EP4649090A1 - Anti-unc5c antibodies - Google Patents
Anti-unc5c antibodiesInfo
- Publication number
- EP4649090A1 EP4649090A1 EP24701314.7A EP24701314A EP4649090A1 EP 4649090 A1 EP4649090 A1 EP 4649090A1 EP 24701314 A EP24701314 A EP 24701314A EP 4649090 A1 EP4649090 A1 EP 4649090A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- atl
- seq
- antibody
- unc5c
- optionally
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to antibodies and fragments thereof capable of binding to UNC5C, and particularly, although not exclusively to novel therapeutic antibodies. Methods for using anti-UNC5C antibodies in the treatment of neurodegenerative diseases are also described.
- the World Health Organization estimates that dementia is currently the seventh leading cause of death among all diseases and one of the major causes of disability and dependency among older people globally.
- AD Alzheimer’s disease
- AD is the most common cause of dementia affecting 1 in 14 individuals over 65 years old (Prince, M et al (2014)).
- AD is a progressive neurodegenerative disorder with brain atrophy leading to progressive cognitive impairment, including short term memory difficulty, impairment in expressive speech, visuospatial processing and executive (mental agility) processing) (Knopman, D.S., et al. (2021)).
- New therapies to Alzheimer’s disease are being actively sought to modify the course of the disease.
- Current candidates targeting beta-amyloid, Tau, and innate immunity in the brain have in some cases shown pharmacodynamic effects on pathological mechanisms in clinical trials but have yet to demonstrate convincing disease modification in late-stage clinical trials to date (Golde TE (2022)).
- Frontotemporal dementia is a common form of dementia in those younger than 65 years and is expected to increase in prevalence as the population ages (Rosso SM, et al. 2003).
- FTD is an umbrella term for a group of neurodegenerative diseases characterised by progressive deficits in behaviour, executive function, and language (Bang J, et al. 2015). Whilst our understanding of the pathophysiology has considerably improved in the past decade, the development of disease-modifying drugs has been suggested to remain years away (Panza, F., et al. (2020)).
- ALS Amyotrophic lateral sclerosis
- the present invention concerns novel antibodies to UNC5C.
- VH heavy chain variable
- VL light chain variable
- the present inventors identify a convergent heavy chain variable (VH) domain sequence that was present in multiple resilient individuals and therefore likely to have a protective function against neurodegeneration.
- VH was paired with a light chain variable (VL) domain and target deconvolution for the resulting antibody, ATL_5262, revealed UNC5C as its target. Further testing of this antibody showed that this antibody competes with netrin 1 , UNC5C’s ligand, for binding to UNC5C.
- the present inventors further identified candidate antibodies derived from ATL_5262 by modification of the heavy chain sequence.
- novel antibodies with improved properties include antibodies comprising the heavy chain of antibodies referred herein as ATL_0005262, ATL_0005998, ATL_0006001 , ATL_0006002, ATL_0006003, ATL_0006036, ATL_0006039, ATL_0006177, ATL_0006178, ATL_0006187, ATL_0006291 , ATL_0006530,
- ATL_0006537, ATL_0006538 and ATL_0006539 were shown to be particularly promising.
- the antibodies described herein are expected to improve or reverse neurodegeneration, for example in neurodegenerative diseases such as FTD, AD and ALS, by binding to UNC5C.
- the heavy chains described herein and antibodies derived therefrom were identified based on convergence in resilient individuals in cohorts of patients otherwise considered at risk of developing neurodegenerative disease. As such convergence is extremely unlikely by chance, the antibodies are to some extent “biologically validated” as likely to have therapeutic functions.
- the disclosure provides an isolated antibody or antibody fragment thereof which specifically binds to UNC5C protein or a fragment thereof, wherein the antibody mimics and/or competes with Netrin-1 for binding to UNC5C, optionally wherein competition with Netrin-1 is determined by ELISA.
- Embodiments of the first aspect may have any one or more of the following optional features.
- the isolated antibody may bind human and/or mouse UNC5C, for example the antibody may bind human UNC5C with an EC50 of at most 9.81 E-08 M, or at most 1 E-08M, or at most 5.5E-09M or at most 9.7E- 09M as assessed by ELISA (such as binding of plated rhUNC5C).
- the antibody may reduce UNC5C-mediated apoptosis.
- the antibody may reduce UNC5C-mediated neuronal apoptosis.
- the antibody may reduce (UNC5C mediated) apoptosis in induced pluripotent stem cell (iPSC)-derived neurons.
- the antibody may reduce (UNC5C mediated) apoptosis in neuroblastoma cells, e.g. S/7-SY5Ycells. Apoptosis may be measured by measuring caspase 3/7.
- the antibody may selectively bind to UNC5C over other one or more netrin receptors, for example the antibody may selectively bind to UNC5C over one or more (or all of): neogenin, DCC, and DSCAM, UNC5A, UNC5B, UNC5.
- the antibody may bind to UNC5C in accordance with SEQ ID NO: 99 and to an UNC5C T835M variant in accordance with SEQ ID NO: 110.
- the antibody may reduce beta-amyloid toxicity in neurons, for example the antibody may reduce cell death of beta-amyloid treated neurons in vitro and/or reduce a caspase 3/7 signal in response to betaamyloid induced cytotoxicity.
- the antibody may enhance synaptic health. Enhanced synaptic health may be assessed by: (i) an increased neuronal expression of one or more synaptic proteins selected from: PSD95, synaptophysin, synapsin-1 , synaptotagmin-1 , neurofilament-L, and GAP-43; and/or (ii) increased neuronal growth and/or branching; (iii) increase firing synchronicity and/or firing rate of neurons, e.g. the antibody may increase synchrony index and fire rate of motor neurons with a TDP43 Q331 K mutation.
- the antibody may improve the function and/or survival of dopaminergic neurons.
- An improvement in dopaminergic neuron function and/or survival may be assessed by an at least partial rescue, by the antibody, of the effects of UNC5C or netrin-1 haploinsufficiency on innervation by dopaminergic neurons to the medial prefrontal cortex, and/or dopamine content in the medial prefrontal cortex.
- the antibody may reduce neurodegeneration of dopaminergic neurons. This may be assessed by measuring neurodegeneration upon exposure to a neurotoxin such as 6-Hydroxydopamine (6-OHDA).
- the antibody may bind to the extracellular region of UNC5C.
- the antibody may bind to an epitope in the N terminal immunoglobulin domain of UNC5C (also referred to as “first immunoglobulin domain).
- the antibody may bind to one or more residues of UNC5C that are involved in binding of Netrin- 1 to UNC5C.
- the antibody may bind to an epitope in UNC5C comprising one or more of, or all of, the following residues: Thr89, Gln90, Gln102, Lys103, Val107, Asp108, Glu109, Arg110, Val111 , Ile118, Arg120 of UNC5C when numbered in accordance with SEQ ID NO: 99, optionally wherein the antibody binds to residues Thr89, Gln90, Gln102, Lys103, Val107, Glu109, Ile118, and Arg120of UNC5C when numbered in accordance with SEQ ID NO: 99.
- the antibody may comprise a heavy chain variable domain (VH) with the following CDRs: CDRH1 comprising amino acid sequence SEQ ID NO:20, CDRH2 comprising amino acid sequence SEQ ID NO:21 or SEQ ID NO:22, and CDRH3 comprising amino acid sequence SEQ ID NO:23, or a set of CDRs which contains one or two amino acid mutations, optionally substitutions, compared with the above set of CDRs.
- the antibody may have a VH comprising the CDRH1 , CDRH2 and CDRH3 or ATL_5262 or ATL6178, and variants thereof (e.g. ATL_6033, 6034, 6035, 6036, 6037, 6038, 6039).
- the antibody may have a heavy chain variable domain (VH) with the following framework sequences: HFWR1 of SEQ ID NQ:50, HFWR2 of SEQ ID NO:51 , HFWR3 of SEQ ID NO:55, and HFWR4 of SEQ ID NO:62, or framework sequences with one to five mutations, for example substitutions, compared to the framework sequences above.
- VH heavy chain variable domain
- the mutations in the framework sequences may be selected from the following positions in standard IMGT numbering: HFWR2: positions 40, 49, HFWR3: positions 80, 82, 86, and/or wherein the substitutions in the framework sequences are selected from the following positions in standard IMGT numbering: HFWR2: at positions 40: T40S, at position 49: R49G, HFWR3: at position 80: I80V, at position 82: T82K, at position 86: H86Q.
- the mutations in the framework sequences may not include a mutation at position 67 in standard IMGT numbering.
- the antibody may have a heavy chain variable domain (VH) with the following framework sequences: HFWR1 of SEQ ID NO:50; HFWR2 of SEQ ID NO:51 , 52, 53 or 54; HFWR3 of SEQ ID NO:55, 56, 57, 58, or 61 ; HFWR4 of SEQ ID NO:62.
- VH heavy chain variable domain
- the antibody may have a heavy chain variable domain (VH) with the following framework sequences: HFWR1 of SEQ ID NQ:50; HFWR2 of SEQ ID NO: 52; HFWR3 of SEQ ID NO: 61 ; and HFWR4 of SEQ ID NO:62.
- the antibody may have a heavy chain variable domain (VH) comprising a sequence selected that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with a sequence selected from SEQ ID Nos: 1 (ATL_5262 VH), 5 (ATL_0006036_VH), 8 (ATL_0006039_VH), 91 (ATL_0006177_VH), and 93 (ATL_0006178_VH).
- VH heavy chain variable domain
- the antibody may have a heavy chain variable domain (VH) comprising a sequence that has at least 80%, at least 85%, at least 90%, or a least 95% sequence identity with a sequence selected from: SEQ ID NO: 91 (ATL_6177 VH); and SEQ ID NO:93 (ATL_6178 VH).
- VH heavy chain variable domain
- the antibody may have a heavy chain variable domain (VH) comprising CDRH1 , CDRH2, and CDRH3 within a germline framework, provided that position 67 in standard IMGT numbering is Q.
- VH heavy chain variable domain
- the antibody may comprise a heavy chain variable domain (VH) with the following CDRs: CDRH1 comprising amino acid sequence SEQ ID NO: 115 or 116, CDRH2 comprising amino acid sequence SEQ ID NO: 117 or 118, and CDRH3 comprising amino acid sequence SEQ ID NO: 119 or 120, optionally wherein the antibody comprises a heavy chain variable domain (VH) with the CDRs of ATL_6187 VH (SEQ ID NO: 115, 117 and 119) or the CDRs of ATL_6191 VH (SEQ ID NO: 116, 118 and 120).
- VH heavy chain variable domain
- the antibody may have a heavy chain variable domain (VH) with the following framework sequences: HFWR1 of SEQ ID NO: 50; HFWR2 of SEQ ID NO: 52 or 195; HFWR3 of SEQ ID NO: 196 or 197; HFWR4 of SEQ ID NO: 198 or 62: or framework sequences comprising 1 to 5 mutations, such as substitutions, compared to these framework sequences.
- the antibody may comprise a heavy chain variable domain (VH) with the HFWRs of ATL_6187 VH (SEQ ID NO:50, 52, 196, 198) or the HFWRs of ATL_6191 VH (SEQ ID NO: 50, 195, 197, 62).
- the heavy chain variable domain may comprise a sequence selected that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with a sequence selected from SEQ ID NOs: 112 (ATL_0006187 VH), and 113 (ATL_0006191 VH).
- VL light chain variable domain
- CDRL1 comprising amino acid sequence SEQ ID NO:24, 27, 30, 31 or 32
- CDRL2 comprising amino acid sequence SEQ ID NO:34
- CDRL3 comprising amino acid sequence SEQ ID NQ:40, 43, 46, 47, or a set of CDRs which contains one, two or three amino acid mutations, for example substitutions compared with the above set of CDRs.
- the antibody may have a VL with the CDRs of any of ATL_5262; 6033; 6034; 6035; 6036; 6037; 6038; 6039; 6177; 6178; 5998; 6001 ; 6002; and 6003, and homologues 6187 and 6191.
- the isolated antibody may have a light chain variable domain (VL) with the following framework sequences: LFWR1 of SEQ ID NO:63; 66; LFWR2 of SEQ ID NO:71 ; 73; 75; LFWR3 of SEQ ID NO:77; 80; and LFWR4 of SEQ ID NO:85; 87; 89; or a set of FWRs which contains one to five amino acid substitutions compared with the above set of FWR.
- VL light chain variable domain
- the antibody may have a VL with the LFWR of any of ATL_5262; 6033; 6034; 6035; 6036; 6037; 6038; 6039; 6177; 6178; 5998; 6001 ; 6002; and 6003, and homologues ATL6187 and 6191 .
- the antibody may have a light chain variable domain (VL) comprising a sequence selected that has at least 80%, at least 85%, at least 90%, or a least 95% sequence identity with a sequence selected from SEQ ID Nos: 9 (ATL_5262 VL), 12 (ATL_5998 VL), 15 (ATL_6001 VL), 16 (ATL_6002 VL), 17 (ATL_6003 VL).
- VL light chain variable domain
- the antibody may have a light chain variable domain (VL) comprising a sequence that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with a sequence selected from: SEQ ID: 9 (ATL_5262 VL), SEQ ID NO: 16 (ATL_6002 VL); and SEQ ID NO:17 (ATL_6003 VL).
- VL light chain variable domain
- VH residuesTyr55, Gly63, Thr64, Thr65, Asn66, Ser74, Arg108, Met110 may interact with one or more residues of UNC5C; and/or one or more of (or all of) VL residues Tyr38, Seri 07, Tyr108, Ser109, Thr114, may interact with one or more residues of UNC5C.
- the antibody may comprise a VH with: (i) at position 55: Tyr, at position 63: Gly, at position 64: Thr, at position 65: Thr, at position 66: Asn, at position 74: Ser, at position 108: Arg, and at position 110: Met, or (ii) a sequence with conservative amino acid substitutions at one or more of these positions.
- the antibody may comprise a VL with: at position 38: Tyr, at position 107: Ser, at position 108: Tyr, at position 109: Ser, at position 114: Thr, or a sequence with conservative amino acid substitutions at one or more of these positions.
- the antibody may have a VH with at least 80% sequence identity with the VH of SEQ ID NO: 1 (ATL_5262 VH), and a VL with at least 80% sequence identity with the VL of SEQ ID: 9 (ATL_5262 VL), wherein: (a) VH residue 66 is Asn, optionally wherein Asn66 interacts with Vai 107 of UNC5C; and/or (b) VH residues 55, 66, 108 and 110 are respectively Tyr, Asn, Arg and Met, optionally wherein Tyr55, Asn66, Arg108, and/or Met110 interact with Glu109 of UNC5C; and/or (c) VH residues 108 is Arg and/or residue 110 is Met, optionally wherein Arg108, and/or Met110 interact with Ile118 of UNC5C; and/or (d) VH residues 55, 64, 65 are respectively Tyr, Thr and Thr, optionally wherein Tyr55, Thr64, and/or Thr65 interacts
- the antibody may comprise a heavy chain variable domain (VH) with the following CDRs: CDRH1 comprising amino acid sequence SEQ ID NO: 142-149;_CDRH2 comprising amino acid sequence SEQ ID NO: 150-158, and_CDRH3 comprising amino acid sequence SEQ ID NO: 159-168.
- VH heavy chain variable domain
- the antibody may comprise a VH with the CDRs of any of the antibodies ATL_6530 (SEQ ID NO:142, 150, 159); ATL_6531 (SEQ ID NO:143, 151 , 160); ATL_6532 (SEQ ID NO: 144, 152, 161); ATL_6533 (SEQ ID NO:145, 153, 162); ATL_6534 (SEQ ID NO:144, 152, 163); ATL_6535 (SEQ ID NO: 143, 154, 164); ATL_6536 (SEQ ID NO:146, 155, 165); ATL_6537 (SEQ ID NO:147, 156, 166); ATL_6538 (SEQ ID NO:148, 157, 167); ATL_6539 (SEQ ID NO:149, 158, 168).
- ATL_6530 SEQ ID NO:142, 150, 159
- ATL_6531 SEQ ID NO:143, 151 , 160
- ATL_6532 S
- the antibody may have a heavy chain variable domain (VH) with the following framework sequences: HFWR1 of SEQ ID NO: 199, 202, 205, 209, 212, 213, 216, 220, 224, 227; HFWR2 of SEQ ID NO: 200, 203, 206, 210, 214, 217, 221 , 225, 228; HFWR3 of SEQ ID NO: 201 , 204, 207, 211 , 215, 218, 222, 226, 229; HFWR4 of SEQ ID NO: 62, 208, 219, 223,
- the antibody may have a heavy chain variable domain (VH) with the framework sequences of any of the antibodies ATL_6530 (SEQ ID NO:199, 200, 201 , 62); ATL_6531 (SEQ ID NO:202, 203, 204, 62); ATL_6532 (SEQ ID NO:205, 206, 207, 208); ATL_6533 (SEQ
- the antibody may have a heavy chain variable domain (VH) comprising a sequence selected that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with a sequence selected from SEQ ID NOs: 122 (ATL_0006530 VH); 123 (ATL_0006531 VH); 124 (ATL_0006532 VH); 125 (ATL_0006533 VH); 126 (ATL_0006534 VH); 127 (ATL_0006535 VH); 128 (ATL_0006536 VH); 129 (ATL_0006537 VH); 130 (ATL_0006538 VH).
- the antibody may have a heavy chain variable domain (VH) comprising a sequence that has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with a sequence selected from: SEQ ID NO: 124 (ATL_6532 VH); SEQ ID NO: 125 (ATL_6533 VH).
- the antibody may comprise a light chain variable domain (VL) with the following CDRs: CDRL1 comprising amino acid sequence SEQ ID NO: 169-176; CDRL2 comprising amino acid sequence SEQ ID NO: 177-183; CDRL3 comprising amino acid sequence SEQ ID NO: 184-193.
- VL light chain variable domain
- the antibody may comprise a VL with the CDRs of any of the antibodies ATL_6530 (SEQ ID NO:169, 177, 184);
- ATL_6531 (SEQ ID NO:170, 178, 185); ATL_6532 (SEQ ID NO:171 , 177, 186); ATL_6533 (SEQ ID NO:
- ATL_6534 SEQ ID NO:169, 177, 188
- ATL_6535 SEQ ID NO:172, 179, 189
- ATL_6536 (SEQ ID NO:173, 180, 190); ATL_6537 (SEQ ID NO:174, 181 , 191); ATL_6538 (SEQ ID NO:
- ATL_6539 SEQ ID NO:176, 183, 193.
- the antibody may further have a light chain variable domain (VL) with the following framework sequences: LFWR1 of SEQ ID NO: 230 to 237 and 68; LFWR2 of SEQ ID NO: 239 to 246; LFWR3 of SEQ ID NO: 247 to 255; and LFWR4 of SEQ ID NO: 256 to 258.
- VL light chain variable domain
- the antibody may comprise a VL with the FWRs of any of the antibodies ATL_6530 (SEQ ID NO:230, 238, 247, 256); ATL_6531 (SEQ ID NO:231 , 239, 248, 257); ATL_6532 (SEQ ID NO:232, 240, 249, 258); ATL_6533 (SEQ ID NO:230, 241 , 247, 256); ATL_6534 (SEQ ID NO:233, 238, 250, 256); ATL_6535 (SEQ ID NO:234, 242, 251 , 257); ATL_6536 (SEQ ID NO:68, 243, 252, 257); ATL_6537 (SEQ ID NO:235, 244, 253, 256); ATL_6538 (SEQ ID NO:236, 245, 254, 256); ATL_6539 (SEQ ID NO:237, 246, 255, 256).
- ATL_6530 SEQ ID NO:230, 238, 247, 256
- the light chain variable domain (VL) may comprise a sequence selected that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with a sequence selected from SEQ ID NO: 132- 141 (ATL6530-6539 VL).
- the antibody may have a light chain variable domain (VL) comprising a sequence that has at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with a sequence selected from: SEQ ID NO: 134 (ATL_0006532); or SEQ ID NO: 135 (ATL_0006533).
- the antibody may comprise an scFv antibody molecule, a nanobody, an antibody constant region, or a whole antibody.
- the antibody may be a monoclonal antibody and/or wherein the antibody is a whole antibody and/or wherein the antibody is an lgG1 or variant thereof, optionally wherein the antibody is an lgG1 variant L234A/L235A (LALA).
- the disclosure provides an isolated nucleic acid which comprises a nucleotide sequence encoding an antibody or antibody fragment thereof, including a VH or VL domain, as described herein.
- the disclosure provides a vector or set of vectors comprising the nucleic acid according to the preceding aspect.
- the disclosure provides host cell comprising the vector or set of vectors according to the sixth aspect, or a host cell in vitro transformed with a nucleic acid of the fifth aspect.
- composition comprising an antibody or fragment thereof, including an antibody VH domain or antibody VL domain, as described herein, and at least one additional component.
- the composition may comprise a pharmaceutically acceptable excipient, vehicle or carrier.
- the disclosure provides a method of producing an antibody or fragment thereof, the method comprising culturing host cells according to the fifth aspect under conditions for production of said antibody or fragment thereof.
- the method may further comprise isolating and/or purifying said antibody or fragment thereof.
- the method may further comprise formulating the antibody or fragment thereof into a composition including at least one additional component.
- the disclosure provides a method of treating a disease or disorder in a subject, comprising administering to the subject an effective amount of an isolated antibody or antibody fragment as described herein.
- the disclosure provides method of reducing apoptosis in a cell expressing UNC5C, the method comprising contacting the cell with an antibody or antibody fragment as described herein.
- the cell may be a neuron.
- the contacting may be performed in vitro.
- the disclosure provides the use of an antibody or fragment thereof that binds UNC5C, in the manufacture of a medicament for treatment of a neurodegenerative disease or disorder.
- the antibody or fragment thereof may be according to any embodiment as described herein.
- the disclosure provides a method of treatment of a neurodegenerative disease or disorder, the method comprising administering an antibody or fragment thereof that binds UNC5C in a therapeutically effective amount, to a patient with the disease or disorder or at risk of developing the disease or disorder.
- the antibody or fragment thereof may be an antibody as described herein.
- the disclosure provides an antibody or fragment thereof that binds UNC5C, for use in the treatment of a neurodegenerative disease or disorder.
- the antibody or fragment thereof may be an antibody or fragment thereof as described herein.
- a neurodegenerative disorder according to any aspect such as any of the 12 th , 13 th or 14 th aspects may be selected from: frontotemporal dementia (FTD), Alzheimer’s disease (AD), Huntington’s Disease (HD), Parkinson’s disease (PD), amyotrophic lateral sclerosis (ALS), human immunodeficiency virus (HlV)-induced encephalitis, Chronic traumatic encephalopathy (CTE), vascular dementia, prion diseases, Lewy body disease, Spinal muscular atrophy (SMA), Motor Neuron Disease (MND), such as amyotrophic lateral sclerosis (ALS), progressive supranuclear palsy (PSP), spinocerebellar ataxias (SCA) types 1 , 2, 6, 7 and 17, Machado-J
- FDD fronto
- the invention includes the combination of the aspects and preferred features described except where such a combination is clearly impermissible or expressly avoided.
- an isolated antibody or antibody fragment thereof which comprises a heavy chain variable domain (VH) with the following CDRs: CDRH1 comprising amino acid sequence SEQ ID NO:20, CDRH2 comprising amino acid sequence SEQ ID NO:21 or SEQ ID NO:22, and CDRH3 comprising amino acid sequence SEQ ID NO:23.
- the antibody may comprise a heavy chain variable domain (VH) with CDRs with one or two amino acid substitutions compared with the following CDRs: CDRH1 comprising amino acid sequence SEQ ID NQ:20, CDRH2 comprising amino acid sequence SEQ ID NO:21 or SEQ ID NO:22, and CDRH3 comprising amino acid sequence SEQ ID NO:23.
- an isolated antibody or antibody fragment thereof which specifically binds to UNC5C protein or a fragment thereof, wherein the antibody comprises a heavy chain variable domain (VH) with the following CDRs: CDRH1 comprising amino acid sequence SEQ ID NO: 115 or 116; CDRH2 comprising amino acid sequence SEQ ID NO: 117 or 118; and CDRH3 comprising amino acid sequence SEQ ID NO: 119 or 120.
- the antibody may comprise a heavy chain variable domain (VH) with the CDRs of ATL_6187 VH (SEQ ID NO: 115, 117 and 119) or the CDRs of ATL_6191 VH (SEQ ID NO: 116, 118 and 120).
- the antibody may mimic and/or compete with Netrin-1 for binding to UNC5C.
- the antibody may have any of the features described above in relation to the first aspect.
- an isolated antibody or antibody fragment thereof which specifically binds to UNC5C protein or a fragment thereof, wherein the antibody comprises a heavy chain variable domain (VH) with the following CDRs: CDRH1 comprising amino acid sequence SEQ ID NO: 142-149; CDRH2 comprising amino acid sequence SEQ ID NO: 150-158, and CDRH3 comprising amino acid sequence SEQ ID NO: 174-183.
- VH heavy chain variable domain
- the antibody may comprise a VH with the CDRs of any of the antibodies ATL_6530 (SEQ ID NO:142, 150, 159); ATL_6531 (SEQ ID NO:143, 151 , 160); ATL_6532 (SEQ ID NO: 144, 152, 161); ATL_6533 (SEQ ID NO:145, 153, 162); ATL_6534 (SEQ ID NO:144, 152, 163); ATL_6535 (SEQ ID NO: 143, 154, 164); ATL_6536 (SEQ ID NO:146, 155, 165); ATL_6537 (SEQ ID NO:147, 156, 166); ATL_6538 (SEQ ID NO:148, 157, 167); ATL_6539 (SEQ ID NO:149, 158, 168).
- the antibody may mimic and/or compete with Netrin-1 for binding to UNC5C.
- the antibody may have any of the features described above in relation to the first aspect.
- an isolated antibody or antibody fragment thereof which specifically binds to UNC5C protein or a fragment thereof, for use in the treatment of a neurodegenerative disorder.
- the antibody may mimic and/or compete with Netrin-1 for binding to UNC5C.
- the antibody may comprise a heavy chain variable domain (VH) with the following CDRs: CDRH1 comprising amino acid sequence SEQ ID NQ:20, CDRH2 comprising amino acid sequence SEQ ID NO:21 or SEQ ID NO:22, and CDRH3 comprising amino acid sequence SEQ ID NO:23.
- VH heavy chain variable domain
- Embodiments of any of the above aspects may have any one or more of the following optional features.
- the antibody may bind the same binding site on UNC5C as Netrin-1.
- the antibody may have an epitope that at least partially overlaps the binding site of Netrin-1 .
- the antibody of any aspect may comprise a heavy chain variable domain (VH) with CDRs that have at least 70%, 75%, 80%, 85% or 90% sequence identity with the following CDRs: CDRH1 comprising amino acid sequence SEQ ID NQ:20, CDRH2 comprising amino acid sequence SEQ ID NO:21 or SEQ ID NO:22, and CDRH3 comprising amino acid sequence SEQ ID NO:23.
- VH heavy chain variable domain
- the antibody may have CDRHs that have the same lengths as those CDRHs.
- the antibody of any aspect may comprise a heavy chain variable domain (VH) with the CDR of the heavy chain of antibodies ATL_5262, ATL_0006036, ATL_0006039, ATL_0006177 or ATL_0006178, or a set of CDRs with one two three amino acid substitutions or at least 70%, 75%, 80%, 85% or 90% sequence identity with these CDRs.
- the one or two substitutions may comprise or consist of a substitution at the following residue within the CDRs, using the standard numbering of IMGT: 58 in CDRH2.
- the substitution may be N58Y.
- the antibody may have a heavy chain variable domain (VH) with the following framework sequences: HFWR1 of SEQ ID NQ:50, HFWR2 of SEQ ID NO:51 , HFWR3 of SEQ ID NO:55, and HFWR4 of SEQ ID NO:62, or framework sequences with one to five substitutions compared to the framework sequences above.
- the substitutions in the framework sequences may be selected from the following positions in standard IMGT numbering: HFWR2: positions 40, 49, HFWR3: positions 80, 82, 86.
- substitutions in the framework sequences may be selected from the following positions in standard IMGT numbering: HFWR2: at positions 40: T40S, at position 49: R49G, HFWR3: at position 80: I80V, at position 82: T82K, at position 86: H86Q.
- the substitutions in the framework sequences may not include a substitution at position 67 in standard IMGT numbering. In other words, the Q at position 67 may be maintained.
- the present inventors have found that maintaining the Q at position 67 in HFWR3 improved binding affinity to UNC5C.
- removing the N at position 58 in the CDRH2 sequence may remove a potential sequence liability (position that may be problematic during production of the antibody).
- the present inventors have found that removing the T at position 82 in the HFWR3 reduced the risk of aspartate isomerisation. They have further found that replacing this T with K improved binding affinity of the antibody to UNC5C.
- substitutions at positions 40, 49 (in HFWR2), 80, 86 (in HFWR3), particularly to replace them with the residues on the corresponding germline sequence, may reduce immunogenicity, improve antibody expression and stability.
- the antibody may have a heavy chain variable domain (VH) with the following framework sequences: HFWR1 of SEQ ID NO:50; HFWR2 of SEQ ID NO:51 , 52, 53 or 54; HFWR3 of SEQ ID NO:55, 56, 57, 58, or 61 ; HFWR4 of SEQ ID NO:62.
- the antibody may have a heavy chain variable domain (VH) with the following framework sequences: HFWR1 of SEQ ID NQ:50; HFWR2 of SEQ ID NO: 52; HFWR3 of SEQ ID NO: 61 ; and HFWR4 of SEQ ID NO:62.
- the antibody may have a heavy chain variable domain (VH) comprising a sequence selected that has a least 95% sequence identity with a sequence selected from SEQ ID Nos: 1 (ATL_5262 VH), 5 (ATL_0006036_VH), 8 (ATL_0006039_VH), 91 (ATL_0006177_VH), and 93 (ATL_0006178_VH).
- VH heavy chain variable domain
- the antibody may have a heavy chain variable domain (VH) comprising a sequence that has a least 95% sequence identity with a sequence selected from: SEQ ID: 91 (ATL_6177 VH) and SEQ ID NO:93 (ATL_6178 VH).
- ATL_6177 and ATL_6178 are expected to have improved stability and binding potency compared with other antibodies described herein, due to the particular sequence of the VH of these antibodies (SEQ ID Nos: 91 and 93 in Table 1 , or as described in Figure 22A).
- ATL_5262 VH is described in Table 1 , or as described in Figure 21 A. As described further below and in Figure 21 A, ATL_5262 VH has the same sequence as ATL_0005996_VH, ATL_0005997_VH, ATL_0005998_VH,
- the antibody may comprise a heavy chain variable domain that has a sequence selected from SEQ ID Nos: 1 (ATL_5262 VH), 5 (ATL_0006036_VH), 8 (ATL_0006039_VH), 91 (ATL_0006177_VH), and 93 (ATL_0006178_VH).
- the antibody may have a heavy chain variable domain (VH) comprising CDRH1 , CDRH2, and CDRH3 within a germline framework, provided that position 67 in standard IMGT numbering is Q.
- the antibody may bind human and/or mouse UNC5C.
- the antibody may bind human UNC5C with an EC50 of at most 9.81 E-08 M, or at most 1 E-08M, or at most 5.5E-09M as assessed by ELISA (such as binding of plated rhUNC5C).
- the antibody may reduce UNC5C-mediated apoptosis.
- the antibody may reduce UNC5C-mediated neuronal apoptosis.
- the antibody may reduce apoptosis in induced pluripotent stem cell (iPSC)-derived neurons. Reduction in apoptosis can be verified by comparison to a suitable control (e.g.
- the antibody may have an effect on synaptic health.
- the antibody may increase synaptic plasticity.
- the antibody may increase one or more measures of synaptic health (including but not limited to e.g. plasticity), such as the number of processes per cell, length of neurite outgrowth and/or branching.
- Antibodies according to the disclosure may improve neuron survival and/or synaptic functions.
- antibodies of the disclosure may reduce amyloid toxicity.
- Antibodies of the disclosure may reduce cell death of amyloid treated neurons in vitro. Cell death may be as measured by measuring a caspase3/7 signal in response to beta amyloid induced cytotoxicity.
- Antibodies of the disclosure may increase the expression of one or more synaptic proteins, such as e.g. GAP-43.
- Antibodies of the disclosure may at least partially rescue neuronal cell death and axonal damage caused by netrin-1 depletion.
- Antibodies of the disclosure may improve neuron connectivity and/or firing rate and/or synchrony in motor neurons.
- Antibodies of the disclosure may improve neuron connectivity and/or firing rate and/or synchrony in motor neurons of subjects with ALS. Antibodies of the disclosure may improve the function and/or survival of dopaminergic neurons. For example, antibodies of the disclosure may at least partially rescue the effects of UNC5C or netrin-1 haploinsufficiency on innervation by dopaminergic neurons to the medial prefrontal cortex, and/or dopamine content in the medial prefrontal cortex. This may be assessed by determining an increased response to amphetamine in Netrin 1 haploinsufficient mice treated with antibodies of the disclosure. Antibodies of the disclosure may reduce neurodegeneration of dopaminergic neurons.
- a neurotoxin such as 6-Hydroxydopamine (6-OHDA)
- 6-OHDA 6-Hydroxydopamine
- methods of improving the survival and/or function (including synaptic function) of motor and/or dopaminergic neurons in a subject in need thereof comprising administering an antibody of the disclosure in a therapeutically effective amount.
- methods of treating a disease or disorder associated with motor neuron and/or dopaminergic neuron dysfunction or death comprising administering an antibody of the disclosure in a therapeutically effective amount.
- the antibody may selectively bind to UNC5C over other one or more netrin receptors.
- the antibody may selectively bind to UNC5C over one or more (or all of): neogenin, DCC, and DSCAM, UNC5A, UNC5B, UNC5.
- Selective binding may refer to preferential binding (e.g. lower EC50) for one species (e.g. UNC5C) over another (e.g. other netrin receptor), or to no detectable binding to comparative targets (e.g. other netrin receptors).
- Selective binding may be verified by biolayer interferometry analysis as described herein.
- the antibody may bind to monomeric UNC5C and/or dimeric UNC5C and/or homodimeric UNC5C.
- the antibody may bind to monomeric UNC5C.
- the antibody may comprise an scFv antibody molecule, a nanobody, an antibody constant region, or a whole antibody.
- the antibody may be a whole antibody.
- the antibody may be an IgG 1 or variant thereof, optionally wherein the antibody is an lgG1 variant L234A/L235A (LALA).
- the antibody may further comprise a light chain variable domain (VL) with the following CDRs: CDRL1 comprising amino acid sequence SEQ ID NO:24, 31 or 32, CDRL2 comprising amino acid sequence SEQ ID NO:34, and CDRL3 comprising amino acid sequence SEQ ID NO:40, 47, or a set of CDRs which contains one, two or three amino acid substitutions compared with the above set of CDRs.
- VL light chain variable domain
- the antibody of any aspect may comprise a light chain variable domain (VL) with CDRs that have at least 70%, 75%, 80%, 85% or 90% sequence identity with the following CDRs: CDRL1 comprising amino acid sequence SEQ ID NO:24, 31 , or 32, CDRL2 comprising amino acid sequence SEQ ID NO:34, and CDRL3 comprising amino acid sequence SEQ ID NQ:40 or 47.
- VL light chain variable domain
- CDRL1 comprising amino acid sequence SEQ ID NO:24, 31 , or 32
- CDRL2 comprising amino acid sequence SEQ ID NO:34
- CDRL3 comprising amino acid sequence SEQ ID NQ:40 or 47.
- the antibody may have CDRLs that have the same lengths as those CDRLs.
- the antibody of any aspect may comprise a light chain variable domain (VL) with the CDR of the light chain of antibodies ATL_5262, ATL_0006002 or ATL_0006003, or a set of CDRs with one two three amino acid substitutions or at least 70%, 75%, 80%, 85% or 90% sequence identity with these CDRs.
- the antibody of any aspect may comprise a light chain variable domain (VL) with the CDR of the light chain of antibodies ATL_5262 or ATL_0006002, or a set of CDRs with one two three amino acid substitutions or at least 70%, 75%, 80%, 85% or 90% sequence identity with these CDRs.
- the CDRL1 , CDRL2 and CDRL3 of the VL domain may be within a germline framework.
- the antibody may further comprises a light chain variable domain (VL) with the following framework regions: LFWR1 comprising any of amino acid sequences SEQ ID NO: 63 to 70, LFWR2 comprising any of amino acid sequences SEQ ID NO:71 to 76, LFWR3 comprising any of amino acid sequences SEQ ID NO:77 to 84, and LFWR4 comprising any of amino acid sequences SEQ ID NO:85 to 90, or a set of FWRs which contains one to five amino acid substitution compared with the above set of FWRs.
- VL light chain variable domain
- the antibody may have a light chain variable domain (VL) with the following framework sequences: LFWR1 of SEQ ID NO:63; LFWR2 of SEQ ID NO:71 ; LFWR3 of SEQ ID NO:77; and LFWR4 of SEQ ID NO:85 or 87; or a set of FWRs which contains one to five amino acid substitutions compared with the above set of FWR.
- VL light chain variable domain
- the antibody may have a light chain variable domain (VL) comprising a sequence selected that has a least 95% sequence identity with a sequence selected from SEQ ID Nos: 9 (ATL_5262 VL), or 10 to 19.
- the antibody may have a light chain variable domain (VL) with the following framework sequences: LFWR1 of SEQ ID NO:63; LFWR2 of SEQ ID NO:71 ; LFWR3 of SEQ ID NO:77; and LFWR4 of SEQ ID NO:85 or 87; or a set of FWRs which contains one to five amino acid substitutions compared with the above set of FWR.
- the antibody may have a light chain variable domain (VL) comprising a sequence that has a least 95% sequence identity with a sequence selected from: SEQ ID: 9 (ATL_5262 VL), 16 (ATL_6002 VL) and SEQ ID NO:17 (ATL_6003 VL).
- VL light chain variable domain
- Figure 1 shows schematically a process for unbiased antibody discovery.
- Figure 2 shows results of ELISA assays for binding of antibodies identified in FTD resilient individuals to recombinant UNC5C.
- the pool of antibodies tested consisted of 18 antibodies identified from a FTD cohort, one antibody from a Huntington cohort, and an anti-PDL1 antibody, previously used as a positive control in a Retrogenix target deconvolution assay.
- the antibody, ATL_5262 binds to UNC5C.
- the blue bars indicate raw absorbance signals to recombinant UNC5C and the orange bars represent absorbance signals to an irrelevant protein, lysozyme.
- Figure shows absorbance at 450nm.
- the anti-Fc tag bars show the results for an anti-Fc-HRP treated well which controls that the UNC5C is correctly coated on the assay plate.
- Figure 3 shows the presence of UNC5C antibodies in subjects who are resilient to neurodegeneration in different neurodegenerative disease cohorts.
- UNC5C antibodies were found in resilient centenarians (>100 year old subjects with no symptoms of neurodegeneration); resilient Alzheimer’s disease (AD) patients (a resilient Alzheimer's disease subject showing slow cognitive progression), Frontotemporal dementia (FTD) patients (three subjects with resilience for FTD - carriers of high risk mutations and older age but no progression to FTD), Parkinson’s disease (PD) patients (prodromal REM sleep behaviour disorder (RBD) but no Parkinson's diagnosis), and cognitively healthy controls (predominantly individuals over 60 years of age).
- AD Alzheimer’s disease
- FTD Frontotemporal dementia
- PD Parkinson’s disease
- RBD cognitive REM sleep behaviour disorder
- Figure 4 shows the results of a Netrin 1 competition assay.
- ELISA plates were coated with rhUNC5C (recombinant human UNC5C) and preincubated with His-tagged recombinant Netrin 1 prior to adding ATL_5262 or control antibody ATL_5338.
- A. Netrin 1 was detected using an anti-His (horseradish peroxidase) HRP antibody.
- Antibody (ATL_5262 or control) was detected by anti-F(ab)’2-HRP detection. Assays were set up in duplicate whereby one replicate had Netrin 1 binding detected with anti- His-HRP (A) and the second replicate was used to determine ATL_0005262 antibody binding using the anti-Fab'2-HRP detection.
- B. Figure shows absorbance at 450nm.
- Figure 5 shows the results of a concentration-dependent Netrin 1 competition assay.
- ELISA plates were coated with rhUNC5C and preincubated with a 12-point dilution series of His-tagged recombinant Netrin 1 (starting at 3nM) prior to adding ATL_5262.
- Netrin 1 was detected using anti-His HRP detection and is shown in the figure as “Netrin 1 signal (+ ATL_5262)”.
- ATL_5262 was detected using anti-F(ab)’2-HRP detection and is shown in the figure as “ATL_0005262 signal (+ Netrinl)”.
- Control wells contained Netrin 1 alone. Data represented as percentage of maximum absorbance signal.
- Figure 6 shows the results of a Netrin 1 competition assay.
- ELISA plates were coated with rhUNC5C and preincubated with ATL_5262 or control antibody ATL_5338 prior to adding His-tagged recombinant Netrin 1.
- Netrin 1 was detected using anti-His HRP detection and is shown in the figure as “Netrin signal (+ ATL_0005262)” or “Netrin signal (+ ATL_00005338)”.
- ATL_5262 was detected using anti-F(ab)’2-HRP detection.
- Figure shows absorbance at 450nm.
- Figure 7 shows binding of ATL_5262 to recombinant human (rh) UNC5C (A), recombinant mouse (rm) UNC5C (B), and to lysozyme (C), using ELISA.
- Figure shows absorbance at 450nm.
- Figure 8 shows (A) a VH alignment of ATL_5262 and ATL_5262 homologues identified across neurodegeneration cohorts in resilient individuals.
- Figure shows IMGT numbering.
- A shows sequences of antibodies described herein (in particular, VH of ATL_0005262, SEQ ID NO: 1 ; VH of ATL_0006187, SEQ ID NO: 112; VH of ATL_0006191 , SEQ ID NO: 113), with variable positions in the heavy chain highlighted.
- B-1 to B-4) show the heavy chain sequences of the antibodies in (A) as well as ATL_6178 (VH of ATL_6178, SEQ ID NO: 93), aligned by IMGT position numbering.
- ATL_5262 and ATL_6178 have the same VL. Homologues were identified based on VH alone so only VH sequences are shown.
- Figure 9 illustrates a workflow for a 2-week and 4-week stability study and a freeze-thaw (3x FT) stability study for ATL_5262.
- Quality control (QC) analysis was performed using size exclusion high performance liquid chromatography (SEC-HPLC), sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS - PAGE); Capillary electrophoresis sodium dodecyl sulfate (CE-SDS) capillary isoelectric focusing (clEF); dynamic light scattering (DLS); and binding ELISA.
- SEC-HPLC size exclusion high performance liquid chromatography
- SDS - PAGE sodium dodecyl sulfate-polyacrylamide gel electrophoresis
- CE-SDS Capillary electrophoresis sodium dodecyl sulfate
- clEF capillary isoelectric focusing
- DLS dynamic light scattering
- binding ELISA binding ELISA
- Figure 10 shows the results of a thermal shift assay for ATL_5262 at 1 (left) and 5mg/ml (right) (ratio of unfolded-to-folded protein as a function of temperature).
- Figure 11 shows electropherograms of the charge variants of ATL_5262 tested by clEF two weeks (A) and 4 weeks (B) after storage at the indicated temperatures (-80 °C, 4 °C, and 40°C).
- C. is a zoomed-in version of A and B showing the acidic species on the left-hand side of the graphs.
- Figure 12 shows SEC-HPLC chromatograms for ATL_5262 after 2 weeks (Figure 11A) or 4 weeks ( Figure 11 B) at the indicated temperatures (-80 °C, 4 °C, and 40°C).
- Figure 13 shows the results of an SDS-PAGE for ATL_5262 after 2 weeks (A) or 4 weeks (B) at the indicated temperatures (-80 °C, 4 °C, and 40°C) or after a 3x FT study (B).
- FT Freeze Thaw
- NIST NIST mAb control
- R Reduced
- NR Non-Reduced.
- Figure 14 shows the results of CE-SDS for ATL_5262 after 2 weeks (A) non-reduced and (C) reduced samples) or 4 weeks (B) non-reduced and (D) reduced samples at the indicated temperatures (-80, +4 and +40C)
- Figure 15 shows the results of an ELISA testing the binding of ATL_5262 to rhUNC5C after 2 weeks (A) or 4 weeks (B) at the indicated temperatures (-80 °C, 4 °C, and 40°C) or after a 3x FT study (B).
- Figure 16 shows the results of an ELISA testing the binding of different VH variants of ATL_5262 to rhUNC5C.
- ATL_5338 was included as a negative control.
- Figure shows absorbance at 450nm.
- Figure 17 shows the results of an ELISA testing the binding of different VH variants of ATL_5262 to rhUNC5C (A), rmUNC5C (B), and lysozyme (C).
- ATL_5338 was included as a negative control.
- ATL_6002 and ATL_6003 were included for comparison.
- Figure shows absorbance at 450nm.
- Figure 18 shows the results of an ELISA testing the binding of different VH variants of ATL_5262 to Fc tagged rhUNC5C (A), or His-tagged rhUNC5C (B).
- ATL_5338 was included as a negative control.
- ATL_6002 and ATL_6003 were included for comparison.
- Figure shows absorbance at 450nm.
- Figure 19 shows the results of an ELISA testing the binding of different VH variants of ATL_5262 to rhUNC5C (A), rmUNC5C (B), and lysozyme (C).
- ATL_5338 was included as a negative control.
- Figure shows absorbance at 450nm.
- Figure 20 shows the results of an in vivo mouse pharmacokinetic study assessing antibody levels in serum (A), and CSF (B) following administration of escalation doses of ATL_5262 or a control antibody, ATL_5338.
- Figure 21 shows sequences of antibodies described herein, with variable positions in the heavy chain highlighted.
- A Heavy chains, aligned by IMGT position numbering.
- VH of ATL_6034 SEQ ID NO: 3,
- VH of ATL_0006035 SEQ ID NO: 4,
- VH of ATL_0006036 SEQ ID NO: 5;
- VH of ATL_0006178 SEQ ID NO: 93.
- VL of ATL_0005262 SEQ ID NO: 9; VL of ATL_0005996: SEQ ID NO: 10; VL of ATL_0005997: SEQ ID NO: 11 ; VL of ATL_0005998: SEQ ID NO: 12; VL of ATL_0005999: SEQ ID NO: 13; VL of ATL_0006000: SEQ ID NO: 14; VL of ATL_0006001 : SEQ ID NO: 15; VL of ATL_0006002 : SEQ ID NO: 16; VL of ATL_0006003 : SEQ ID NO: 17; VL of ATL_0006004 : SEQ ID NO: 18; VL of ATL_0006005 : SEQ ID NO: 19; VL of ATL_0006033, 6034, 6035, 6036, 6037, 6038, 6039, 6177: SEQ ID NO: 92; VL of ATL_00061
- Figure 22 shows caspase 3/7 production in response to beta amyloid 1-42 toxicity in SHSY5Y Cells in the indicated conditions.
- Figure 23 shows the results of a western blot showing the protein expression of the indicated synaptic proteins (Neurofilament-L, Synaptophysin, PSD95 Synapsin-1 , Synaptotagmin-1) following treatment of Human iPS-derived Dopaminergic neurons with ATL6178.
- Figure 24 show the results of a Netrin-1 depletion assay using human iPSC-derived spinal motor neurons pre-treated with ATLX1282 and ATL-5262.
- Figure 25 shows the results of a multielectrode assay (MEA) using an ALS TDP43 iCell Motor Neuron cell line treated with ATLX-1282.
- A Graph showing the number of active electrodes in the indicated groups.
- B Graph showing burst percentage in indicated experimental groups.
- C Graph showing the mean resistance (left) and number of covered electrodes (right) as a measure of viability.
- Figure 26 shows ATLX-1282 mediated rescue of AMPH induced locomotion in Netrin 1 haplo insufficient mice.
- the data shows the results of a locomotion assay in Netrin 1 haplo-insufficient mice demonstrating ATLX-1282 mediated rescue of amphetamine (AMPH)-induced locomotion.
- Graph shows the distance travelled by mice in the indicated groups 10 days after antibody or control (anti-fluorescein antibody, ATL5338 (LALA)) treatment. Saline was used as a control for AMPH treatment and wild-type mice were used as a control for Netrin 1 haplo-insufficient mice. ****P ⁇ 0.0001 One way ANOVA with Sidak's multiple comparisons test.
- Figure 27 shows the percentage of contralateral touches displayed by Rats 26 days after 6-OHDA or saline treatment. Mice were administered isotype control (ATL5338) or ATLX1282 via intra-peritoneally once a week. ***P ⁇ 0.001 One way ANOVA with Sidak's multiple comparisons test.
- Figure 28 shows the results of a bio-layer interferometry assay to assess binding of ATL_5262 and ATL_6178 to different Netrin 1 receptors and related proteins.
- the graph shows reference-corrected sensor response at the end of the measured association step (average of 25-30 seconds signal) of a BLI kinetic assay.
- Antigen was loaded as ligand and dipped into antibody as analyte during association, and assay buffer during dissociation.
- Figure 29 shows the results of a netrin-1 competition assay demonstrating that binding of ATLX-1282 and ATL_5262 to mouse brain tissue is blocked via Netrin-1.
- Figure 30 shows the results of a flow cytometry assay showing binding of ATL5262 and ATLX-1282 to UNC5C and the UNC5C T835M variant (AD variant) overexpressed in HEK-293 cells.
- A Quantification of UNC5C binding as measured by the % of lgG+ cells (detecting the antibody).
- B Quantification of UNC5C binding as measured by the Mean fluorescence intensity (MFI) of IgG.
- Figure 31 shows the X-ray crystal structure of an ATL_5262 Fab fragment bound to human UNC5C Ig domains.
- A shows a cartoon view of the full Fab-UNC5C complex.
- B shows close-up views of the specific interactions between the ATL_5262 and UNC5C as shown in (A).
- G shows a protein alignment of human UNC5 family members B (SEQ ID NO: 260), A (SEQ ID NO; 261) and D (SEQ ID NO: 262) to region of human UNC5C Ig-like domain 1 that interacts with ATL_5262 (SEQ ID NO: 259).
- Figure 32 shows sequences of antibodies described herein, with variable positions in the heavy chain highlighted.
- A. (A-1 to A-4) Heavy chains, aligned by IMGT position numbering.
- VH of ATL_0005262 SEQ ID NO: 1 ;
- VH of ATL_0006178 SEQ ID NO: 93;
- VH of ATL_0006530 SEQ ID NO: 122;
- VH of ATL_0006531 SEQ ID NO: 123;
- VH of ATL_0006532 SEQ ID NO:124;
- VH of ATL_0006533 SEQ ID NO:125;
- VH of ATL_0006534 SEQ ID NO:126;
- VH of ATL_0006535 SEQ ID NO:127;
- VH of ATL_0006536 SEQ ID NO:128;
- VH of ATL_0006537 SEQ ID NO:129;
- VH of ATL_0006538 SEQ ID NO:130;
- VL of ATL_0005262 SEQ ID NO: 9; VL of ATL_0006178: SEQ ID NO: 92; VL of ATL_0006530: SEQ ID NO: 132; VL of ATL_0006531 : SEQ ID NO: 133; VL of ATL_0006532: SEQ ID NO:134; VL of ATL_0006533: SEQ ID NO:135; VL of ATL_0006534: SEQ ID NO:136; VL of ATL_0006535: SEQ ID NO:137; VL of ATL_0006536: SEQ ID NO:138; VL of ATL_0006537: SEQ ID NO:139; VL of ATL_0006538: SEQ ID NO:140; VL of ATL_0006539: SEQ ID NO:141.
- an antibody capable of “specific binding” or “specifically binding” a target is one able to bind through the association of the epitope recognition site with an epitope within the target. It is distinct from non-specific binding, for example Fc-mediated binding, ionic and/or hydrophobic interactions.
- an antibody which specifically binds a target recognises and binds to a specific protein structure within it rather than to proteins generally.
- ATL_000xxxx ATL_xxxx or “xxxx”, where “xxxx” is a four digits reference number specific to an antibody described herein. All of the above notations are used interchangeably to refer to the same antibody or a portion thereof (e.g. a VH, VL or part thereof, of the antibody).
- antibody ATL_0005262 is interchangeably referred to herein as ATL_5262 and 5262.
- UNC5 A-D referred to as UNC5 H1-4 in other mammalian species
- CNS central nervous system
- Additional netrin receptors include Down's syndrome cell adhesion molecule (DSCAM), neogenin, Deleted in Colorectal Cancer (DCC) and CD146 (also known as Melanoma Cell Adhesion Molecule (MCAM or Mel-CAM). These receptors differ in the number of n-terminal Ig domains, inclusion of fibronectin type III domains and intracellular domains.
- DSCAM Down's syndrome cell adhesion molecule
- DCC neogenin
- CD146 also known as Melanoma Cell Adhesion Molecule
- the antibodies described herein are capable of specifically binding UNC5C over other netrin receptors such as neogenin, DCC, DSCAM, UNC5A, UNC5B, and UNC5D. Binding of an antibody to a candidate protein can be verified for example by biolayer interferometry analysis as described herein.
- UNC5C is a dependence receptor responsible for the regulation of neuronal apoptosis, and whether UNC5C promotes or inhibits apoptosis depends on its binding to netrin-1 (Lambi et al (2001); Poliak S, et al. 2015).
- UNC5 receptors have intracellular death domains. This domain can interact with death- associated protein kinase (DAPK1) to induce apoptosis in the absence of ligand binding, whilst the receptors remain in monomeric form.
- DAPK1 death- associated protein kinase
- the T835M mutation in the death domain of UNC5C further increases apoptosis.
- UNC5C Cleavage of UNC5C by LGMN has also been proposed to increase UNC5C mediated neuronal apoptosis relevant to Alzheimer’s disease (Chen et al 2021).
- UNC5C forms a dimer and promotes neuronal survival, migration, and differentiation, i.e. it has anti-apoptotic role.
- Multimerisation of UNC5 receptors is sufficient to prevent the apoptotic signal pathway activation (Mille et al 2009 Cell Death and Differentiation 16, 1344-1351) and netrin-1 directly inhibits apoptosis in neurones (Llambi et al 2001).
- UNC5C has also been shown to form heterodimers with DCC or DSCAM (Boyer and Gupton, 2018). Antibodies described herein may bind monomeric UNC5C and dimeric UNC5C. Antibodies described herein may bind homodimeric UNC5C. UNC5C has been implicated in Alzheimer’s disease where truncated UNC5C resulting in enhanced neuronal apoptosis was found to be associated with accelerated AD pathology in mice (Chen et al., 2021). Further, several SNPs in UNC5C are linked to the development of Alzheimer’s disease (AD).
- AD Alzheimer’s disease
- the SNP T835M predisposes to the AD and increases neuronal apoptosis (Li Q, et al. 2018).
- UNC5C has also been implicated in Parkinson’s Disease (PD) where cleavage of UNC5C was shown to cause neuronal loss in a mouse model of PD (Chen et al. 2022).
- Netrin-1 is one of several netrins, all members of the laminin superfamily. Netrins are secreted proteins that direct axon extension and cell migration during neural development and regulate cell adhesion, the maturation of cell morphology, cell survival and tumorigenesis (Rajasekharan, et al. (2009)). They are bifunctional proteins that act as attractants for some cell types and as repellents for others. The UNC-5 family of receptors mediate the repellent response to netrin.
- Netrin 1 consists of a laminin-like domain in the N-terminal (LN, also known as domain VI), followed by three epidermal growth factor (EGF) repeats (EGF1 , EGF2 and EGF3, also known as domain V), and a C-terminal Netrin-like domain (NTR) that shares homology with domains found in complement and other proteins (Dun et al. 2017).
- LN N-terminal
- EGF1 , EGF2 and EGF3 epidermal growth factor repeats
- NTR C-terminal Netrin-like domain
- antibodies described herein specifically bind to UNC5C and mimics and/or competes with Netrin-1 for binding with UNC5C. Competition with Netrin-1 binding may be assessed by ELISA assays as described herein. Thus, antibodies described herein may compete for the same binding site on UNC5C as Netrin-1. Antibodies described herein may bind the same binding site on UNC5C as Netrin-1.
- An antibody mimicking netrin-1 may refer to the antibody interacting with UNC5C in a way that mimics the effect of netrin-1 on UNC5C structure and/or activity.
- An antibody competing with netrin-1 for binding to UNC5C may refer to the binding of the antibody to UNC5C being dependent on the presence or absence of Netrin-1 , and/or the binding of Netrin-1 to UNC5C being dependent on the presence or absence of the antibody.
- An antibody competing with netrin-1 for binding to UNC5C may refer to the binding of the antibody to UNC5C being inhibited by Netrin-1.
- an antibody competing with netrin-1 for binding to UNC5C may refer to the binding of the antibody to UNC5C being at least partially inhibited in the presence of Netrin-1. This may be assessed for example using an ELISA assay, such as described herein.
- UNC5C may be pre-incubated with Netrin-1 prior to incubation with the antibody, and the amount of bound antibody may be compared to a control condition without Netrin-1 preincubation. A reduction in the amount of bound antibody may indicate that the antibody competes with Netrin-1 for binding to UNC5C.
- a signal indicative of the presence of the antibody bound to UNC5C may be reduced by at least 50%, at least 60%, at least 70%, at least 80% or at least 90% in the presence of Netrin-1 (such as e.g. following pre-incubation with 200microg/l Netrin-1).
- binding of the antibody to UNC5C may be reduced by at least 50%, at least 60%, at least 70%, at least 80% or at least 90% in the presence of Netrin-1 (such as e.g. following pre-incubation with 200microg/l Netrin-1).
- Antibodies as described herein may be such that binding of the antibody to UNC5C is inhibited by Netrin- 1 in a concentration dependent manner. This can be assessed for example using an ELISA assay as described herein, or any other binding assay in combination with incubation with a plurality of different concentrations of Netrin-1 (e.g. a Netrin-1 dilution series). A reduction in binding of the antibody to UNC5C in the presence of Netrin-1 (e.g. when the antibody is incubated with UNC5C following preincubation with Netrin-1), which is dependent on the concentration of Netrin-1 , may be considered to be indicative of Netrin-1 concentration-dependent inhibition of binding of the antibody to UNC5C.
- a signal indicative of the presence of the antibody bound to UNC5C may be reduced by at least 50% in the presence of at least 10 8 M of Netrin-1 (such as e.g. following pre-incubation with 10 8 M of Netrin-1). In embodiments, binding of the antibody to UNC5C may be reduced by at least 50% in the presence at least 10 8 M of Netrin-1 (such as e.g. following pre-incubation with 10 8 M of Netrin-1). In embodiments, a signal indicative of the presence of the antibody bound to UNC5C may be reduced by at least 80% in the presence of at least 10 7 M of Netrin-1 (such as e.g. following pre-incubation with 10 7 M of Netrin-1).
- Antibodies described herein may have a binding site that at least partially overlaps with the netrin-1 binding site. Antibodies described herein may cause the dimerization of UNC5C.
- the human gene encoding UNC5C (Gene ID: 8633) is present on 4q22.3 and consists of 20 exons. Reference non-human UNC5C amino acid and coding sequences are available in public databases.
- the sequence of human UNC5C is available under Uniprot identifier 095185. It comprises 931 amino acids. Amino acids 62-159 form an Ig-like domain, amino acids 161-256 form an Ig-like C2-type domain, amino acids 260-314 and 316-368 form TSP type-1 1 and TSP type-1 2 domains, amino acids 530-673 form a ZU5 domain and amino acids 850-929 form a death domain.
- the protein is cleaved at amino acids 415-416 by caspase-3.
- a reference human UNC5C amino acid sequence is provided as SEQ ID NO: 99.
- mouse UNC5C is available under Uniprot identifier 008747. It comprises 931 amino acids. Amino acids 62-159 form an Ig-like domain (also referred to herein as the first immunoglobulin domain or N terminal immunoglobulin domain), amino acids 161-256 form an Ig-like C2-type domain (also referred to herein as the second immunoglobulin domain), amino acids 260-314 and 316-368 form TSP type-1 1 and TSP type-1 2 domains, amino acids 530-673 form a ZU5 domain and amino acids 850-929 form a death domain. The protein is cleaved at amino acids 415-416 by caspase-3. A reference mouse UNC5C amino acid sequence is provided as SEQ ID NO: 100.
- UNC5C encompasses truncations, derivatives, and variants of the sequence of UNC5C provided herein, and may refer to any protein with at least 80%, at least 90%, or at least 95% sequence identity.
- the antibodies described herein are capable of specifically binding a peptide or protein having or comprising the amino acid sequence of SEQ ID NO: 99 (including a full length UNC5C protein comprising said sequence, or a fragment of said protein comprising said sequence), or a fragment thereof, such as e.g. a fragment comprising or consisting of amino acids 41-380 of human or murine (mouse) UNC5C (such as e.g.
- the antibody may bind to the N terminal immunoglobulin domain of UNC5C (also referred to as “first immunoglobulin domain).
- the antibody may bind to one or more residues of UNC5C that are involved in binding of Netrin-1 to UNC5C.
- the antibody may bind to one or more residues of UNC5C located in the first immunoglobulin domain of UNC5C.
- Antibodies described herein bind UNC5C (e.g. mouse and/or human) with high affinity.
- High affinity binding may be assessed by measuring the EC50 value, the concentration at which the antibody produces a half-maximal binding, for example via ELISA as described herein.
- affinity of the antibody may be assessed by binding to plate-bound recombinant human UNC5C as described herein.
- High affinity as referred to herein means an EC50 value of at most 1 E-06 M (i.e.
- the antibodies described herein bind UNC5C with an EC50 of at most 100 nM, as assessed via ELISA (e.g. as described herein).
- the antibody binds human UNC5C with an EC50 of at most 1 E-08M, at most 1.1 E- 08M, at most 2.24E-08, at most 2.40E-08, at most 9.81 E-08 M, at most 4.52E-09, at most 5.5E-09M, at most 9.62E-09M, at most 5.50E-10, at most 7.10E-10, at most 1.00E-11 , at most 1.30E-1 1 , at most 3.90E-11 , at most 2.80E-12, or at most 9.20E-12.
- the antibody binds human UNC5C with an EC50 of about 1 .1 E-08M, about 2.24E- 08, about 2.40E-08, about 9.81 E-08 M, about 4.52E-09, about 5.5E-09M, about 8.00E-09, about 9.62E- 09M, about, 5.50E-10, about 7.10E-10, about 1.00E-11 , about 1.30E-11 , about 3.90E-11 , about 2.80E- 12, about 9.20E-12.
- the EC50 value is between 1 E-07 M and 1 E-13M, 5E-07 M and 1 E-13M; 1 E-08 M and 1 E-13M; 5E-08 M and 1 E-13M; 1 E-09 M and 1 E-13M; 5E-09 M and 1 E-13M; 1 E-10 M and 1 E-13M; 5E-10 M and 1 E-13M; 1 E-11 M and 1 E-13M; 5E-1 1 M and 1 E-13M; 1 E-12 M and 1 E-13M; 5E-12 M and 1 E-13M; bewteen 1 E-07 M and 1 E-12M, 5E-07 M and 1 E-12M; 1 E-08 M and 1 E-12M; 5E-08 M and 1 E- 12M; 1 E-09 M and 1 E-12M; 5E-09 M and 1 E-12M; 1 E-10 M and 1 E-12M; 5E-10 M and 1 E-12M; 1 E-11 M and 1 E-12M; 5E-11 M and 1E-12M; 1 E-07 M and
- antibodies described herein are capable of specifically binding a UNC5C protein or protein fragments comprising or consisting of a UNC5C variant amino acid sequence.
- the UNC5C variant protein or fragment comprises an amino acid sequence that has at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identity with SEQ ID NO: 99.
- the antibodies disclosed herein are capable of specifically binding a UNC5C fragment comprising at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or more of the UNC5C amino acid sequence, or a UNC5C variant sequence.
- UNC5C may be human UNC5C or mouse UNC5C.
- UNC5C may be human UNC5C.
- UNC5C may refer to human UNC5C unless context indicates otherwise. In other embodiments, for example when the individual to be treated is a non-human mammal, UNC5C may be non-human UNC5C.
- Antibodies of the present disclosure may specifically target a single epitope on the UNC5C protein.
- epitope also known as antigenic determinant, as used herein refers to any protein determinant capable of specific binding to an immunoglobulin or fragment thereof.
- Epitopic, or antigenic, determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three-dimensional structural characteristics, as well as specific charge characteristics.
- Antibodies described herein may bind to a discontinuous epitope of UNC5C.
- Antibodies described herein may bind to an epitope that comprises one or more of, or all of, the following residues of UNC5C provided as SEQ ID NO: 99: Thr89, Gln90, Gln102, Lys103, Val107, Asp108, Glu109, Arg110, Val111 , Ile118, Arg120 or corresponding residues in a homologous sequence.
- the antibody binds to residues Thr89, Gln90, Gln102, Lys103, Val107, Glu109, Ile118, and Arg120.
- one or more of (or all of) of VH residues 55, 63, 64, 65, 66, 74, 108, 110 in IMGT numbering interact with one or more residues in the epitope.
- one or more of (or all of) of VH residues 55 (Tyr), 63 (Gly), 64 (T, H or S, more specifically Thr), 65 (T or S, more specifically Thr), 66 (Asn), 74 (Ser), 108 (Arg), 110 (Met) in IMGT numbering interact with one or more residues in the epitope.
- one or more of (or all of) of VH residues 55 (Tyr), 63 (Gly), 64 (Thr or conservative substitution e.g. H or S), 65 (Thr or conservative substitution e.g. S), 66 (Asn), 74 (Ser), 108 (Arg), 110 (Met) in IMGT numbering interact with one or more residues in the epitope.
- one or more of (or all of) VL residues 38, 107, 108, 109, and 114 in IMGT numbering interact with one or more residues in the epitope.
- one or more of (or all of) VL residues 38 (Y, D, L or T, such as Tyr in specific embodiments), 107 (S, Y, F or W, such as Ser in specific embodiments), 108 (Y, D, T, or G, such as Tyr in specific embodiments), 109 (S, D, K or absent, such as Ser in specific embodiments), 114 (T, N, S, R, G, or A, such as Thr in specific embodiments) in IMGT numbering interact with one or more residues in the epitope.
- Position 38 is Tyr in antibodies 5262, 6178, 6530, 6531 , 6533, 6534, 6537, 6539, D in antibody 6335, L in antibody 6336 and T in antibody 6538.
- Position 107 is S in antibodies 5262 and 6178 (same VL), Y in antibodies 6530, 6532, 6533, 6534, 6535 and 6536, F in 6531 , and W in antibodies 6537, 6538 and 6539.
- Position 108 is Y in antibodies 5262 and 6178, D in antibodies 6530, 6532, 6533, 6534, 6535, 6537 and 6538, T in antibodies 6531 and 6536, and G in antibody 6539.
- Position 109 is S in antibodies 5262, 6178, 6530, 6533, 6534, 6535, 6536 and 6537, D in antibodies 6531 and 6538, K in antibody 6532 and absent in antibody 6539.
- Position 114 is T in antibodies 5262, 6178 and 6536, N in antibodies 6530, 6533 and 6538, S in antibodies 6531 and 6537, R in antibody 6532, G in antibody 6534, A in antibody 6535.
- the VH of an antibody as described herein has: at residue 55: Tyr, at residue 63: Gly, at residue 64: T, H or S, more specifically Thr, at residue 65: T or S, more specifically Thr, at residue 66: Asn, at residue 74: Ser, at residue 108: Arg, at residue 110: Met, where all positions are in IMGT numbering.
- the VL of an antibody as described herein has: at residue 38: Y, D, L or T, such as Tyr in specific embodiments, at residue 107: S, Y, F or W, such as Ser in specific embodiments, at residue 108: Y, D, T, or G, such as Tyr in specific embodiments, at residue 109: S, D, K or absent (deletion), such as Ser in specific embodiments, at residue 114: T, N, S, R, G, or A, such as Thr in specific embodiments, where all positions are in IMGT numbering. Any of the amino acids at any of these positions can be combined with each other, and all resulting combinations are explicitly envisaged.
- VH residue 64 e.g. Thr
- VH residue 63 e.g. Gly
- VH residue 65 e.g. Thr
- VH residue 74 e.g.
- VH residue 66 (Asn) of antibodies described herein interacts with Vai 107 of the discontinuous epitope; and/or (f) VH residues 55 (e.g. Tyr), 66 (e.g. Asn), 108 (e.g. Arg), and/or 110 (e.g. Met) of antibodies described herein interact with Glu109 of the discontinuous epitope; and/or (g) VH residues 108 (e.g. Arg), and/or 110 (e.g. Met) of antibodies described herein interact with Ile118 of the discontinuous epitope; and/or (h) VH residue 55 (e.g.
- VL residue 114 e.g. Thr
- VL residue 109 e.g. Ser
- VL residue 108 e.g. Ser
- Tyr of antibodies described herein interacts with Arg110 and/or Vai 111 of the discontinuous epitope; wherein the UNC5C residues are those at the specified positions in SEQ ID NO: 99 or corresponding positions in a homologous sequence.
- mapping epitopes including but not limited to X-ray co-crystallography as described herein; cryogenic electron microscopy as described, for example, in Renaud et al., 2018; mutagenesis strategies, such as alanine scanning mutagenesis as described, for example, in Cunningham et al., 1989.
- An “antigen binding domain” describes the part of a molecule that binds to all or part of the target antigen.
- An antibody generally comprises six complementarity-determining regions (CDRs); three in the VH region: HCDR1 , HCDR2 and HCDR3, and three in the VL region: LCDR1 , LCDR2, and LCDR3.
- the six CDRs together define the paratope of the antigen binding domain, which is the part of the antigen binding domain which binds to the target antigen.
- the paratope of an antibody as described herein may include the following VH residues: 55 (e.g. Tyr), 63 (e.g. Gly), 64 (e.g. Thr, His or Ser), 65 (e.g.
- the paratope of an antibody as described herein may include the following VL residues: 38 (e.g. Tyr, D, L or T), 107 (e.g. Ser, Y, F, or W), 108 (e.g. Tyr, D, T or G), 109 (e.g. Ser, D, K or - (deletion)), 114 (e.g. Thr, N, S, R, G or A) in IMGT numbering.
- an antibody according to any embodiment of the present disclosure may comprise a VH with the following residues: at position 55: Tyr, at position 63: Gly, at position 64: Thr, at position 65: Thr, at position 66: Asn, at position 74: Ser, at position 108: Arg, at position 110: Met in IMGT numbering.
- an antibody according to any embodiment of the present disclosure may comprise a VL with the following residues: at position 38: Tyr, at position 107: Ser, at position 108: Tyr, at position 109: Ser, at position 114: Thr in IMGT numbering.
- the present disclosure relates primarily to antibody molecules, whether whole antibody (e.g. IgG, such as lgG1) or antibody fragments (e.g.
- an antibody antigen binding region (also referred to as “antigen binding portions”) are provided, as are antibody heavy chain variable (VH) and light chain variable (VL) domains. Within VH and VL domains are provided complementarity determining regions (CDRs), which may be provided within different framework regions (FRs), to form VH or VL domains, as the case may be.
- An antigen binding site may consist of an antibody VH domain and/or a VL domain.
- an antibody according to the present disclosure may be an scFv antibody molecule, a nanobody, or a whole antibody.
- the antibody may comprise an antibody constant region.
- the antibody constant region may be a human constant region, such as a human lgG1 constant region.
- the antibody may be a whole antibody.
- the antibody may be an IgG, such as an lgG1 or variant thereof.
- the antibody may be an lgG1 variant L234A/L235A (LALA).
- Antibodies according to the present disclosure may be provided in isolated form.
- the term “antibody” encompasses a fragment or derivative thereof, or a synthetic antibody or synthetic antibody fragment.
- An antibody or fragment thereof may be a monoclonal antibody (mAb).
- mAbs are homogenous populations of antibodies specifically targeting a single epitope on an antigen.
- variable domains that antigenic specificity is conferred by variable domains and is independent of the constant domains as known from experiments involving the bacterial expression of antibody fragments, all containing one or more variable domains.
- variable domains include Fab-like molecules (Better et al (1988) Science 240, 1041); Fv molecules (Skerra et al (1988) Science 240, 1038); single-chain Fv (ScFv) molecules where the VH and VL partner domains are linked via a flexible oligopeptide (Bird et al (1988) Science 20 242, 423; Huston et al (1988) Proc. Natl. Acad. Sd.
- ScFv molecules refers to molecules wherein the VH and VL partner domains are covalently linked, e.g. by a flexible oligopeptide.
- Fab, Fv, ScFv and sdAb antibody fragments can all be expressed in and secreted from E. coli, thus allowing the facile production of large amounts of the said fragments.
- a ’’fragment” of an antibody may comprise any number of residues of a “parental” antibody, whilst retaining target binding ability.
- a fragment may lack effector function, for example may be entirely unable to bind or show diminished binding to the Fc receptor, relative to the parent.
- a fragment is typically smaller than the parental antibody.
- a fragment may comprise 50%, 60%, 70%, 80%, 90%, 95% or more of the contiguous or non-contiguous amino acids of the parental antibody.
- a fragment may comprise 50, 100, 150, 200, 250, 300 or more contiguous or non-contiguous amino acids of the parental antibody.
- a fragment may comprise deletions in the Fc region, or of the Fc region.
- a fragment may retain the CDRs and/or the variable domains of the parental antibody, unaltered.
- a fragment is an Fab fragment or an F(ab’)2 fragment.
- the disclosure further provides antibodies comprising a heavy chain variable domain (VH) with the CDRs of the VH of antibodies ATL_6187 or ATL_6191 : CDRH1 comprising amino acid sequence SEQ ID NO: 115 or SEQ ID NO: 116, CDRH2 comprising amino acid sequence SEQ ID NO: 117 or SEQ ID NO: 118, and CDRH3 comprising amino acid sequence SEQ ID NO: 119 or SEQ ID NO: 120.
- antibodies according to the present disclosure may have a heavy chain variable domain (VH) with the CDRs of the heavy chain variable domain (VH) of antibody ATL_6187, i.e.
- antibodies according to the present disclosure may have a heavy chain variable domain (VH) with the CDRs of the heavy chain variable domain (VH) of antibody ATL_6191 , i.e. CDRH1 comprising amino acid sequence SEQ ID NO: 116, CDRH2 comprising amino acid sequence SEQ ID NO: 118, and CDRH3 comprising amino acid sequence SEQ ID NO: 120.
- VH heavy chain variable domain
- at least one of the VH CDR 1-3 sequences may vary.
- a variant may have VH CDRs that have up to 3 amino acid mutations over the above VH CDRs.
- the disclosure further provides antibodies comprising a heavy chain variable domain (VH) with the CDRs of the VH of the antibodies ATL_6530; ATL_6531 ; ATL_6532; ATL_6533; ATL_6534; ATL_6535; ATL_6536; ATL_6537; ATL_6538; ATL_6539: CDRH1 comprising amino acid sequence SEQ ID NO: 142-149, CDRH2 comprising amino acid sequence SEQ ID NO: 150-158, and CDRH3 comprising amino acid sequence SEQ ID NO: 159-168.
- VH heavy chain variable domain
- antibodies according to the present disclosure may have a heavy chain variable domain (VH) with the CDRs of the heavy chain variable domain (VH) of antibody ATL_6530, i.e. CDRH1 comprising amino acid sequence SEQ ID NO: 142, CDRH2 comprising amino acid sequence SEQ ID NO: 150, and CDRH3 comprising amino acid sequence SEQ ID NO: 159.
- antibodies according to the present disclosure may have a heavy chain variable domain (VH) with the CDRs of the heavy chain variable domain (VH) of antibody ATL_6531 , i.e.
- antibodies according to the present disclosure may have a heavy chain variable domain (VH) with the CDRs of the heavy chain variable domain (VH) of antibody ATL_6532, i.e. CDRH1 comprising amino acid sequence SEQ ID NO: 144, CDRH2 comprising amino acid sequence SEQ ID NO: 152, and CDRH3 comprising amino acid sequence SEQ ID NO: 161.
- VH heavy chain variable domain
- antibodies according to the present disclosure may have a heavy chain variable domain (VH) with the CDRs of the heavy chain variable domain (VH) of antibody ATL_6533, i.e. CDRH1 comprising amino acid sequence SEQ ID NO: 145, CDRH2 comprising amino acid sequence SEQ ID NO: 153, and CDRH3 comprising amino acid sequence SEQ ID NO: 162.
- VH heavy chain variable domain
- antibodies according to the present disclosure may have a heavy chain variable domain (VH) with the CDRs of the heavy chain variable domain (VH) of antibody ATL_6534, i.e.
- antibodies according to the present disclosure may have a heavy chain variable domain (VH) with the CDRs of the heavy chain variable domain (VH) of antibody ATL_6535, i.e. CDRH1 comprising amino acid sequence SEQ ID NO: 143, CDRH2 comprising amino acid sequence SEQ ID NO: 154, and CDRH3 comprising amino acid sequence SEQ ID NO: 164.
- VH heavy chain variable domain
- antibodies according to the present disclosure may have a heavy chain variable domain (VH) with the CDRs of the heavy chain variable domain (VH) of antibody ATL_6536, i.e. CDRH1 comprising amino acid sequence SEQ ID NO: 146, CDRH2 comprising amino acid sequence SEQ ID NO: 155, and CDRH3 comprising amino acid sequence SEQ ID NO: 165.
- antibodies according to the present disclosure may have a heavy chain variable domain (VH) with the CDRs of the heavy chain variable domain (VH) of antibody ATL_6537, i.e. CDRH1 comprising amino acid sequence SEQ ID NO: 147, CDRH2 comprising amino acid sequence SEQ ID NO: 156, and CDRH3 comprising amino acid sequence SEQ ID NO: 166.
- antibodies according to the present disclosure may have a heavy chain variable domain (VH) with the CDRs of the heavy chain variable domain (VH) of antibody ATL_6538, i.e. CDRH1 comprising amino acid sequence SEQ ID NO: 148, CDRH2 comprising amino acid sequence SEQ ID NO: 157, and CDRH3 comprising amino acid sequence SEQ ID NO: 167.
- antibodies according to the present disclosure may have a heavy chain variable domain (VH) with the CDRs of the heavy chain variable domain (VH) of antibody ATL_6539, i.e.
- VH1 comprising amino acid sequence SEQ ID NO: 149
- CDRH2 comprising amino acid sequence SEQ ID NO: 158
- CDRH3 comprising amino acid sequence SEQ ID NO: 168.
- at least one of the VH CDR 1-3 sequences may vary.
- a variant may have VH CDRs that have up to 3 amino acid mutations over the above VH CDRs.
- At least one of the VH CDR 1-3 sequences may vary. That is, the above set of CDRs may comprise one, two, or three mutations. Mutations as used herein refers to amino acid substitutions, insertions, or deletions. Mutations may be introduced by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. A variant may have one or two amino acid mutations, such as substitutions compared with the set of VH CDR1-3 described above. In embodiments, an antibody according to the disclosure comprises CDRs with sequences that have one or two mutations, such as substitutions compared to the VH CDR sequences of any antibody described herein.
- an antibody according to the disclosure may comprise VH CDRs with the sequences of any antibody above, except that one or two of the CDRHs comprise a substitution, where the total number of substitutions across the CDRHs does not exceed 2.
- a variant may have one, two or three, preferably at most one or two substitutions in each of one or more of the VH CDR1-3 described above.
- CDRH1 regions of any antibodies or fragments described herein may have a length of 8 amino acids.
- CDRH2 regions of any antibodies or fragments described herein may have a length of 7 amino acids.
- CDRH3 regions of any antibodies or fragments described herein may have a length of 13 amino acids.
- a variant may have VH CDRs that have at least 70%, at least 80% or at least 90% sequence identity with any set of VH CDRs described herein.
- a variant with a combined CDRH 1-3 length of 28 amino acids may have up to 8, up to 5, or up to 2 amino acid substitutions compared to a set of VH CDRs described herein.
- a variant may have one or two substitutions comprising or consisting of a substitution at position 58 in CDRH2. The substitution may be N58Y.
- An antibody according to the present disclosure may have a VH with the following CDRHs: CDRH1 comprising amino acid sequence SEQ ID NO:20, CDRH2 comprising amino acid sequence SEQ ID NO:21 and CDRH3 comprising amino acid sequence SEQ ID NO:23. These are the VH CDRs of ATL_5262 and all variants thereof except ATL_6178 (i.e. ATL_6033, 6034, 6035, 6036, 6037, 6038, 6039, 6177).
- An antibody according to the present disclosure may have a VH with the following CDRHs: CDRH1 comprising amino acid sequence SEQ ID NQ:20, CDRH2 comprising amino acid sequence SEQ ID NO:22 and CDRH3 comprising amino acid sequence SEQ ID NO:23. These are the VH CDRs of ATL_6178
- An antibody according to the present disclosure may have a VH with the following CDRHs: CDRH1 comprising amino acid sequence SEQ ID NO:144, CDRH2 comprising amino acid sequence SEQ ID NO:152 and CDRH3 comprising amino acid sequence SEQ ID NO:161. These are the VH CDRs or ATL_6532. These are the CDRs of ATL_6533.
- Antibodies according to the present disclosure may have a light chain variable domain (VL) with the CDRs of the light chain variable domain (VL) of antibody ATL_5262 (identical to those of ATL_6178), ATL_6002, or ATL_6003, or ATL6187, or more specifically ATL_5262, or ATL_6002.
- Antibodies according to the present disclosure may have the following light chain CDRs:
- CDRL1 SEQ ID NO: 24, 31 or 32,
- CDRL2 SEQ ID NO:34 and
- CDRL3 SEQ ID NO:40 or 47 or 121 .
- At least one of the VL CDR 1-3 sequences may vary.
- a variant may have 1 , 2, or 3 amino acid mutations, such as substitutions compared with the set of VL CDR1-3 described above.
- an antibody according to the disclosure comprises CDRs with sequences that have between 1 and 3 mutations, such as substitutions compared to the VL CDR sequences of any antibody described herein.
- an antibody according to the disclosure may comprise VL CDRs with the sequences of any antibody above, except that one to 3 of the CDRLs comprise a substitution, where the total number of substitutions across the CDRLs does not exceed 3.
- a variant may have one, two or three, preferably at most one or two substitutions in each of one or more of the VL CDR1-3 described above.
- CDRL1 regions of any antibodies or fragments described herein may have a length of between 6 and 12 amino acids, preferably 6 amino acids.
- CDRL2 regions of any antibodies or fragments described herein may have a length of 3 amino acids.
- CDRL3 regions of any antibodies or fragments described herein may have a length of 9 or 10 amino acids, preferably 9.
- a variant may have VL CDRs that have at least 70%, at least 80% or at least 90% sequence identity with any set of VL CDRs described herein.
- a variant with a combined CDRL 1-3 length of 18 amino acids may have up to 5, up to 3, or up to 1 amino acid substitutions compared to a set of VL CDRs described herein.
- Antibodies according to the present disclosure may have a VL with the following CDRLs: CDRL1 : SEQ ID NO: 24, CDRL2: SEQ ID NO:34, CDRL3: SEQ ID NO:40. These are the VL CDRs of antibodies ATL_5262; 6033; 6034; 6035; 6036; 6037; 6038; 6039; 6177; 6178, 6187 and 6191.
- Antibodies according to the present disclosure may have a VL comprising:
- Antibodies according to the present disclosure may have a VL comprising the framework sequences of any of ATL_6530, ATL_6531 , ATL_6532, ATL_6533, ATL_6534, ATL_6535, ATL_6536, ATL_6537, ATL_6538, ATL_6539.
- VH CDRs 1-3 and optionally VL CDRs 1-3 of any of the antibodies described above may also be particularly useful in conjunction with a number of different framework regions. Accordingly, light and/or heavy chains having CDRs 1-3 as described above may possess an alternative framework region. Suitable framework regions are known in the art and are described for example in M. Lefranc & G. Le Franc (2001) "The Immunoglobulin Facts Book", Academic Press.
- An antibody of the disclosure may have the CDRH1 , CDRH2 and CDRH3 of the VH domain within a germline framework.
- the antibody of the disclosure has a heavy chain variable domain (VH) comprising CDRH1 , CDRH2, and CDRH3 within a germline framework, provided that position 67 in standard IMGT numbering is Q.
- VH heavy chain variable domain
- An antibody of the disclosure may have a heavy chain variable domain (VH) with the framework sequences FWRH1 , FWRH2, FWRH3 and FWRH4 of any of the ATL_5262 variants (i.e. antibodies ATL_0005996, ATL_0005997, ATL_0005998, ATL_0005999, ATL_0006000, ATL_0006001 ,
- An antibody according to the disclosure may have a VH with the following framework sequences: HFWR1 of SEQ ID NO: 50; HFWR2 of SEQ ID NO: 51 ; HFWR3 of SEQ ID NO: 55; and HFWR4 of SEQ ID NO: 62; or framework sequences comprising one to five mutations, such as substitutions, compared to these framework sequences.
- Mutations in the FWRH sequences may include one or more of, or all of: (i) HFWR2: positions 40, 49, (ii) HFWR3: positions 80, 82, 86.
- the mutations in the framework sequences are substitutions and are selected from the following positions in standard IMGT numbering: (i) HFWR2: at positions 40: T40S, at position 49: R49G, (ii) HFWR3: at position 80: I80V, at position 82: T82K, at position 86: H86Q; in standard IMGT numbering.
- Mutations in the FWRH sequences may not include a substitution at position 67 in standard IMGT numbering.
- An antibody according to the disclosure may have a VH with the following framework sequences: HFWR1 of SEQ ID NO: 50; HFWR2 of SEQ ID NO: 51-54; HFWR3 of SEQ ID NO: 55-61 ; and HFWR4 of SEQ ID NO: 62.
- the antibody according to the present disclosure may have a heavy chain variable domain (VH) comprising the following framework sequences:
- HFWR2 of ATL_6187 or ATL_6191 WSWIRQPPGKGLEWIGY (SEQ ID NO: 52) or WSWIRQTPGKGLEWIGY (SEQ ID NO: 195);
- NQNPSLKSRVTMSVDSSKSQLSLKLTSVTAADTAVYYC SEQ ID NO: 196
- NYNPSLKSRVTISVDTFKNQFSLKLTSVTAADTAVYYC SEQ ID NO: 197
- HFWR4 of ATL_6187 or ATL_6191 WGQGILVIVSS (SEQ ID NO: 198) or WGQGTLVTVSS (SEQ ID NO: 62), or framework sequences comprising one to ten or one to 5 mutations, such as substitutions, compared to these framework sequences.
- Mutations in the FWRH may include one or more, or all, of:
- HFWR2 position 43, optionally wherein the mutation is the substitution I42V; position 49 optionally wherein the mutation is the substitution R49A;
- HFWR3 position 68, optionally wherein the mutation is the substitution N68S; position 78, optionally wherein the mutation is the substitution I78M; position 81 , optionally wherein the mutation is the substitution D81Y; position 83, optionally wherein the mutation is the substitution S83F; position 84, optionally wherein the mutation is the substitution K84T; position 87, optionally wherein the mutation is the substitution F87L;
- HFWR4 position 122, optionally wherein the mutation is the substitution I122K; position 125, optionally wherein the mutation is the substitution T125L
- the antibody according to the present disclosure may have a heavy chain variable domain (VH) comprising the framework sequences of any of antibodies ATL_6530, 6531 , 6532, 6533, 6534, 6535, 656, 6537, 6538 or 6539, or framework sequences comprising one to five mutations, such as substitutions, compared to these framework sequences.
- VH heavy chain variable domain
- Mutations in the FWRH may include mutations at one or more, or all, of positions:
- 74 optionally wherein the mutation is the substitution S74G; 75, optionally wherein the mutation is the substitution R75Q; 76, optionally wherein the mutation is the substitution V76F; 78, optionally wherein the mutation is the substitution I78M; 79, optionally wherein the mutation is the substitution S79T; 83, optionally wherein the mutation is the substitution S83A; 84, optionally wherein the mutation is the substitution K84I; 85, optionally wherein the mutation is the substitution N85S; 89, optionally wherein the mutation is the substitution L89M; 93, optionally wherein the mutation is the substitution S93R; 96, optionally wherein the mutation is the substitution A96S;
- HFWR4 120, optionally wherein the mutation is the substitution Q120H.
- antibodies may have VH (and optionally VL) regions comprising an amino acid sequence that has a high percentage sequence identity to the VH and/or VL amino acid sequences described above.
- antibodies according to the present disclosure include antibodies that bind UNC5C and have a VH regions that comprises an amino acid sequence having at least 70%, more preferably one of at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the VH region amino acid sequence of any antibody described herein, such as ATL_5262, ATL_6036, ATL_6039, ATL_6177, ATL_6178, ATL_6187, ATL_6191 , ATL_6530-6539 (SEQ ID NOs: 1 , 5, 8, 91 , 93, 112, 113, 122-131).
- any sequence obtained by applying conservative one or more conservative amino acid substitutions to a sequence as described herein is also encompassed, provided that the overall sequence identity is within the ranges provided and that the resulting antibody still binds UNC5C and competes with / mimic netrin-1 binding to UNC5C.
- An antibody of the disclosure may have the CDRL1 , CDRL2 and CDRL3 of the VL domain within a germline framework.
- An antibody of the disclosure may have a light chain variable domain (VL) with the framework sequences LFWR1 , LFWR2, LFWR3 and LFWR4 of any of ATL_5262 variants, including ATL_5262, ATL_6036, ATL_6039, ATL_6177 or ATL_6178.
- the antibody of the disclosure may have a light chain variable domain (VL) with the following framework sequences: LFWR1 of SEQ ID NO:63; LFWR2 of SEQ ID NO:71 ; LFWR3 of SEQ ID NO:77; and LFWR4 of SEQ ID NO:85 or 87; or a set of FWRs which contains one to five amino acid mutations, such as substitutions, compared with the above set of FWR.
- VL light chain variable domain
- antibodies of the disclosure may have a VL region that comprises an amino acid sequence having at least 70%, more preferably one of at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the VL region amino acid sequence of any antibody described herein, such as ATL_5262, ATL_5998, ATL_6001 , ATL_6002, ATL_6003, ATL_6177, ATL_6178, ATL_6187, ATL_6191 , ATL6530-6539 (SEQ ID Nos: 9, 12, 15, 16, 17, 92, 94, 114, 132-141).
- antibodies of the disclosure may have a VL region that comprises an amino acid sequence having at least 70%, more preferably one of at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the VL region amino acid sequence of antibody ATL_5262 or ATL_6002 (SEQ ID Nos: 9, 16).
- antibodies of the disclosure may have a VL region that comprises an amino acid sequence having at least 70%, more preferably one of at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the VL region amino acid sequence of antibody ATL_5262, or ATL_6178 (SEQ ID Nos: 9, 94).
- Antibodies of the disclosure may have a type L or type K VL region.
- the antibodies described herein may comprise: a heavy chain variable domain (VH) comprising a sequence that has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%, 96%, 97%, 98%, 99% or 100% sequence identity to sequence identity to SEQ ID NO: 1 and a and a light chain variable domain (VL) comprising a sequence that has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%, 96%, 97%, 98%, 99% or 100% sequence identity to sequence identity to SEQ ID NO: 9.
- VH heavy chain variable domain
- VL light chain variable domain
- Antibodies described herein include antibodies that have a heavy chain variable domain (VH) comprising a sequence of the VH of any antibody described herein and a light chain variable domain (VL) comprising a sequence of the VH of any antibody described herein.
- antibodies described herein include antibodies that have: (i) a heavy chain variable domain (VH) comprising a sequence of the VH of ATL_5262, ATL_6177, ATL_6178, ATL_6033, ATL_6034, ATL6035, ATL_6036, ATL_6037, ATL_6038, ATL_6039, ATL_5998, ATL_6001 , ATL_6002, ATL_6003, ATL_6187, ATL_6191 , ATL_6530, ATL_6531 , ATL_6532, ATL_6533, ATL_6534, ATL_6535, ATL_6536, ATL_6537, ATL_6538, ATL_6539, and (
- antibodies that have: (i) a heavy chain variable domain (VH) comprising a sequence of the VH of ATL_5262, ATL_6177, ATL_6178, ATL_6033, ATL_6034, ATL6035, ATL_6036, ATL_6037, ATL_6038, ATL_6039, ATL_5998, ATL_6001 , ATL_6002, ATL_6003, ATL_6187, ATL_6191 , and (ii) a light chain variable domain (VL) comprising a sequence of the VL of ATL_5262, ATL_6177, ATL_6178, ATL_6033, ATL_6034, ATL6035, ATL_6036, ATL_6037, ATL_6038, ATL_6039, ATL_5998, ATL_6001 , ATL_6002, ATL_6003, ATL_6187, ATL_6191.
- VH heavy chain variable domain
- the antibodies of the disclosure are derived from human antibodies and may therefore be referred to as human antibodies.
- Antibodies of the disclosure were obtained by pairing a human VH domain with a VL domain using a transformer-based model. Thus, antibodies of the disclosure may differ from naturally occurring antibodies at least by their VH-VL pairing.
- Antibodies of the disclosure may comprise human VH and/or VL sequences.
- Antibodies of the disclosure may be formulated as human lgG1 antibodies or variants thereof.
- Antibodies of the disclosure may have a human framework sequence and/or a human Fc domain.
- Percentage (%) sequence identity is defined as the percentage of amino acid residues in a candidate sequence that are identical with residues in a comparative sequence after aligning the sequences and introducing gaps if necessary, to achieve the maximum sequence identity, and not considering any conservative substitutions as part of the sequence identity. Sequence identity is preferably calculated over the entire length of the respective sequences. Where the aligned sequences are of different length, sequence identity of the shorter comparison sequence may be determined over the entire length of the longer given sequence or, where the comparison sequence is longer than the given sequence, sequence identity of the comparison sequence may be determined over the entire length of the shorter given sequence. Sequence identity may be defined with reference to the algorithm GAP (Wisconsin GCG package, Accelerys Inc, San Diego USA).
- Use of GAP may be preferred but other algorithms may be used, e.g. BLAST (which uses the method of Altschul et al. (1990) J. Mol. Biol. 215: 405-410), FASTA (which uses the method of Pearson and Lipman (1988) PNAS USA 85: 2444-2448), SSEARCH (Smith and Waterman (1981) J. Mol Biol. 147: 195-197; ), HMMER3 (Johnson LS et al BMC Bioinformatics.
- antibodies or fragments thereof according to the present disclosure are able to cross the blood-brain barrier.
- the antibodies of the present disclosure are bispecific antibodies.
- antibodies according to the present disclosure may have one scFV chain that binds a receptor in the brain, such as the transferrin receptor (Yu et al.,Sci Transl Med. 2014 Nov 5;6(261):261 ra154.), as well as a scFv chain that binds UNC5C as described herein.
- antibodies according to the disclosure comprise an antibody or fragment thereof that binds UNC5C as described herein (such as e.g.
- the two binding moieties of such a bispecific molecule may form a fusion protein.
- single domain antibodies otherwise known as nanobodies, comprising the heavy chain CDRs and/or the VH sequence of any antibody described herein.
- antibodies or fusion molecules comprising a nanobody that binds UNC5C as described herein, and a nanobody that binds a receptor in the brain.
- antibodies of fusion molecules comprising a scFV chain or nanobody that binds UNC5C as described herein, and an aptamer that binds a receptor in the brain.
- Isolated nucleic acids encoding an antibody, antigen binding fragment, or polypeptide as described herein are provided.
- a vector comprising a nucleic acid described herein, and a host cell comprising the vector.
- the host cell may be a eukaryotic, or mammalian, e.g. Chinese Hamster Ovary (CHO), cell or may be a prokaryotic cell, e.g. E. coli.
- the vector is a viral vector, for example a bacteriophage.
- an antibody, or antibody fragment as described herein, the method comprising culturing a host cell as described herein under conditions suitable for the expression of a vector encoding the antibody, or antibody fragment, and isolating and/or purifying the antibody, or antibody fragment.
- the method further comprises formulating the antibody or antibody fragment into a composition including at least an additional component.
- Netrin-1 has been shown to protect against p-amyloid-induced neurotoxicity through NF-KB/Nrf2 dependent mechanism (Zamani et al., 2020).
- Antibodies described herein may reduce p-amyloid-induced neurotoxicity. This may be assessed by measuring apoptosis, for example by measuring caspase 3/7 production, in neurons treated with p-amyloid as described herein.
- Antibodies according to the disclosure may improve neuron survival and/or synaptic functions.
- antibodies of the disclosure may reduce amyloid toxicity.
- Antibodies of the disclosure may reduce cell death of amyloid treated neurons in vitro. Cell death may be as measured by measuring a caspase3/7 signal in response to beta amyloid induced cytotoxicity.
- Antibodies of the disclosure may increase the expression of one or more synaptic proteins, such as e.g. GAP-43.
- Antibodies of the disclosure may at least partially rescue neuronal cell death and axonal damage caused by netrin-1 depletion.
- Antibodies of the disclosure may improve neuron connectivity and/or firing rate and/or synchrony in motor neurons.
- the antibodies and fragments thereof described may find use in therapy.
- a subject to be treated or diagnosed may be any animal or human.
- the subject is preferably mammalian, more preferably human.
- the subject may be male or female.
- the subject may be a patient.
- Therapeutic uses may be in human or animals (veterinary use).
- Medicaments and pharmaceutical compositions according to aspects of the present invention may be formulated for administration by a number of routes, including but not limited to, parenteral, intravenous, intra-arterial, intramuscular, oral and nasal.
- the medicaments and compositions may be formulated for injection.
- compositions may be prepared using a pharmaceutically acceptable “carrier” composed of materials that are considered safe and effective.
- “Pharmaceutically acceptable” refers to molecular entities and compositions that are “generally regarded as safe”, e.g., that are physiologically tolerable and do not typically produce an allergic or similar untoward reaction, such as gastric upset and the like, when administered to a human.
- this term refers to molecular entities and compositions approved by a regulatory agency of the US federal or a state government, as the GRAS list under section 5 204(s) and 409 of the Federal Food, Drug and Cosmetic Act, that is subject to premarket review and approval by the FDA or similar lists, the U.S.
- carrier refers to diluents, binders, lubricants and disintegrants. Those with skill in the art are familiar with such pharmaceutical carriers and methods of compounding pharmaceutical compositions using such carriers.
- compositions provided herein may include one or more excipients, e.g., solvents, solubility enhancers, suspending agents, buffering agents, isotonicity agents, antioxidants or antimicrobial preservatives.
- excipients e.g., solvents, solubility enhancers, suspending agents, buffering agents, isotonicity agents, antioxidants or antimicrobial preservatives.
- the excipients of the compositions will not adversely affect the stability, bioavailability, safety, and/or efficacy of the active ingredients, i.e. the anti-CFH antibodies used in the composition.
- Excipients may be selected from the group consisting of buffering agents, solubilizing agents, tonicity agents, chelating agents, antioxidants, antimicrobial agents, and preservatives.
- Administration is preferably in a “therapeutically effective amount”, this being sufficient to show benefit to the individual.
- the actual amount administered, and rate and time-course of administration, will depend on the nature and severity of the disease being treated. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in Remington’s Pharmaceutical Sciences, 20 th Edition, 2000, pub. Lippincott, Williams & Wilkins.
- Conditions treatable in accordance with the present disclosure include any in which UNC5C plays a role, including neurodegenerative disorders, and in particular those characterised by increased neuronal apoptosis, decreased synaptic health and/or altered synaptic plasticity (e.g. reduced or abnormal synaptic plasticity).
- the antibodies of the present disclosure were originally identified through analysis of resilient frontotemporal dementia (FTD) patients. These antibodies were subsequently found in other resilient and control individuals in Alzheimer’s disease (AD); Parkinson’s disease (PD); and in resilient centenarians indicating relevance beyond FTD to other neurodegenerative diseases.
- FTD resilient frontotemporal dementia
- AD Alzheimer’s disease
- PD Parkinson’s disease
- resilient centenarians indicating relevance beyond FTD to other neurodegenerative diseases.
- antibodies of the disclosure for use as a medicament.
- antibodies of the disclosure for use in the treatment or prevention of a neurodegenerative disease.
- antibodies of the disclosure for use in the manufacture of a medicament, such as a medicament for the treatment or prevention of a neurodegenerative disease or disorder. Also described herein a method of treating a subject who has been diagnosed as having or being at risk of having a neurodegenerative disorder, the method comprising administering an antibody as described herein in a therapeutically effective amount to the subject.
- a neurodegenerative disease or disorder can comprise one or more of the following: FTD, AD, HD, Parkinson’s disease (PD), human immunodeficiency virus (HlV)-induced encephalitis, Chronic traumatic encephalopathy (CTE), vascular dementia, prion diseases, Lewy body disease, Spinal muscular atrophy (S MA); Motor Neuron Disease (MND), such as amyotrophic lateral sclerosis (ALS), progressive supranuclear palsy (PSP), spinocerebellar ataxias (SCA) types 1 , 2, 6, 7 and 17, Machado- Joseph disease (MJD/SCA3), dentatorubral pallidoluysian atrophy (DRPLA), spinal bulbar muscular atrophy X-linked type 1 (SMAX1/SBMA), Anderson-Fabry (X-linked Fabry Disease), and DNAJB6 Myopathies.
- FTD amyotrophic lateral sclerosis
- PSP progressive supranuclear palsy
- SCA spino
- the neurodegenerative disease is selected from FTD, AD, HD, MND, such as ALS, and PD.
- the neurodegenerative disease is a MND, such as ALS.
- the neurodegenerative disease is FTD, AD, HD or PD.
- the antibodies of the disclosure may be used in therapy with further therapeutic agents.
- a “further therapeutic agent” is an additional compound, protein, vector, antibody, cell or entity with a therapeutic effect.
- the antibodies may be co-administered with a further therapeutic agent.
- the antibodies may be co-formulated with a further therapeutic agent.
- the antibodies may be sequentially administered before or after a further therapeutic agent.
- the antibodies described herein may be used as biomarkers indicating that a subject is likely to respond to therapy using an antibody or antibody fragment as described herein.
- a method of treating a subject who has been diagnosed as having or likely to have a disease in which UNC5C plays a role comprising: obtaining BCR sequence data from the subject; determining, using said sequence data, whether the subject’s BCR repertoire comprises one or more antibodies that are likely to bind to UNC5C; and administering to a subject whose BCR repertoire does not comprise one or more antibodies that are likely to bind to UNC5C a therapeutically effective amount of an antibody or antibody fragment thereof as described herein.
- the sample may be a culture of cells grown in vitro.
- the culture may comprise a suspension of cells or cells cultured in a culture plate or dish.
- Methods according to the present disclosure may be performed, or products may be present, in vitro, ex vivo, or in vivo.
- in vitro is intended to encompass experiments with materials, biological substances, cells and/or tissues in laboratory conditions or in culture whereas the term “in vivo” is intended to encompass experiments and procedures with intact multi-cellular organisms.
- Ex vivo refers to something present or taking place outside an organism, e.g. outside the human or animal body, which may be on tissue (e.g. whole organs) or cells taken from the organism.
- a kit of parts comprising an antibody according to the present invention.
- the kit comprises an antibody according to the present invention and one or more of: reagents for use in immunochemistry; the antibodies immobilised to a solid support; means for labelling the antibodies; means for linking the antibodies to a cytotoxic moiety; a further therapeutic agent.
- Example sequence of antibodies described herein are provided in Figure 21 , 8B, 32 (aligned by IMGT position numbering) and in the table below.
- VH Heavy chain variable domain
- VL Light chain variable domain
- CDR Complementarity-Determining Region
- CDRL refers to CDRs in the light chain variable domain (numbered 1, 2 or 3 from N-ter)
- CDRH refers to CDRs in the heavy chain variable domain ((numbered 1, 2 or 3 from N-ter)
- FWR Framework region
- LFWR refers to an FWR in the light chain (numbered 1, 2, 3 or 4 from N-ter)
- HFWR refers to an FWR in the heavy chain (numbered 1, 2, 3 or 4 from N-ter).
- ATL_ is used as an antibody identifier.
- Example 1 demonstrate the identification of potential therapeutic antibodies from a cohort of subjects that have or at considered at risk of developing frontotemporal dementia or Parkinson’s disease (PD) (Example 1), as well as their in vitro and in vivo characterisation (Examples 2-5, 7-19) and optimisation (Example 6). Further antibodies were subsequently identified that display similar properties to those of Example 1 and 6 (Example 20).
- PD frontotemporal dementia or Parkinson’s disease
- UNC5C recombinant human antigen Fc-tagged R&D Systems, #1005-UN; or in-house production from HEK293F cells with N-terminal His or FLAG tag (SEQ ID NO: 98) - in-house human antigen was used to confirm results were not driven by Fc tag) or mouse antigen (in-house production from HEK393F cells with N-terminal His or FLAG tag (SEQ ID NO:97 -the expressed murine UNC5C extracellular domain comprises AA 41-380 of the murine UNC5C sequence); rat antigen (SEQ ID NO: 103); or cyno antigen (SEQ ID NO: 104) were directly absorbed to an ELISA plate at 3pg/ml (50pl per well) and incubated overnight at 4°C.
- the plate was washed with PBS. Plates were blocked with 200pl/well of blocking solution (1% BSA w/v in PBS) for 1 hour at room temperature. Following this, the blocking solution was removed and antibodies to be assessed were diluted in dilution series (1 pM to 0.05nM) in blocking solution (1% BSA w/v in PBS) and applied to the plate. Plates were incubated at room temperature for 1 hour. The plate was washed with PBS/0.1% Tween. Anti-Human IgG HRP (Jackson ImmunoResearch; #109-035-097) was added to plate and incubated for 1 hour at room temperature to detect antibody binding.
- blocking solution 1% BSA w/v in PBS
- the plate was washed with PBS/0.1% Tween and TMB solution (Life Technology; #002023) added. Plates were incubated for 5 minutes at room temperature prior to the addition of stopping solution (0.5M sulphuric acid). Absorbance was read on Molecular Devices FilterMaxF5 plate reader at 450nm. Analysis was performed using a non- linear fit curve fitting algorithm on GraphPad prism and EC50 calculated.
- the pool of 20 antibodies used in this screen were 18 antibodies identified from FTD sample cohort analysis, one antibody from a Huntington cohort and one positive control anti-PDL1 antibody.
- the antibodies were mixed in equal proportions (concentrations) to create the pool.
- the antibody pool was screened at 4ug/ml, so each individual antibody within the pool was screened at 0.2ug/ml.
- the pool of antibodies was screened for binding against fixed HEK293 cells/slides expressing the “Retrogenix library” comprising duplicate 6019 human plasma membrane proteins, secreted and cell surface tethered human secreted proteins and 397 human heterodimers. Screens were performed in duplicate.
- Antibody binding is detected using an AlexaFluor647-labelled secondary antibody and scanning slides. UNC5C was identified as a weak binder in one replicate and a very weak binder in the second replicate.
- UNC5C recombinant human antigen R&D Systems; #1005-UN or mouse antigen (in-house production) were directly absorbed to ELISA plate at 3pg/ml (50ul per well) and incubated overnight at 4C. The plate was washed with PBS. Plates were blocked with 200pl/well of blocking solution (1% BSA w/v in PBS) for 1 hour at room temperature. Following this, recombinant human Netrin 1 with C-terminal His tag (R&D Systems; #6419-N1) or vehicle was added to the plate for a pre-incubation step at room temperature for 30 minutes.
- Netrin 1 was then added to the wells at a final concentration of 75nM, and incubated at room temperature for 1 hour.
- the assay was set up in replicate wells to be able to detect both ATL_0005262 antibody binding and Netrin 1 binding.
- the plate was then washed with PBS/0.1% Tween.
- Anti-Human IgG HRP was added to plate (Jackson lmmunoResearch;#109-035-097) and incubated for 1 hour at room temperature to detect antibody binding to UNC5C.
- Anti-His-HRP Invitrogen #MA1-21315-HRP was added to wells to detect Netrin 1 binding to UNC5C.
- the plate was washed with PBS/0.1% Tween and TMB solution (LifeTechnology; #002023) added. Plates were incubated for 5 minutes at room temperature prior to the addition of stopping solution (0.5M sulphuric acid). Absorbance read on Molecular Devices FilterMaxF5 plate reader at 450nm.
- Biosensors were hydrated and conditioned prior to use by immersion in assay buffer and regeneration buffer (10 mM glycine pH 1.5, Cytiva), and brought to equilibrium in assay buffer prior to loading.
- the binding signal of a control antibody dipped into the same sample was subtracted from the raw data.
- Reference data was collected from loaded sensors dipped in a concentration-matched control antibody analyte.
- Charge variant analysis was performed by preparing a master mix to dilute antibody samples to run on a clEF cartridge on a Maurice instrument (Protein Simple).
- the master mix had a final concentration of methyl cellulose 0.35% (Protein Simple, 101876), pharmalyte pH 3-10 4% (Protein Simple, 17-0456-01), 10mM arginine (Protein Simple, 042-691), pl markers 4.05 and 9.99 0.01% (Protein Simple, 046-029 and 046-034).
- Samples were diluted at 0.15-0.25mg/ml in the master mix and were run for 1 minute at 1500 volts followed by 4.5 minutes at 3000 volts.
- a system suitability standard (Protein Simple, 046-044) was also run at the beginning of the run. Stability data generated at 2 and 4 weeks was overlaid to compare the charge species profile.
- Capillary isoelectric focussing (clEF) for ATL_6187 was performed on a Maurice instrument (ProteinSimple). 20 ug of sample was added to a master mix containing carrier ampholyte, pl markers pl 7 and 10, methyl cellulose and urea and loaded into a clEF cartridge (ProteinSimple), separation was performed between the pH range pl 7.0 to 10.0 and detection performed at 280 nm.
- Antibody samples were diluted to 1.2mg/ml in 20 mM histidine acetate, 150 mM NaCI pH 5.5 to runon a Zorbax GF-250 SEC-HPLC column (Agilent) on a Vanquish Flex (Thermo Scientific). Samples were separated by size in mobile phase 20mM Sodium phosphate, 300mM Sodium sulfate and 100mM Arginine at a flow rate of 0.75ml/minute at +25C for 25 minutes per sample. Chromeleon software (Thermo Scientific) was used to integrate the chromatograms.
- 2pg of antibody samples were prepared by diluting in waterand 2x Laemmli Sample Buffer (Bio-Rad). Samples were analysed at both reduced and non-reduced conditions; reduced samples had the addition of 50mM DTT (Sigma-Aldrich). All samples were heated to 95°C for 5 mins and loaded into wells of Bolt 4-12% Bis-Tris Plus Protein gels (Thermo Scientific) alongside 5pl of a molecular weight marker was loaded on each gel, Precision Plus Protein Dual Colour Standards (Bio-Rad, 1610737) and run in Bolt MES SDS Running Buffer (Thermo Scientific).
- CE-SDS Capillary electrophoresis sodium dodecyl sulfate
- CE-SDS was performed on a Maurice instrument separating samples on a CE-SDS Plus Cartridge (Protein Simple).
- Antibody samples were prepared by mixing 5pL of sample at 12.6mg/ml with 55pL of 1x Sample Buffer (Protein Simple), for a 1 mg/mL test solution concentration.
- 2.5pL of 2-Mercaptoethanol (Sigma-Aldrich ref: M6250) was added to the mix for non-reduced samples
- 2.5pL of lodoacetamide (Sigma-Aldrich) was added, then thoroughly vortexed and heated at 70°C for 10 minutes, followed by 5minutes on ice.
- Samples at 50mg/ml (ATL_6178) for freeze-thaw assessments were temperature cycled between -70°C and room temperature, allowing the sample to completely thaw each time, for either 3 or 5 cycles. All stressed samples were compared to a -70°C frozen control sample.
- Samples requiring low pH conditions were adjusted to pH3.5 using hydrochloric acid and placed at 25°C for 6h or 24h, after which they were frozen at -70°C until required for analysis.
- purified ATL_6178 was concentrated to 50 mg/mL, 100 mg/mL or to a maximum of 288.9 mg/mL by ultrafiltration centrifugation. The sample at 288.9 mg/mL was diluted to 200 mg/mL for analysis. Samples were then analysed before or after being incubated at 25°C for 7 days.
- Protein thermal shift measurements were performed on an Uncle (Unchained labs). Antibodies were diluted to 1 mg/ml or 5mg/ml in 20 mM Histidine Acetate, 150 mM NaCI, pH 5.5 buffer and run through a temperature ramp of 25-95°C increasing at a rate of 0.5°C/minute. Samples were run in triplicate, loading 8.8pl in 3 different wells of a uni (Unchained Labs). Laser settings were set to achieve an initial fluorescence in the 300-350 nm range of 10000 - 50000 counts. Melting temperature (Tm1/Tm2) and aggregation temperature (Tagg/Tonset) were analysed using Uncle Analysis software v6 (Unchained Labs). Tm measurement was calculated using the 350/330nm ratio, while Tonset and Tagg were obtained from SLS read at 266nm.
- ATL_0005262 To determine the PK of UNC5C antibodies, an in vivo PK experiment was performed with ATL_0005262. Six-eight week-old male C57BL/6J mice were treated via IP with ATL_0005262 at 1 , 10 and 60mg/kg and serum was collected 1 , 4, 8, 24, 72 and 144 hours post-dose. Brains and cerebrospinal fluid (CSF) were collected at 24, 72 and 144 hours post-dose. ATL_5338 was administered at 10mg/kg as a control antibody. Antibody levels were assessed via ELISA.
- the cells were lysed and protein extracted using RIPA cell lysis buffer, consisting of 50 mM Tris (pH 8.0), 150 mM NaCI, 5 mM EDTA, 1 % NP-40, 0.5 % sodium deoxycholate and 1 % SDS, supplemented with protease and phosphatase inhibitors (Sigma).
- RIPA cell lysis buffer consisting of 50 mM Tris (pH 8.0), 150 mM NaCI, 5 mM EDTA, 1 % NP-40, 0.5 % sodium deoxycholate and 1 % SDS, supplemented with protease and phosphatase inhibitors (Sigma).
- the impact of the various treatments was assessed by quantitative Western blot, performed by RayBiotech, Inc. (Peachtree Corners, GA, USA) using their Auto Western Blot Service. Extracted protein sample at a concentration of 0.1 mg/ml was loaded into the automated capillary electrophoresis machine.
- the following antibodies were employed
- PA5-67780 NeurofilamentL (Cell Signaling; Catalog No. 2837), Synaptophysin (Cell Signaling; Catalog No. 36406), PSD95 (Cell Signaling; Catalog No. 3450), Synapsin-1 (Cell Signaling; Catalog No. 5297), Synaptotagmin-1 (Cell Signaling; Catalog No. 14558).
- Secondary antibodies from RayBiotech, Inc. auto Western Blot Service catalogue were used.
- Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) antibody provided by RayBiotech from their service library was used.
- assays included: (a) live/dead Assay; (b) GAP-43 expression analysis; and (c) neurite outgrowth assessment (using XonaChips compartmentalized microfluidic devices, from Xona Microfluidics, USA).
- somatic and axonal compartments were imaged using a 20x objective, capturing both differential interference contrast (DIC) and 488-channel fluorescence. Visualization was performed after three PBS washes, and images were acquired using Echo Revolve. Quantitative analysis of the axonal compartment involved measuring total neurite length and total neurite number.
- iCell Motor Neurons isogenic control (Catalog # C1048), iCell Motor Neurons ALS TDP43 Q331 K (Catalog # R1144) and iCell Astrocytes (Catalog # R1092) were all sourced from FUJIFILM Cellular Dynamics, Inc. and maintained in accordance with the manufacturer's protocols.
- Culture surfaces were prepared by initially treating them with a 0.1 % polyethylenimine solution (Sigma-Aldrich), followed by an overnight incubation. Subsequently, treated surfaces were thoroughly washed three times with sterile distilled water and allowed to air dry for an hour.
- the dried surfaces were then coated with 5 pg/ml laminin (Sigma-Aldrich), followed by another overnight incubation. After this incubation, the laminin solution was aspirated, and cells were plated immediately at a density of 55,000 cells per cm 2 , using the provided manufacturer's medium. Notably, the cell culture included a ratio of 15 % astrocytes to neurons (equivalent to 1.5 K astrocytes per 10 K neurons). The cultured motor neurons were fed every 2-3 days with a 50 % medium replacement and were analyzed between days 15 and 20 of culture for all experiments.
- MEA multielectrode array
- Maestro MEA system from Axion Biosystems.
- standard recording settings for spontaneous neuronal spikes were applied using Axis software (version 2.5). Cells were maintained at a constant temperature of 37°C and 5 % CO2 throughout the 2-minute recording period.
- the standard settings included a 130* gain, recording from 1 to 25,000 Hz, and a low-pass digital filter of 2 kHz for noise reduction.
- Spike detection was configured at 5* the standard deviation of the noise, and network burst detection was recorded if at least 25 % of the electrodes in a given well exhibited synchronous activity.
- results reported herein were derived from averaging all electrodes in each well and then averaging data from six wells.
- the experimental treatments consisted of ATL-5338 (isotype control) and ATLX-1282, both administered at specific final concentrations of 100 nM. These treatments commenced on day 15 of the experiment and continued for 142 hours (Dose 1 : 0 time point; Dose 2: 120 h after 1 st Dose).
- daily recordings were conducted from day 15 to day 20, with one recording performed each day. Recorded data were subjected to processing using Axion Biosystems' software for spike detection and waveform analysis. Statistical analysis was carried out using appropriate statistical tests to compare the effects of different compounds on neural network activity. Results were considered statistically significant at p ⁇ 0.05.
- the pre-treatment was selected from 80 nM ATL5262, 80 nM ATLX-1282, 80 nM isotype control (ATL-5338), 10 nM Netrin- 1 , 10 nM clusterin (control protein having a similar size to Netrin 1 (100kD)), or a negative control (antifluorescein ATL_5338, same lgG1 isoptype) lacking a pretreatment.
- p-amyloid peptide 1-42 (rPeptide, catalogue # A-1170; Abeam, catalogue # AB120301) diluted in complete medium with caspase 3/7 green dye (20 pM final concentration) was added.
- the plate was then read using an Incucyte live imaging system (Sartorious) for 72 hrs using Red/Green optical module. Analysis was performed following removal of any outliers (Grubbs and ROUT - no outliers detected) with normalisation of green count to number of cells (red count). Area under the curve on Graphpad prism was generated with Oneway Anova with Sidak's multiple comparisons test used to determine significance between treatments.
- Locomotor activity, rearing frequency and stereotypic counts was recorded in 5 minutes bins for 30 minute baseline following which mice received either amphetamine (4 mg/kg) or saline and placed back in the OF chambers for a further 60-minute session.
- Saline was used as a control for Amphetamine
- ATL5338 was used as an isotype control for ATLX-1282.
- Rats used were female Sprague-Dawley rats (Charles River, approximately 290 g at time of surgery). On Day 1 of study, all animals received either 6-OHDA or vehicle (saline) administered unilaterally, at three sites, into the right striatum according to stereotaxic techniques. ATLX-1282 and the isotype control (ATL5338) were administered IP at a dose volume of 5 ml/kg, once a week (QW) for 4 weeks. On day 26 of study, rats underwent behavioural assessment via cylinder test (assessment of spontaneous forepaw use). The number of times each paw touches the side of the cylinder during an individual rear is determined from post hoc analysis of video by an observer blinded to the treatments given and results plotted as % contralateral touches.
- UNC5C recombinant human antigen R&D Systems; #1005-UN
- R&D Systems #1005-UN
- the plates were washed with PBS. Plates were blocked with 1 % BSA w/v in PBS blocking solution for 1 hour at room temperature.
- the phage-derived antibodies ATL6530- ATL6539
- negative control antibody ATL_0005338 were added to the plates in a dilution curve ranging from 1 pM to 0.1 pM (final concentration; once Netrin-1 added). Plates were incubated for 30 minutes at room temperature.
- Netrin-1 (R&D Systems; #6419-N1) was then added to the wells at a final concentration of 75 nM, and incubated at room temperature for 1 hour.
- the assay was set up in replicate wells to be able to detect both antibody binding UNC5C in the presence and absence of Netrin-1 , in addition to Netrin-1 binding UNC5C in the presence of antibody.
- the plate was then washed with PBS/0.1 % Tween.
- Anti-human IgG HRP was added to the plates (Jackson lmmunoResearch;#109-035-097) and incubated for 1 hour at room temperature to detect antibody binding to UNC5C.
- Anti-His-HRP (Invitrogen #MA1-21315-HRP) was added to wells to detect Netrin-1 binding to UNC5C.
- the plates were washed with PBS/0.1 % Tween and TMB solution (LifeTechnology; #002023) added. Plates were incubated for 5 minutes at room temperature prior to the addition of stopping solution (0.5 M sulphuric acid).
- Absorbance was read on a Molecular Devices FilterMaxF5 plate reader at 450 nm. Analysis was performed using a non-linear fit curve fitting algorithm on GraphPad prism and EC50 calculated.
- C57BL/6 naive mouse brains were cryopreserved via snap freezing in OCT, sectioned using a cryostat onto glass slides and stored at -20°C until use. Slides were thawed and air-dried prior to fixation in neutral buffered formalin (10 %) for 10 minutes and washed in PBS-Triton X (0.5 %) for 30 minutes. Hydrophobic barriers were drawn around each tissue section and blocked with appropriate blocking solution (1 % BSA, 10 % FBS, 5 mM EDTA, 0.3 M glycine in PBS-Tx 0.5 %) with addition of either Clusterin (R&D Systems cat. # 2937-HS-050), Netrin-4 (R&D Systems cat.
- nucleotide sequences encoding canonical UNC5C (SEQ ID NO: 99) and mutated UNC5C T835M variant (SEQ ID NO: 110) were cloned into the lentiviral transfer vector pCDH-EF1a-MCS-(PGK-GFP- T2A-Puro) (System Biosciences; #CD813A-1) and confirmed with sanger sequencing.
- Lentiviral particles were produced in the 293T cell line (ATCC; #CRL-3216) using TransIT-VirusGEN Transfection Reagent (Mirus; #MIR 6700) and pPACKHI HIV Lentivector Packaging Kit (System Biosciences; # LV500A-1).
- Stable cell lines were generated by transduction of HEK-293 cell line (ECACC; #CRL-1573) with lentiviral particles and subsequent selection of successfully transduced cells with puromycin (GibcoTM; # A1113803) at 1 pg/ml. Overexpressing cell lines were monitored for GFP expression and cultured in the presence of selection antibiotic.
- HEK-293 cells as well as cell lines expressing UNC5C, mutated UNC5C T835M and empty vector (EV) control were harvested using non-enzymatic dissociation buffer (CORNING; cat # 25-056-CI).
- Cells were then labelled with viability dye eF780 (Invitrogen; #65-0865), washed with FACS buffer (DPBS, Gibco; #14190-169, 2% FBS, LSG; #S-001A-USDA) and incubated with the antibodies at 100 pg/ml (0.69 nM), in triplicate, for 1 h at 4°C.
- the percentage of APC positive cells (lgG + cells) as well as IgG-APC median fluorescence intensity (MFI) were measured in the population gated on single/viable/cells.
- the HEK-293 cell line was used as the negative control for APC (lgG + ) gating and the background signal was subtracted from the results.
- Recombinant human UNC5C was produced in ExpiHEK293 by transient transfection of a construct corresponding to Ig domains 1 and 2 and purified via a C-terminal hexahistidine tag (SEQ ID NO: 111).
- the Fab fragment of ATL_5262 was produced by transient transfection of ExpiCHO and purified via the CH1 domain. Both components were purified by SEC, mixed together to form the complex and screened for crystallisation using commercial crystallisation screens.
- X-ray diffraction data was collected from crystals grown in 22 % PEG Smear Broad, 0.1 M Bicine pH 9.3 (among many other formulations that had a similar composition and pH).
- Data was autoprocessed with Xia2/Dials and used for molecular replacement with the program Phaser using a truncated “Netrin receptor UNC5C” monomer (UniProt ID D6RE16 AlphaFold model) and a Fab heterodimer (PDB ID 6CNR) as search models.
- the original data from autoprocessing was reindexed to P6522 (space group of the protein crystal) and the model was taken through several rounds of interactive model rebuilding with the program Coot and refinement with Refmac, and finally manual and automatic solvent building with ARP/wARP, to produce the final model.
- Data collection and refinement statistics are set out in Table 4.
- the model contains one molecule each of the Fab heavy and light chains and one molecule of UNC5C in the asymmetric unit.
- the asymmetric unit is the area within the crystal lattice that contains the molecules that are repeated throughout the crystal. Finding only one copy of each the Fab and antigen, in combination with analysis of how the repeating units interact with each other here show that there are no other biologically relevant interactions e.g. dimerisation of the target.
- Table 4 Data collection and refinement statistics. Statistics for the highest-resolution shell are shown in parentheses.
- a phage library of scFv molecules displayed on an M13 phage was generated by cloning the heavy chain variable region (VH) repertoire of subjects SU_0000656 and SU_0000697 into a sub-library of phagemid vectors with light chain variable region (VL) sequences from healthy donors.
- VH heavy chain variable region
- VL light chain variable region
- Hyper phage 1.5e12 cfu/ml
- PRHYPE catalogue number PRHYPE
- K07deltaplll used in Phage display and phage ELISA
- UNC5C_HUMAN antigen SEQ ID NO: 194 produced In-house (in house number UNC5C_HUMAN_008 (Alchemab) res41-380 Batch#004) (used in Phage Display and Phage ELISA)
- 2TYAG 2TY media supplemented with 100 pg/ml ampicillin and 2 % glucose
- the cultures were then incubated overnight at 25°C with good aeration and next day the phages were separated from bacteria by centrifugation for 10 minutes at 3200 rpm. The phage-containing supernatant was transferred to a new plate and blocked with 3 % milk w/v in PBS.
- UNC5C recombinant human antigen in-house, UNC5C_HUMAN_008 (Alchemab) res41-380 Batch#004) or negative control Lysozyme (MP Biomedicals #195303) were directly absorbed to ELISA plate at 3 pg/ml (50 pl per well) and incubated overnight at 4°C.
- Each antigen-coated plate was washed with PBS and blocked with 200 pl/well of blocking solution (3 % milk w/v in PBS) for 1 hour at room temperature. Following this, the blocking solution was removed and blocked phage samples to be assessed were applied to the plates. Plates were incubated at room temperature for 1 hour.
- Convergent sequence clusters derived from the antibody repertoire of resilient groups of individuals can be used to identify disease-specific antibody sequences.
- the present inventors sought to identify candidate protective antibodies from Frontotemporal dementia (FTD)-resilient individuals from a cohort of FTD patients (Genetic FTD Initiative (GENFI), www.genfi.org/).
- FTD encompasses several types of dementia impacting frontal and temporal lobes of the brain, and major genetic risk factors are GRN and C9orf72 mutations.
- Resilience to FTD was defined as individuals not developing disease despite being within the top 33% of the cumulative age of onset of frontotemporal dementia and the presence of GRN or C9orf72 mutations. From the total cohort of over 1000 individuals, the 22 most highly resilient individuals were selected. Sequencing of the antibody repertoires of these resilient patients revealed a convergent heavy chain variable (VH) sequence among three highly resilient individuals (See Figure 1 for workflow used to identify convergent VH sequences from the FTD dataset). The probability of all three individuals producing this antibody by chance is extremely low. It is likely that this particular sequence was highly selected for and thus advantageous to the individual.
- VH convergent heavy chain variable
- the VH sequence was subsequently paired with a VL using a transformer-based model comprising an encoder-decoder model trained on a corpus of paired VH-VL sequences. Further details on how such a model may be trained and used is provided in WO2022/223451 .
- the trained model takes a VH sequence as input and generates a single complementary VL sequence as output.
- ATL_5262 (ATL_0005262) was included in a proteomics array for target deconvolution, identifying the Netrin receptor UNC5C as its target (data not shown). Binding of ATL_5262 to UNC5C was confirmed by ELISA ( Figure 2).
- Figure 8 shows a VH sequence alignment of representative ATL_5262 homologous sequences ATL_6187 and ATL_6191 (SEQ ID NO: 112-113).
- the representative VH sequences of the ATL_5262 homologues were subsequently paired with the VL of ATL_5262 (SEQ ID NO: 9) and produced as lgG1 Fc NULL antibodies.
- the VH of these antibodies had at least 80% sequence identify with the sequence of the VH of ATL_5262 (in particular: 6187: 84.87%, 6191 :89.92%- for reference the 5262 derivative antibody 6178 has 94.96% VH sequence identity with the VH of ATL_5262, all determined using Clustal).
- Antibodies 6187 and 6191 both had EC50 for binding to EC50 below 10 7 (determined by ELISA). These antibodies have 0 or 1 mutation in the VH CDR3 compared to ATL_5262 (at most 1 mutation at position 117 in IMGT numbering, Y117S) and up to 3 mutations in each of the VH CDR2 and CDR1 compared to ATL_5262. Both ATL_6178 and ATL_6191 had a mutated variable region and IGHG1 constant region, which indicates that class-switch recombination and affinity maturation through somatic hypermutation have occurred, and thus that most likely there has been a germinal centre-induced immune response to antigen (see Table 5). These highly mutated class switched sequences are likely from memory B cells, which are typically more specific to the antigen than a naive B cell.
- UNC5C antibodies could be found in resilient individuals in these cohorts highlights the relevance of UNC5C as a therapeutic target in various neurodegenerative conditions.
- FIG. 4A shows that Netrin 1 could be detected in wells containing UNC5C alone, UNC5C and ATL5262, and UNC5C and ATL_5338, indicating that Netrin 1 inhibits binding of ATL_5262 to UNC5C.
- Figure 4B shows that ATL_5262 could only be detected in wells not preincubated with Netrin 1 , confirming that ATL_5262 binds to UNC5C and this binding is inhibited by Netrin 1.
- Figure 4B further shows that the control antibody ATL_5338 does not bind to UNC5C.
- ATL_5262 Human and murine UNC5C have 97% homology, and ATL_5262 is able to bind both rhUNC5C ( Figure 7A) and rmUNC5C ( Figure 7B).
- Control antibody ATL_5338 shows negligible binding to rhUNC5C ( Figure 7A) and rmUNC5C ( Figure 7B).
- ATL_5262 does not bind to irrelevant protein lysozyme ( Figure 7C), indicating that the antibody does not exhibit non-specific binding.
- ATL_5262 binds both human and mouse recombinant UNC5C.
- EXAMPLE 4 Binding to other netrin receptors and related proteins
- the inventors subsequently sought to investigate the selectivity of ATL_5262 for UNC5C.
- a BLAST search of human protein sequences with >50-% sequence identity was performed using the reference UNC5C sequence (accession 095185) in the UniProtKB database (www.uniprot.org/). This returned the related proteins UNC5A, UNC5B, UNC5D.
- the human netrin receptors neogenin, DCC, and DSCAM were considered as potential binding partners.
- FIG. 28 shows that ATL_5262 and ATL6178 bind to UNC5C but not to any other Netrin receptors or related proteins in this assay (UNC5A, B, D, DCC, and neogenin-1 ectodomains). No evidence of binding to any non-UNC5C antigens by either antibody at a concentration of up to 100 nM was observed, indicating selectivity of these ATL_5262 and ATL_6178 for UNC5C.
- ATL_6178 was analysed in a binding assay against fixed HEK293 cells expressing 6105 individual full-length human plasma membrane proteins and cell surface-tethered secreted human proteins, as well as a further 400 human heterodimers, followed by a series of confirmatory screens, using the Retrogenix platform with the operators blinded to the antibody target.
- Other Netrin-1 receptors including UNC5A, UNC5B and UNC5D, NEO1 , DCC and DSCAM were in the screening panel and displayed no binding to ATL_6178.
- UNC5C was the only confirmed target for ATL_6178.
- ATL_5262 was tested in a thermal shift assay at both 1 and 5mg/ml. The results of this are shown in Table 6, and Figure 10. This shows that Tm1 and Tm2 was within a normal range for monoclonal antibodies (mAbs) and Tagg occurred before Tonset, indicating that aggregation is induced by unfolding more strongly than by protein-protein or protein-buffer interaction. Tmi is after Tagg indicating that the protein begins to aggregate at ⁇ 50% ratio of unfolded-to-folded protein. Table 6. Tonset, Tm1, Tm2 and Tagg for ATL_5262 in a thermal shift assay.
- Capillary isoelectric focussing was used to analyse charge heterogeneity of ATL_5262 after 2 weeks ( Figure 11 A) or 4 weeks (Figure 11B) in storage at -80 °C, 4 °C, and 40 °C. Whilst an increase in acidic charge variants was observed at 40 °C (49.27% at 2 weeks and 53.39% at 4 weeks) (Figure 11C, Table 4), minimal changes in charge species present were observed in all other conditions (Table 7).
- Table 7 Calculated percentage of acidic species area; main peak area; and basic species area.
- Figure 12 shows that no soluble aggregates formed following incubation at - 80°C, 4°C, 40°C for 2 weeks ( Figure 12A) or 4 weeks ( Figure 12B).
- Table 8 further supports the excellent stability of ATL_5262 and shows low levels of high molecular weight species (HMWS) and low levels of low molecular weight species (LMWS) indicating that there is low aggregation and degradation propensity of the antibody up to 40C, which is further supported by the high percentage of monomers in all of the samples (>95%).
- HMWS high molecular weight species
- LMWS low levels of low molecular weight species
- HMWS high molecular weight species
- LWMS low molecular weight species.
- SDS-PAGE was used to analyse the purity of ATL_5262 after storage at - 80°C, 4°C, 40°C for two weeks ( Figure 13A) or 4 weeks (Figure 13B), or after 3 FT cycles (Figure 13B).
- Reduced IgG antibodies typically give rise to glycosylated heavy chains of approximately 50 kDa and light chains of approximately 25 kDa on SDS-PAGE (as indicated by “R” in Figure 13) and 150 kDa bands for non-reduced antibodies (as indicated by NR in Figure 13A and B).
- Minimal changes to samples molecular weight separations are detected for both reduced and non-reduced samples following the temperature and freeze thaw stability time course.
- NIST mAb was run as a molecular weight control of a human IgG 1 mAb.
- CE-SDS was used to analyse the molecular weight and purity of species following the temperature time course stability samples.
- Non-reduced samples show a 3-5% decrease in main species at 40C at both 2 weeks ( Figure 14A) and 4 weeks ( Figure 14B) but not at other storage temperatures (Table 9), under reducing conditions minimal changes were detected through the temperature time course stability study at both 2 weeks (Figure 14C) and 4 weeks (Table 14D) (Table 10).
- ATL_5262 binding of ATL_5262 to rhUNC5C was tested after two weeks (Figure 15A) or 4 weeks (Figure 15B) at -80 °C, 4°C, or 40 °C, or after 3 x FT cycles ( Figure 15B) using ELISA.
- ATL_5262 showed consistent binding to UNC5C under all conditions and this was reflected in consistent EC50 values (Table 11), indicating that the binding potency of ATL_5262 is unaffected by temperature changes or freeze thaw conditions.
- ATL_5262 is stable at -80°C and 4°C up to 4 weeks tested, and through -80°C 3x Freeze Thaw cycles, and while some biophysical changes were observed at 40°C, ELISA shows that binding to UNC5C is not affected by these changes. ATL_5262 is therefore stable and suitable for further development.
- VH SEQ ID NO: 1
- VL sequence SEQ ID NO: 9
- the ATL_5262 sequence was compared with the VH germline sequence and found to have five amino acid substitutions compared with the germline sequence. Reverting sequences to germline typically reduces immunogenicity and improves antibody expression and stability. Therefore, one VH variant tested was the germline reversed VH framework sequence, ATL_6033 (SEQ ID NO: 2).
- mutating IMGT position 82 of the VH to a lysine (K) in order to reduce the risk of aspartate (T) isomerisation enhances binding of the resulting antibody (ATL_6039) to UNC5C about 3-fold compared with ATL_5262 ( Figure 16).
- IMGT residues 67 and 82 are important for UNC5C binding.
- ATL_6178 (SEQ ID NO: 93) also removes an additional potential sequence liability by mutating Asparagine (N) at position 58 IMGT, which is part of a predicted Asparagine deamidation site in CDR2 (NS motif), to Tyrosine (Y) (N58Y).
- N Asparagine
- Y Tyrosine
- ATL_6177 and ATL_6178 are expected to have improved stability and binding potency compared with other ATL_5262 variants.
- the tested VH variants show similar binding profiles for human (Figure 17A) and murine UNC5C (Figure 17B), whilst showing minimal binding to lysozyme at the highest concentration of antibody used (Figure 17C).
- UNC5C exists in monomeric form in the absence of its ligand netrin 1 , and in dimeric form when it binds to netrin-1.
- ATL_5262 binds both monomeric and dimeric UNC5C.
- an ELISA was performed using Fc-tagged dimeric rhUNC5C and His-tagged monomeric rhUNC5C. Similar binding profiles were observed for binding to the dimeric Fc-tagged rhUNC5 ( Figure 18A) and monomeric his- tagged rhUNC5C ( Figure 18B), and this was reflected in similar EC50 values (Table 13) indicating that ATL_5262 is capable of binding to both monomeric and dimeric UNC5C.
- Antibody variants of ATL_5262 with different light chains were also generated and tested.
- VLs were obtained by a two-step process.
- 600 different VLs were computationally synthesised for the VH of ATL_5262 using a modified version of the model described in WO2022/223451 , where encoder and decoder models were replaced with a pretrained AntiBERTa model as described in Leem at al., 2022.
- the 600 different VH-VL pairs were prioritised using a separate AntiBERTa model, described in GB 2215218.5 filed 14 October 2022.
- the model from GB2215218.5 takes a VH-VL pair as input (natural or synthetic) and computes the probability that the two chains would form a pairing.
- VLs were selected for synthesis based on the predicted probability from the model (selecting candidate VLs with high predicted pairing probability with the VH of ATL_5262), low sequence liability content, and sequence diversity.
- VL variants tested included the VL of ATL_5996 (SEQ ID NO: 10); ATL_5997 (SEQ ID NO: 11); ATL_5998 (SEQ ID NO: 12); ATL_5999 (SEQ ID NO: 13); ATL_6000 (SEQ ID NO: 14); ATL_6001 (SEQ ID NO: 15); ATL_6002 (SEQ ID NO: 16); ATL_6003 (SEQ ID NO:17); ATL_6004 (SEQ ID NO: 18); ATL_6005 (SEQ ID NO:19). All of the above VL variants antibodies include the VH of ATL_5262.
- ATL_0006034, ATL_0006035, ATL_0006036, ATL_0006037, ATL_0006038, ATL_0006039, ATL_0006177, ATL_0006178, ATL_0006187, ATL_0006191 all demonstrated binding to human UNC5C with various potencies (see Table 14).
- ATL_0006001 and ATL_6039 a signal at least 3x the level of lysosome control was observed, but a full dose response curve could not be obtained and so an EC50 cannot be reported. In both cases the data therefore shows that the antibodies do bind the target. In the case of ATL_6039 an EC50 could not be obtained because the antibody was very potent and a lower concentration range would need to be tested to get an EC50. This data means that antibody certainly binds, just cannot report potency number.
- ATL_0006191 showed binding to mouse UNC5C.
- ATL_0005262, ATL_0006178 and ATL_0006191 were demonstrated binding to cyno UNC5C.
- ATL_0005262, ATL_0006178 and ATL_0006191 were tested and demonstrated binding to rat UNC5C.
- Netrin 1 competed with ATL_0005262, ATL_0006002, ATL_0006036, ATL_0006039, ATL_0006177 and ATL_0006178 for binding to human UNC5C.
- ATL_5262 exhibits linear serum ( Figure 20A) and CSF PK ( Figure 20B) with a clearance profile that is comparable to the non-binding lgG1 control, ATL_5338.
- ATL_5262 shows evidence of CNS-penetration with a serum:CSF ratio of -0.1-0.2%.
- Amyloid treatment of SHSY5Y derived from a neuroblastoma cell line, cells has been demonstrated to induce cell death. Netrin 1 has been reported to reduce this.
- ATL6178 also referred to herein as ATLX-1282
- ATL5262 can replicate this effect, a rescue experiment, adding the antibodies to the amyloid-treated SHSY5Y cells was performed, followed by measuring caspase 3/7 production as a measure for amyloid toxicity.
- Figure 22 shows the results of this assay.
- ATLX1282 (ATL_6178), ATL5262 and Netrin 1 all demonstrated an ability to reduce caspase3/7 signal in response to beta amyloid 1-42 induced cytotoxicity.
- the antibodies described herein are expected to be able to enhance synaptic health (such as e.g. plasticity) by acting as a netrin-1 mimic. This can be tested using in vitro assays that directly assess measures of synaptic health which may include but are not limited to parameters such as the number of processes per cell, the length of neurite outgrowth, and branching (using for example the methods provided in Spijkers et al., Sci Rep, 2021), as would be expected from their binding profile.
- ATL6178 enhances synaptic health by acting as a netrin-1 mimic using in vitro assays that directly assess measures of synaptic health which may include but are not limited to parameters such as the number of processes per cell, the length of neurite outgrowth, and branching (using for example the methods provided in Spijkers et al., 2021), as would be expected from their binding profile.
- TDP-43 is a highly conserved ribonuclear protein that accumulates as ubiquitinated inclusions in both ALS and FTD patients.
- iPSC-derived motor neurons carrying the ALS-relevant TDP43 Q331 K mutation have been reported to display synaptic dysfunction when assessed by multielectrode array (Smith, Alec S T et al. “2021).
- Co-culture of such neurons with iCell Astrocytes provides a sophisticated co-culture model, enabling a more comprehensive understanding of neural network behaviour and its response to various compounds.
- iPSC-derived motor neuron and astrocyte co-culture system was treated with ATLX-1282 or isotype control (ATL-5338) for up to 142 hours and activity assessed via a multielectrode assay (MEA), which measures the extra-cellular field potential produced by the neurons.
- MEA multielectrode assay
- ALS TDP43 Q331 K iCell Motor Neurons manifest pronounced deficiencies in overall activity, viability, and burst dynamics when compared to the isogenic control counterparts, iCell Motor Neurons.
- These ALS TDP43 Q331 K iCell Motor Neurons also exhibit discernible alterations in connectivity and mean firing rate in comparison to the isogenic iCell Motor Neurons.
- ATLX-1282 attenuates the temporal-dependent loss in activity seen in TDP43 Q331 K motor neurons and promotes enhanced bursting activity (Figure 25A-B). Viability is relatively stable over time within respective cell lines (Figure 25C) suggesting that any change in activity is not simply a result of cell death but a putative change in, and promotion of, neural health. Noteworthily, ATLX-1282 plays a pivotal role in enhancing synaptic connections, thus fostering heightened synchrony among ALS TDP43 Q331 K motor neurons as illustrated by an increased synchrony index and higher fire rate of TDP43 cells treated with ATLX-1282 compared with isotype controls ( Figure 25D). These findings represent compelling substantiation for the efficacy of ATLX-1282 treatment within motor neurons.
- UNC5C or netrin-1 haploinsufficiency leads to altered innervation by dopaminergic neurons to the medial prefrontal cortex, and perturbed dopamine content in the medial prefrontal cortex (mPFC). This manifests as a reduced response to the stimulant amphetamine (Pokinko et al; 2015).
- ATLX-1282 could act as a ligand mimetic for Netrin 1
- Netrin 1 haplo-insufficient mice were treated with ATLX-1282 and response to Amphetamine assessed.
- Amphetamine was administered at various days, starting on day 8 post the first ATXL-1282 treatment.
- ATLX-1282 treatment resulted in a statistically significant increased response to Amphetamine in Netrin 1 haploinsufficient mice, relative to the isotype control (see Figure 26).
- ATLX-1282 can effectively engage UNC5C in its natural CNS setting and may reduce the deficit induced by Netrin 1 haploinsufficiency and that ATLX-1282 can act as a ligand mimetic for Netrin 1 .
- 6-Hydroxydopamine (6-OHDA) is a neurotoxin which has been demonstrated to cause degeneration of dopaminergic neurons in the mid brain. Netrin 1 via intracerebroventricular injection (ICV) has been shown to have a neuroprotective effect against 6-OHDA-mediated degeneration (Jasmin et al., 2021).
- ATLX-1282 and isotype control ATL-5338 were tested in an efficacy study in 6-OHDA treated rats to see if they could replicate this effect (if ATLX-1282 has similar neuroprotective effects to netrin-1 in this model).
- a contralateral paw cylinder test was used to assess this to determine the degree of dopaminergic cell loss in the treated rats. Rats treated with 6-OHDA displayed an average decrease in contralateral paw use relative to saline treated controls, indicating success of the 6-OHDA treatment (i.e. demonstrating 6-OHDA-mediated neurodegeneration).
- UNC5C antibodies as described herein show therapeutic effects in the treatment and/or prevention of neurodegenerative diseases such as PD, FTD and AD and provides antibodies that can achieve this by binding to the same binding site as Netrin 1 .
- ATL_6178 also referred to herein as ATXL_1282
- ATXL_1282 The manufacturability of ATL_6178 was tested following exposure to different stress conditions. Such conditions included freeze thaw cycles, agitation, thermal stability and low pH. Stressed samples were evaluated for appearance, purity, aggregation, size and change in charge variants using MFI, SEC-HPLC, CE-SDS, clEF and DLS. Samples were also concentrated to high densities (50 mg/mL, 100 mg/mL and 200 mg/mL) and analysed at time 0 and after 7 days incubation at room temperature. Solubility samples were analysed for appearance, viscosity and purity using SEC-HPLC.
- ATL_6178 was expressed from a CHO-K1 stable pool transfection, following a 14 day fed batch the culture was harvested and the monoclonal antibody purified using protein A capture and a second stage cation exchange chromatography step followed by centrifugation using a 30kDa cut off and buffer exchange into formulation buffer 20mM histidine HCI, 8% sucrose, 0.04% tween 80, pH 6.0 followed by sterile filtration.
- ATLX-1282 solubility was tested at 50 mg/mL, 100 mg/mL and 200 mg/mL. Samples were evaluated at time 0 and after 7 days at 25°C. The results are shown in Table 15 and Table 16. Visual evaluation showed the protein is free of particles and there is no change in appearance (Table 15), while SEC-HPLC analysis demonstrates no substantial change in monomeric form, small changes in low molecular weight species (LMWS) and high molecular weight species (HMWS) present after concentration and incubation at 25°C for 7 days (Table 16). This indicates the molecule is stable at high concentrations. Viscosity reaches a maximum of 24 cP at 200mg/mL indicating the molecule is manufacturable.
- the antibody was subjected to a panel of different stress conditions, including temperature, freeze-thaw cycles, agitation and low pH. Visual analysis of the samples before and after the stress conditions showed that samples were slightly yellow, slightly opalescent and free of visible particles, with no change in appearance following assessed conditions with the exception of thermal stress at 40°C for 4 weeks showing a low level of visible particles. Table 17 shows the results of these stress studies.
- Micro flow imaging (MFI) analysis shows an increase in subvisible particle detecting >2-25um for the 40C stress condition.
- Particle size and distribution were analysed using dynamic light scattering (DLS).
- the Z- average showed no significant change in any sample compared to the un-stressed stored at -70C.
- the polydispersity index (PDI) indicates the samples were monodispersed (Table 18).
- HMW High molecular weight
- LMW Low molecular weight
- W Week(s)
- C Cycle(s)
- D Day(s)
- h hour(s).
- ATL_1678 Charge heterogeneity of ATL_1678 was analysed using clEF. A decrease in the main charge variants was observed at 40°C (-22.6pp at 2 weeks and 34.3pp at 4 weeks) with both an increase in acidic and basic species, however minimal changes in charge species present were observed in all other conditions
- ATL_6178 also referred to herein as ATLX-1282
- ATL5262 To assess the ability of ATL_6178 (also referred to herein as ATLX-1282) and ATL5262 to bind to UNC5C in its natural central nervous system (CNS) context, antibody binding to frozen mouse brain sections was assessed.
- CNS central nervous system
- ATLX-1282 (ATL_6178) and ATL_5262 demonstrated a similar binding pattern, and this was blocked by 10 nM Netrin-1 , but not by similar sized proteins such as clusterin and Netrin-4 (which do not bind to UNC5C), as shown in Figures 29A-D. This is in keeping with the in vitro data described above showing the ability of ATLX-1282 and ATL_5262 to bind to UNC5C selectively.
- ATL5262 and ATLX-1282 showed increased binding to HEK-293 cells overexpressing UNC5C and HEK-293 cells overexpressing UNC5C T835M relative to cells transfected with an empty vector control ( Figures 30A and B).
- ATL5262 and ATLX-1282 can bind to UNC5C and the UNC5C T835M variant linked to AD (VAR_081368) when they are in a natural cell membrane context.
- This data shows that the antibodies bind to the Alzheimer’s disease associated form of UNC5C.
- the antibodies described herein were shown to bind to the extracellular region of UNC5C and this mutation affects the intracellular region. Therefore, all antibodies described are expected to bind to the AD relevant form of UNC5C.
- Table 23 Summary of inter-chain interactions within 4.0 A, including polar contacts and hydrophobic interactions.
- Figure 30F shows a protein alignment of human UNC5 family members B, A and D to region of human UNC5C Ig-like domain 1 that interacts with ATL_5262. Identical sequences highlighted in red. Amino acids of UNC5C involved in the interaction to ATL_5262 and summarised in Table 23 are indicated by arrows. These data indicate that specificity of ATL_5262 to UNC5C over the other UNC5 family members may be driven by amino acids that are different between UNC5C and the other UNC5 proteins.
- Phage display selections were carried out to discover additional functional and resilient patient-derived antibodies for UNC5C.
- Phage display libraries were generated from VH repertoires of patients who carried the original antibody ATL_0005262, and a VL repertoire from healthy donors. Phage display selections were done by panning on two UNC5C antigens. A subset of enriched antibodies was screened by phage ELISA on UNC5C antigen and 10 antibodies were chosen for IgG conversion.
- This example thus identifies further antibodies that bind UNC5C with high affinity and are able to compete with Netrin-1 for UNC5C binding and are therefore expected to have similar properties to ATL_5262 and ATLX-1282, including reducing UNC5C mediated apoptosis, reducing beta-amyloid toxicity, increasing neuron activity, viability and burst frequency, and enhancing synaptic health in vitro and in vivo.
- UNC5C antibodies as described herein show therapeutic effects in the treatment and/or prevention of neurodegenerative diseases such as PD, FTD, AD and ALS and provides antibodies that can achieve this by binding to the same binding site as Netrin 1 .
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Life Sciences & Earth Sciences (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Molecular Biology (AREA)
- Hospice & Palliative Care (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Psychiatry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
Claims
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GB202300277 | 2023-01-09 | ||
| GBGB2317371.9A GB202317371D0 (en) | 2023-11-13 | 2023-11-13 | Anti-unc5c antibodies |
| GBGB2319255.2A GB202319255D0 (en) | 2023-12-15 | 2023-12-15 | Anti-UNC5C antibodies |
| PCT/EP2024/050407 WO2024149766A1 (en) | 2023-01-09 | 2024-01-09 | Anti-unc5c antibodies |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP4649090A1 true EP4649090A1 (en) | 2025-11-19 |
Family
ID=89663157
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP24701314.7A Pending EP4649090A1 (en) | 2023-01-09 | 2024-01-09 | Anti-unc5c antibodies |
Country Status (13)
| Country | Link |
|---|---|
| EP (1) | EP4649090A1 (en) |
| JP (1) | JP2026503279A (en) |
| KR (1) | KR20250133935A (en) |
| CN (1) | CN121419991A (en) |
| AU (1) | AU2024207916A1 (en) |
| CL (1) | CL2025002020A1 (en) |
| CO (1) | CO2025009241A2 (en) |
| CR (1) | CR20250274A (en) |
| DO (1) | DOP2025000164A (en) |
| IL (1) | IL321771A (en) |
| JO (1) | JOP20250161A1 (en) |
| PE (1) | PE20252587A1 (en) |
| WO (1) | WO2024149766A1 (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025125898A1 (en) * | 2023-12-15 | 2025-06-19 | Alchemab Therapeutics Ltd | Anti-unc5c antibodies and uses thereof |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP6338530B2 (en) * | 2011-11-10 | 2018-06-06 | ジェネンテック, インコーポレイテッド | Methods for treating, diagnosing, and monitoring Alzheimer's disease |
| AR106543A1 (en) * | 2015-11-02 | 2018-01-24 | Netris Pharma | NTN1 NEUTRALIZING AGENT COMBINATION THERAPY WITH DRUGS THAT INHIBIT EPIGENTICAL CONTROL |
| GB202105776D0 (en) | 2021-04-22 | 2021-06-09 | Alchemab Therapeutics Ltd | Engineering of antigen-binding proteins |
-
2024
- 2024-01-09 KR KR1020257026468A patent/KR20250133935A/en active Pending
- 2024-01-09 JP JP2025540179A patent/JP2026503279A/en active Pending
- 2024-01-09 IL IL321771A patent/IL321771A/en unknown
- 2024-01-09 AU AU2024207916A patent/AU2024207916A1/en active Pending
- 2024-01-09 EP EP24701314.7A patent/EP4649090A1/en active Pending
- 2024-01-09 WO PCT/EP2024/050407 patent/WO2024149766A1/en not_active Ceased
- 2024-01-09 CN CN202480017275.8A patent/CN121419991A/en active Pending
- 2024-01-09 CR CR20250274A patent/CR20250274A/en unknown
- 2024-01-09 PE PE2025001449A patent/PE20252587A1/en unknown
-
2025
- 2025-07-08 JO JOJO/P/2025/0161A patent/JOP20250161A1/en unknown
- 2025-07-08 CL CL2025002020A patent/CL2025002020A1/en unknown
- 2025-07-08 CO CONC2025/0009241A patent/CO2025009241A2/en unknown
- 2025-07-09 DO DO2025000164A patent/DOP2025000164A/en unknown
Also Published As
| Publication number | Publication date |
|---|---|
| JOP20250161A1 (en) | 2025-07-08 |
| AU2024207916A1 (en) | 2025-07-17 |
| WO2024149766A1 (en) | 2024-07-18 |
| IL321771A (en) | 2025-08-01 |
| DOP2025000164A (en) | 2025-08-15 |
| CO2025009241A2 (en) | 2025-07-28 |
| PE20252587A1 (en) | 2025-11-11 |
| CL2025002020A1 (en) | 2025-10-17 |
| JP2026503279A (en) | 2026-01-28 |
| CR20250274A (en) | 2025-09-16 |
| CN121419991A (en) | 2026-01-27 |
| KR20250133935A (en) | 2025-09-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP6952827B2 (en) | Blood-brain barrier transport molecules and their use | |
| EP2084190B1 (en) | Lingo binding molecules and pharmaceutical use thereof | |
| CN109311975A (en) | Anti-AGE Antibodies for the Treatment of Neurodegenerative Disorders | |
| US12459993B2 (en) | Anti-alpha-synuclein antibodies and uses thereof | |
| KR102871588B1 (en) | anti-PD-1 antibodies | |
| TW201908342A (en) | Medicament, use and method for treatment | |
| EP3177648A1 (en) | Anti-tenascin c antibodies and uses thereof | |
| US20240076361A1 (en) | Anti-pt217 tau antibody | |
| US12351623B2 (en) | Antibody compositions targeting non-phosphorylated alpha-synuclein aggregates | |
| WO2021005019A1 (en) | Tau epitope and binding molecules | |
| WO2024149766A1 (en) | Anti-unc5c antibodies | |
| WO2020260722A1 (en) | Tau epitope and binding molecules | |
| US12281168B2 (en) | Binding molecule specific for LIF and use thereof | |
| WO2021043203A1 (en) | Anti-cxcr2 antibodies and uses thereof | |
| US20260103516A1 (en) | Anti-unc5c antibodies | |
| US20260062482A1 (en) | Anti-unc5c antibodies | |
| US20240228604A1 (en) | Anti-unc5c antibodies | |
| US20230110188A1 (en) | MuSK AGONIST ANTIBODY | |
| CN118488967A (en) | Galectin-10 antibodies | |
| WO2025125898A1 (en) | Anti-unc5c antibodies and uses thereof | |
| KR20250116724A (en) | anti-huntingtin antibodies | |
| TW202607018A (en) | Anti-apoe4 antibody and uses thereof | |
| CN120457144A (en) | Generation of antibodies that act as silent and positive allosteric modulators of the α7 nicotinic acetylcholine receptor | |
| TW202546003A (en) | Antibodies targeting human leukocyte antigen G or their antigen-binding fragments and their applications | |
| NZ788350A (en) | Binding molecule specific for LIF and use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20250811 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| P01 | Opt-out of the competence of the unified patent court (upc) registered |
Free format text: CASE NUMBER: UPC_APP_0014633_4649090/2025 Effective date: 20251125 |
|
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 40128850 Country of ref document: HK |
|
| RAV | Requested validation state of the european patent: fee paid |
Extension state: MA Effective date: 20250811 Extension state: MD Effective date: 20250811 Extension state: TN Effective date: 20250811 |