EP4688816A1 - Crd.vl thermostable protein domains with lectin-like properties derived from galectin 3 - Google Patents
Crd.vl thermostable protein domains with lectin-like properties derived from galectin 3Info
- Publication number
- EP4688816A1 EP4688816A1 EP24718103.5A EP24718103A EP4688816A1 EP 4688816 A1 EP4688816 A1 EP 4688816A1 EP 24718103 A EP24718103 A EP 24718103A EP 4688816 A1 EP4688816 A1 EP 4688816A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- crd
- protein
- interest
- seq
- fusion protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4726—Lectins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/14—Extraction; Separation; Purification
- C07K1/16—Extraction; Separation; Purification by chromatography
- C07K1/22—Affinity chromatography or related techniques based upon selective absorption processes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/7056—Lectin superfamily, e.g. CD23, CD72
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
Definitions
- the present invention concerns new thermostable peptides derived from human galectin-3, in particular from its CRDSAT domain, that are useful to facilitate and improve the purification yield of fusion proteins, in particular of thermostable fusion proteins by simple heating.
- the present invention finds its applications mainly in public and private research laboratories, as well as in the pharmaceutical industry having the need to produce recombinant proteins for the purpose of fundamental studies or of therapeutic interest.
- references in square brackets ([ ]) refer to the list of references at the end of the text.
- a key step for the use of recombinant proteins is their purification from ectopic overexpression systems.
- bacterial strains have been optimised to improve the yields, purity, folding and/or safety of proteins encoded on plasmid expression vectors, which are themselves optimised to best perform their task.
- purification tags that can be fused to the protein of interest have been developed.
- Some tags can improve the solubility of the protein construct, but many, including 6xHis (composed of at least six histidines), GST (glutathione S-transferase), MBP (Maltose- Binding Protein), TAP (Tandem Affinity Purification), FLAG and STREP (STREPtavidin), benefit from their ability to bind specifically to agarose or Sepharose resin beads coated with a specific ligand. The affinity for the ligand allows the protein of interest to be retained on the beads, while the proteins in the cell expression system are removed in the washing step.
- 6xHis composed of at least six histidines
- GST glutlutathione S-transferase
- MBP Maltose- Binding Protein
- TAP Tandem Affinity Purification
- FLAG and STREP STREPtavidin
- thermostability of a recombinant protein can be exploited to increase its purification yield. Indeed, when a protein of interest is overexpressed by bacterial systems such as E. coli, many endogenous proteins, associated with cell growth, are produced.
- the thermostability of a recombinant protein can be exploited to increase its purification yield. Indeed, when a protein of interest is overexpressed by bacterial systems such as E. coli, many endogenous proteins, associated with cell growth, are produced. As these proteins precipitate at temperatures above 55 °C, many of them can be efficiently removed from the soluble bacterial fraction by a simple heating step of a few minutes.
- CRDSAT carbohydrate recognition domain
- thermostable variants called CRD.VL protein domains or CRD.VL, when fused to a thermostable protein of interest thus allow to improve the purification yield by simple heating.
- An object of the present invention is therefore a CRD.VL protein domain comprising or consisting of a peptide having the following amino acid sequence: MSATGAYPATGPYGAPAGPLIVPYELPX28PGGX32HPGMLITIQGTVKPNANRIALDF QRGNDXeiAFHFNPRFNENNRRVIVCNTKQGNQWGPEERQMHFPFEXiooGKPFKIQ X108LVEPDHFKVAVNDQHLLX126YX128HRVKNLQEINKLX141ISGDIQLTSVSYTMI, wherein X28, X32, Xe-i, X100, X108, X126, X128, and X141 are independently of each other any amino acid (SEQ ID NO: 1 ).
- X28 is Leu or lie
- X32 is Vai or lie
- Xei is Vai or lie
- X100 is Ser or Arg
- X108 is Vai or lie
- X126 is Gin or Glu
- X128 is Asn or Lys
- X141 is Gly or Arg (SEQ ID NO: 7).
- said CRD.VL protein domain comprises or consists of the amino acid sequence:
- Another object of the present invention is a fusion protein comprising or consisting of a CRD.VL protein domain of the present invention fused to a molecule of interest, with a protease cleavage site inserted between the two.
- the cleavage site is a TEV protease cleavage site.
- Another object of the present invention is an plasmidic expression vector comprising a nucleotide sequence encoding a fusion protein of the present invention.
- Another object of the present invention is a method for producing a purified protein of interest, said method comprising: a) preparing an expression vector according to claim 6; b) transforming a host cell with said expression vector; c) culturing said transformed host cell under conditions enabling the expression of the fusion protein in the culture medium; d) optionally heating the culture medium containing the expressed fusion protein at a temperature ranging from 56 to 70 °C, preferably at 60 °C; and e) purifying the molecule of interest.
- the purification step e) is carried out by:
- the purification step e) is carried out by:
- the separation step (iv) is carried out by ion exchange chromatography or size exclusion exclusion chromatography or hydrophobic interaction chromatography.
- the elution step (ii) is carried out with a lactose solution.
- Figure 1 represents protein sequence alignment of CRD.VL1 , CRD.VL2 and CRD.VL3 (SEQ ID NOs: 2-4) in view of the protein sequence of CRDSAT (SEQ ID NO: 6).
- An asterisk indicates positions which have a single, fully conserved residue.
- a colon indicates conservation between groups of strongly similar properties.
- a period indicates conservation between groups of weakly similar properties.
- a first consensus sequence (CRD. CONS, SEQ ID NO: 5) that contains a X at positions in the CRD.VL1 , CRD.VL2 and CRD.VL3 sequences that do not strictly match with the CRDSAT sequence is reported.
- a second consensus sequence (CRD.VLX, SEQ ID NO: 1 ) that contains a X at positions in the CRD.VL1 , CRD.VL2 and CRD.VL3 sequences that do not strictly match therebetween.
- the numbering of the sequences is related to the numbering of the full-length wild-type human galectin-3.
- Figure 2 represents SDS-PAGE analysis of the purification of CRDSAT, CD.VL1 , CRD.VL2 and CRD.VL3 expressed individually in E. coli BL21 (DE3) pRARE2.
- « Sso » « LacSeph » « Pellet » « Elu » and « kDa » refer respectively to the supernatant sonicate, the Lactose-Sepharose beads, the Pellet after centrifugation, the elution with D-Lactose and the protein size ladder.
- the « 4 °C » tag means that the purification step was done at 4 °C.
- the « 60 °C » tag means that the purification step follows a heating at 60 °C of the sonicated supernatant.
- CRDSAT is mainly found in the « Elu - 4 °C » and « Pellet - 60 °C » lanes
- Figure 3 represents dynamic light scattering analysis of CRDSAT, CRD.VL1 , CRV.VL2 and CRD.VL3 performed on a Zetasizer apparatus (Malvern, Ltd). Data were recorded at 20 °C in lysis buffer using a protein concentration of 50 pM. The variant proteins size observed with this technique are similar to CRDSAT and is characteristic of a monomeric CRD protein (from 5.2 to 5.9 nm).
- Figure 4 represents circular dichroism analysis of CRDSAT, CRD.VL1 , CRD.VL2 and CRD.VL3 concentrated at 50 pM in 10 mM NaPi, 100 mM NaF, pH 7.4 buffer, performed on a Chirascan spectrometer (Applied Photophysics, Ltd).
- Figure 5 represents differential scanning calorimetry of CRDSAT, CRD.VL1 , CRV.VL2 and CRD.VL3 performed on a VP-DSC instrument (MicroCai, Malvern, Ltd) at a 35 pM concentration in 20 mM NaPi, 150 mM NaCI, pH 7.4 buffer. Denaturation curves allowed to measure a mid-point temperature value or TM, corresponding to the to half-denaturation of the protein sample. TM values for CRDSAT equals to 55.7 °C; 77.4 °C for CRD.VL1 , 86.9 °C for CRD.VL2 and 92.2 °C for CRD.VL3 respectively. The higher the TM value, the higher the protein thermostability.
- Figure 6 represents SDS-PAGE analysis of the purification of Trx1 and PETase fused to CRD.VL1 and of Trx1 fused to CRDSAT expressed in E. coli BL21 (DE3) pRARE2.
- « Sso » « LacSeph » « Pellet » « Elu » and « kDa » refer respectively to the sonicated supernatant, the Lactose-Sepharose beads, the pellet after centrifugation, the elution with D-Lactose and the protein size ladder.
- the « 4 °C » tag means that the purification step was done at 4 °C.
- the « 60 °C » tag means that the purification step follows a heating at 60 °C of the sonicated supernatant.
- Figure 7 represents PET hydrolysis assay performed at 65 °C with PETase fused to CRD.VL1 or to the 6xHIS tag.
- Starting pH value of the 100 mM Bicine buffer containing 50 mg of amorphous PET is 8.90.
- CRD.VL1 three protein sequences were designed, called CRD.VL1 , CRD.VL2 and CRD.VL3 ( Figure 1 ; SEQ ID NOs: 2-4). More in details, and in order to preserve the binding properties of the D-lactose, specific to the CRDs, residues in the vicinity of the sugar binding pocket made, in CRDSAT, with residues N160, R162, V172, N174, W181 , E184, R186, were not mutated. In addition, residues from the N-terminal tail that contains a polyproline stretch and residues which appear to be important to maintain the overall three-dimensional structure of the protein, were not mutated.
- the sequence of the CRDSAT encoded in the pCARGHO vector [1 ,2] was modified to match the ones of CRD.VL1 , CRD.VL2 and CRD.VL3.
- a BL21 (DE3) pRARE 2 Escherichia coli strain was then transformed with a pCARGHO (i.e. without CRD.VL sequence), pCARGHOvu, pCARGHOvL2 or pCARGHOvis vector as previously shown in [1 ,2].
- a positive clone was selected on LB-agar plates then grown overnight at 37 °C under agitation in liquid LB medium.
- the latter culture was used to seed a fresh LB medium cultivated at 37 °C under agitation until optical density reached a value of 0.6 at 600 nm.
- Protein overexpression was induced with addition of 0.25 mM IPTG (Isopropyl [3-D-1 -thiogalactopyranoside) in the bacterial culture that was then placed at 20 °C under agitation for 16 hours.
- a lysis buffer 25 mM HEPES, 300 mM NaCI, pH 7.5. The suspension was sonicated, then centrifuged in order to discard the insoluble protein fraction. To increase the cleaning rate, the supernatant was heated for 10 minutes at 60 °C to precipitate labile proteins and then, centrifuged. The supernatant resulting from the heating step was mixed for 10 minutes with lactose-Sepharose beads that specifically bind properly folded CRDs. The beads were washed with the lysis buffer before being mixed with the lysis buffer supplemented with 200 mM of D-Lactose to release the protein of interest. This protein purification process was followed by polyacrylamide gel electrophoresis under denaturant conditions (SDS-PAGE).
- CRD.VL1 , CRD.VL2 and CRD.VL3 successfully bind to, then elute from, the lactose-Sepharose. This demonstrates the ability of these variants to specifically bind D-Lactose and strongly suggests that they fold as CRDSAT from which they are derived.
- CRD.VL1 , CRD.VL2 and CRD.VL3 were first analyzed using dynamic light scattering (DLS). Data were recorded at 20°C in lysis buffer on a Zetasizer apparatus using a protein concentration of 50 pM. The protein sizes observed with this technique are in the same range than CRDSAT and characteristic of a monomeric CRD protein ( Figure 3).
- CRD.VL1 , CRD.VL2 and CRD.VL3 do not suffer any damage at 60°C since they keep their ability to specifically bind D-lactose after a heating step.
- DSC differential scanning calorimetry
- thermostable CRD.VL to purify passenger protein
- CRD.VL1 a bacterial Thioredoxin (Trx1 , Miranda-Vizuete et al., 1997) [4] and to a PET hydrolase (the latter being an enzyme able to hydrolyze polyethylene terephthalate (PET) and turns it into ethylene glycol and terephthalic acid, Tournier et al., 2020) [5], Both proteins have been shown to be thermostable and active at temperatures above 65 °C.
- Trx1 bacterial Thioredoxin
- PET hydrolase the latter being an enzyme able to hydrolyze polyethylene terephthalate (PET) and turns it into ethylene glycol and terephthalic acid, Tournier et al., 2020
- DNA sequences of the passenger proteins were integrated into a pCARGHOvu plasmid, downstream a CRD.VL1 tag sequence and a protease TEV cleavage site.
- Protein expression and purification were performed as described above, meaning with the inclusion of a heating step at 60 °C performed on the soluble fraction obtained after cell sonication.
- Trx1 fused to CRDSAT did not withstand the heating step at 60 °C of the Sso since it was found insoluble in the pellet at this stage and therefore could not be selected on Lactose-Sepharose beads (Figure 6).
- Monomeric and thermostable variants of the CRDSAT such as CRD.VL1 , CRD.VL2 and CRD.VL3, could be effectively used as lectinic purification tags without altering the potential enzymatic activity of a passenger protein (protein of interest). They can simplify, speed up and improve the purification of the passenger protein using a heating step followed by D-Lactose affinity chromatography. The low cost of this process may be advantageous for large scale exploitation of these protein tags.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Cell Biology (AREA)
- Immunology (AREA)
- Analytical Chemistry (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention concerns new thermostable peptides derived from human galectin-3, in particular from its CRDSAT domain, that are useful to facilitate and improve the purification yield of fusion proteins, in particular of thermostable fusion proteins by simple heating.
Description
CRD.VL THERMOSTABLE PROTEIN DOMAINS WITH LECTIN-LIKE PROPERTIES DERIVED FROM GALECTIN 3
DESCRIPTION
Technical field of the invention
The present invention concerns new thermostable peptides derived from human galectin-3, in particular from its CRDSAT domain, that are useful to facilitate and improve the purification yield of fusion proteins, in particular of thermostable fusion proteins by simple heating.
The present invention finds its applications mainly in public and private research laboratories, as well as in the pharmaceutical industry having the need to produce recombinant proteins for the purpose of fundamental studies or of therapeutic interest.
In the description below, references in square brackets ([ ]) refer to the list of references at the end of the text.
State of the art
For several years, the application needs for recombinant proteins have been growing in many economic and research fields, ranging, for example, from the pharmaceutical, chemical and agronomic industries to university laboratories.
A key step for the use of recombinant proteins is their purification from ectopic overexpression systems. For decades, bacterial strains have been optimised to improve the yields, purity, folding and/or safety of proteins encoded on plasmid expression vectors, which are themselves optimised to best perform their task. To facilitate operations, purification tags that can be fused to the protein of interest have been developed. Some tags, such as the SUMO (Small Ubiquitin-like Modifier) tag, can improve the solubility of the protein construct, but many, including 6xHis (composed of at least six histidines), GST (glutathione S-transferase), MBP (Maltose- Binding Protein), TAP (Tandem Affinity Purification), FLAG and STREP (STREPtavidin), benefit from their ability to bind specifically to agarose or Sepharose resin beads coated with a specific ligand. The affinity for the ligand allows the protein of interest to be retained on the beads, while the proteins in the cell expression system are removed in the washing step. Competition with an eluent molecule, or direct
cleavage by a protease specifically recognising a target region embedded in the protein construct, releases the protein of interest from the beads. Thus, the more specific the affinity chromatography step, the purer the eluted fractions.
The thermostability of a recombinant protein can be exploited to increase its purification yield. Indeed, when a protein of interest is overexpressed by bacterial systems such as E. coli, many endogenous proteins, associated with cell growth, are produced. The thermostability of a recombinant protein can be exploited to increase its purification yield. Indeed, when a protein of interest is overexpressed by bacterial systems such as E. coli, many endogenous proteins, associated with cell growth, are produced. As these proteins precipitate at temperatures above 55 °C, many of them can be efficiently removed from the soluble bacterial fraction by a simple heating step of a few minutes.
Recently a protein purification tag based on the carbohydrate recognition domain (CRD) of human galectin-3, called CRDSAT, has been developed which allows for improved purification of proteins of interest by affinity chromatography. This protein tag has the advantage of being highly specific for its ligand, of facilitating the solubilisation of the protein to be purified and of working with a low cost system linked to the use of an abundant and inexpensive compound: D-lactose [1 ], However, it has limited temperature stability, with a temperature of 55.8 °C measured by differential scanning calorimetry (DSC) (see Figure 1 ).
Description of the invention
Molecular engineering can often be used to modify the catalytic, binding or physicochemical properties of proteins. Different approaches are possible, some consisting of random mutagenesis of the peptide sequence, others based on a rationale guided by the three-dimensional structure of the protein. The inventors opted for this second approach to try to improve the stability of the CRDSAT.
The inventors therefore designed variants of CRDSAT with retained lectin activity making it possible to select fusion proteins by affinity chromatography and improved stability at high temperature (up to about 92 °C for instance). These thermostable variants, called CRD.VL protein domains or CRD.VL, when fused to a thermostable protein of interest thus allow to improve the purification yield by simple heating.
An object of the present invention is therefore a CRD.VL protein domain comprising or consisting of a peptide having the following amino acid sequence:
MSATGAYPATGPYGAPAGPLIVPYELPX28PGGX32HPGMLITIQGTVKPNANRIALDF QRGNDXeiAFHFNPRFNENNRRVIVCNTKQGNQWGPEERQMHFPFEXiooGKPFKIQ X108LVEPDHFKVAVNDQHLLX126YX128HRVKNLQEINKLX141ISGDIQLTSVSYTMI, wherein X28, X32, Xe-i, X100, X108, X126, X128, and X141 are independently of each other any amino acid (SEQ ID NO: 1 ).
According to a particular embodiment of the CRD.VL protein domain of the invention, X28 is Leu or lie, X32 is Vai or lie, Xei is Vai or lie, X100 is Ser or Arg, X108 is Vai or lie, X126 is Gin or Glu, X128 is Asn or Lys, and/or X141 is Gly or Arg (SEQ ID NO: 7).
According to a particular embodiment of the CRD.VL protein domain of the invention, said CRD.VL protein domain comprises or consists of the amino acid sequence:
MSATGAYPATGPYGAPAGPLIVPYELPLPGGVHPGMLITIQGTVKPNANRIALDFQR GNDVAFHFNPRFNENNRRVIVCNTKQGNQWGPEERQMHFPFESGKPFKIQVLVEP DHFKVAVNDQHLLQYNHRVKNLQEINKLGISGDIQLTSVSYTMI (SEQ ID NO: 2) as the CRD.VL1 protein domain,
MSATGAYPATGPYGAPAGPLIVPYELPLPGGVHPGMLITIQGTVKPNANRIALDFQR GNDVAFHFNPRFNENNRRVIVCNTKQGNQWGPEERQMHFPFERGKPFKIQILVEP DHFKVAVNDQHLLQYNHRVKNLQEINKLRISGDIQLTSVSYTMI (SEQ ID NO: 3) as the CRD.VL2 protein domain, or
MSATGAYPATGPYGAPAGPLIVPYELPIPGGIHPGMLITIQGTVKPNANRIALDFQRG NDIAFHFNPRFNENNRRVIVCNTKQGNQWGPEERQMHFPFERGKPFKIQILVEPDH FKVAVNDQHLLEYKHRVKNLQEINKLRISGDIQLTSVSYTMI (SEQ ID NO: 4) as the CRD.VL3 protein domain.
Another object of the present invention is a fusion protein comprising or consisting of a CRD.VL protein domain of the present invention fused to a molecule of interest, with a protease cleavage site inserted between the two.
According to a particular embodiment of the fusion protein of the present invention, the cleavage site is a TEV protease cleavage site.
Another object of the present invention is an plasmidic expression vector comprising a nucleotide sequence encoding a fusion protein of the present invention.
Another object of the present invention is a method for producing a purified protein of interest, said method comprising: a) preparing an expression vector according to claim 6;
b) transforming a host cell with said expression vector; c) culturing said transformed host cell under conditions enabling the expression of the fusion protein in the culture medium; d) optionally heating the culture medium containing the expressed fusion protein at a temperature ranging from 56 to 70 °C, preferably at 60 °C; and e) purifying the molecule of interest.
According to a particular embodiment of the method of the present invention, the purification step e) is carried out by:
(i) binding the fusion protein via the CRD.VL protein domain onto a chromatography support grafted with lactose molecules, preferably onto a column of agarose or sepharose resin grafted with lactose molecules;
(ii) cleavage by protease of the protein of interest;
(iii) elution of the protein of interest;
(iv) separation of the protease from the protein of interest.
According to a particular embodiment of the method of the present invention, the purification step e) is carried out by:
(i) binding the fusion protein via the CRD.VL protein domain onto a chromatography support grafted with lactose molecules, preferably onto a column of agarose or sepharose resin grafted with lactose molecules;
(ii) elution of the fusion protein;
(iii) cleavage by protease of the protein of interest in solution;
(iv) separation of the protease and the CRD.VL protein domain, from the protein of interest.
According to a particular embodiment of the method of the present invention, the separation step (iv) is carried out by ion exchange chromatography or size exclusion exclusion chromatography or hydrophobic interaction chromatography.
According to a particular embodiment of the method of the present invention, the elution step (ii) is carried out with a lactose solution.
Brief description of the figures
Figure 1 represents protein sequence alignment of CRD.VL1 , CRD.VL2 and CRD.VL3 (SEQ ID NOs: 2-4) in view of the protein sequence of CRDSAT (SEQ ID NO: 6). An asterisk indicates positions which have a single, fully conserved residue. A colon indicates conservation between groups of strongly similar properties. A period
indicates conservation between groups of weakly similar properties. A first consensus sequence (CRD. CONS, SEQ ID NO: 5) that contains a X at positions in the CRD.VL1 , CRD.VL2 and CRD.VL3 sequences that do not strictly match with the CRDSAT sequence is reported. A second consensus sequence (CRD.VLX, SEQ ID NO: 1 ) that contains a X at positions in the CRD.VL1 , CRD.VL2 and CRD.VL3 sequences that do not strictly match therebetween. The numbering of the sequences is related to the numbering of the full-length wild-type human galectin-3.
Figure 2 represents SDS-PAGE analysis of the purification of CRDSAT, CD.VL1 , CRD.VL2 and CRD.VL3 expressed individually in E. coli BL21 (DE3) pRARE2. « Sso », « LacSeph », « Pellet », « Elu » and « kDa » refer respectively to the supernatant sonicate, the Lactose-Sepharose beads, the Pellet after centrifugation, the elution with D-Lactose and the protein size ladder. The « 4 °C » tag means that the purification step was done at 4 °C. The « 60 °C » tag means that the purification step follows a heating at 60 °C of the sonicated supernatant. Only CRD.VL1 , CRD.VL2 and CRD.VL3 are found in the « Elu - 60 °C » tracks and absent from the « Pellet - 60 °C » tracks. CRDSAT is mainly found in the « Elu - 4 °C » and « Pellet - 60 °C » lanes
Figure 3 represents dynamic light scattering analysis of CRDSAT, CRD.VL1 , CRV.VL2 and CRD.VL3 performed on a Zetasizer apparatus (Malvern, Ltd). Data were recorded at 20 °C in lysis buffer using a protein concentration of 50 pM. The variant proteins size observed with this technique are similar to CRDSAT and is characteristic of a monomeric CRD protein (from 5.2 to 5.9 nm).
Figure 4 represents circular dichroism analysis of CRDSAT, CRD.VL1 , CRD.VL2 and CRD.VL3 concentrated at 50 pM in 10 mM NaPi, 100 mM NaF, pH 7.4 buffer, performed on a Chirascan spectrometer (Applied Photophysics, Ltd).
Figure 5 represents differential scanning calorimetry of CRDSAT, CRD.VL1 , CRV.VL2 and CRD.VL3 performed on a VP-DSC instrument (MicroCai, Malvern, Ltd) at a 35 pM concentration in 20 mM NaPi, 150 mM NaCI, pH 7.4 buffer. Denaturation curves allowed to measure a mid-point temperature value or TM, corresponding to the to half-denaturation of the protein sample. TM values for CRDSAT equals to 55.7 °C; 77.4 °C for CRD.VL1 , 86.9 °C for CRD.VL2 and 92.2 °C for CRD.VL3 respectively. The higher the TM value, the higher the protein thermostability.
Figure 6 represents SDS-PAGE analysis of the purification of Trx1 and PETase fused to CRD.VL1 and of Trx1 fused to CRDSAT expressed in E. coli BL21 (DE3) pRARE2. « Sso », « LacSeph », « Pellet », « Elu » and « kDa » refer respectively to
the sonicated supernatant, the Lactose-Sepharose beads, the pellet after centrifugation, the elution with D-Lactose and the protein size ladder. The « 4 °C » tag means that the purification step was done at 4 °C. The « 60 °C » tag means that the purification step follows a heating at 60 °C of the sonicated supernatant.
Figure 7 represents PET hydrolysis assay performed at 65 °C with PETase fused to CRD.VL1 or to the 6xHIS tag. Starting pH value of the 100 mM Bicine buffer containing 50 mg of amorphous PET is 8.90.
EXAMPLES
EXAMPLE 1 : PRODUCTION OF THERMOSTABLE CRD.VL PROTEIN DOMAINS AND USES THEREOF
Design of three protein sequences derived from the CRDSAT protein sequence
With the aim to inspect the protein sequence variability of the CRDSAT domain derived from the human Galectin-3 (residue 96 to 250 (plus a Met residue in Nterm) SEQ ID NO: 6), an analysis of its three-dimensional X-ray structure (Kriznik et al., 2019) [2] was undertook using the PROSS webserver (Goldenzweig et al., 2016) [3], As a result, a maximum of 28 variable position was obtained.
Taken advantage of these positions, three protein sequences were designed, called CRD.VL1 , CRD.VL2 and CRD.VL3 (Figure 1 ; SEQ ID NOs: 2-4). More in details, and in order to preserve the binding properties of the D-lactose, specific to the CRDs, residues in the vicinity of the sugar binding pocket made, in CRDSAT, with residues N160, R162, V172, N174, W181 , E184, R186, were not mutated. In addition, residues from the N-terminal tail that contains a polyproline stretch and residues which appear to be important to maintain the overall three-dimensional structure of the protein, were not mutated.
From these variant sequences (SEQ ID NOs: 2-4), a consensus sequence was derived that could be the subject of point mutations, namely: MSATGAYPATGPYGAPAGPLIVPYELPX28PGGX32HPGMLITIQGTVKPNANRIALDF QRGNDX61AFHFNPRFNENNRRVIVCNTKQGNQWGPEERQMHFPFEX100GKPFKIQ Xi08LVEPDHFKVAVNDQHLLXi26YXi28HRVKNLQEINKLXi4ilSGDIQLTSVSYTMI, wherein X28, X32, Xei, X100, X108, X126, X128, and X141 are independently of each other any amino acid (SEQ ID NO: 1 ); or in particular
wherein X28 is Leu or lie, X32 is Vai or lie, Xei is Vai or lie, X100 is Ser or Arg, X108 is Vai or lie, X126 is Gin or Glu, X128 is Asn or Lys, and/or X141 is Gly or Arg (SEQ ID NO: 7).
Purification of recombinant CRDSAT, CRD.VL1, CRD.VL2 and CRD.VL3 using a heating step
To test the isolated overexpression of the three variants described in Figure 1 , the sequence of the CRDSAT encoded in the pCARGHO vector [1 ,2] was modified to match the ones of CRD.VL1 , CRD.VL2 and CRD.VL3. A BL21 (DE3) pRARE 2 Escherichia coli strain was then transformed with a pCARGHO (i.e. without CRD.VL sequence), pCARGHOvu, pCARGHOvL2 or pCARGHOvis vector as previously shown in [1 ,2].
For each transformation, a positive clone was selected on LB-agar plates then grown overnight at 37 °C under agitation in liquid LB medium. The latter culture was used to seed a fresh LB medium cultivated at 37 °C under agitation until optical density reached a value of 0.6 at 600 nm. Protein overexpression was induced with addition of 0.25 mM IPTG (Isopropyl [3-D-1 -thiogalactopyranoside) in the bacterial culture that was then placed at 20 °C under agitation for 16 hours.
Cells were harvested by centrifugation and resuspended in a lysis buffer (25 mM HEPES, 300 mM NaCI, pH 7.5). The suspension was sonicated, then centrifuged in order to discard the insoluble protein fraction. To increase the cleaning rate, the supernatant was heated for 10 minutes at 60 °C to precipitate labile proteins and then, centrifuged. The supernatant resulting from the heating step was mixed for 10 minutes with lactose-Sepharose beads that specifically bind properly folded CRDs. The beads were washed with the lysis buffer before being mixed with the lysis buffer supplemented with 200 mM of D-Lactose to release the protein of interest. This protein purification process was followed by polyacrylamide gel electrophoresis under denaturant conditions (SDS-PAGE).
As a result, it was shown that CRD.VL1 , CRD.VL2 and CRD.VL3 expressed individually could support, with no or only weak material loss, a heating step at 60°C in contrary to CRDSAT (Figure 2). Indeed, the latter was entirely found in the pellet resulting from centrifugation that follows the heating step, whereas it remains soluble when the purification is fully performed at 4 °C. It was also noticed that many other soluble proteins coming from the bacterial expression system are also discarded from the supernatant by heat-induced precipitation (See lane Pellet - 60 °C in Figure 2).
Importantly, CRD.VL1 , CRD.VL2 and CRD.VL3 successfully bind to, then elute from, the lactose-Sepharose. This demonstrates the ability of these variants to specifically bind D-Lactose and strongly suggests that they fold as CRDSAT from which they are derived.
Structural analysis of CRD.VL1, CRD.VL2 and CRD.VL3
Purified recombinant CRD.VL1 , CRD.VL2 and CRD.VL3 were first analyzed using dynamic light scattering (DLS). Data were recorded at 20°C in lysis buffer on a Zetasizer apparatus using a protein concentration of 50 pM. The protein sizes observed with this technique are in the same range than CRDSAT and characteristic of a monomeric CRD protein (Figure 3).
Second, a circular dichroism (CD) analysis of the three variants concentrated at 50 pM in 10 mM sodium phosphate (NaPi), 100 mM NaF, pH 7.4 revealed that spectra of the variants are very close to the one of CRDSAT (Figure 4). Indeed identical curves that overwhelmingly overlap were obtained, which relies on a similar structural conformation between the 3 CRD.VL and the original CRDSAT. The full beta-sheet signature is consistent with the 3D structure of CRDSAT obtained by X-ray method (pdb code : 6H64).
Altogether, it demonstrates, as suggested by their D-lactose binding properties, that CRD.VL1 , CRD.VL2 and CRD.VL3 fold as CRDSAT.
Thermal stability of CRD.VL1, CRD.VL2 and CRD.VL3
As shown in Figure 2, CRD.VL1 , CRD.VL2 and CRD.VL3 do not suffer any damage at 60°C since they keep their ability to specifically bind D-lactose after a heating step. To better characterize their thermal stability, which appears undoubtedly greater than the CRDSAT one, differential scanning calorimetry (DSC) was used and recorded on a Microcal VP-DSC in a 0.54 mL cell, at a pressure of 2 atm with a protein concentration of 35 pM in 20 mM NaPi, 150 mM NaCI, pH 7.4. The Tm, corresponding to the midpoint temperature of the unfolding transition, was determined with the Origin 7.0 software (Malvern).
Tm values of 55.7, 77.4, 86.9 and 92.2 °C were measured for CRDSAT, CRD.VL1 , CRD.VL2 and CRD.VL3 respectively (Figure 5). This explains the purification data in which CRDSAT precipitated after heating at 60 °C. Indeed, according to the DSC data, this protein domain is unfolded at this temperature and aggregates in an insoluble
pellet. In agreement with the DSC results, CRD.VL1 , CRD.VL2 and CRD.VL3 remain stable at 60 °C during the purification process and could thus be successfully purified as soluble lectinic domains.
Interestingly, the accumulation of mutations at the positions described in the consensus sequence shown in Figure 1 seems linked to the increase of the thermal stability of the protein domain.
Using thermostable CRD.VL to purify passenger protein
To take advantage of the thermostability of variants of CRDSAT, we fused CRD.VL1 to a bacterial Thioredoxin (Trx1 , Miranda-Vizuete et al., 1997) [4] and to a PET hydrolase (the latter being an enzyme able to hydrolyze polyethylene terephthalate (PET) and turns it into ethylene glycol and terephthalic acid, Tournier et al., 2020) [5], Both proteins have been shown to be thermostable and active at temperatures above 65 °C.
DNA sequences of the passenger proteins were integrated into a pCARGHOvu plasmid, downstream a CRD.VL1 tag sequence and a protease TEV cleavage site.
Protein expression and purification were performed as described above, meaning with the inclusion of a heating step at 60 °C performed on the soluble fraction obtained after cell sonication.
In Figure 6, it was shown that this step allowed a very efficient cleaning of the undesired bacterial proteins and did not significantly affect the solubility of the fusion proteins CRD.VL1 -Trx1 and CRD.VLI -PETase. Indeed, most of the soluble proteins coming from the E. coli expression strain were found in the pellet after heating whereas the CRD. VL1 -tagged proteins were overwhelmingly kept in the soluble fraction at the end of the purification process, meaning they are found in the « Elu - 60 °C » lane. More importantly, the two CRD. VL1 -tagged proteins are successfully selected on and eluted from Lactose-Sepharose beads.
As a control, Trx1 fused to CRDSAT did not withstand the heating step at 60 °C of the Sso since it was found insoluble in the pellet at this stage and therefore could not be selected on Lactose-Sepharose beads (Figure 6).
Finally, we designed a PET hydrolysis assay to test the activity of the CRD.VL1 - tagged PETase. A coupon of 50 mg of amorphous PET (Goodfellow) was placed in a 2 mL tube and immerged in 100 mM Bicine buffer, pH 8.9. A final concentration of 500 nM of 6xHIS-PETase or CRD.VLI -PETase, both heat-purified, was introduced in
the tube that was next incubated at 65 °C during three days. Hydrolysis of the PET was measured by monitoring the decrease of the pH value of the buffer due to the formation of terephthalic acid upon enzymatic digestion. This assay was performed two times to estimate the reproducibility of the results.
A decrease in the pH value was observed after 1 and 3 days due to the release of terephtalic acid upon PET hydrolysis (Figure 7). Mean and standard-deviation of the pH value were reported on the graphic as well as in the table below. With similar pH values obtained after 3 days, therefore it was shown that the heat-purified PETase fused to CRD.VL1 possessed an enzymatic activity comparable to the his-tagged PETase (Figure 7).
Conclusion
In conclusion, substitutable positions in the protein sequence of CRDSAT were identified, as well as associated amino acids to be favored, to increase the thermal stability of this domain derived from the human galectin-3 (Figure 1 ). The substitute amino acids to be preferred will be those found in CRD.VL3 because the latter presents the greatest Tm value.
Monomeric and thermostable variants of the CRDSAT, such as CRD.VL1 , CRD.VL2 and CRD.VL3, could be effectively used as lectinic purification tags without altering the potential enzymatic activity of a passenger protein (protein of interest). They can simplify, speed up and improve the purification of the passenger protein using a heating step followed by D-Lactose affinity chromatography. The low cost of this process may be advantageous for large scale exploitation of these protein tags.
List of references
[1] International Application WO 2017/194888
[2] Kriznik et al., Biotechnol. J., 14(4) : e1800214, 2019; doi :10.1002/biot.201800214 [3] Goldenzweig, A. et al., Mol. Cell, 63(2): 337-346, 2016
[4] Miranda-Vizuete et al., J. Biol. Chem., 272(49) : 30841-30847, 1997
[5] Tournier et al., Nature, 580(7802) : 216-219, 2020
Claims
1 ) CRD.VL protein domain comprising a peptide having the following amino acid sequence: MSATGAYPATGPYGAPAGPLIVPYELPX28PGGX32HPGMLITIQGTVKPNANRIALDF QRGNDX61AFHFNPRFNENNRRVIVCNTKQGNQWGPEERQMHFPFEX100GKPFKIQ
X108LVEPDHFKVAVNDQHLLX126YX128HRVKNLQEINKLX141ISGDIQLTSVSYTMI, wherein X28, X32, Xe-i, X100, X108, X126, X128, and X141 are independently of each other any amino acid (SEQ ID NO: 1 ).
2) CRD.VL protein domain according to claim 1 , wherein X28 is Leu or lie, X32 is Vai or lie, Xei is Vai or lie, X100 is Ser or Arg, X108 is Vai or lie, X126 is Gin or Glu, X128 is Asn or Lys, and/or X141 is Gly or Arg (SEQ ID NO: 7).
3) CRD.VL protein domain according to claim 1 or 2 comprising the amino acid sequence/ MSATGAYPATGPYGAPAGPLIVPYELPLPGGVHPGMLITIQGTVKPNANRIALDFQR GNDVAFHFNPRFNENNRRVIVCNTKQGNQWGPEERQMHFPFESGKPFKIQVLVEP DHFKVAVNDQHLLQYNHRVKNLQEINKLGISGDIQLTSVSYTMI (SEQ ID NO: 2), MSATGAYPATGPYGAPAGPLIVPYELPLPGGVHPGMLITIQGTVKPNANRIALDFQR GNDVAFHFNPRFNENNRRVIVCNTKQGNQWGPEERQMHFPFERGKPFKIQILVEP DHFKVAVNDQHLLQYNHRVKNLQEINKLRISGDIQLTSVSYTMI (SEQ ID NO: 3), or MSATGAYPATGPYGAPAGPLIVPYELPIPGGIHPGMLITIQGTVKPNANRIALDFQRG NDIAFHFNPRFNENNRRVIVCNTKQGNQWGPEERQMHFPFERGKPFKIQILVEPDH FKVAVNDQHLLEYKHRVKNLQEINKLRISGDIQLTSVSYTMI (SEQ ID NO: 4).
4) Fusion protein comprising a CRD.VL protein domain as defined in any of claims 1 to 3 fused to a molecule of interest, with a protease cleavage site inserted between the two.
5) Fusion protein according to claim 4, wherein the cleavage site is a TEV protease cleavage site.
6) Expression vector comprising a nucleotide sequence encoding a fusion protein as defined in any of claims 4 or 5.
7) Method for producing a purified protein of interest, said method comprising: a) preparing an expression vector according to claim 6; b) transforming a host cell with said expression vector; c) culturing said transformed host cell under conditions enabling the expression of the fusion protein in the culture medium; d) optionally heating the culture medium containing the expressed fusion protein at a temperature ranging from 56 to 70 °C, preferably at 60 °C; and e) purifying the molecule of interest.
8) Method according to claim 7, wherein the purification step e) is carried out by:
(i) binding the fusion protein via the CRD.VL protein domain onto a chromatography support grafted with lactose molecules, preferably onto a column of agarose or sepharose resin grafted with lactose molecules;
(ii) cleavage by protease of the protein of interest;
(iii) elution of the protein of interest;
(iv) separation of the protease from the protein of interest.
9) Method according to claim 7, wherein the purification step e) is carried out by:
(i) binding the fusion protein via the CRD.VL protein domain onto a chromatography support grafted with lactose molecules, preferably onto a column of agarose or sepharose resin grafted with lactose molecules;
(ii) elution of the fusion protein;
(iii) cleavage by protease of the protein of interest in solution;
(iv) separation of the protease and the CRD.VL protein domain, from the protein of interest.
10) Method according to any one of claims 8 or 9, wherein the separation step (iv) is carried out by ion exchange chromatography or size exclusion exclusion chromatography or hydrophobic interaction chromatography. 11 ) Method according to any one of claims 8 to 10, wherein the elution step
(ii) is carried out with a lactose solution.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP23305488.1A EP4442699A1 (en) | 2023-04-04 | 2023-04-04 | Crd.vl thermostable protein domains with lectin-like properties derived from galectin 3 |
| PCT/EP2024/059076 WO2024208910A1 (en) | 2023-04-04 | 2024-04-03 | Crd.vl thermostable protein domains with lectin-like properties derived from galectin 3 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP4688816A1 true EP4688816A1 (en) | 2026-02-11 |
Family
ID=86382853
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP23305488.1A Withdrawn EP4442699A1 (en) | 2023-04-04 | 2023-04-04 | Crd.vl thermostable protein domains with lectin-like properties derived from galectin 3 |
| EP24718103.5A Pending EP4688816A1 (en) | 2023-04-04 | 2024-04-03 | Crd.vl thermostable protein domains with lectin-like properties derived from galectin 3 |
Family Applications Before (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP23305488.1A Withdrawn EP4442699A1 (en) | 2023-04-04 | 2023-04-04 | Crd.vl thermostable protein domains with lectin-like properties derived from galectin 3 |
Country Status (2)
| Country | Link |
|---|---|
| EP (2) | EP4442699A1 (en) |
| WO (1) | WO2024208910A1 (en) |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR3051192B1 (en) | 2016-05-13 | 2020-12-25 | Univ De Lorraine | METHOD OF PURIFICATION OF RECOMBINANT PROTEINS BY AFFINITY BASED ON THE LECTINIC ACTIVITY OF THE CRD DOMAIN OF A GALECTIN |
-
2023
- 2023-04-04 EP EP23305488.1A patent/EP4442699A1/en not_active Withdrawn
-
2024
- 2024-04-03 WO PCT/EP2024/059076 patent/WO2024208910A1/en not_active Ceased
- 2024-04-03 EP EP24718103.5A patent/EP4688816A1/en active Pending
Also Published As
| Publication number | Publication date |
|---|---|
| WO2024208910A1 (en) | 2024-10-10 |
| EP4442699A1 (en) | 2024-10-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN112608933B (en) | A kind of high-purity preparation method of recombinant blue copper peptide precursor-oligopeptide | |
| CN113025675B (en) | Process for producing polypeptide | |
| CN116640743A (en) | A kind of endonuclease and its application | |
| CN112358530B (en) | Peptide tags, highly soluble recombinant nitrilases and their applications in the synthesis of pharmaceutical chemicals | |
| CN106604991A (en) | Modified beta-galactosidase | |
| CN116622795A (en) | Preparation method of L-amino acid ligase and its application in dipeptide synthesis | |
| CN113667707B (en) | Method for producing D-psicose from glucose | |
| CN106434699A (en) | SUMO and SUMO protease encoding gene and application thereof | |
| JP7105761B2 (en) | Methods for Affinity Purification of Recombinant Proteins Based on the Lectin Activity of Galectin CRDs | |
| CN105950593B (en) | Prokaryotic recombinant expression and preparation method of a lysyl endopeptidase | |
| EP4442699A1 (en) | Crd.vl thermostable protein domains with lectin-like properties derived from galectin 3 | |
| CN108148852A (en) | A kind of alginate lyase SHA-6 genes and application | |
| CN110540601B (en) | Recombinant PLB-hEGF fusion protein and application thereof | |
| CN107034202A (en) | A kind of N glycosyl transferases AaNGT and its application | |
| WO2025179727A1 (en) | Soluble intermediate of vosoritide, method for preparing intermediate and method for preparing vosoritide | |
| CN116284278B (en) | A molecular peptide mutant with high ester bond formation efficiency | |
| CN115975040B (en) | Bacteroides heparinase I fusion protein, its encoding gene, and preparation method | |
| CN118755746A (en) | Recombinant plasmid, construction method and prokaryotic expression method of μ-conotoxin peptide | |
| CN105732819A (en) | Carrier protein His6-H4-NLS-Tat-AHNP and preparation method | |
| CN111607004B (en) | A method for selectively protecting enzyme cleavage sites during trypsin digestion | |
| Asante-Appiah et al. | Purification of untagged retroviral integrases by immobilized metal ion affinity chromatography | |
| CN107746432A (en) | A kind of modified proteins of A β 42 and its expression and purification method | |
| CN108265042A (en) | A kind of preparation method of recombinant enterokinase | |
| CN106566819B (en) | A kind of low temperature halophilic alpha-amylase gene cloning, expression and separation and purification method | |
| CN103881997A (en) | Cubilose acid aldolase mutant as well as coding gene and application thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20251030 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR |