epitope, which is immunologically relevant with respect to the disease to be treated. Accordingly, RNA described herein is applicable for inducing or enhancing an immune response. RNA described herein is thus useful in a prophylactic and/or therapeutic treatment of a disease involving an antigen or epitope.
In some embodiments of the disclosure, the aim is to provide an immune response against cells comprising an antigen, e.g., Mtb antigen.
In some embodiments of the disclosure, the aim is to prophylactically or therapeutically treat tuberculosis by vaccination. Due to the high degree of sequence conservation of the disclosed antigens between different Mycobacterium species, including Mycobacterium tuberculosis, Mycobacterium bovis, Mycobacterium caprae, Mycobacterium orygis, Mycobacterium africanum, Mycobacterium microti, Mycobacterium canetti and Mycobacterium pinnipedii, exposure of a subject to Mycobacterium tuberculosis antigens will result in a high degree of cross-reactivity with antigens of other Mycobacterium species. Therefore, a vaccine based on or directed at Mycobacterium tuberculosis antigens will elicit a robust immune response against other Mycobacterium species, in particular Mycobacterium bovis, Mycobacterium caprae, Mycobacterium orygis, Mycobacterium africanum, Mycobacterium microti, Mycobacterium canetti and Mycobacterium pinnipedii as well.
In some embodiments of the disclosure, the aim is to provide an immune response against a Mycobacterium selected from Mycobacterium tuberculosis, Mycobacterium bovis, Mycobacterium caprae, Mycobacterium orygis, Mycobacterium africanum, Mycobacterium microti, Mycobacterium canetti and Mycobacterium pinnipedii and to prevent or treat tuberculosis.
In preferred embodiments of the disclosure, the aim is to provide an immune response against Mycobacterium tuberculosis.
In some embodiments of the disclosure, the aim is to treat an infection with Mycobacterium tuberculosis.
In some embodiments of the disclosure, the aim is to prevent or treat disease symptoms caused by an infection with Mycobacterium tuberculosis.
In some embodiments of the disclosure, the aim is to provide protection against an infection with Mycobacterium tuberculosis by vaccination.
In some embodiments of the disclosure, the aim is to provide protection against an outbreak of disease in a subject infected with Mycobacterium tuberculosis. In some embodiments of the disclosure, the aim is to provide protection against symptoms of tuberculosis in a subjected infected with Mycobacterium tuberculosis.
In some embodiments, the RNA is present in a composition as described herein.
In some embodiments, the RNA is administered in a pharmaceutically effective amount.
In some embodiments, the subject is a mammal. In some embodiments, the mammal is a human.
In some embodiments, the subject treated had been exposed to Mycobacterium tuberculosis. In some embodiments, the subject treated had not been exposed to Mycobacterium tuberculosis.
In some embodiments, the treatments described herein involve pre- or post-exposure vaccination against Mycobacterium tuberculosis, or a combination thereof.
Citation of documents and studies referenced herein is not intended as an admission that any of the foregoing is pertinent prior art. All statements as to the contents of these documents are based on the information available to the applicants and do not constitute any admission as to the correctness of the contents of these documents. The description (including the following examples) is presented to enable a person of ordinary skill in the art to make and use the various embodiments. Descriptions of specific devices, techniques, and applications are provided only as examples. Various modifications to the examples described herein will be readily apparent to those of ordinary skill in the art, and the general principles defined herein may be applied to other examples and applications without departing from the spirit and scope of the various embodiments. Thus, the various embodiments are not intended to be limited to the examples described herein and shown, but are to be accorded the scope consistent with the claims.
Examples Example 1: Constructs
Fifteen antigens were selected as primary targets for the chimeric protein design based on different properties, as shown in table 8.
Table 8: Antigen properties Legend to table 8: * = Rvl792 is a pseudogene Mycobacterium tuberculosis H37Rv, because of a point mutation that introduces a stop codon. This mutation is also present in all other Mtb strains belonging to the lineages L2, L3 and L4. However, the protein is produced and functional in ancestral Mtb strains and is found to be actively involved in dissemination of infection for Mycobacterium tuberculosis lineage 1 strains (Described in Saelens et al. 2022, Cell, https://doi.Org/10.1016/j.cell.2022.10.019). # = This also includes an extended version of the sequence that is 101 amino acids long because it utilizes a start codon 6bp upstream of the annotated start codon: MHVSFVMAYPEMLAAAADTLQSIGATTVASNAAAAAPTTGWPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLAS SASSYAATEVANAAAAS (SEQ ID NO: 4).
To design chimeric proteins that would elicit optimal immune response, a computational pipeline was developed that incorporates: 1) Optimizing selection of antigen fragments that cover more conserved regions with abundant predicted epitopes. 2) Avoiding generation of a chimeric protein that could yield human self-antigen epitopes. 3) Optionally optimizing antigen coverage relative to chimeric protein length. 4) Selecting the optimal junctions of fragments based on the predicted edges of epitopes.
Regions of target antigens with relatively high immunogenicity were selected based on predicted epitopes that overlap with amino acid positions of said regions along the sequence of the target antigen. For predicted epitopes, the accumulation of start and end sites of epitopes along sequence of target antigen was also considered, to inform selection of fragments that cover sufficiently the whole length of epitopes. To avoid generation of self-reactive epitopes, each target antigen was screened for sequence overlaps of 8 amino acids (shortest amino acid sequence length that can be presented by class I HLA) against human proteome. Fragment selection was restricted so that selected fragments contain equal or less than 2 amino acids within human proteome 8 amino acid overlap.
After fragment selection, an N-terminal secretion signal (sequence: MGGAAARLGAVILFWIVGLHGVRG, from human herpesvirus 1 gD - SEQ ID NO: 19) and a C-terminal transmembrane domain and trafficking signal derived from human HLA class I (sequence IVGIVAGLAVLAVWIGAVVATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA - SEQ ID NO: 52) were added to facilitate better T cell immune response, and GS-linkers (sequence: GGSGGGGSGG - SEQ ID NO: 56) were inserted between selected target antigen fragments/full-length antigens to allow better cleavage and release of target antigen fragments/full-length antigens.
After the chimeric protein sequences were created with additional secretion signal, transmembrane trafficking domain and linkers, the resulting amino acid sequences were screened again in terms of overlaps with human proteome, to avoid generation of self-reactive junctional epitopes. If 8 sequential amino acids from strings were found to overlap with the human proteome, equal or less than 2 amino acids from selected target antigen fragment were allowed within the overlap, otherwise the start or end site of the target antigen fragment were adjusted until the chimeric protein fit the criteria.
An overview of the bioinformatic data guiding antigen selection and the design of the chimeric proteins is shown in Figures 1 to 11.
Exemplary chimeric proteins designed based on the above criteria are depicted in Figures 12 to 18. All antigen-encoding mRNA sequences are fused at the N-terminus to a signal peptide fragment (sec), which mediates translocation of the cell translated antigen into the endoplasmic reticulum. The constructs also comprise a transmembrane domain (also referred to as TMD) and/or a trafficking signal at the C-terminus. Some constructs comprise an MHC class I transmembrane and cytoplasmic domain (MITD) included in their respective antigen C-termini. MITD is a cell trafficking-signal for cell membrane anchoring of the translated protein and induction of endocytosis of the translated protein to optimize T cell responses. Strings 1, 2, 3, 4, 5, 6, 7, 8 and 9 were generated with MITD. Some constructs comprise a TMD that is derived from HSV. Strings 4, 5, 6 and 7 were also generated with a HSV-derived TMD. Further, string 4 was generated in a third version comprising an different viral TMD.
"String 1" is a chimeric protein comprising antigens or antigen fragments of Wbbll, PPE18 and PE13 (Figure 12).
"String 2" is a chimeric protein comprising antigens or antigen fragments of EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW (Figure 13).
"String 3" is a chimeric protein comprising antigens or antigen fragments of EsxB, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW (Figure 14).
"String 4" is a chimeric protein comprising antigens or antigen fragments of PE13, PPE18, Esxl, EsxJ, EsxN and EsxW (Figure 15).
"String 5" is a chimeric protein comprising antigens or antigen fragments of PE13, PPE18, EsxG, EsxJ, and EsxW (Figure 16).
"String 6" is a chimeric protein comprising antigens or antigen fragments of PE13, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW (Figure 17).
"String 7" is a chimeric protein comprising antigens or antigen fragments of PE13, EsxA, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW (Figure 18).
"String 8" is a chimeric protein comprising antigens or antigen fragments of PE13, Esxl, EsxJ, EsxN and EsxW.
"String 9" is a chimeric protein comprising antigens or antigen fragments of PE13, PPE18, Esxl, EsxJ, EsxN and EsxW.
In addition to the sequence encoding the chimeric proteins (i.e., the open reading frame [ORF]), each RNA construct contains common structural elements optimized for maximal RNA stability and translational efficiency (5'-cap, 5'-untranslated region [UTR], 3'-UTR, and poly(A)-tail). The cap at the 5'-end of the RNA is a so-called capO (selfamplifying mRNA and unmodified mRNA; [m27'2' °GppspG]) or capl structure (nucleoside-modified mRNA; [rr^7'3 - °Gppp(mi2' 0) ApG]).
Example 2: Proteomics analysis
RNA molecules encoding chimeric proteins are evaluated on expression as measured by mass spectrometry (MS), followed up by epitope presentation as measured by MS HLA ligandomics. The RNAs are transfected into a mammalian cell line in the presence and absence of a proteasome inhibitor, and relative expression is evaluated by measuring the abundance of peptides derived uniquely from each RNA-encoded full-length antigen or antigen fragment following a trypsin digestion. Heavy-isotopically labeled tryptic peptides are used to confirm the identity and assist with quantification of the targeted tryptic peptides. Because the turnover rate of the chimeric proteins can be very high compared to the abundance of encoded protein, the proteasome inhibitor is used to block degradation of the protein and measure the accumulated protein synthesized during a given timeframe. By comparing the amount of protein with and without the proteasome inhibitor, protein turnover can be quantified. Measuring the turnover is beneficial since proteins must be degraded in order for class I HLA presentation to occur. The obtained data confirms the chimeric proteins to be robustly expressed and to exhibit a suitable turnover rate.
In addition, the RNA molecules encoding the chimeric proteins are transfected into a A375 cell line stably expressing an affinity-tagged construct of a single HLA allele. The affinity tag is used to enrich that single allele from the background of the endogenous A375 alleles in order to detect epitopes encoded in the transfected RNA molecules bound to that particular allele. MS analysis can occur in one of two modes: 1) targeted MS, using heavy-isotope labeled peptides to specifically target predicted RNA-encoded epitopes with high sensitivity, and 2) discovery MS, which uses an unbiased sampling of all epitopes present in the sample, including epitopes that may be encoded in the transfected RNAs. These HLA ligandomics datasets confirm processing and presentation of RNA-encoded antigens onto human MHCs.
Example 3: Mass-soectrometric verification of in vitro expression of different strings.
RNA encoding the exemplary chimeric protein string 1 depicted in Figure 12A was transfected into HEK293T cells in the presence or absence of proteasome inhibitor MG132. Following lysis, total protein content was normalized, cysteines were reduced and alkylated, and proteins were subjected to tryptic digestion. The samples were analyzed by targeted and discovery MS to look for tryptic peptides derived uniquely from the transfected RNAs. The peptides AGWLSVYVPSAEVLHHK (SEQ ID NO: 69) and LLPTGANLGYGTAVNR (SEQ ID NO: 70) derived from Wbbll, and ALPLTSLTSAAER (SEQ ID NO: 71) and GFAPAAAAQAVQTAAQNGVR (SEQ ID NO: 72) derived from PPE18, were synthesized as heavy peptides. The position of these peptides on the sequence of the exemplary chimeric protein is depicted in Figure 19A. Using the signal of the heavy peptides as a benchmark for detection, their counterparts could all be detected in the total trypsinated lysate from transfected, but not from non-transfected cells. As shown in Figure 19B, all the peptides were detected. Furthermore, the peptides were detected in higher quantities when cells were treated with MG132 proteasome inhibitor. This indicates that these constructs are most-likely subject to a high turnover rate which is considered advantageous for T cell epitope processing.
RNAs encoding chimeric proteins string 2 or string 3 depicted in Figure 13A and 14A were transfected into HEK293T cells in the presence (Light grey bars) of absence (Dark grey bars) of proteasome inhibitor MG132. Following lysis, total protein content was normalized, cysteines were reduced and alkylated, and proteins were subjected to tryptic digestion. The samples were analyzed by targeted and discovery MS to look for tryptic peptides derived uniquely from the transfected RNA strings. The indicated peptides were synthesized as heavy peptides and their counterparts could all be detected in the total trypsinated lysate from transfected, but not from non-transfected cells. The peptide AQAASLEAEHQAIVR (SEQ ID NO: 73) is derived from EsxN; NFQVIYEQANAHGQK (SEQ ID NO: 74) is derived from Esxl; GAAGTAAQAAVVR (SEQ ID NO: 75) is derived from EsxB and is therefore only detected in the string encoding this antigen. The position of these peptides on the sequence of the exemplary chimeric protein string is depicted in Figure 20A. As shown in Figure 20B, all the peptides were detected in the respective strings. No clear differences were seen in samples with or without proteasome inhibitor added, which may suggest that the proteins are relatively stable or turned over by non-proteasome dependent processes. Example 4: HLA liqandomics of the chimeric protein strings.
RNA encoding the exemplary chimeric protein string 1 (Figure 12A), string 2 (Figure 13A) or string 3 (Figure 14A) was transfected into A375 cells stably expressing an affinity-tagged version of either HLA-B*07:02, HLA-A*02:01, HLA-C*03:04, or HLA-A*24:02. Following lysis, tagged HLA molecules were labeled with biotin and enriched on NeutrAvidin beads. Following washing, peptides were eluted from HLA complexes using acid and filtered through molecular weight cutoff filters. Cysteines were reduced and alkylated, and peptides were cleaned up by C18 desalting. Heavy-isotope labeled synthetic peptides were spiked into each sample, and targeted and discovery MS was performed to look for epitope peptides derived uniquely from transfected mRNA constructs. In addition, samples were prepared from A375 cell lines expressing HLA-B*07:02, HLA-A*02:01, HLA-C*03:04, and HLA- A*24:02 in the same manner described above, except during desalting, peptides were fractionated at basic pH into 3 fractions on an SDB-XC column. These samples were analyzed solely by discovery MS to further increase the depth of identified epitopes from the transfected RNAs. The different detected peptides are depicted in the visual representation of the strings (Figures 21A, 22A, 23A) as well as in the table depicting their exact sequence (Figures 21B, 22B, 23B). The detected epitopes were derived from different parts of all of the respective strings, indicating that the whole constructs have the potential to be processed and presented on human HLA molecules.
Example 5: In vivo immunogenicity testing
The RNA-constructs are formulated in lipid nano-particles and between 1.0 and 4.0 pg of formulated RNA is used to immunize five C57BI/6 mice. As a control group, mice are injected with a 0.9% saline solution. lOOpI of blood is collected 21 days after the primary immunization and mice are boosted with a second dose of formulated RNA. 14 days after the boost (35 days after the primary injection) the animals are sacrificed and blood is collected as well as the spleen of the animals. Serum, obtained from the bloodletting at d21 and at the time of sacrifice is assessed for the presence of antibodies by developing ELISA 's with the help of overlapping peptide libraries and/or recombinant proteins of the antigens. The spleens are used to isolate splenocytes. Splenocytes are additionally pooled per experimental group and CD4+ and CD8+ splenocytes are separated by antibody labeling followed by Magnetic associated cell sorting (MACS). These CD4+ and CD8+ pooled fractions are analyzed by fluorospot identically to the total unpooled splenocytes.
Splenocytes are analyzed for protein production by fluorospot analysis. To this end, precoated plates are washed with PBS and incubated for 30 minutes in growth medium containing 10% fetal calf serum or an appropriate alternative. 5*105 splenocytes are added to each well in combinations with peptide libraries or appropriate positive and negative controls covering the individual antigen fragments/full-length antigens of each string. The peptide libraries consist of 15 amino acid long peptides with a 5 amino acid interval. In other words, the first peptide covers amino acid 1-15 of the antigen and the second peptide covers amino acids 16-20, and so forth. After incubation with the peptide libraries the cells are removed from the well and plates are washed five times with 200 pl PBS. Plates are then stained with primary detection antibodies against murine IL-2, IFNy and TNFo diluted in PBS containing 0.1% BSA, during two hours in the dark at 4°C. Afterwards, cells are washed 5 times with 200 and pl PBS and incubated for 1 hour with fluorophore labeled secondary antibodies. After this, plates are washed 5 times again with PBS and incubated for 30 minutes with 50 pl fluorescence enhancer. After this, the plates are emptied and dried in a dark place before measuring the fluorescence in three channels using a FluoroSpot plate reader. Example 6: Immunogenicity of the chimeric protein in C57BI/6 mice.
Adult female C57BI/6 mice were immunized with 4pg of RNA encoding string 1 (Figure 12A), string 2 (Figure 13A) or string 3 (Figure 14A), as described in example 5. The RNA was formulated in a lipid nanoparticle formulation (in 20pl of volume), or with 0.9% NaCI solution as a control. 21 days after the primary immunization the mice were boosted with the same dose. 14 days after the boosting dose (35 days post primary immunization) mice were sacrificed and splenocytes were isolated and analyzed as described in Example 5. In addition, a portion of the splenocytes was pooled and separated into CD4+ and CD8+ fractions by magnetic associated cell-sorting (MACS). Both the total splenocytes and the CD4+ and CD8+ fractions were assessed for T cell reactogenicity by restimulation with overlapping 15-mer peptide pools specific for individual antigens or antigen fragments or parts of antigen fragments of the strings. The peptide libraries consist of 15 amino acid long peptides with a 5 amino acid interval. In other words, the first peptide will cover amino acid 1-15 of the antigen and the second peptide will cover amino acids 16-20, and so forth. Fluorospot was used as a read-out to determine IFNy, IL-2 and TNFa production.
String 1: As shown in Figure 24, all antigens and antigen fragments analyzed were found to be immunogenic above baseline, confirming that the approach was successful in inducing immunogenicity of multiple different antigens simultaneously. The strongest responses in total splenocytes were detected against the N terminus of Wbbll and the three antigen fragments encoding different domains of PPE18. Analysis of MACS 'ed cells, shown in Figure 24A, B and C, right columns, reveals that the N terminus of Wbbll (Wbbll_l) is highly immunogenic as measured by both CD4+ and CD8+ responses. In contrast both PE13 antigen fragments and PPE18_1 and PPE18_3 antigen fragments are predominantly immunogenic in CD4+ cells whereas PPE18_2 is predominantly immunogenic in CD8+ cells. In addition, splenocytes from mice mock-immunized with 0.9% NaCI were pooled and restimulated in technical triplicates (datapoint in the figure) to assess background reactivity of the tested peptide pools. As shown in Figure 24D, none of the peptides induced signals above that of a unrelated control peptide (trpl).
These results clearly show that the approach described herein can be used to induce both CD4+ and CD8+ T cell responses, depending on the antigen and the genetic background of the immunized subject. Furthermore, each of the tested antigen fragments and antigens was immunogenic, resulting in robust immune activation against several stages of Mtb infection and, thereby, validating the approaches of antigen and fragment selection as well as vaccination with RNA encoding the chimeric proteins described herein.
Stings 2 and 3: All antigens and antigen fragments analyzed were found to be immunogenic above baseline (Figure 25). As expected, no signal could be detected for EsxB in string 2 (which does not encode EsxB). Splenocytes from mice mock-immunized with 0.9% NaCI were pooled and restimulated in technical triplicates (datapoint in the figure) to assess background reactivity of the tested peptide pools. None of the peptides induced signals above that of a unrelated control peptide (trpl) (Figure 25). The above results confirm that the antigen string approach was successful and specific in inducing immunogenicity of multiple different antigens simultaneously. Analysis of MACS 'ed cells reveals that strings can induce potent CD4+ and CD8+ responses depending on the antigen used. Whereas EsxB, Esxl, EsxJ, EsxN and EsxW induced predominantly high CD4+ responses EsxG induced similar levels of CD4+ and CD8+ cells producing IFNy and EsxH induced predominantly CD8+ responses, but CD4+ responses as well. Example 7: Immunogenicity of the chimeric proteins in human H LA-transgenic mice
The same experiment as described in example 6 with C57BI/6 mice is performed in a transgenic mouse model expressing human HLA-A2.1 and HLA-DR1, while being deficient of their endogenous murine MHC-I and MHC-II molecules (Pajot, Michel, et al., 2004; Pajot, Pancre, et al., 2004). The T cell responses are assessed by fluorospot analysis of peptide-stimulated splenocytes in the same way as described for the C57BI/6 mice. In particular, the IFNy T cell responses against string 1 (Fig. 26 A and B), string 2 (Fig 26 C and D) and string 3 (Fig. 26 E and F) were assessed by fluorospot analysis of peptide-stimulated full splenocytes, as well as isolated CD4+ or CD8+ T cells. Overall immunogenicity of all strings tested was confirmed in the human HLA- transgenic mouse model. String 2 and 3 demonstrated comparable IFNy patterns, yet lower levels compared to the previous study in C57BI/6 mice. In contrast, PE13_1 and Wbbll_2 from string 1 induced higher levels of IFNy, which shows that these antigens and antigen fragments have the capacity to be immunogenic, and that the low immunogenicity in C57BL/6 mice was likely due to MHC restriction. Inversely, the other chimeric proteins were less immunogenic than seen before in full splenocytes from C57BI/6 mice. Cytokine secretion in CD4+ or CD8+ T cells clearly confirmed the presence of predicted immunodominant epitopes for human HLA e.g. for Wbbll_2 and Wbbll_3 being dominant CD8+ T cell antigens, or EsxN and EsxW predominantly activating CD4+ T cells. Together, these data confirm the capacity of the individual building blocks of the chimeric proteins to be presented on human HLA-molecules and induce T cell responses in wVo in multiple different MHC/HLA backgrounds.
Example 8: In vivo immunogenicity testing of a string combining antigens from previous strings modified with different transmembrane domains
Selected antigens and antigen fragments from string 1 and 2 were combined into a novel string (string 4) to confirm antigenicity of the antigens independently of position in the string and the presence of other antigens. This string contains the antigens and antigen fragments of PE13_1, PE13_2, PPE18_1, PPE18_2, PPE18_3, Esxl, EsxJ, EsxN and EsxW (Figure 15A). The string was modified by the MITD sequence to induce optimal T cell responses as described above, but in parallel was also tested with two other transmembrane-trafficking domain alternatives of viral origin (Tml (being derived from HSV) and Tm2). These three constructs were individually encoded on modRNA and LNP-formulated as described above. Immunogenicity was assessed in C57BI/6 mice as described in example 6. Overall strong immune responses in the form of either IFNy, IL-2, or TNFo were observed for most of the antigens tested (Figure 27). Especially strong IFNy responses were found against PPE18_2. IL-2 responses were strong against PE_13_2, PPE18_1, PPE18_3 Esxl and EsxN. TNFo responses mostly mirrored those of IL-2, but with more variability. Low, but slightly above baseline responses were seen for all antigens including the smaller fragments like EsxJ and PE13_1. Direct comparison of the MITD sequence with the alternative sequences Tml and Tm2 does not show a clear advantage of any of these sequences over the other indicating the versatility of the antigen cassette to be compatible with different trafficking or transmembrane domains. In the CD4+ or CD8+ MACS separated T cells similar responses were observed compared to the total splenocytes. PPE18_2 was particularly able to induce high IFNy production in CD8+ T cells possible explaining the high responses against this antigen fragment in the total splenocytes. The other antigens had a more balanced or CD4 dominated response. Also in this part of the experiment, the three different transmembrane domains induced similar levels of responses in both the CD4+ and CD8+ compartments. Example 9: Immunogenicity of antigens after BCG vaccination.
For certain vaccines it has been found that efficiency is improved in case they elicit de novo immune responses. It is possible, that in many countries, a mRNA vaccine against tuberculosis may be combined with M. bovis BCG vaccination or be administered to individuals previously vaccinated with BCG. There have been reports that boosting BCG with de novo antigens is more efficient compared to boosting with antigens that also elicit an immune response after BCG vaccination (e.g. Woodworth et al. 2021 https://www.nature.com/articles/s41467-021-26934-0). In certain settings it may be advantageous to boost existing responses and in other settings it may be better to induce de novo responses compared to BCG vaccination. To better understand which antigens would boost BCG responses and which antigens would elicit de novo responses in BCG vaccinated individuals, 5 C57BL/6 mice were subcutaneously immunized with l*105 CFU M. bovis BCG Copenhagen. 35 days after vaccination the mice were sacrificed and splenocytes and CD4+ and CD8+ T cells were obtained and tested for cytokine production in response to the peptide libraries used to assess the T cell strings by fluorospot as described in example 5. As can be seen in Figure 28, above baseline IFNy responses were found in CD4+ T cells for PPE18_1, and EsxG, whereas BCG induced relatively high levels of EsxH-reactive CD8+ T cells (Figure 28A). The IL-2 (Figure 28B) and TNFo (Figure 28C) production were more variable, but followed similar trends in the CD4+ compartment. Also in the total splenocytes BCG vaccination induced immune responses mainly against PPE18_1, EsxG and EsxH (Figure 28D).
Example 10: Testing immunodominance of EsxG and EsxH.
Including antigens which are highly immunogenic in a wide range of HLA-backgrounds can be a good basis for vaccine design. However, one potential drawback can be that immunodominance of one antigen might lead to reduced responses to other antigens. EsxG and EsxH were identified as strongly immunogenic antigens and a large amount of peptides from EsxG was found HLA-ligandomics studies. These antigens have also been described to be immunodominant in C57BL/6 mice in other studies. Thus, the effect of including these antigens on immunogenicity of the other antigens on a string are assessed. Two strings were designed to compare to string 6. The first of these strings is identical to string 6 except that EsxG and EsxH are omitted (string 8). Since this results in a smaller RNA overall and a higher expression of the smaller string could be possible, additionally a version of string 5 that replaces EsxG and EsxH with PPE18_2 and PPE18_3, which together are almost identical in size (total antigen length would differ by only 6 amino acids), was designed (string 9). These strings are tested head-to-head for immunogenicity in C57BL/6 mice es described in example 5. In parallel, the expression of individual parts of the antigens in the string is verified by Mass spectrometry as described in examples 2 and 3.
Example 11: Visualizing IEDB and liqandomics-derived epitope hits along with string inclusion across antigens.
The antigen and antigen fragment sequences used in the strings were compared with compiled data on epitopes proven to be immunogenic in humans from the immune epitope database (IEDB). In this respect, each of the antigens that were used in a string was analyzed with a specific plot detailing the IEDB and ligandomics epitopes identified above along with their corresponding HLA alleles, as discussed below.
The antigen reference sequence (shown partially or completely at the bottom of Figures 29-38) from the H37Rv reference strain was used to map all the epitopes shown. Except for certain antigens (listed below), all of the antigens or antigen fragments have four subplots (labeled A-D) described below in the top-to-bottom order. A. The topmost subplot shows the total number of times that the corresponding epitope has been listed across multiple HLA alleles and studies in IEDB, and therefore is a measure of the immunogenicity of the corresponding region of the antigen.
B. Underneath, the "IEDB HLA alleles" heatmap shows the number of times any particular HLA allele shown has been listed as being immunogenic together with an epitope in IEDB.
C. Similar to the "IEDB HLA alleles" heatmap, this "Ligandomics HLA alleles" heatmap highlights the number of times that the corresponding HLA class I allele was identified as presenting any ligandomics epitope.
D. In the last subplot, the heatmap shows which region of the antigen has been used in one of the designed strings listed. For antigens which have been used as antigen fragments these plots can be used to see whether this affects regions of known immunogenicity.
As can be seen in Figures 32 and 36, antigens ESXB and ESXJ did not have any ligandomics hits (i.e. there is no subplot C), while Figure 31 shows that antigen WBBL1 does not have any IEDB hits listed (i.e. there is no subplot B). Therefore, the subplots corresponding to these missing information are not included for these antigens.
Together this dataset gives a rich overview of the immunogenicity of the particular regions of the antigens and antigen fragments included in the constructs described here in the human population and confirm that the selected antigens and antigen fragments will be antigenic in a H LA-diverse population.
Example 12: String variations
String 10 and String 10R are generated as a variation of string 5 (MITD) to optimize signal peptide cleavage, antigen-chunk composition and localization to induce improved antigenicity of the constructs. Similarly Strings 11 and String 11_R are iterations of String 6 (MITD) and Strings 12 and String 12_R are iterations of String 7 (MITD). Chunk PE13_2 is consistently placed as the first chunk of these strings, based on its predicted suitability to be combined with the HSV-gDl signal peptide for optimal processing and secretion. The other chunks are separated when they are derived from the same antigen with at least 1 chunk from another antigen in between to reduce the chance of functional folding of protein chunks. Each string 10 to 12 was also generated with a reversed order of all chunks except for PE13_2 and the N-terminal and C-terminal backbone components HSV-gDl and MITD. These constructs are tested for overall expression by different methods, including LC-MS proteomics after transfection of RNA in eukaryotic cells. Peptide presentation by antigen presenting cells after transfection with these RNAs is measured for selected individual chunks by either proteomic analysis after immunoprecipitation of recombinantly expressed HLA-molecules or by recognition of lymphocytes transfected with recombinant T-cell receptors in vitro. Immunogenicity of the strings is assessed by vaccination of mice with two or three doses of LNP-formulated RNA followed by assessment of T-cell responses to each individual chunk, by restimulation of splenocytes with specific overlapping peptide libraries. Follow-up experiments establish immunogenicity in combination with other mRNA constructs.

Claims

Claims
1. RNA molecule encoding a chimeric protein comprising T cell epitopes of three or more different Mycobacterium tuberculosis antigens or immunogenic variants thereof, wherein the chimeric protein comprises one or more antigen fragments, wherein at least one Mycobacterium tuberculosis antigen or immunogenic variant thereof is represented by one or more antigen fragments and the remaining Mycobacterium tuberculosis antigens or immunogenic variants thereof are represented by one or more antigen fragments and/or one or more full-length antigens, wherein each antigen fragment or full-length antigen comprises one or more T cell epitopes, and wherein each antigen fragment or full-length antigen is separated from other antigen fragments or full- length antigens in the chimeric protein by a polypeptide linker.
2. The RNA molecule of claim 1, wherein the chimeric protein comprises T cell epitopes of four or more different Mycobacterium tuberculosis antigens.
3. The RNA molecule of claim 1, wherein the chimeric protein comprises T cell epitopes of five or more different Mycobacterium tuberculosis antigens.
4. The RNA molecule of claim 1, wherein the chimeric protein comprises T cell epitopes of six or more different Mycobacterium tuberculosis antigens.
5. The RNA molecule of claim 1, wherein the chimeric protein comprises T cell epitopes of seven or more different Mycobacterium tuberculosis antigens.
6. The RNA molecule of any one of claims 1 to 5, wherein the Mycobacterium tuberculosis antigens are selected from the group of Wbbll, PPE18, PE13, EsxA, EsxB, EsxG, EsxH, Esxl, Esxl, EsxK, EsxL, EsxM, EsxN, EsxV and EsxW.
7. The RNA molecule of claim 6, wherein: p) the Wbbll antigen comprises the amino acid sequence of SEQ ID NO: 1 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 1; q) the PPE18 antigen comprises the amino acid sequence of SEQ ID NO: 2 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 2; r) the PE13 antigen comprises the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO: 4 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO: 4; s) the EsxA antigen comprises the amino acid sequence of SEQ ID NO: 5 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 5; t) the EsxB antigen comprises the amino acid sequence of SEQ ID NO: 6 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 6; u) the EsxG antigen comprises the amino acid sequence of SEQ ID NO: 7 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 7; v) the EsxH antigen comprises the amino acid sequence of SEQ ID NO: 8 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 8; w) the Esxl antigen comprises the amino acid sequence of SEQ ID NO: 9 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 9; x) the Esxl antigen comprises the amino acid sequence of SEQ ID NO: 10 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 10; y) the EsxK antigen comprises the amino acid sequence of SEQ ID NO: 11 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 11; z) the EsxL antigen comprises the amino acid sequence of SEQ ID NO: 12 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 12; aa) the EsxM antigen comprises the amino acid sequence of SEQ ID NO: 13 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 13; bb) the EsxN antigen comprises the amino acid sequence of SEQ ID NO: 14 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 14; cc) the EsxV antigen comprises the amino acid sequence of SEQ ID NO: 15 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 15; and/or dd) the EsxW antigen comprises the amino acid sequence of SEQ ID NO: 16 and an immunogenic variant thereof has an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 16.
8. The RNA molecule of claim 6 or 7, wherein the Mycobacterium tuberculosis antigens comprise Wbbll, PPE18 and PE13.
9. The RNA molecule of claim 8, wherein the chimeric protein comprises: d) a first and a second antigen fragment of PE13; e) a first, a second and a third antigen fragment of PPE18; and f) a full-length antigen of WbbLl.
10. The RNA molecule of claim 9, wherein: f) the first antigen fragment of PE13 comprises the amino acid sequence of positions 1 to 27 of SEQ ID NO: 3 or an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 1 to 27 of SEQ ID NO: 3; g) the second antigen fragment of PE13 comprises the amino acid sequence of positions 39 to 99 of SEQ ID NO: 3 or an amino acid sequence having at least 98%, 96%, 94%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 39 to 99 of SEQ ID NO: 3; h) the first antigen fragment of PPE18 comprises the amino acid sequence of positions 1 to 155 of SEQ ID NO: 2 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 1 to 155 of SEQ ID NO: 2; i) the second antigen fragment of PPE18 comprises the amino acid sequence of positions 186 to 296 of SEQ ID NO: 2 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 186 to 296 of SEQ ID NO: 2; and/or j) the third antigen fragment of PPE18 comprises the amino acid sequence of positions 303 to 391 of SEQ ID NO: 2 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 303 to 391 of SEQ ID NO: 2.
11. The RNA molecule of claim 9 or 10, wherein the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: first antigen fragment of PE13 - linker - third antigen fragment of PPE18 - linker - full-length antigen of Wbbll - linker - second antigen fragment of PPE18 - linker - second antigen fragment of PE13 - linker - first antigen fragment of PPE18.
12. The RNA molecule of claim 6 or 7, wherein the Mycobacterium tuberculosis antigens comprise EsxG, EsxH, Esxl, EsxJ, EsxN, and EsxW.
13. The RNA molecule of claim 12, wherein the Mycobacterium tuberculosis antigens additionally comprise EsxB.
14. The RNA molecule of claim 12, wherein the chimeric protein comprises: g) a full-length antigen of EsxG; h) a full-length antigen of EsxH; i) a full-length antigen of Esxl; j) an antigen fragment of EsxJ; k) a full-length antigen of EsxN; and l) a full-length antigen of EsxW.
15. The RNA molecule of claim 13, wherein the chimeric protein additionally comprises: h) an antigen fragment of EsxB i) a full-length antigen of EsxG; j) a full-length antigen of EsxH; k) a full-length antigen of Esxl; l) an antigen fragment of EsxJ; m) a full-length antigen of EsxN; and n) a full-length antigen of EsxW.
16. The RNA molecule of any one of claims 14 or 15, wherein: c) the antigen fragment of EsxB comprises the amino acid sequence of positions 1 to 87 of SEQ ID NO: 6 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 1 to 87 of SEQ ID NO: 6; and/or d) the antigen fragment of EsxJ comprises the amino acid sequence of positions 1 to 14 of SEQ ID NO: 10 or an amino acid sequence having at least 93%, 86% or 79% identity to the amino acid sequence of positions 1 to 14 of SEQ ID NO: 10.
17. The RNA molecule of claim 14 or 16, wherein the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: c) full-length antigen of EsxG - linker - full-length antigen of EsxH - linker - full-length antigen of Esxl - linker - antigen fragment of EsxJ - linker - full-length antigen of EsxN - linker - full-length antigen of EsxW; or d) full-length antigen of EsxG - linker - full-length antigen of Esxl - linker - full-length antigen of EsxH - linker - antigen fragment of EsxJ - linker - full-length antigen of EsxN - linker - full- length antigen of EsxW.
18. The RNA molecule of claim 15 or 16, wherein the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: c) antigen fragment of EsxB - linker - full-length antigen of EsxG - linker - full-length antigen of EsxH - linker - full-length antigen of Esxl - linker - antigen fragment of EsxJ - linker - full-length antigen of EsxN - linker - full-length antigen of EsxW; or d) antigen fragment of EsxB - linker - full-length antigen of EsxG - linker - full-length antigen of Esxl - linker - full-length antigen of EsxH - linker - antigen fragment of EsxJ - linker - full-length antigen of EsxN - linker - full-length antigen of EsxW.
19. The RNA molecule of claim 6 or 7, wherein the Mycobacterium tuberculosis antigens comprise PE13 and two or more antigens selected from PPE18, EsxW, EsxJ, EsxG, Esxl, EsxN, EsxH and EsxA.
20. The RNA molecule of claim 19, wherein the Mycobacterium tuberculosis antigens comprise h) PE13, PPE18, Esxl, EsxJ, EsxN and EsxW; i) PE13, PPE18, EsxG, EsxJ, and EsxW; j) PE13, PPE18, EsxG, Esxl, and EsxN k) PE13, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW; l) PE13, EsxA, EsxG, EsxH, Esxl, EsxJ, EsxN and EsxW; m) PE13, Esxl, EsxJ, EsxN and EsxW; or n) PE13, PPE18, Esxl, EsxJ, EsxN and EsxW.
21. The RNA molecule of claim 19 or 20, wherein the chimeric protein comprises: g) a first and a second antigen fragment of PE13; h) a first, a second and a third antigen fragment of PPE18; i) a full-length antigen of Esxl; j) an antigen fragment of EsxJ; k) an antigen fragment of EsxN; and l) a full-length antigen of EsxW.
22. The RNA molecule of claim 19 or 20, wherein the chimeric protein comprises: f) a first and a second antigen fragment of PE13; g) a first, a second and a third antigen fragment of PPE18; h) a full-length antigen of EsxG; i) an antigen fragment of EsxJ; and j) a full-length antigen of EsxW.
23. The RNA molecule of claim 19 or 20, wherein the chimeric protein comprises: a) a first and a second antigen fragment of PE13; b) a first, a second and a third antigen fragment of PPE18; c) a full-length antigen of EsxG; d) an antigen fragment of Esxl; and e) a full-length antigen of EsxN.
24. The RNA molecule of claim 19 or 20, wherein the chimeric protein comprises: h) a first and a second antigen fragment of PE13; i) a full-length antigen of EsxG; j) a full-length antigen of EsxH; k) a full-length antigen of Esxl; l) an antigen fragment of EsxJ; m) an antigen fragment of EsxN; and n) a full-length antigen of EsxW.
25. The RNA molecule of claim 19 or 20, wherein the chimeric protein comprises: i) a first and a second antigen fragment of PE13; j) a first and a second antigen fragment of EsxA; k) a full-length antigen of EsxG; l) a full-length antigen of EsxH: m) a full-length antigen of Esxl; n) an antigen fragment of EsxJ; o) an antigen fragment of EsxN; and p) a full-length antigen of EsxW.
26. The RNA molecule of claim 19 or 20, wherein the chimeric protein comprises: f) a first and a second antigen fragment of PE13; g) a full-length antigen of Esxl; h) an antigen fragment of EsxJ; i) an antigen fragment of EsxN; and j) a full-length antigen of EsxW.
27. The RNA molecule of claim 19 or 20, wherein the chimeric protein comprises: g) a first and a second antigen fragment of PE13; h) a second and a third antigen fragment of PPE18; i) a full-length antigen of Esxl; j) an antigen fragment of EsxJ; k) an antigen fragment of EsxN; and l) a full-length antigen of EsxW.
28. The RNA molecule of any one of claims 21 to 27, wherein: j) the first antigen fragment of PE13 comprises the amino acid sequence of positions 1 to 27 of SEQ ID NO: 3 or an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 1 to 27 of SEQ ID NO: 3; or the first antigen fragment of PE13 comprises the amino acid sequence of positions 1 to 29 of SEQ ID NO: 4 or an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 1 to 29 of SEQ ID NO: 4; k) the second antigen fragment of PE13 comprises the amino acid sequence of positions 39 to 97 of SEQ ID NO: 3 or an amino acid sequence having at least 98%, 96%, 94%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 39 to 97 of SEQ ID NO: 3; or the second antigen fragment of PE13 comprises the amino acid sequence of positions 41 to 99 of SEQ ID NO: 4 or an amino acid sequence having at least 98%, 96%, 94%, 92%, 88%, 84% or 80% identity to the amino acid sequence of positions 41 to 99 of SEQ ID NO: 4; l) the first antigen fragment of PPE18 comprises the amino acid sequence of positions 1 to 155 of SEQ ID NO: 2 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 1 to 155 of SEQ ID NO: 2; m) the second antigen fragment of PPE18 comprises the amino acid sequence of positions 186 to 296 of SEQ ID NO: 2 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 186 to 296 of SEQ ID NO: 2; n) the third antigen fragment of PPE18 comprises the amino acid sequence of positions 303 to 391 of SEQ ID NO: 2 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 303 to 391 of SEQ ID NO: 2; o) the first antigen fragment of EsxA comprises the amino acid sequence of positions 1 to 35 of SEQ ID NO: 5 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 1 to 35 of SEQ ID NO: 5; p) the second antigen fragment of EsxA comprises the amino acid sequence of positions 26 to 81 of SEQ ID NO: 5 or an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of positions 26 to 81 of SEQ ID NO: 5; q) the antigen fragment of EsxJ comprises the amino acid sequence of positions 1 to 14 of SEQ ID NO: 10 or an amino acid sequence having at least 93%, 86% or 79% identity to the amino acid sequence of positions 1 to 14 of SEQ ID NO: 10 and/or r) the antigen fragment of EsxN comprises the amino acid sequence of positions 10 to 67 of SEQ ID NO: 14 or an amino acid sequence having at least 93%, 86% or 79% identity to the amino acid sequence of positions 10 to 67 of SEQ ID NO: 14.
29. RNA molecule of claim 21 or 28, wherein the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: first antigen fragment of PE13 - linker - third antigen fragment of PPE18 - linker - full-length antigen of EsxW - linker - antigen fragment of EsxJ - linker - second antigen fragment of PPE18 - linker - second antigen fragment of PE13 - linker - first antigen fragment of PPE18 - linker - full-length antigen of Esxl - linker - antigen fragment of EsxN.
30. RNA molecule of claim 22 or 28, wherein the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: first antigen fragment of PE13 - linker - third antigen fragment of PPE18 - linker - full-length antigen of EsxW - linker - full-length antigen of EsxG - linker - second antigen fragment of PE13 - linker - second antigen fragment of PPE18 - linker - antigen fragment of EsxJ - linker - first antigen fragment of PPE18.
31. RNA molecule of claim 23 or 28, wherein the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: a) second antigen fragment of PE13 - linker - third antigen fragment of PPE18 - linker - antigen fragment of EsxN - linker - full-length antigen of EsxG - linker - first antigen fragment of PE13 - linker - second antigen fragment of PPE18 - linker - full-length antigen of Esxl - linker - first antigen fragment of PPE18; or b) second antigen fragment of PE13 - linker - first antigen fragment of PPE18 - linker - full-length antigen of Esxl - linker - second antigen fragment of PPE18 - linker - first antigen fragment of PE13 - linker - full-length antigen of EsxG - linker - antigen fragment of EsxN - linker - third antigen fragment of PPE18.
32. RNA molecule of claim 24 or 28, wherein the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: a) first antigen fragment of PE13 - linker - full-length antigen of EsxW - linker - full-length antigen of EsxG - linker - second antigen fragment of PE13 - linker - full-length antigen of Esxl - linker - antigen fragment of EsxN - linker - antigen fragment of EsxJ - linker - full-length antigen of EsxH; b) second antigen fragment of PE13 - linker - full-length antigen of EsxW - linker - full-length antigen of EsxG - linker - first antigen fragment of PE13 - linker - full-length antigen of Esxl - linker - antigen fragment of EsxN - linker - antigen fragment of EsxJ - linker - full-length antigen of EsxH; or c) second antigen fragment of PE13 - linker - full-length antigen of EsxH - linker - antigen fragment of EsxJ - linker - antigen fragment of EsxN - linker - full-length antigen of Esxl - linker - first antigen fragment of PE13 - linker - full-length antigen of EsxG - linker - full-length antigen of EsxW.
33. RNA molecule of claim 25 or 28, wherein the full-length antigens and antigen fragments in the chimeric protein are arranged in the following order: a) first antigen fragment of PE13 - linker - full-length antigen of EsxW - linker - full-length antigen of EsxG - linker - second antigen fragment of EsxA - linker - second antigen fragment of PE13 - linker - full-length antigen of Esxl - linker - first antigen fragment of EsxA - linker - antigen fragment of EsxN - linker - antigen fragment of EsxJ - linker - full-length antigen of EsxH; b) second antigen fragment of PE13 - linker - full-length antigen of EsxW - linker - full-length antigen of EsxG - linker - second antigen fragment of EsxA - linker - first antigen fragment of PE13 - linker - full-length antigen of Esxl - linker - first antigen fragment of EsxA - linker - antigen fragment of EsxN - linker - antigen fragment of EsxJ - linker - full-length antigen of EsxH; or c) second antigen fragment of PE13 - linker - full-length antigen of EsxH - linker - antigen fragment of EsxJ - linker - antigen fragment of EsxN - linker - first antigen fragment of EsxA - linker - full-length antigen of Esxl - linker - first antigen fragment of PE13 - linker - second antigen fragment of EsxA - linker - full-length antigen of EsxG - linker - full-length antigen of EsxW.
34. The RNA molecule of any one of claims 1 to 33, wherein one or more of the polypeptide linkers comprises one or more glycine and/or one or more serine amino acid.
35. The RNA molecule of any one of claim 1 to 34, wherein one or more of the polypeptide linkers is at least 1, at least 5 or at least 10 amino acids in length.
36. The RNA molecule of any one of claims 1 to 35, wherein one or more of the polypeptide linkers has the amino acid sequence of SEQ ID NO: 56.
37. The RNA molecule of any one of claims 1 to 36, wherein the chimeric protein comprises a non-native signal peptide at its N-terminus.
38. The RNA molecule of claim 37, wherein the non-native signal peptide is a human, bacterial or viral signal peptide.
39. The RNA molecule of claim 38, wherein the non-native signal peptide comprises a secretory signal.
40. The RNA molecule of claim 38 or 39, wherein the non-native signal peptide is functional in mammalian cells.
41. The RNA molecule of any one of claims 38 to 40, wherein the non-native signal peptide comprises an amino acid sequence selected from the group of SEQ ID NOs: 17 to 37 or 65, an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to SEQ ID NOs: 17 to 37 or 65, an amino acid sequence encoded by a nucleotide sequence selected from the group of SEQ ID NOs: 38 to 51, or an amino acid sequence having at least 96%, 92%, 88%, 84% or 80% identity to amino acid sequences encoded by a nucleotide sequence selected from the group of SEQ ID NOs: 38 to 51.
42. The RNA molecule of any one of claims 38 to 41, wherein the non-native signal peptide is a viral signal peptide.
43. The RNA molecule of claim 42, wherein the non-native signal peptide is a HSV-1 glycoprotein D signal peptide.
44. The RNA molecule of any one of claims 1 to 43, wherein the chimeric protein comprises a non-native transmembrane domain at its C-terminus.
45. The RNA molecule of any one of claim 44, wherein the non-native transmembrane domain is a human, bacterial or viral transmembrane domain.
46. The RNA molecule of claim 44 or 45, wherein the non-native transmembrane domain comprises a trafficking domain.
47. The RNA molecule of claim 46, wherein non-native trafficking domain is an MHC class I trafficking domain.
48. The RNA molecule of claim 47, wherein the MHC class I trafficking domain comprises the amino acid sequence of SEQ ID NO: 52 or an amino acid sequence having at least 98%, 96%, 90%, or 80% identity to the amino acid sequence of SEQ ID NO: 52.
49. The RNA molecule of claim 45, wherein the non-native transmembrane domain is a viral transmembrane domain.
50. The RNA molecule of claim 49, wherein the non-native transmembrane domain is derived from HSV.
51. The RNA molecule of any one of claims 1 to 50, wherein the RNA molecule comprises a 5' cap.
52. The RNA molecule of claim 51, wherein the 5' cap comprises a capl structure.
53. The RNA molecule of claim 51, wherein the 5'-cap comprises m27'3 -OGppp(mi2' °)ApG.
54. The RNA molecule of any one of claims 1 to 53, wherein the RNA molecule comprises a 5'-UTR.
55. The RNA molecule of claim 54, wherein the 5'-UTR comprises a modified human alpha-globin 5'-UTR.
56. The RNA molecule of claim 54 or 55, wherein the 5'-UTR comprises the nucleotide sequence of SEQ ID
NO: 53, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 53.
57. The RNA molecule of any one of claims 1 to 56, wherein the RNA comprises a 3'-UTR.
58. The RNA molecule of claim 57, wherein the 3'-UTR comprises a first sequence from the amino terminal enhancer of split (AES) messenger RNA and a second sequence from the mitochondrial encoded 12S ribosomal RNA.
59. The RNA molecule of claim 57 or 58, wherein the 3'-UTR comprises the nucleotide sequence of SEQ ID
NO: 54, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 54.
60. The RNA molecule of any one of claims 1 to 59, wherein the RNA molecule comprises a polyA sequence.
61. The RNA molecule of claim 60, wherein the polyA sequence is an interrupted sequence of A nucleotides.
62. The RNA molecule of claim 60 or 61, wherein the polyA sequence comprises 30 adenine nucleotides followed by 70 adenine nucleotides, wherein the 30 adenine nucleotides and 70 adenine nucleotides are separated by a nucleotide linker sequence of 10 nucleotides.
63. The RNA molecule of any one of claims 60 to 62, wherein the polyA sequence comprises the nucleotide sequence of SEQ ID NO: 55, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 55.
64. The RNA molecule of any one of claims 60 to 63, wherein the RNA molecule comprises a 5'-cap, a 5'-UTR, a 3'-UTR and a polyA sequence.
65. The RNA molecule of any one of claims 1 to 64, wherein the RNA molecule comprises modified nucleotides, nucleosides or nucleobases.
66. The RNA molecule of claim 65, wherein the RNA molecule comprises modified uridines.
67. The RNA molecule of any one of claims 66, wherein the RNA molecule comprises modified uridines in place of all uridines.
68. The RNA molecule of claim 66 or 67, wherein the modified uridines are Nl-methyl-pseudouridine.
69. The RNA molecule of any one of claims 1 to 68, wherein the coding sequence of the RNA molecule is codon-optimized and/or is characterized in that its G/C content is increased compared to the parental sequence.
70. Chimeric protein encoded by the RNA molecule of any one of claims 1 to 69.
71. DNA molecule encoding the RNA molecule of any one of claims 1 to 69.
72. Pharmaceutical composition comprising one or more RNA molecules of any one of claims 1 to 69.
73. The pharmaceutical composition of claim 72, wherein the one or more RNA molecules are formulated in a lipid formulation, such as in lipid nanoparticles or liposomes.
74. The pharmaceutical composition of claim 73, wherein the lipid formulation comprises each of: e) a cationically ionizable lipid; f) a steroid; g) a neutral lipid; and h) a polymer-conjugated lipid.
75. The pharmaceutical composition of claim 74, wherein the cationically ionizable lipid is present in a concentration ranging from about 40 to about 60 mol percent of the total lipids.
76. The pharmaceutical composition of claim 74 or 75, wherein the steroid is present in a concentration ranging from about 30 to about 50 mol percent of the total lipids.
77. The pharmaceutical composition of any one of claims 74 to 76, wherein the neutral lipid is present in a concentration ranging from about 5 to about 15 mol percent of the total lipids.
78. The pharmaceutical composition of any one of claims 74 to 77, wherein the polymer-conjugated lipid is present in a concentration ranging from about 1 to about 10 mol percent of the total lipids.
79. The pharmaceutical composition of any one of claims 74 to 78, wherein the cationically ionizable lipid is within a range of about 40 to about 60 mole percent, the steroid is within a range of about 30 to about 50 mole percent, the neutral lipid is within a range of about 5 to about 15 mole percent, and the polymer-conjugated lipid is within a range of about 1 to about 10 mole percent.
80. The pharmaceutical composition of any one of claims 74 to 79, wherein the steroid comprises cholesterol.
81. The pharmaceutical composition of any one of claims 74 to 80, wherein the neutral lipid comprises a phospholipid.
82. The pharmaceutical composition of claim 81, wherein the phospholipid comprises distearoylphosphatidylcholine (DSPC).
83. The pharmaceutical composition of any one of claims 74 to 82, wherein the polymer-conjugated lipid comprises a polyethylene glycol (PEG)-lipid.
84. The pharmaceutical composition of any one of claims 72 to 83, wherein the pharmaceutical composition further comprises one or more pharmaceutically acceptable carriers, diluents and/or excipients.
85. The pharmaceutical composition of any one of claims 72 to 84, wherein the one or more RNA molecules are in a liquid formulation.
86. The pharmaceutical composition of any one of claims 72 to 84, wherein the one or more RNA molecules are in a frozen formulation.
87. The pharmaceutical composition of any one of claims 72 to 84, wherein the one or more RNA molecules are in a lyophilized formulation.
88. The pharmaceutical composition of any one of claims 72 to 87, wherein the one or more RNA molecules are formulated for injection.
89. The pharmaceutical composition of claim 88, wherein the one or more RNA molecules are formulated for intramuscular administration.
90. The pharmaceutical composition of any one of claims 72 to 89, therein the pharmaceutical composition is formulated for administration in human.
91. Kit comprising one or more pharmaceutical compositions of any one of claims 72 to 90.
92. The kit of claim 91, wherein two or more pharmaceutical compositions comprising the same or different RNA molecules according to any one of claims 1 to 69 are in separate vials.
93. The kit of claim 91 or 92, further comprising instructions for use of the one or more pharmaceutical composition for treating or preventing tuberculosis.
94. RNA molecule of any one of claims 1 to 69, chimeric protein of claim 70, DNA molecule of claim 71, pharmaceutical composition of any one of claims 72 to 90 or kit of any one of claims 91 to 93 for use as a medicament.
95. The RNA molecule, chimeric protein, DNA molecule, pharmaceutical composition or kit for use of claim 94, wherein the use comprises a therapeutic or prophylactic treatment of a disease or disorder in a subject.
96. The RNA molecule, chimeric protein, DNA molecule, pharmaceutical composition or kit for use of claim 94 or 95, wherein the use comprises the use as a vaccine against a disease or disorder in a subject.
97. The RNA molecule, chimeric protein, pharmaceutical composition or kit for use of claim 95 or 96, wherein the subject is a human infected with the disease or disorder or in danger of contracting the disease or disorder.
98. RNA molecule of any one of claims 1 to 69, chimeric protein of claim 70, DNA molecule of claim 71, pharmaceutical composition of any one of claims 72 to 90 or kit of any one of claims 91 to 93 for use in treating or preventing tuberculosis in a subject.
99. The RNA molecule, chimeric protein, pharmaceutical composition or kit for use of claim 98, wherein the subject is a human suffering from tuberculosis or in danger of contracting tuberculosis.
100. The RNA molecule, chimeric protein, pharmaceutical composition or kit for use of claim 98 or 99, wherein the use is as a vaccine for preventing tuberculosis.
101. Use of the RNA molecule of any one of claims 1 to 69, the chimeric protein of claim 70, the DNA molecule of claim 71, the pharmaceutical composition of any one of claims 72 to 90 or the kit of any one of claims 91 to 93 for the manufacture of a medicament for preventing or treating tuberculosis.
102. Method of vaccinating a subject comprising administering the RNA molecule of any one of claims 1 to 69, the chimeric protein of claim 70, the DNA molecule of claim 71, the pharmaceutical composition of any one of claims 72 to 90 or the kit of any one of claims 91 to 93 to the subject.
103. The method of claim 102, wherein the vaccination is for preventing tuberculosis.
104. The method of claim 102 or 103, wherein administration is by intramuscular administration.
105. The method of any one of claims 102 to 104, comprising administering to the subject at least one dose of the RNA, chimeric protein or pharmaceutical composition.
106. The method of any one of claims 102 to 105, comprising administering to the subject at least two doses of the RNA, chimeric protein or pharmaceutical composition.
107. The method of any one of claims 102 to 106, wherein an amount of the RNA of at least 10 pg per dose is administered.
108. The method of any one of claims 102 to 107, wherein the subject is a human.
109. The RNA molecule, chimeric protein, pharmaceutical composition or kit for use of any one of claims 98 to 100, the use of claim 101 or the method of any one of claims 102 to 108, wherein the tuberculosis is caused by an infection with a Mycobacterium.
110. The RNA molecule, chimeric protein, pharmaceutical composition or kit for use, the use or the method of claim 109, wherein the Mycobacterium is selected from the group of Mycobacterium tuberculosis, Mycobacterium bovis, Mycobacterium caprae, Mycobacterium orygis, Mycobacterium africanum, Mycobacterium microti, Mycobacterium canetti and Mycobacterium pinnipedii.
111. The RNA molecule, chimeric protein, pharmaceutical composition or kit for use, the use or the method of claim 110, wherein the Mycobacterium is Mycobacterium tuberculosis.
EP24725309.9A 2023-04-14 2024-04-12 Rna for preventing or treating tuberculosis Pending EP4694920A1 (en)

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US202363496147P 2023-04-14 2023-04-14
US202363496149P 2023-04-14 2023-04-14
US202363512683P 2023-07-10 2023-07-10
US202363512681P 2023-07-10 2023-07-10
US202363586839P 2023-09-29 2023-09-29
PCT/US2024/024500 WO2024216214A1 (en) 2023-04-14 2024-04-12 Rna for preventing or treating tuberculosis

Publications (1)

Publication Number Publication Date
EP4694920A1 true EP4694920A1 (en) 2026-02-18

Family

ID=91070198

Family Applications (1)

Application Number Title Priority Date Filing Date
EP24725309.9A Pending EP4694920A1 (en) 2023-04-14 2024-04-12 Rna for preventing or treating tuberculosis

Country Status (3)

Country Link
EP (1) EP4694920A1 (en)
CN (1) CN121398842A (en)
WO (1) WO2024216214A1 (en)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3200234A1 (en) 2020-11-25 2022-06-02 Daryl C. Drummond Lipid nanoparticles for delivery of nucleic acids, and related methods of use
EP4637810A2 (en) * 2022-12-22 2025-10-29 Akagera Medicines, Inc. Lipid nanoparticles for the prevention of tuberculosis or other mycobacterial infections

Family Cites Families (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2686899B1 (en) 1992-01-31 1995-09-01 Rhone Poulenc Rorer Sa NOVEL BIOLOGICALLY ACTIVE POLYPEPTIDES, THEIR PREPARATION AND PHARMACEUTICAL COMPOSITIONS CONTAINING THEM.
US20050287153A1 (en) 2002-06-28 2005-12-29 Genentech, Inc. Serum albumin binding peptides for tumor targeting
US7176278B2 (en) 2001-08-30 2007-02-13 Biorexis Technology, Inc. Modified transferrin fusion proteins
US7696320B2 (en) 2004-08-24 2010-04-13 Domantis Limited Ligands that have binding specificity for VEGF and/or EGFR and methods of use therefor
EP2284192A3 (en) 2002-11-08 2011-07-20 Ablynx N.V. Camelidae antibodies for sublingual administration
JP5010923B2 (en) 2004-02-09 2012-08-29 ヒューマン ジノーム サイエンシーズ, インコーポレイテッド Albumin fusion protein
DE102005046490A1 (en) 2005-09-28 2007-03-29 Johannes-Gutenberg-Universität Mainz New nucleic acid molecule comprising promoter, a transcriptable nucleic acid sequence, a first and second nucleic acid sequence for producing modified RNA with transcriptional stability and translational efficiency
US20070269422A1 (en) 2006-05-17 2007-11-22 Ablynx N.V. Serum albumin binding proteins with long half-lives
KR101193722B1 (en) 2006-07-24 2013-01-11 바이오렉시스 파마슈티칼 코포레이션 Exendin fusion proteins
CN101646689A (en) 2006-09-08 2010-02-10 埃博灵克斯股份有限公司 Serum albumin binding proteins with long half-lives
WO2009083804A2 (en) 2007-12-27 2009-07-09 Novartis Ag Improved fibronectin-based binding molecules and their use
US9296810B2 (en) 2008-05-02 2016-03-29 Novartis Ag Fibronectin-based binding molecules and uses thereof
CN106977608A (en) 2010-04-09 2017-07-25 阿尔布麦狄克斯公司 Albumin derivant and variant
ES2689875T3 (en) 2010-04-13 2018-11-16 Bristol-Myers Squibb Company Proteins with a fibronectin-based framework domain that bind PCSK9
JP2014529997A (en) 2011-09-23 2014-11-17 ウニヴェルズィテート シュトゥットガルト Serum half-life extension using immunoglobulin binding domains
HK1200842A1 (en) 2011-11-18 2015-08-14 Albumedix Ltd Proteins with improved half-life and other properties
WO2013143555A1 (en) 2012-03-26 2013-10-03 Biontech Ag Rna formulation for immunotherapy
WO2016005004A1 (en) 2014-07-11 2016-01-14 Biontech Rna Pharmaceuticals Gmbh Stabilization of poly(a) sequence encoding dna sequences
WO2017059902A1 (en) 2015-10-07 2017-04-13 Biontech Rna Pharmaceuticals Gmbh 3' utr sequences for stabilization of rna
RS63986B1 (en) 2015-10-28 2023-03-31 Acuitas Therapeutics Inc Novel lipids and lipid nanoparticle formulations for delivery of nucleic acids
AU2017251983B2 (en) 2016-04-22 2023-07-20 BioNTech SE Methods for providing single-stranded RNA
EP4714454A2 (en) 2016-10-26 2026-03-25 Acuitas Therapeutics Inc. Lipid nanoparticle formulations
KR102673794B1 (en) * 2017-06-15 2024-06-11 액세스 투 어드밴스드 헬스 인스티튜트 Nanostructured lipid carriers and stable emulsions and their uses
WO2024023790A1 (en) * 2022-07-29 2024-02-01 University Of Cape Town Vaccine constructs comprising tuberculosis antigens
US20260048110A1 (en) * 2022-08-03 2026-02-19 BioNTech SE Rna for preventing or treating tuberculosis

Also Published As

Publication number Publication date
CN121398842A (en) 2026-01-23
WO2024216214A1 (en) 2024-10-17

Similar Documents

Publication Publication Date Title
US20260048110A1 (en) Rna for preventing or treating tuberculosis
AU2023237054B2 (en) Potency assay for therapeutic potential of coding nucleic acid
CA3198742A1 (en) Lnp compositions comprising rna and methods for preparing, storing and using the same
EP4456882B1 (en) Lipid-based formulations for administration of rna
WO2024216214A1 (en) Rna for preventing or treating tuberculosis
WO2024027910A1 (en) Rna for preventing or treating tuberculosis
US20250222132A1 (en) Nucleic acid compositions comprising a multivalent anion, such as an inorganic polyphosphate, and methods for preparing, storing and using the same
WO2024213776A1 (en) Rna for preventing or treating tuberculosis
WO2024216212A1 (en) Rna for preventing or treating tuberculosis
EP4673557A1 (en) Linker sequence potency assays for multiple coding nucleic acids
US20240226132A1 (en) Rna compositions comprising a buffer substance and methods for preparing, storing and using the same
EP4238577A2 (en) Compositions for administration of different doses of rna
WO2026082899A2 (en) Rna for preventing or treating tuberculosis
WO2026041793A1 (en) Chimeric proteins comprising non-human protein domains for enhancing antigenicity
WO2026047153A1 (en) Potency assay for multiple coding nucleic acids
WO2025223684A1 (en) Methods and compositions for stimulating immune response
WO2024180363A1 (en) Linker sequence potency assays for multiple coding nucleic acids
HK40099434A (en) Compositions for administration of different doses of rna

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20251111

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR