EP4630440A1 - Protein nanopellets for fish or teleost and crustacean vaccination - Google Patents
Protein nanopellets for fish or teleost and crustacean vaccinationInfo
- Publication number
- EP4630440A1 EP4630440A1 EP23821532.1A EP23821532A EP4630440A1 EP 4630440 A1 EP4630440 A1 EP 4630440A1 EP 23821532 A EP23821532 A EP 23821532A EP 4630440 A1 EP4630440 A1 EP 4630440A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- nanopellet
- protein
- polypeptide
- svcv
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/461—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/555—Interferons [IFN]
- C07K14/57—IFN-gamma
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5258—Virus-like particles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
- A61K2039/541—Mucosal route
- A61K2039/542—Mucosal route oral/gastrointestinal
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
- A61K2039/552—Veterinary vaccine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55522—Cytokines; Lymphokines; Interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55561—CpG containing adjuvants; Oligonucleotide containing adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55572—Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/20011—Rhabdoviridae
- C12N2760/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/20011—Rhabdoviridae
- C12N2760/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/20011—Rhabdoviridae
- C12N2760/20211—Vesiculovirus, e.g. vesicular stomatitis Indiana virus
- C12N2760/20234—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/30011—Nodaviridae
- C12N2770/30034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- Present invention belongs to the field of fusion proteins.
- the invention relates to a fusion protein with immunization activity.
- the fusion protein of the invention is particularly useful in the immunization against viral infections in fish or teleost and crustaceans by means of oral vaccination.
- spring viremia of carp is an infectious viral disease common to carp (Cyprinus carpio) and other cyprinid fish species (including zebrafish (Danio rerio), koi ⁇ Cyprinus carpio koi), silver carp (Hypophthalmichthys molitrix), goldfish (Carassius auratus) or grass carp (Ctenopharyngodon idella) among others, caused by the SVC virus (SVCV).
- SVC SVC virus
- SVCV is a member of the family Rhabdoviridae, with negativesense ssRNA encoding five proteins-nucleoprotein (N), phosphoprotein (P), matrix protein (M), glycoprotein (G), and RNA-dependent polymerase (L).
- N proteins-nucleoprotein
- P phosphoprotein
- M matrix protein
- G glycoprotein
- L RNA-dependent polymerase
- vaccination is one of the most promising ones. But it needs to optimize efficacy, while taking into account production and administration costs, environmental risks, and compliance with legislation.
- An alternative vaccine approach is the use of recombinant protein viral antigens.
- the main advantage of subunit vaccines is they are safe: there is no risk of DNA integration into the host, reversion, or invasion. Their main drawbacks are the stability and half-life of recombinant proteins in vivo; and the lack of pathogen associated molecular patterns (PAMPS) that the immune system utilizes to recognize pathogens via pattern recognition receptors (PRRs) thus needing adjuvants with co-stimulatory activity to enhance the magnitude of the immune response.
- PAMPS pathogen associated molecular patterns
- Oral delivery would be the most practical, cheap, and least stressful delivery method.
- the harsh gastric environment promotes antigen breakdown. So, immunorelevant epitopes need to be protected against gastrointestinal pH, which is particularly low in carnivorous fish, as well as digestive enzymes within the tract.
- IBs viral protein antigens nanostructured as bacterial inclusion bodies
- IBs can be designed to bear the antigenic protein or epitopes of interest and provide a slow release of functional protein over time.
- the attractiveness of IBs as a fish or teleost and crustacean prophylactic is manifold.
- Their stability at gastrointestinal pH allows administrating the antigen orally through the feed, avoiding the necessity for vaccine encapsulation and the cost and stress to fish associated with injection.
- Production in Escherichia coli is achieved in bulk with a simple enzymatic and mechanical purification procedure which minimizes costs. This straightforward process implies that the IBs carry over fragments of bacterial lipopolysaccharide, peptidoglycans, and nucleic acids as impurities, but which are known adjuvants and immunomodulators of fish.
- the IB vehicle a carrier and viral antigen as one biomaterial, elicit both an innate and adaptive immune response against the target virus in fish or teleost and crustacean. Additionally, IBs' stability under lyophilizing conditions and over a range of temperatures indicates their potential as a practical farm product with a lasting shelf life, avoiding the cold chain.
- IBs immunostimulant for fish, by nanostructuring recombinant cytokines TNF-o and CCL4 and testing them in a bacterial Infection model in zebrafish.
- uptake of the TNF-a IB by intestinal cells was demonstrated in vivo in rainbow trout via oral intubation.
- NanoPellets For nanostructured viral antigens as IBs for use in fish food, the term “NanoPellets” (NPs) was coined.
- VP2 viral capsid protein 2
- IPNV infectious pancreatic necrosis virus
- IPNV infectious pancreatic necrosis virus
- VHSV viral haemorrhagic septicaemia virus
- VNNV C coat protein of viral nervous necrosis virus
- Betanodavirus viral antigenic proteins
- NanoPellets present two main characteristics that makes them a very promising administration strategy for oral and immersion vaccine development for fish and shellfish as they protect the subunits from their high susceptibility to degradation and contain contaminants (in very small amounts) such as endotoxin, nucleic acids or peptidoglycans that can in turn work also as immunostimulators because all of them are well known PAMPs, that the immune system utilizes to recognize pathogens via pattern recognition receptors.
- a particular fusion polypeptide including an antigenic protein module and in-vaccine adjuvant in the same sequence which surprisingly allowed to obtain a functional and stable active system for the oral immunization of fishes or teleost and certain crustacean.
- IFNs interferons
- IFN gamma is especially important in potentiating the antiviral defenses.
- IFNs can be used for treatment of different diseases, their stability remained the main obstacle that hindered the utilization of recombinant proteins as therapeutics. IFNs failed to show the expected bioactivity in vivo due to degradation, and also to the tendency to aggregate irreversibly under mild denaturing conditions.
- Mx proteins are the only IFN-induced proteins known to posse antiviral properties. Mx proteins are dynamin-like large GTPases, and GTPase activity is required for their antiviral activity. MxA recognizes incoming viral proteins as well as newly synthesized viral proteins in the cytoplasm of infected cells and inhibits transport of viral proteins into the nucleus, thus blocking early steps in the viral life cycle.
- nanostructured polypeptides including IFN combined with an antigenic module remained stable and functional even under the harshest conditions of pH and temperature.
- a first aspect of the invention is a polypeptide comprising the amino acid sequence of an interferon or a fragment thereof, the amino acid sequence of a viral antigen or a fragment thereof and, optionally, a linker between them.
- one or more polypeptides could be nanostructured, forming a NanoPellet, presenting surprisingly high stability, even in harsh conditions, of both the antigenic module (i.e., viral antigen or fragment thereof) and the in-vaccine adjuvant (i.e., interferon or fragment thereof), and they showed enhanced immunogenic activity.
- the antigenic module i.e., viral antigen or fragment thereof
- the in-vaccine adjuvant i.e., interferon or fragment thereof
- polypeptides including IFN and an antigenic module were indeed successfully structured as nanopellets. And, even more surprising and as shown in the examples, the yield of production of such polypeptides was greater than polypeptides only including the antigenic module.
- nanopellets remained stable and functional.
- stability and functionality of interferon is advantageous and surprising.
- the invention relates to a protein NanoPellet comprising one or more of the polypeptides as defined in the first aspect, and with a particle diameter from 400 nm to 1500 nm, measured by electron microscopy.
- the second aspect of the invention refers to a protein nanopellet comprising one or more polypeptides comprising the amino acid sequence of an interferon or a fragment thereof, the amino acid sequence of a viral antigen or a fragment thereof and, optionally, a linker between them; and with a particle diameter from 400 nm to 1500 nm, measured by electron microscopy.
- nanopellets containing the polypeptides defined in the first aspect, administered by immersion were efficiently uptake by zebrafish larvae cells and elicited a strong antiviral response. Therefore, due to the capability of promoting an enhanced immunogenic reaction, the polypeptide as well as the protein NanoPellet are used in immunogenic compositions.
- a third aspect of the invention is an immunogenic composition comprising one or more polypeptides as defined in the first aspect, and/or the protein nanopellet as defined in the second aspect.
- the inventors vaccinated adult zebrafish with the nanopellets as defined in the second aspect and infected the animals with spring viremia carp virus.
- the results surprisingly showed excellent levels of survival compared with non-vaccinated and control fish, and the degrees of protection were even different from previous attempts using a DNA vaccine engineered with a plasmid that drives the expression of the SVCV-G protein.
- a fourth aspect of the invention is a vaccine comprising the immunogenic composition as defined above, and a pharmaceutically acceptable excipient and/or carrier.
- a fifth aspect of the invention is a polypeptide as defined in the first aspect and/or the protein nanopellet as defined in the second aspect, and/or the immunogenic composition as defined in the third aspect, and/or the vaccine as defined in the fourth aspect, for use in therapy. In other words, they are for use as a medicament.
- Another (sixth) aspect of the invention is a food composition
- a food composition comprising a polypeptide, and/or a protein nanopellet, and/or the immunogenic composition, and/or the vaccine, as defined above.
- the food composition comprises at least one edible ingredient.
- the invention also provides as an additional aspect a polynucleotide encoding the polypeptide as defined in the first aspect.
- Yet another aspect is a cell system comprising the polypeptide and/or the vector, both as defined above. More precisely, the invention provides a host cell which is transformed or transfected with the polynucleotide and/or the vector as defined above, and it also provides a cell culture comprising said host cell.
- FIG. 1A Characterization of nanostructured SVCV NP proteins, (i) Field Emission Scanning Electron Microscopy images (FESEM). The scale line reference's units are micrometers (pm).
- Fig. stands for " Figure”.
- Figure 1 B Characterization of nanostructured SVCV-IFN NP proteins, (i) Field Emission Scanning Electron Microscopy images (FESEM). The scale line reference's units are micrometers (pm).
- Figure 2 Uptake of SVCV and SVCV-IFN nanopellets by ZFL cells.
- A SVCV NP dose response (x-axis represents Dose in pg/ml; left y-axis represents percentage of Fluorescent cells (%); right y-axis represents Mean Fluorescent Intensity (MFI); “C” stands for Control);
- B SVCV time course (x-axis represents Time in hours (h); left y-axis represents percentage of Fluorescent cells (%); right y-axis represents Mean Fluorescent Intensity (MFI); "ns” stands for Non-Significant; “C” stands for Control);
- C SVCV-IFN NP dose response (x-axis represents Dose in pg/ml (h); left y-axis represents percentage of Fluorescent cells (%); right y-axis represents Mean Fluorescent Intensity (MFI); “C” stands for Control);;
- D SVCV-IFN NP time
- FIG. 4 Biodistribution in vivo in zebrafish larvae.
- A Control
- B SVCV NP
- C SVCV-IFN NP . Uptake in larvae.
- Zebrafish larvae (3 dpf) were immersed with 10 pig/ml of fluorescent SVCV NP and SVCV-IFN NP for 48 h.
- E3 medium with PBS were used as control,
- Transmitted image, ii) fluorescent image and (iii) merged image.
- G stands for Gastrointestinal tract.
- P stands for Pancreas.
- Fish were vaccinated with 5 pig/fish of different antigens (iRFP NP , SVCV NP , SVCV-IFN NP ) by intraperitoneal injection.
- Thirty days post-vaccination fish were challenged with SVCV (4 x 10 4 TCID50/ml). Number of dead fish in each group was counted daily.
- the x-axis represents the days after trials.
- the y-axis represents the cumulative mortality (%).
- the line of squares represents the control SVCV; the line of circles represents the iRF P NP ; the filled triangles line represents the SVCV NP ; the empty inverted triangles line represents the SVCV-IFN NP .
- Figure 6 Detection of antigen in vaccinal feed. Western Blot with an anti-His-tag antibody to detect VHSV- I FN NP after feed manufacturing by extrusion and final delipidation and NaOH extraction. A is the lane loaded with a total protein of 25 pig. B is the lane loaded with a total protein of 50 pig.
- Squares line refers to rainbow trout fed with iRFP NP .
- Triangles line refers to rainbow trout fed with VHSV-IFN NP (SEQ ID NO: 16). Fish injected with medium were used as the control (circles line).
- the x-axis refers to days post-challenge.
- the y-axis refers to the percentage of cumulative mortality.
- SEQ ID NO: 16 is
- the x-axis respectively refers to length and width in nanometers (nm).
- the y axis refers to frequency.
- FIG. 1 Field Emission Scanning Electron Microscopy images (FESEM) of IL-6 (A) and LCDV (B).
- FESEM Field Emission Scanning Electron Microscopy images
- the scale line reference's units are micrometers (pm)
- FIG 11 FESEM of zebrafish I FNy.
- the scale line reference's units are micrometers (pm)
- FIG. 12 Field Emission Scanning Electron Microscopy images (FESEM) of three different conditions: (Fig 12AI) SVCV-IFN NP control, (Fig 12BI) SVCV-IFN NP incubated at pH 2, (Fig 12CI) SVCV-IFN NP incubated at pH 10 and (Fig 12DI) SVCV-IFN NP at 100°C.
- the scale line reference's units are micrometers (pm).
- the x-axis respectively refers to length and width in nanometers (nm).
- the y axis refers to frequency.
- a "polypeptide” is a chain of amino acids linked by a peptide bond (i.e., amide bonds) including from more than 10 amino acids. They are biological polymers and are called “proteins” when the number of amino acid residues is over 50 amino acids. As the skilled person will know, they can be obtained by synthetic routes, for example by solid-phase peptide synthesis on a rink amide resin using Fmoc-o-amine-protected amino acid. They can also be obtained from the recombinant gene technology, through genetic engineering of a fusion gene. This typically involves removing the stop codon from a cDNA sequence coding for the first protein, then appending the cDNA sequence of the second protein in frame through ligation or overlap extension PCR.
- That DNA sequence will then be expressed by a cell as a single protein.
- the protein can be engineered to include the full sequence of both original proteins, or only a portion of either. If the two entities are proteins, often linker (or "spacer") peptides are also added, which make it more likely that the proteins fold independently and behave as expected. Translation of this fusion gene results in a single or multiple polypeptides with functional properties derived from each of the original proteins.
- polypeptide in this description is also to be understood a molecule of peptide/protein nature comprising two independent polypeptides coded for different or the same genes that are linked by a linker molecule other than a peptide. In this later scenario the compound of formula (I) or formula (II) is still considered a polypeptide that could also be referred as a conjugate of formula (I) or formula (II), or as a compound of formula (I) or formula (II).
- polynucleotide is to be understood as a nucleic acid molecule (DNA or RNA) comprising deoxyribonucleotides or ribonucleotides.
- Nucleic acid can be single or double stranded, and it includes, but it is not limited to, nucleotide sequences coding for polypeptides.
- polynucleotides used for the obtaining of the polypeptides by recombinant technology have a varying length depending on the construct. They have a length from at least 1000 nt nucleotides up to 4000 nt, and the mean of sizes of different constructs is 2000 nt.
- a “gene construct” according to the invention can also be named as an "expression cassette”. It refers to a polynucleotide sequence including in turn a sequence coding for a protein of interest, which is operatively linked to an expression promoter, said promoter controlling expression of the sequence coding for the protein.
- operatively linked is to be understood that the sequence coding for the protein is disposed after the sequence of the promoter (in the 5'-3' direction), or near the promoter in case restriction sites are included, or other stabilizing elements of the gene construction are present.
- the gene constructs may also comprise small fragments with useful sequences to adapt it to more complex expression systems (vectors, plasmids), or a polyadenylation tail disposed after the sequence coding for the protein of interest.
- the expression cassette itself is also an expression system, being vectors or plasmids further used to protect the gene construct, or to promote entrance to cells in case of viral vectors.
- the "promoters” are of DNA regions that initiate transcription of a particular genes. Promoters are located near the transcription start sites of genes, on the same strand and upstream on the DNA (towards the 5' region of the sense strand). Promoters can be about 100-1000 base pairs long.
- a "constitutive promoter” is a promoter that is active in all circumstances in the cell, contrary to others that are regulated, becoming active in the cell only in response to specific stimuli, such as “inducible promoters”.
- the latter is inserted in a vector, which is a DNA molecule used as a vehicle to artificially carry foreign genetic material into another cell, where it can be replicated and/or expressed (e.g., plasmid, cosmid, Lambda phages).
- a vector containing foreign DNA is termed recombinant DNA.
- the four major types of vectors are plasmids, viral vectors, cosmids, and artificial chromosomes.
- vectors may carry elements (sequences) the skilled person will know aiding in the expression and stability of the expressed sequence, as well as tags or labels to purify the recombinant expressed polypeptide.
- the vectors are transfected to appropriate cell systems (host cells), which by means of their replicative and expression biochemical machinery will allow the obtaining of the recombinant polypeptide.
- nanopellet (usually written as NanoPellet and abbreviated NP) or “nanoparticle” as used herein, refers generally to a particle with at least two dimensions at the nanoscale, particularly with all three dimensions at the nanoscale (1-1000 nm), although few micras are also to be considered within the nanoscale (1-1200 nm).
- shape i.e., morphology
- nanoparticle there are included particles with an ellipsoid shape, spheres.
- the nanoparticle is an ellipsoid.
- size refers to a characteristic physical dimension.
- the size of the nanoparticle corresponds to the diameter of the nanoparticle.
- the set of nanoparticles can have a distribution of sizes around the specified size.
- a size of a set of nanoparticles can refer to a mode of a distribution of sizes, such as a peak size of the distribution of sizes.
- the diameter is the equivalent diameter of the spherical body including the object.
- the diameter or any physical dimension (i.e., width and length and high) of the nanoparticle/nanopellet when in this description the diameter or any physical dimension (i.e., width and length and high) of the nanoparticle/nanopellet is mentioned, it relates to dimension measured by Electron Microscopy, in particular Field Emission Scanning Electron Microscopy images (FESEM).
- FESEM Field Emission Scanning Electron Microscopy images
- the term "food composition” or "food product” is used herein in its broadest meaning, including any type of product, in any form of presentation, which can be ingested by an animal, including humans.
- it includes the common food that is used to feed aquatic animals, in particular fish or teleost and crustacean.
- An example of a fish diets are dry pellets made of 70% vegetable constituents and 30% marine raw matters such as fishmeal and fish oil.
- the fish feed contains vegetable components originating from plants such as soy, corn, rapeseed, sunflowers, broad beans, and wheat, which serve as proteins, carbohydrates, and fat sources.
- Other marine ingredients, such as fishmeal and fish oil are made from byproducts of the seafood processing industry that are not suitable for human consumption.
- immunogenic refers to material which elicits an immunological response in the host of a cellular or antibody-mediated immune response type to the composition upon administration to a vertebrate, including humans.
- the immunogenic composition comprises molecules with antigenic properties, such as immunogenic polypeptides.
- An immunogenic polypeptide is generally referred to as antigenic.
- a molecule is "antigenic” when it is capable of specifically interacting with an antigen recognition molecule of the immune system, such as an immunoglobulin (antibody) or T cell antigen receptor.
- An antigenic polypeptide contains an epitope of at least about five, and particularly at least about 10, at least 15, at least 20 or at least 50 amino acids.
- An antigenic portion of a polypeptide can be that portion that is immunodominant for antibody or T cell receptor recognition, or it can be a portion used to generate an antibody to the molecule by conjugating the antigenic portion to a carrier polypeptide for immunization.
- the immunogenic composition relates according to this description, to the active molecule, composition comprising said molecule, or composition comprising more than one antigenic molecule to which a particular immune reaction is desired.
- antigen refers to a molecule against which a subject can initiate an immune response, e.g., a humoral and/or cellular immune response. Depending on the intended function of the composition, one or more antigens may be included.
- fragment thereof refers to fragment or fragments that maintain the activity of the polypeptide from which they derive, for example, fragments with interferon activity as in-vaccine adjuvant or fragments with immunogenicity of the viral antigen
- immunologically effective amount means the administration of that amount or dose of antigen, either in a single dose or as part of a series, that elicits, or is able to elicit, an immune response that reduces the incidence of or lessens the severity of Infection or incident of disease in an animal for either the treatment or prevention of disease.
- the immunologically effective amount or effective dose is also able for inducing the production of antibody for either the treatment or prevention of disease. This amount will vary depending upon a variety of factors, including the physical condition of the subject, and can be readily determined by someone of skill in the art.
- medicament is synonymous of a pharmaceutical or veterinary drug (also referred to as medicine, medication, or simply drug) use to cure, treat, or prevent disease in animals, including humans, as widely accepted.
- Drugs are classified in various ways. One key distinction is between traditional smallmolecule drugs, usually derived from chemical synthesis, and biopharmaceuticals, which include recombinant proteins, vaccines, blood products used therapeutically (such as Intravenous Immunoglobulin (IVIG)), gene therapy, monoclonal antibodies and cell therapy (for instance, stem-cell therapies).
- IVIG Intravenous Immunoglobulin
- gene therapy for instance, stem-cell therapies.
- stem-cell therapies for instance, stem-cell therapies.
- medicament preferably is a veterinary medicament, and even more preferably is a vaccine for veterinary use.
- the term "vaccine” as used herein, means an immunogenic composition of the invention accompanied by adequate excipients and/or carriers, that when administered to an animal, elicits, or is able to elicit, directly or indirectly, an immune response in the animal.
- the vaccines of the present invention elicit an immunological response in the host of a cellular or antibody-mediated type upon administration to the subject that it is protective.
- oral vaccine means that the vaccine is in particular appropriated for oral administration, thus including the galenic for being stable and to deliver the immunogenic composition at the desired place and in an adequate conformation to induce the immunological reaction.
- carrier is to be understood as a pharmaceutically acceptable component other than the immunogenic component.
- the carrier can be organic, inorganic, or both.
- Suitable carriers well known to those of skill in the art and include, without limitation, large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, lipid aggregates (such as oil droplets or liposomes) and inactive virus particles.
- pharmaceutically acceptable excipients or carriers refers to pharmaceutically acceptable materials, compositions or vehicles. Each component must be pharmaceutically acceptable in the sense of being compatible with the other ingredients of the pharmaceutical composition. It must also be suitable for use in contact with the tissue or organ of humans and animals without excessive toxicity, irritation, allergic response, immunogenicity or other problems or complications commensurate with a reasonable benefit/risk ratio.
- fusion polypeptide comprising at least a viral antigenic module and an interferon module, and an immunogenic composition and/or vaccine comprising said fusion polypeptide, for use as a medicament in fish or teleost and certain crustaceans.
- fusion polypeptide for use as a medicament disclosed herewith apply also to the immunogenic composition and/or the vaccine for use as a medicament comprising said fusion polypeptide.
- a first aspect of the invention is a polypeptide comprising the amino acid sequence of an interferon or a fragment thereof, the amino acid sequence of a viral antigen or a fragment thereof and, optionally, a linker between them.
- polypeptide has formula (I):
- n is an integer selected from 0 or 1;
- R1 which is at the N-terminal end of the polypeptide, comprises the amino acid sequence of an interferon or a fragment thereof;
- L is a linker
- R2 which is at the C-terminal end of the polypeptide, comprises the amino acid sequence of a viral antigen or a fragment thereof.
- polypeptide can be defined as having formula (I)
- n is an integer selected from 0 or 1;
- R1 which is at the N-terminal end of the polypeptide, is an in-vaccine adjuvant
- L is a peptide linker
- R2 which is at the C-terminal end of the polypeptide, is an antigenic protein module.
- the polypeptide can be upside down. I.e. the antigenic protein module can be at the N-terminal end of the polypeptide and the in-vaccine adjuvant in the C-terminal end of the polypeptide.
- polypeptide has formula (II):
- n is an integer selected from 0 or 1;
- R2 which is at the N-terminal end of the polypeptide, comprises the amino acid sequence of a viral antigen or a fragment thereof;
- L is a linker
- R1 which is at the C-terminal end of the polypeptide, comprises the amino acid sequence of an interferon or a fragment thereof.
- polypeptide can be defined as having formula (II)
- n is an integer selected from 0 or 1;
- R2 which is at the N-terminal end of the polypeptide, is an antigenic protein module
- L is a peptide linker
- R1 which is at the C-terminal end of the polypeptide, is an in-vaccine adjuvant.
- the expression “the polypeptide has formula (I)” (or formula (II)) is understood as “the polypeptide comprises or consists of formula (I)” (or formula (II)). More in particular, it is understood as “the polypeptide consists of formula (I)” (or formula (II)).
- polypeptides of formula (I) and (II) are, in certain embodiments, a fusion protein.
- the polypeptide is one in which R2 comprises the amino acid sequence of a viral antigen of a virus causing disease in aquatic animals selected from fish or teleost and crustacean. More in particular, fish or teleost and crustacean selected from the group consisting of Salmonids, turbot, carp, cyprinids, seabass, common sole, turbot, barramundi, Seabream and prawns.
- the polypeptide is one in which R2 comprises the amino acid sequence of a viral antigen of a virus causing disease.
- said virus selected from the group of Infectious Pancreatic Necrosis Virus (IPNV), Viral Hemorrhagic Septicemia Virus (VHSV), Viral Nervous Necrosis Virus (VNNV) or its specific serotype Red-spotted Grouper Nervous Necrosis Virus/Striped Jack Nervous Necrosis Virus (RGNNV/SJNNV), Lymphocystis Disease Virus (LCDV) and Spring Viraemia of Carp Virus (SVCV).
- IPNV Infectious Pancreatic Necrosis Virus
- VHSV Viral Hemorrhagic Septicemia Virus
- VNNV Viral Nervous Necrosis Virus
- RGNNV/SJNNV Viral Nervous Necrosis Virus
- LCDV Lymphocystis Disease Virus
- SVCV Spring Viraemia of Carp
- said viral antigen is a viral protein or a fragment thereof selected from the group of glycoproteins, capsid proteins, major capsid proteins or fragments thereof.
- it is a protein or fragment capable of causing immune reaction.
- the virus causing disease is Spring Viremia Carp Virus.
- the antigen module of said virus contained in the polypeptide of the first aspect is the G3 region of the Glycoprotein G of said virus.
- the polypeptide is one in which R2 comprises SEQ ID NO: 1 or a sequence at least 85%, or at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% identical to SEQ ID NO: 1 .
- polypeptide is one in which R2 consists of SEQ ID NO: 1.
- the virus causing disease is Viral Hemorrhagic Septicemia Virus.
- the antigen module of said virus contained in the polypeptide of the first aspect is the fragment 16 of the Glycoprotein G of said virus.
- the polypeptide is one in which R2 comprises SEQ ID NO: 5 or a sequence at least 85%, or at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% identical to SEQ ID NO: 5.
- the polypeptide is one in which R2 consists of SEQ ID NO: 5.
- the virus causing disease is Viral Nervous Necrosis Virus.
- the antigen module of said virus contained in the polypeptide of the first aspect is a fragment of the coat protein gene of said virus.
- the coat protein gene is from the Iberian betanodavirus isolate (strain SpSs-IAuscl60.03), which is a reassortant RGNNV/SJNNV strain.
- the polypeptide is one in which R2 comprises SEQ ID NO: 6 or a sequence at least 85%, or at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% identical to SEQ ID NO: 6.
- the polypeptide is one in which R2 consists in SEQ ID NO: 6.
- the polypeptide is one in which R1 comprises the amino acid sequence of an interferon or a fragment thereof of an animal species selected from fish or teleost and crustacean, the interferon selected from the group consisting of interferons Type I and Type II.
- the interferon or a fragment thereof is of fish and/or crustacean selected from the group consisting of Salmonids, turbot, carp, cyprinids, seabass, common sole, turbot, barramundi, Seabream and/or prawns.
- the interferon or a fragment thereof from the above embodiment is selected from the Type II interferon group.
- the polypeptide is one in which R1 comprises the amino acid sequence or a fragment thereof of the interferon y (gamma).
- the interferon or fragment thereof is selected from the group of Trout interferon y, Turbot interferon y, Seabream interferon, Seabass interferon y, zebra fish and/or carp interferon
- the interferon y or a fragment thereof is the zebrafish or carp interferon
- the polypeptide is one in which R1 comprises SEQ ID NO: 2 or a sequence at least 85%, or at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% identical to SEQ ID NO: 2.
- the polypeptide is one in which R1 consists in SEQ ID NO: 2.
- the amino acid sequences of interferon or fragments thereof of all the aspects of the invention are given in Table 2:
- the IFN gamma 1 from D. rerio (27-175) as defined in Table 2 is also useful for other cyprinids species.
- for Cyprinus carpio is also useful for other cyprinids species.
- the trout I FNy (25-180) as defined in Table 2, is also useful for other salmonid species.
- for Salmo salar for Salmo salar.
- the polypeptide is one in which “n” is 1 , and the linker L is selected from a peptide with a length from 2 to 15 amino acids.
- the peptide length is any selected from 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15.
- polypeptide is one in which the linker L is a peptide comprising or consisting in SEQ ID NO: 3.
- Linkers of different nature would also work as long as the spatial distribution of the linker set forth in SEQ ID No. 3 is maintained.
- the linker L is selected from the group of consisting of the above-indicated peptides, PEGs, other polymeric compounds (such as nucleic acids, polylactide acid, polycaprolactones, polyvynilsuccinates, polyhidroxybutirates). Even in the case the linker (L) is not of peptide nature, the compound of formula (I) or formula (II) is still considered a polypeptide according to this description, although in such a case it could also be referred as a conjugate of formula (I) or formula (II).
- linker (L) when present in formula (I) or formula (II), it allows the spatial disposition that makes R1 and R2 more visible to the immune system (i.e., spatially disposed to allow a response of the immune system).
- the invention provides a polynucleotide which encodes the compound as defined in the first aspect.
- the polynucleotide is DNA or RNA.
- the invention also provides a vector comprising the polynucleotide as disclosed above.
- suitable vectors include those conventionally used in biomedicine and known to the skilled person.
- the invention also provides a cell system which is transformed or transfected with the polynucleotide or the vector of the invention. More precisely, the invention provides a host cell which is transformed or transfected with the polynucleotide and/or the vector as defined above, and it also provides a cell culture comprising said host cell. The skilled person would know which host cells are suitable for the synthesis of the protein of the invention.
- the invention provides a protein nanopellet (i.e., nanoparticle) comprising one or more of the polypeptides defined in the first aspect and with a particle diameter from 400 nm to 1500 nm, measured by electron microscopy.
- the invention provides a protein nanopellet comprising one or more polypeptides comprising the amino acid sequence of an interferon or a fragment thereof, the amino acid sequence of a viral antigen or a fragment thereof and, optionally, a linker between them; and with a particle diameter from 400 nm to 1500 nm, measured by electron microscopy.
- the nanopellet is immunogenic.
- the nanopellet is spheroid, and it has a width from 250 nm to 1000 nm, and a length from 500 nm to 1500 nm.
- the measures of these dimensions obtained, as indicated by EM, in particular by Field emission scanning electron microscopy (FESEM).
- the nanopellet has a width from 500 nm to 750 nm and a length from 750 nm to 1200 nm.
- the nanopellet has a width from 519.1 nm to 728.9 nm and a length from 765.1 nm to 1 198.9 nm.
- the protein nanopellet comprises one or more of endotoxin, nucleic acids or peptidoglycans.
- the invention also contemplates a method for the obtention of a protein nanopellet as defined in the second aspect comprising the following steps:
- the host cell (I ,e. , cell system for the production of the nanopellets) is a bacterial cell.
- the cell system for the production of the nanopellets is E. coli bacteria. More in particular it is strain BL21 of E. coli.
- the step of purification is carried out by enzymatic and/or mechanical disruption of the cell host, optionally in presence of a one or more of solvents, detergents, and surfactants, in particular non-ionic surfactants, and protease inhibitors.
- Examples of enzymes include the lysozyme.
- Examples of physical or mechanical means include centrifugation steps, frozen and thaw cycles.
- non-ionic surfactants examples include Triton X-100.
- non-ionic surfactants are food grade non-ionic surfactants, in particular selected from polyglycerol alkyl ethers, glucosyl dialkyl ethers, crownethers, ester-linked surfactants, polyoxyethylene alkyl ethers, Brij, Spans (sorbitan esters) and Tweens (Polysorbates).
- Food grade means that are compounds useful in the processes for obtaining food without any danger for the final consumers.
- the step of purification is carried out optionally performing a chromatographic step.
- the step of purification is carried out without performing a chromatographic step.
- the method comprises the following steps:
- the method comprises the following steps: - Transformation of a host cell with plasmids or vectors comprising a polynucleotide encoding a polypeptide as described in the first aspect, or in any of its embodiments, to obtain a host transformed cell;
- the invention provides a protein nanopellet obtainable by the method defined in the previous embodiments. All the particular embodiments of the method are applicable to the nanopellets obtainable by means of the same.
- a third aspect of the invention is an immunogenic composition comprising one or more polypeptides as defined in the first aspect, and/or the protein nanopellet as defined in the second aspect.
- a fourth aspect of the invention is a vaccine comprising the immunogenic composition as defined above, and a pharmaceutically acceptable excipient and/or carrier.
- the vaccine comprises an immunogenically effective amount of the immunogenic composition.
- the vaccine further comprises an adjuvant.
- the vaccine is an oral vaccine.
- the fifth aspect of the invention is a polypeptide as defined in the first aspect and/or the protein nanopellet as defined in the second aspect, and/or the immunogenic composition as defined in the third aspect, and/or the vaccine as defined in the fourth aspect, for use in therapy, that is, as a medicament.
- polypeptide and/or the protein nanopellet, and/or the immunogenic composition, and/or the vaccine as defined above is for use in the prevention and/or treatment of a viral disease in fish or teleost and crustaceans.
- This embodiment can also be formulated as the use of the polypeptide and/or the protein nanopellet, and/or the immunogenic composition, and/or the vaccine as defined above for the manufacture of a medicament, for the treatment and/or prevention of infections or diseases caused by viral diseases in fish or crustacean.
- This embodiment can also be formulated as a method of immunizing fish or teleost and crustacean in need thereof with an immunologically effective amount of a polypeptide and/or a protein nanopellet, and/or an immunogenic composition, and/or a vaccine as defined above, in particular for treating and/or preventing infections or disease caused by viruses.
- the infections or disease are caused by one or more viruses selected from the group consisting of pancreatic necrosis virus (IPNV), Viral Hemorrhagic Septicemia Virus (VHSV), Viral Nervous Necrosis Virus (VNNV) and Spring Viraemia of Carp Virus (SVCV). More in particular, the infections or disease are caused by SVCV and/or VHSV. More in particular, the infections or diseases are caused by SVCV. More in particular, the infections or diseases are caused by VHSV. Particularly, the fish or crustacean is selected from the group of Salmonids, turbot, carp, cyprinids, seabass, common sole, turbot, barramundi, Seabream and/or prawns.
- IPNV pancreatic necrosis virus
- VHSV Viral Hemorrhagic Septicemia Virus
- VNNV Viral Nervous Necrosis Virus
- SVCV Spring Viraemia of Carp Virus
- the infections or disease
- polypeptide and/or the protein nanopellet, and/or the immunogenic composition, and/or the vaccine is for use in preventing and/or treating SVCV in carp or zebrafish.
- polypeptide and/or the protein nanopellet, and/or the immunogenic composition, and/or the vaccine are for use in preventing and/or treating VHSV in rainbow trout.
- the vaccination of fish or teleost and crustacean can be achieved by several means, such as intubation, interperitoneal injection, immersion and oral, among other.
- the polypeptide as defined in the first aspect and/or the protein nanopellet as defined in the second aspect, and/or the immunogenic composition as defined in the third aspect, and/or the vaccine as defined in the fourth aspect, for use in therapy is administered by a mean selected from the group of intubation, immersion, interperitoneal ly injection and oral administration.
- oral administration is highly desirable for therapy and prophylaxis for fish or teleost and crustacean viral diseases, particularly for species with moderate market value and high production.
- the present invention is a biocompatible, cheap and modular platform that allow the production of recombinant proteins in a highly stable conformation.
- the polypeptide as defined in the first aspect and/or the protein nanopellet as defined in the second aspect, and/or the immunogenic composition as defined in the third aspect, and/or the vaccine as defined in the fourth aspect, for use in therapy is orally administered.
- the sixth aspect of the invention is a food, a feed, food or feed additive composition comprising a polypeptide, and/or a protein nanopellet, and/or the immunogenic composition, and/or the vaccine, as defined above.
- the food, feed, food or feed composition, or food or feed additive comprises at least one edible ingredient.
- the at least one edible ingredient is selected from the group of vegetable components, soy, corn, rapeseed, sunflowers, broad beans, wheat, marine ingredients, fishmeal and fish oil.
- the invention also provides a method for the obtention of the food, feed, or feed additive composition as defined in the sixth aspect comprising the following steps: a) mixing a polypeptide as defined in the first aspect, or a protein nanopellet as defined in the second aspect, or an immunogenic composition as defined in the third aspect, or a vaccine as defined in the fourth aspect with at least one edible ingredient; b) conditioning the mixture; c) extrusion of the mixture; d) drying of the mixture; e) oiling of the mixture; and f) optionally, packaging of the mixture.
- the step b) is carried out by adding steam while the mixture is mixing.
- the mixture in step b) reaches a temperature of 120 to 160 °C. More in particular from 125 to 150 °C.
- the mixture in step b) reaches a moisture of 15 to 30%.
- the mixture in step b) reaches a moisture of 20 to 24%.
- the step c) is carried out at high pressure.
- the skilled person would be aware of high pressions suitable for extrusion processes.
- the step c) is carried out at a pressure selected from around 2.5 to around 10 MPa. More in particular the pressure is selected from around 6 to around 8 MPa. More in particular, the pressure is of around 7 MPa.
- the step c) is carried out at a temperature selected from 0 to 100°C. More in particular, from 30 to 100°C. More in particular the step b) is carried out at around 100 °C. In another particular embodiment the step c) is carried out at around 40 °C.
- weightwater refers to the weight of water in the wet material
- weightwet refers to the weight of the wet material. It is expressed in percentage (%),and it can range from 0 to 100 percent.
- the skilled person knows well established methods for the measurement of moisture in food or feed products.
- the step d) is carried out until a moisture between 0 to 25% is reached.
- step e) the mixture is oiled until the fat content of the mixture is at least 10%, 15%, 20%, 25%, 30%, 40% or 45% (weight of fat/weight of the total mixture).
- step e) is carried out by means of vacuum pressure.
- method comprises the following steps: a) mixing a polypeptide as defined in the first aspect, or a protein nanopellet as defined in the second aspect, or an immunogenic composition as defined in the third aspect, or a vaccine as defined in the fourth aspect with at least one edible ingredient; b) conditioning the mixture by adding steam to the mixture until it reaches a temperature from 120 to 160 °C; c) extrusion of the mixture at a temperature selected from 30 to 100 °C; d) drying of the mixture until a moisture selected from 5 to 15% is reached; e) oiling of the mixture until the fat content of the mixture is from 15 to 40% (w/w); and f) optionally, packaging of the mixture.
- the method comprises the following steps: a) mixing a polypeptide as defined in the first aspect, or a protein nanopellet as defined in the second aspect, or an immunogenic composition as defined in the third aspect, or a vaccine as defined in the fourth aspect with at least one edible ingredient; b) conditioning the mixture by adding steam to the mixture until it reaches a temperature from 120 to 160 °C and a moisture from 15 to 30%; c) extrusion of the mixture at a pressure selected from 6 to 8 MPa and at a temperature selected from 30 to 100 °C; d) drying of the mixture until a moisture of around 7 to 9% is reached; e) oiling of the mixture until the fat content of the mixture is from 15 to 40% (w/w) by means of vacuum pressure; and f) optionally, packaging of the mixture.
- the method comprises the following steps: a) mixing a polypeptide as defined in the first aspect, or a protein nanopellet as defined in the second aspect, or an immunogenic composition as defined in the third aspect, or a vaccine as defined in the fourth aspect with at least one edible ingredient; b) conditioning the mixture by adding steam to the mixture until it reaches a temperature from 125 to 150 °C and a moisture from 20 to 24%; c) extrusion of the mixture at a pressure of around 7 MPa and at a temperature of around 40 °C; d) drying of the mixture until a moisture of around 8% is reached; e) oiling of the mixture until the fat content of the mixture is from 15 to 40% (w/w) by means of vacuum pressure; and f) optionally, packaging of the mixture.
- the method comprises the following steps: a) mixing a polypeptide as defined in the first aspect, or a protein nanopellet as defined in the second aspect, or an immunogenic composition as defined in the third aspect, or a vaccine as defined in the fourth aspect with at least one edible ingredient; b) conditioning the mixture by adding steam to the mixture until it reaches a temperature from 125 to 150 °C and a moisture from 20 to 24%; c) extrusion of the mixture at a pressure of around 7 MPa and at a temperature of around 100 °C; d) drying of the mixture until a moisture of around 8% is reached; e) oiling of the mixture until the fat content of the mixture is from 15 to 40% (w/w) by means of vacuum pressure; and f) optionally, packaging of the mixture.
- the invention also provides a food, feed, or feed additive obtainable by the method defined in the previous embodiments. All the particular embodiments of the method are applicable to the food, feed, or feed additive obtainable by means of the same.
- a polypeptide comprising the amino acid sequence of an interferon or a fragment thereof, the amino acid sequence of a viral antigen or a fragment thereof and, optionally, a linker between them.
- polypeptide according to embodiment 1 wherein the polypeptide has formula (I):
- n is an integer selected from 0 or 1;
- R1 which is at the N-terminal end of the polypeptide, comprises the amino acid sequence of an interferon or a fragment thereof;
- L is a linker
- R2 which is at the C-terminal end of the polypeptide, comprises the amino acid sequence of a viral antigen or a fragment thereof.
- R2 is the amino acid sequence of a viral antigen of a virus causing disease in aquatic animals selected from fish or teleost and crustacean.
- R2 the amino acid sequence of a viral antigen of a virus causing disease, said virus selected from Infectious pancreatic necrosis virus (IPNV), Viral Hemorrhagic Septicemia Virus (VHSV), Viral Nervous Necrosis Virus (VNNV) and Spring Viraemia of Carp Virus (SVCV).
- IPNV Infectious pancreatic necrosis virus
- VHSV Viral Hemorrhagic Septicemia Virus
- VNNV Viral Nervous Necrosis Virus
- SVCV Spring Viraemia of Carp Virus
- R2 comprises the amino acid sequence as set forth in SEQ ID NO: 1 , or a sequence at least 85% identical to SEQ ID NO: 1 ; or alternatively wherein R2 comprises the amino acid sequence as set forth in SEQ ID NO: 5, or a sequence at least 85% identical to SEQ ID NO: 5.
- R1 comprises the amino acid sequence of an interferon or a fragment thereof of an animal species selected from fish or teleost and crustacean, the interferon selected from the group consisting of interferons Type I and Type II.
- R1 comprises the amino acid sequence as set forth in SEQ ID NO: 2 or a sequence at least 85% identical to SEQ ID NO: 2.
- a protein nanopellet comprising one or more of the polypeptides as defined in any one of embodiments 1- 10, and with a particle diameter from 400 nm to 1500 nm, measured by electron microscopy.
- An immunogenic composition comprising one or more polypeptides as defined in any one of embodiments 1-10, and/or the protein nanopellet as defined in embodiment 11.
- a vaccine comprising the immunogenic composition as defined in embodiment 12, and a pharmaceutically acceptable excipient and/or carrier.
- a food composition comprising a polypeptide as defined in any one of embodiments 1 -10, and/or the protein nanopellet as defined in embodiment 11 , and/or the immunogenic composition as defined in embodiment 12, and/or the vaccine as defined in embodiment 13.
- Recombinant SVCV G protein was designed based on the glycoprotein G sequence (G3 region, AA 254-381 , Uniprot acc. no: Q91 DS0 as set forth in SEQ ID NO: 1).
- Recombinant SVCV G antigen with the interferon gamma module (SVCV-IFN) was based on the sequence of the G3 region (254-381 .
- Clones were designed using the ORF and pET22b removing the periplasmic location signal and including a C terminal poly His-tag.
- Clones were codon optimized for expression in E. coli, synthesized by GeneScript and subcloned into pET22b. Plasmids were transformed into E. coli BL21 (DE3) (Novagen). The red fluorescent protein (RFP), IRFP-His cloned into pET22b (Genscript), was used as a non-relevant control protein. Production of NPs, Purification, Quantification, and Fluorescent Labeling
- E. coll bearing the plasmids coding for NPs were cultured overnight (O/N) in LB medium (Gibco) with ampicillin (100 pg/ml, Sigma-Aldrich) at 37°C and 250 rpm.
- NPs purification the cell cultures were subjected to simple enzymatic and mechanical disruption processes (Torrealba, D., et al., 2016a). Lysozyme (1.5 pg/ml, Roche), protease inhibitor complete EDTA- free Tablets (Roche) and phenyl-methanesulfonyl fluoride (PMSF) (0.4 mM, Roche) were added and incubated at 37°C for 2 to 3 h, under shaking (250 rpm). Cultures were then frozen at -80°C overnight (O/N). After thawing, Triton X-100 (Roche) was added (0.2% v/v) and the solution was stirred for 1 h at room temperature (RT). Then, DNase I (1 pg/ml) and MgSO4 (1 mM) were added, and the cultures were incubated for 1 h at 37°C with shaking.
- Lysozyme 1.5 pg/ml, Roche
- NPs were harvested by centrifugation at 15000 x g, 15 min at 4°C and resuspended in lysis buffer (50 mM Tris HOI pH 8, 100 mM NaCI, 1 mM EDTA) at 1/10 the original culture volume.
- lysis buffer 50 mM Tris HOI pH 8, 100 mM NaCI, 1 mM EDTA
- NPs purified NPs
- SEQ ID NO: 13 Pellets of purified NPs, named SVCV NP (SEQ ID NO: 13) and SVCV-IFN NP (SEQ ID NO: 14) were stored at -80°C until use. Protein was semi-quantified by western blot using an anti-His-tag antibody (Genscript A00186-100), and the protein concentration was calculated using Image Lab 6.0.1 software (BioRad). For flow cytometry or confocal microscopy, NPs were conjugated with Atto-488 NHS ester (Sigma- Aldrich) according to the manufacturer's instructions. Labeling efficiency was determined with the Nanodrop ND-1000 (Thermo Scientific).
- SEQ ID NO: 13 is
- SEQ ID NO: 14 is
- Electron Microscopy was used to determine the external morphology and physical dimensions of the NPs.
- Samples were prepared by resuspending NPs at 100 pg/ml in mQ water, pipetting 20 pl onto silicon chips, and air-dried O/N.
- NPs were exposed to different in vitro conditions. For pH, NPs were incubated under gentle stirring at pH 2 and 10 for 3 h together with a control sample. For temperature, NPs were incubated for 5 min at 100 °C.
- NPs were centrifuged at 10.000 x g for 5 min at 4 °C and resuspended at 10 and 50 pg/ml in phosphate buffered saline (PBS, Sigma-Aldrich) and finally 20 pl were deposited onto silicon chips, and air-dried O/N. Electron microscopy images were taken with a FESEM (Zeiss Merlin) and analyzed using Fiji package (National Institute of Health, USA). At least 60 particles were measured, and size distribution histograms were generated using Past 4.04 software (University of Oslo).
- NPs bacterial IBs
- SVCV NP 0.3 mg/l SVCV-IFN NP 3.6 mg/l.
- Expression of recombinant proteins is an empiric process with several experimental constraints that affect the production yield (see Example 9).
- SVCV-IFN NP is generally oviform (elliptical shaped) while SVCV NP is rounder and smaller. Similar morphologies had been observed in other IBs produced in E. coli using the same strain BL21 (DE3) and in M15(pREP4) (Thwaite et al., 2018).
- the size range is shown in Figures 1 Ail, 1 Alii, 1 Bii and 1 Bill with average width and length being 420 ⁇ 67.5 nm and 693 ⁇ 154 nm for SVCV NP and 624 ⁇ 104.9 nm and 982 ⁇ 216.9 nm for SVCV-IFN NP , respectively.
- Morphological and structural integrity of NPs were evaluated under different environmental conditions of temperature and pH to assess the resistance of the NPs under industrial extrusion procedures and gastrointestinal pH conditions.
- SVCV NP and SVCV-IFN NP were subjected to high temperature (100°C) and extreme pH conditions (pH 2 and 10) and significant changes in size or morphology were not observed (data not shown).
- Zebrafish ZFL cells (CRL-2643, ATCC) were cultured according to Thwaite et al. (Thwaite et al., 2018) at 28°C and 5% CO2 in DMEM + GlutaMAX (Gibco), 10% heat-inactivated fetal bovine serum (FBS) (Gibco), 0.01 mg/ml insulin (Sigma-Aldrich), 50 ng/ml epidermal growth factor (Sigma-Aldrich), 2% (v/v) antibiotic/antimycotic (Gibco), and 0.5% (v/v) trout serum which had been filtered (0.20 pm filter Corning) and heat inactivated for 30 min at 56°C.
- GlutaMAX GlutaMAX
- FBS heat-inactivated fetal bovine serum
- FBS heat-inactivated fetal bovine serum
- 0.01 mg/ml insulin Sigma-Aldrich
- 50 ng/ml epidermal growth factor Sigma-Aldrich
- Zebrafish embryonic fibroblast (ZF4 cells) were cultivated at 28°C and 5 % CO2 in RPMI medium (Gibco) supplemented with 10% FBS (Cultek), 1 mM pyruvate (Gibco), 2 mM L-glutamine (Gibco), 50 pig/ml gentamicin (Gibco) and 2 pig/ml amphotericin B (Gibco).
- Fathead minnow (Pimephales promelas) EPC cells were maintained at 28°C and 5 % CO2 in medium RPMI- 1640 supplemented with 10% FBS, 1 mM pyruvate, 2 mM L-glutamine, 50 pig/ml gentamicin and 2 pig/ml amphotericin B.
- SVCV strain 56/70 originally isolated from carp (Fijan, N., Petrinec, Z., Sulimanovic, D., & Zwillenberg, L.O. (1971). Isolation of the viral causative agent from the acute form of Infectious dropsy of carp. Veterinarski Arhiv, 41 , 125-138) was propagated in EPC cells at 28°C until a cytopathic effect was observed. Then, the cell culture medium was harvested, centrifuged at 4000 x g for 30 min, and virus aliquots were stored at - 80°C.
- SVCV NP and SVCV-IFN NP were added at 2.5, 5, 10, 20 and 40 pig/ml and cultures were then incubated O/N (12-14 h).
- SVCV NPs were added at 5 and 10 pig/ml and cultures were simultaneously incubated for 12 and 24 h.
- SVCV NP and SVCV-IFN NP were added at 5 and 10 pig/ml and cultures were then incubated O/N (12-14 h). All experiments were performed in duplicate.
- Post treatment ZFL cells were washed in PBS and incubated at 28°C and 5% CO2 with 1 mg/ml Trypsin (Gibco) for 15 min. This strong trypsinization step aimed to remove NPs attached to the cell surface (Seras-Franzoso, J., Sanchez -Chardi, A., Garcia-Fruitos, E., Vazquez, E., Villaverde, A., 2016.
- ZFL cells were seeded on Ibid! plates (pi-Dish 35 mm) and incubated at 28°C and 5% CO2. The next day cells at approximately 50-60% confluence were placed in minimal media. SVCV NP and SVCV-IFN NP at 20 pg/ml were added 2 h later and cells were incubated for 16 h at 28°C. The cells were stained with Hoechst (nuclei) and CellMask Deep Red (membrane) (Life Technologies). Images were analyzed using Imaris software v8.2.1 (Bitplane) and Imaged (National Institute of Health, USA).
- Modular SVCV NPs were taken up by ZFL cells.
- the mean fluorescence intensity (MFI) increased with dose until 5 - 10 pg/ml ( Figures 2A and 2C) and at higher doses dropped significati vely . This decrease was not related with toxicity or apoptosis since cell survival was 100% across doses and time. Possibly, the MFI had started to drop indicating cells were not able to take up more NP or there is a NP overload that had started to be metabolized, in which case the antigen is broken into small peptides which are presented by the antigen-presenting cells to other cells of the immune system.
- Example 3 Gene Expression Analysis in ZFL and ZF4 Stimulated with NPs Methods.
- RNA of ZFL cells was extracted using TriReagent (Sigma-Aldrich) following the manufacturer's instructions and RNA yield and quality was determined on Nanodrop ND-1000 (Thermo Fisher Scientific) and integrity assessed on the Agilent 2100 Bioanalyzer using RNA 6000 Nano Lab-Chip kit (Agilent Technologies). Then, cDNA was synthesized from 1 pig high quality total RNA using iScript cDNA synthesis kit (Bio-Rad). Quantitative real-time PCR (qPCR) was performed at 60°C annealing temperature in a CFX384 touch real-time PCR detection system (Bio-Rad) using iTaq Universal SYBR Green Supermix kit (Bio-Rad).
- qPCR Quantitative real-time PCR
- Each PCR mixture consisted of 5 pl SYBR Green Supermix, 0.4 pM specific primers, 2 pil diluted cDNA and 2.6 pl water (Sigma-Aldrich) in a final volume of 10 pil.
- the ef1 -a gene was used as a reference gene.
- the dilution factor for all the genes tested was 1 :10 ( ig1, mx, ccl4, Imp2, ifngrl and ef1-a). Amplification efficiencies for primers Imp2 and ifngrl were calculated.
- the primers of ifngrl are those of SEQ ID NO: 9 (TGTGAAGGCATTATGGAACGAA) for the forward primer, and SEQ ID NO: 10 (CTTCCATGTTGATTGAAGGTGAAT) for the reverse primer.
- RNA isolation of ZF4 cells was used according to the manufacturer's instructions. Then, RNA was quantified with a NanoDrop Spectrophotometer (Nanodrop Technologies, Wilmington, DE, USA), and M-MLV reverse transcriptase (Invitrogen, Thermo Fisher Scientific) was used for cDNA synthesis from RNA, as previously described (Chico, V., Gomez, N., Estepa, A., Perez, L, 2006. Rapid detection and quantitation of viral hemorrhagic septicemia virus in experimentally challenged rainbow trout by real-time RT-PCR.
- RT-qPCR was carried out in 20 pl reactions containing 24 ng of cDNA, 10 pl of SYBR green PCR master mix (Thermo Fischer Scientific), and a 900 nM final concentration of each primer using the QUANTSTUDIO 3 System (Applied Biosystems, Thermo Fisher Scientific Inc.).
- the ef1-a gene was used as a reference gene.
- Wild type zebrafish were kept in a re-circulating aquarium with water temperature at 28 ⁇ 1 °C.
- the lighting conditions were 14:10 h (light:dark) and adult fish were fed twice a day at a rate of 2% bodyweight.
- Ammonia, nitrite, nitrate and pH levels were measured once a week and were kept below toxic levels and pH at 7.5 ⁇ 0.5.
- two females and four males were transferred in groups to a breeding tank in the late afternoon. The next morning after 3 h of the onset of light embryos were collected and cultured in embryo medium (E3 medium) in a Petri dish (Deltalab).
- Fertilized eggs were separated from unfertilized eggs using a plastic pipette (Deltalab). All experiments involving zebrafish were performed following International Guiding Principles for Research Involving Animals (EU 2010/63) and the Ethics Committees of the Universitat Autbnoma de Barcelona (UAB, CEEH) and Generalitat Valenciana (2019A/SC/PEA/0203)
- ZFL cells were stimulated with the viral NPs overnight (16 h) at 10 pg/ml.
- Poly (l:C) (10 pg/ml) was also used as a viral dsRNA mimic, LPS as a bacterial mimic and IRFP NP (10 pg/ml) as a control NP made with an immunologically irrelevant protein.
- ZFL cells a typical strong antiviral response after Poly(l:C) treatment was previously reported (Ruyra, A., Torrealba, D., Morera, D., Tort, L, MacKenzie, S., Roher, N. , 2015. Zebrafish liver (ZFL) cells are able to mount an anti-viral response after stimulation with Poly (l:C).
- IRFP NP protein without a relevant immune role does not induce the expression of antiviral genes while SVCV NP and SVCV-IFN NP were able to stimulate ZFL cells by increasing the gene expression of anti-viral genes such as vig1, mx or ccl4.
- the inclusion of the I FNy protein module enhanced the ability of SVCV NP to stimulate an antiviral response showing that IFNy could act as a potent adjuvant when included within the same NP ( Figures 3A, 3B, 3C, 3D and 3E).
- Wild type zebrafish were kept in a re-circulating aquarium with water temperature at 28 ⁇ 1 °C.
- the lighting conditions were 14:10 h (light:dark) and adult fish were fed twice a day at a rate of 2% bodyweight.
- Ammonia, nitrite, nitrate and pH levels were measured once a week and were kept below toxic levels and pH at 7.5 ⁇ 0.5.
- two females and four males were transferred in groups to a breeding tank in the late afternoon. The next morning after 3 h of the onset of light embryos were collected and cultured in embryo medium (E3 medium) in a Petri dish (Deltalab).
- Fertilized eggs were separated from unfertilized eggs using a plastic pipette (Deltalab). All experiments involving zebrafish were performed following International Guiding Principles for Research Involving Animals (EU 2010/63) and the Ethics Committees of the Universitat Autbnoma de Barcelona (UAB, CEEH) and Generalitat Valenciana (2019A/SC/PEA/0203).
- SVCV NP and SVCV-IFN NP treated larvae died after 24 h incubation at the highest dose, 20 g/ml. At 10 g/ml the whole set of larvae survived after immersion in the SVCV NP and SVCV-IFN NP solution.
- Example 6 Biomaterial physical-chemical features: nanosized material with extremely qood resistance properties. Manufacturinq proteins for inclusion in feed. (VHSV and VNNV)
- VHSV and VNNV antigens with the IFNy module were produced in E. coli and purified as nanosized structures at high yield (e.g 14.3 mg/l for VHSV-IFN NP ) and high purity (see Table 4) using a short and simple enzymatic/mechanical purification procedure, which minimizes costs and not needing further chromatographic purification steps.
- chromatography is not used as bacterial contaminants produced during the purification process, such as lipopolysaccharide (LPS), membrane peptidoglycan (PGN), cell wall fragments, and DNA and RNA in variable amounts, are not toxic or generate adverse effects on the fish, and furthermore add an additional immunostimulatory benefit to the recombinant vaccine.
- LPS lipopolysaccharide
- PPN membrane peptidoglycan
- DNA and RNA in variable amounts
- the mechanical and enzymatic processes ensure that there is no contamination with viable bacterial cells.
- VHSV-IFN NP SEQ ID NO: 16
- VNNV-IFN NP VNNV-IFN NP
- iRFP NP iRFP NP
- VHSV-IFN NP A vaccinal feed was developed at small scale with VHSV-IFN NP using standard extrusion protocols. Once the feed was manufactured, VHSV-IFN NP can be isolated and detected after delipidation by a basic extraction from food pellets and it remains intact (Figure 6).
- Biomaterial functional features how these biomaterials ii on fish immune and
- VHSV NP SEQ ID NO: 15
- VHSV-IFN NP VHSV-IFN NP
- IFNy module provided with in-vaccine adjuvant properties in in vitro assays showing improved stimulatory abilities compared with the VHSV NP .
- SEQ ID NO: 15 is
- VHSV-IFN NP HKM or RTGut cell line are stimulated by VHSV-IFN NP but also intraperitoneal injection of VHSV- IFN NP demonstrate that fluorescent NPs could be detected in immune relevant tissue and stimulate the gene expression of immune genes in Spleen, HK and erythrocytes (RBCs) (data not shown).
- the I FNy incorporated in the NPs was able to enhance the induction of an adaptive response through the production of specific and neutralizing antibodies in the case of VHSV-IFN NP , administered to trout also by intubation ( Figures 9A and 9B).
- Adult rainbow trout were intubated on three consecutive days with an accumulative dose of 25 mg/kg fish of NPs.
- Sera was obtained 30 days post immunization from: untreated control, VHSV-IFN NP vaccinated, IRFP NP vaccinated, PBS control, and VHSV infection survival fish positive control. Differences between means were analyzed by a one-way ANOVA with Brown-Forsythe multiple comparisons test.
- capsid viral antigens have an intrinsic ability to auto-organize to form viral capsids. Nevertheless, for example the LCDV viral antigen (without a linked cytokine) was produced as a nanopellet with an extremely low yield (0.07 mg/l) and it was observed an heterogenous pattern by FESEM ( Figure 10B). Despite additional optimization of the expression and purification protocols (enzyme concentration, sonication, etc.), it was not possible to obtain any robust structure.
- cytokines these are soluble proteins usually found circulating in blood. For this reason, cytokines are not expected to easily form nanostructured NPs.
- CCL4 the structuration as nanopellets of four cytokines were studied: CCL4, TNFo, IL-6 and IFN.
- CCL4 and TNFo were successfully produced as NPs.
- IL-6 was not self-assembled and the recombinant protein was "trapped" inside the bacteria ( Figure 10A). Despite additional optimization of the expression and purification protocols (enzyme concentration, sonication, etc.), it was not possible to obtain any robust structure.
- Example 9 NPs production performance
- a mean production yield (mg/l) was calculated based on different batches produced from each NP. As can be seen in the table, surprisingly an increase in protein production yield is observed in all cases when IFN is linked to the viral antigen.
- Example 10 Inclusion of NPs in fish feed
- the vaccine In the context of oral vaccination, the vaccine is either pre-mixed with the feed during feed preparation, usually by extrusion, or mixed with the vaccine prior to feeding by simple homogenization with oil or vacuum coating (Makesh & Rajendran 2022).
- oil or vacuum coating makesh & Rajendran 2022.
- both vacuum coating and, above all, extrusion allow the compound to remain homogeneous in the feed and to be released in the fish's digestive tract with the same dynamics as the normal nutrients.
- both processes involve thermal and mechanical treatments at different pressures and temperatures (Chaabani et al 2020), which may affect the integrity of the proteins.
- the semi-industrial extrusion process may consist of the following steps (Dantagnan et al 2002; Hardy & Brezas et al 2002):
- the operating conditions of the extruder play a very important role, thus, the retention time and the steam injection contribute to the gelatinization of the starches, giving the characteristics to the final product.
- This process is carried out at high temperature (above 130°C) and short time not exceeding 30 seconds (HTST, High Temperature Short Time).
- This step can also be done in low temperature (for example the inventors conducted a semi-industrial similar process with a cold extrusion at around 40 °C obtaining proper results), although it is very recommendable (or even mandatory in industrial scale) to use high temperatures for easily maintaining sterility, among other benefits.
- Feed oiling the feed is coated with oil in an amount equivalent to approximately 12% of the feed weight. Reaching a total amount of lipids of around 15 to 40% in the mixture. Vacuum oiling allows large quantities of oil to enter the center of the pellet in a few seconds.
- Zebrafish liver (ZFL) cells are able to mount an anti-viral response after stimulation with Poly (I :C).
- Poly II :C
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Biomedical Technology (AREA)
- Toxicology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Animal Behavior & Ethology (AREA)
- Biotechnology (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Virology (AREA)
- Veterinary Medicine (AREA)
- Microbiology (AREA)
- Wood Science & Technology (AREA)
- Pharmacology & Pharmacy (AREA)
- General Engineering & Computer Science (AREA)
- Immunology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Mycology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Protein nanopellets for fish or teleost and crustacean vaccination The present invention relates to protein nanopellets comprising one or more polypeptides comprising the amino acid sequence of an interferon or a fragment thereof, the amino acid sequence of a viral antigen or a fragment thereof and, optionally, a linker between them; and with a particle diameter from 400 nm to 1500 nm, measured by electron microscopy. It also discloses their use in immunogenic compositions and vaccines to immunize fish or teleost and crustacean against several virus diseases.
Description
Protein nanopellets for fish or teleost and crustacean vaccination
This application claims the benefit of European Patent Application 22383185.0 filed December 5th, 2022.
Technical Field
Present invention belongs to the field of fusion proteins. In particular, the invention relates to a fusion protein with immunization activity. The fusion protein of the invention is particularly useful in the immunization against viral infections in fish or teleost and crustaceans by means of oral vaccination.
Background Art
According to the Food and Agriculture Organization (FAO), disease outbreaks cost the global aquaculture industry around US$6 billion per year and represent the major farm-level risk. In particular, viral diseases are a major concern, and there is a continuous emergence of them. Considering the gravity and frequency of aquatic animals' disease outbreaks, new strategies for their prevention, detection, and management are urgently needed.
Among viral disease, spring viremia of carp (SVC) is an infectious viral disease common to carp (Cyprinus carpio) and other cyprinid fish species (including zebrafish (Danio rerio), koi {Cyprinus carpio koi), silver carp (Hypophthalmichthys molitrix), goldfish (Carassius auratus) or grass carp (Ctenopharyngodon idella) among others, caused by the SVC virus (SVCV). SVCV is a member of the family Rhabdoviridae, with negativesense ssRNA encoding five proteins-nucleoprotein (N), phosphoprotein (P), matrix protein (M), glycoprotein (G), and RNA-dependent polymerase (L). The expansion of the geographical and host Infection range of SVCV poses a major threat not only to the fish farms and ornamental fish industries, but also to wild fish populations. SVC outbreaks can reach 90% of mortality in juvenile fish.
Among the strategies, vaccination is one of the most promising ones. But it needs to optimize efficacy, while taking into account production and administration costs, environmental risks, and compliance with legislation.
Regarding SVCV, therapeutic or prophylactic approaches to combat SVCV have been ineffective and no commercial vaccine is currently available.
The traditional approach is based on the use of inactivated or attenuated viral vaccines, which are commercially available for certain viral diseases that cause high mortality. However, their main drawbacks are that not all fish viruses are readily culturable in cells; that the administration via injection or immersion for juveniles is expensive, thus only deemed for the most valuable species; and the risk of possible reversion to virulence and environmental spread.
New approaches are thus being sought. Among them, recombinant DNA vaccines have achieved promising results against certain viruses, but they also raise safety and environmental issues regarding genetically modified organisms and their administration by intramuscular injection is costly and difficult to perform on juveniles, as well as causing stress and injury to fish, so it is only worth it in high added value species.
An alternative vaccine approach is the use of recombinant protein viral antigens. The main advantage of subunit vaccines is they are safe: there is no risk of DNA integration into the host, reversion, or invasion. Their main drawbacks are the stability and half-life of recombinant proteins in vivo; and the lack of pathogen associated molecular patterns (PAMPS) that the immune system utilizes to recognize pathogens via pattern recognition receptors (PRRs) thus needing adjuvants with co-stimulatory activity to enhance the magnitude of the immune response.
Oral delivery would be the most practical, cheap, and least stressful delivery method. However, the harsh gastric environment promotes antigen breakdown. So, immunorelevant epitopes need to be protected against gastrointestinal pH, which is particularly low in carnivorous fish, as well as digestive enzymes within the tract.
Aiming to protect the recombinant protein antigens from rapid degradation when inside the animal, different encapsulation techniques such as alginate and chitosan are being tested. Such strategies add an extra production step which increases the cost and makes it expensive for low market value species.
At this end, viral protein antigens nanostructured as bacterial inclusion bodies (IBs) were presented as a novel approach to prophylactic design, enhancing the stability of antigenic proteins while maintaining functionality. IBs are highly stable, tuneable, nanoscale protein particles which can penetrate cells, while retaining significant biological activity, as demonstrated by rescue studies.
They can be designed to bear the antigenic protein or epitopes of interest and provide a slow release of functional protein over time. The attractiveness of IBs as a fish or teleost and crustacean prophylactic is manifold. Their stability at gastrointestinal pH allows administrating the antigen orally through the feed, avoiding the necessity for vaccine encapsulation and the cost and stress to fish associated with injection. Production in Escherichia coli is achieved in bulk with a simple enzymatic and mechanical purification procedure which minimizes costs. This straightforward process implies that the IBs carry over fragments of bacterial lipopolysaccharide, peptidoglycans, and nucleic acids as impurities, but which are known adjuvants and immunomodulators of fish. The IB vehicle, a carrier and viral antigen as one biomaterial, elicit both an innate and adaptive immune response against the target virus in fish or teleost and crustacean. Additionally, IBs' stability under lyophilizing conditions and over a range of temperatures indicates their potential as a practical farm product with a lasting shelf life, avoiding the cold chain.
The potential of IBs have been demonstrated as an immunostimulant for fish, by nanostructuring recombinant cytokines TNF-o and CCL4 and testing them in a bacterial Infection model in zebrafish. In addition, uptake of
the TNF-a IB by intestinal cells was demonstrated in vivo in rainbow trout via oral intubation.
For nanostructured viral antigens as IBs for use in fish food, the term "NanoPellets" (NPs) was coined.
In a recent study three recombinant viral antigenic proteins (viral capsid protein 2 (VP2) from infectious pancreatic necrosis virus (IPNV), an Aquabirnavirus; the glycoprotein G of viral haemorrhagic septicaemia virus (VHSV), a Novirhabdovirus; and the C coat protein of viral nervous necrosis virus (VNNV), a Betanodavirus) were produced as nanostructured biomaterials with view to use in orally delivered prophylaxis. The NanoPellets were successfully taken up in vitro in Zebra Fish Liver Cell Line (ZFL) and in vivo in zebrafish (Danio rerio) via oral administration. They stimulated an antiviral innate immune response both in ZFL and rainbow trout (Oncorhynchus mykiss) head kidney macrophage cell cultures (RT-HKM) cells. Being therefore candidates for immunostimulants (see Thwaite R, Ji J, Torrealba 0, Col/ J, Sabes M, Villaverde A and Roher N (2018) Protein Nanoparticles Made of Recombinant Viral Antigens: A Promising Biomaterial for Oral Delivery of Fish Prophylactics. Front. Immunol. 9:1652. https://doi.orq/10.3389/fimmu.2018, 01652).
All in all, NanoPellets present two main characteristics that makes them a very promising administration strategy for oral and immersion vaccine development for fish and shellfish as they protect the subunits from their high susceptibility to degradation and contain contaminants (in very small amounts) such as endotoxin, nucleic acids or peptidoglycans that can in turn work also as immunostimulators because all of them are well known PAMPs, that the immune system utilizes to recognize pathogens via pattern recognition receptors.
But, despite the intrinsic presence of PAMPs, additional adjuvants with co-stimulatory activity to enhance the magnitude of the immune response are required.
Therefore, there is still a need for enhancing the viral antigen protein nanostructure inclusion bodies prophylactic potential.
Summary of Invention
Inventors have surprisingly found that a particular fusion polypeptide including an antigenic protein module and in-vaccine adjuvant in the same sequence which surprisingly allowed to obtain a functional and stable active system for the oral immunization of fishes or teleost and certain crustacean.
A common feature of anti-viral responses against different virus is the release of interferons (IFNs). And IFNs are known to be pivotal to mount an antiviral defense both in innate and adaptive immunity against virus, in particular, IFN gamma is especially important in potentiating the antiviral defenses. Although IFNs can be used for treatment of different diseases, their stability remained the main obstacle that hindered the utilization of recombinant proteins as therapeutics. IFNs failed to show the expected bioactivity in vivo due to degradation, and also to the tendency to aggregate irreversibly under mild denaturing conditions. Additional studies with recombinant IFNs administration to fish by oral or immersion route failed, due to their extreme
lability, in the induction of the expression of Mx proteins, which are the only IFN-induced proteins known to posse antiviral properties. Mx proteins are dynamin-like large GTPases, and GTPase activity is required for their antiviral activity. MxA recognizes incoming viral proteins as well as newly synthesized viral proteins in the cytoplasm of infected cells and inhibits transport of viral proteins into the nucleus, thus blocking early steps in the viral life cycle.
Surprisingly, the inventors found that nanostructured polypeptides including IFN combined with an antigenic module remained stable and functional even under the harshest conditions of pH and temperature.
Thus, a first aspect of the invention is a polypeptide comprising the amino acid sequence of an interferon or a fragment thereof, the amino acid sequence of a viral antigen or a fragment thereof and, optionally, a linker between them.
As indicated above, and as will be illustrated in the examens below, one or more polypeptides could be nanostructured, forming a NanoPellet, presenting surprisingly high stability, even in harsh conditions, of both the antigenic module (i.e., viral antigen or fragment thereof) and the in-vaccine adjuvant (i.e., interferon or fragment thereof), and they showed enhanced immunogenic activity. This is a great advance as improves the potential of the NanoPellets administration approach, showing their high versatility and that they could include other modules such as ligands for specific molecules or receptors, that would provide a plethora of extra functions to the recombinant antigenic protein.
However, despite the advantages of the nanopellets, spontaneous structuration is an empiric process not always successful or possible. As it is explained in the examples, several constructs are not successfully structured as nanopellets. For example, IFN alone is not successfully structured as nanopellet.
Surprisingly, the inventors found that polypeptides including IFN and an antigenic module were indeed successfully structured as nanopellets. And, even more surprising and as shown in the examples, the yield of production of such polypeptides was greater than polypeptides only including the antigenic module.
Additionally advantageous and surprising is the fact that said nanopellets remained stable and functional. Particularly surprising is the stability and functionality of interferon.
And even more surprising is the maintenance of stability and functionality of both the nanopellet and the interferon included in said nanopellet even under harshest conditions of pH and temperature.
Such resistance to harsh conditions is crucial and a main advantage of the invention. From one side for the above explained need of resistance to the low pH of gastrointestinal systems; and from another side for the need of resistance to the conditions of industrial food or feed manufacturing processes, in particular for the resistance to high temperatures applied during the extrusion process.
Thus, in a second aspect, the invention relates to a protein NanoPellet comprising one or more of the polypeptides as defined in the first aspect, and with a particle diameter from 400 nm to 1500 nm, measured by
electron microscopy.
In other words, the second aspect of the invention refers to a protein nanopellet comprising one or more polypeptides comprising the amino acid sequence of an interferon or a fragment thereof, the amino acid sequence of a viral antigen or a fragment thereof and, optionally, a linker between them; and with a particle diameter from 400 nm to 1500 nm, measured by electron microscopy.
As shown in the examples, the inventors found that nanopellets, containing the polypeptides defined in the first aspect, administered by immersion were efficiently uptake by zebrafish larvae cells and elicited a strong antiviral response. Therefore, due to the capability of promoting an enhanced immunogenic reaction, the polypeptide as well as the protein NanoPellet are used in immunogenic compositions.
Thus, a third aspect of the invention is an immunogenic composition comprising one or more polypeptides as defined in the first aspect, and/or the protein nanopellet as defined in the second aspect.
The inventors vaccinated adult zebrafish with the nanopellets as defined in the second aspect and infected the animals with spring viremia carp virus. The results surprisingly showed excellent levels of survival compared with non-vaccinated and control fish, and the degrees of protection were even different from previous attempts using a DNA vaccine engineered with a plasmid that drives the expression of the SVCV-G protein.
Thus, a fourth aspect of the invention is a vaccine comprising the immunogenic composition as defined above, and a pharmaceutically acceptable excipient and/or carrier.
A fifth aspect of the invention is a polypeptide as defined in the first aspect and/or the protein nanopellet as defined in the second aspect, and/or the immunogenic composition as defined in the third aspect, and/or the vaccine as defined in the fourth aspect, for use in therapy. In other words, they are for use as a medicament.
Another (sixth) aspect of the invention is a food composition comprising a polypeptide, and/or a protein nanopellet, and/or the immunogenic composition, and/or the vaccine, as defined above. The food composition comprises at least one edible ingredient.
The invention also provides as an additional aspect a polynucleotide encoding the polypeptide as defined in the first aspect.
Also herewith disclosed is a vector comprising the polynucleotide encoding the polypeptide as defined in the first aspect.
Yet another aspect is a cell system comprising the polypeptide and/or the vector, both as defined above.
More precisely, the invention provides a host cell which is transformed or transfected with the polynucleotide and/or the vector as defined above, and it also provides a cell culture comprising said host cell.
Brief Description of Drawings
Figure 1A. Characterization of nanostructured SVCVNP proteins, (i) Field Emission Scanning Electron Microscopy images (FESEM). The scale line reference's units are micrometers (pm).
Size distribution histograms (n=60) of length (x-axis represents the length in micrometers (pm)) (ii) and width (x-axis represents the width in micrometers (pm)) (iii) measurements of SVCVNP. As used in the present application, "Fig.” stands for "Figure”.
Figure 1 B. Characterization of nanostructured SVCV-IFNNP proteins, (i) Field Emission Scanning Electron Microscopy images (FESEM). The scale line reference's units are micrometers (pm).
Size distribution histograms measurements of SVCV-IFNNP (n=60): of (ii) length (x-axis represents the length in micrometers (pm)); and (iii) width (x-axis represents the width in micrometers (pm)) (iii).
Figure 2. Uptake of SVCV and SVCV-IFN nanopellets by ZFL cells. (A) SVCVNP dose response (x-axis represents Dose in pg/ml; left y-axis represents percentage of Fluorescent cells (%); right y-axis represents Mean Fluorescent Intensity (MFI); “C” stands for Control); (B) SVCV time course (x-axis represents Time in hours (h); left y-axis represents percentage of Fluorescent cells (%); right y-axis represents Mean Fluorescent Intensity (MFI); "ns” stands for Non-Significant; “C” stands for Control); (C) SVCV-IFNNP dose response (x-axis represents Dose in pg/ml (h); left y-axis represents percentage of Fluorescent cells (%); right y-axis represents Mean Fluorescent Intensity (MFI); “C” stands for Control);; (D) SVCV-IFNNP time course (x-axis represents Time in hours (h); left y-axis represents percentage of Fluorescent cells (%); right y-axis represents Mean Fluorescent Intensity (MFI); "ns” stands for Non-Significant; “C” stands for Control); and (E) Comparative uptake of SVCVNP and SVCV-IFNNP at 10 pg/ml for 12 h (left y-axis represents percentage of Fluorescent cells (%); right y-axis represents Mean Fluorescent Intensity (MFI); "ns” stands for Nonsignificant; “C” stands for Control). For dose response assays 2.5 - 40 pg/ml of fluorescently labeled SVCV and SVCV-IFN were added to ZFL cells and incubated for 12 h and the uptake evaluated by cytometry. For time course 10 pg/ml of fluorescently labeled SVCV and SVCV-IFN were added to ZFL cells and incubated for 12 and 24 h. Differences between means were analyzed by a one-way ANOVA with Dunnett's multiple comparisons test, treatments versus control. Significance levels *p < 0.05; **p < 0.01 ; ***p < 0.001 ; ****p < 0.0001.
Figure 3. Gene expression analysis of ZFL treated with SVCVNP and SVCV-IFNNP: (A) vig1 , (B) mx, (C) ifngrl , (D) Imp2, and (E) ccl4. ZFL cells were incubated as follow: unstimulated control cells, 10 pg/ml of Poly(l:C) and LPS, 10 pg/ml of SVCV, 10 pg/ml of SVCV-IFN and 10 pg/ml of near-infrared fluorescent protein (from now on: iRFPNP) as immunogenically irrelevant control. Data are mean ± SD (n=6). Statistical differences
between treatments and controls were analyzed by unpair non parametric Mann- Whitney test. Significance levels *p < 0.05; **p < 0.01. CT stands for Control. Poly(l:C) means Polyinosinic:polycytidylic acid. The y-axis represents the Relative Expression.
Figure 4. Biodistribution in vivo in zebrafish larvae. (A) Control, (B) SVCVNP, and (C) SVCV-IFNNP. Uptake in larvae. Zebrafish larvae (3 dpf) were immersed with 10 pig/ml of fluorescent SVCVNP and SVCV-IFNNP for 48 h. E3 medium with PBS were used as control, (i) Transmitted image, (ii) fluorescent image and (iii) merged image. G stands for Gastrointestinal tract. P stands for Pancreas.
Figure 5. SVCVNP and SVCV-IFNNP administration protects from SVC virus in vivo Infection.
(A) Representative fish images of SVC virus clinical signs.
(B) Cumulative mortality rate of zebrafish after SVCV challenge. Fish were vaccinated with 5 pig/fish of different antigens (iRFPNP, SVCVNP, SVCV-IFNNP) by intraperitoneal injection. Thirty days post-vaccination fish were challenged with SVCV (4 x 104 TCID50/ml). Number of dead fish in each group was counted daily. The x-axis represents the days after trials. The y-axis represents the cumulative mortality (%). The line of squares represents the control SVCV; the line of circles represents the iRF PNP; the filled triangles line represents the SVCVNP; the empty inverted triangles line represents the SVCV-IFNNP.
Figure 6. Detection of antigen in vaccinal feed. Western Blot with an anti-His-tag antibody to detect VHSV- I FNNP after feed manufacturing by extrusion and final delipidation and NaOH extraction. A is the lane loaded with a total protein of 25 pig. B is the lane loaded with a total protein of 50 pig.
Figure 7. Levels of protection conferred by the NPs vaccinal feed.
(A) Cumulative mortality of VHSV Infected rainbow trout after in-feed vaccination. Squares line refers to rainbow trout fed with iRFPNP. Triangles line refers to rainbow trout fed with VHSV-IFNNP (SEQ ID NO: 16). Fish injected with medium were used as the control (circles line). The x-axis refers to days post-challenge. The y-axis refers to the percentage of cumulative mortality.
SEQ ID NO: 16 is
AQFTSINMKRNIDKLKVHYKISKDQLFNGNPVFPKDTFEDSEQRVLMSWLDVYLSIFGQMLNQTGDQEMIESL KYVKGKIQDLQKHYFLGRIPELRTHLQNLWAIETSDTTVQGKALSEFITIYEKASKLALKFHLKKDNRRKRRQAQ RLKSHIMGGSSRSSTVTFCGTEWIKTDLGDLIQVTGPGGTRKLTPNKCVNTDIQMRGATDDFSYLNHLITNMA QRTECLDAHSDITASGKVSSFLLSKFRPSHPGPGKAHYLLDGQIMRGDCDYEAWSINYNRAQYKTMNNTWK SWKRVDNNTDGYDGMIFGDKLIIPDIEKYQSVYDSGMLVQRNLVEVPHLSIVFVSNTSDLSTNHIHTHHHHHH.
(B) Neutralizing activity of sera dilutions (1 :25 to 1 :1250) of rainbow trout immunized with VHSV-IFNNP. Bars represent the average values and standard deviations (n=8). Black columns represent Control. Striped columns represent iRFPNP. White columns represent VHSV-IFNNP. The X axis represents sera dilution. As shown in the x axis, "N Ab” stands for "Neutralizing Antibody”. The Y axis represents the focus forming units (FFUs). Significance levels ns: no significant; *p < 0.1 ; **p < 0.05; ***p < 0.01.
Figure 8. Characterization of nanostructured VHSV-IFNNP protein at low pH and high temperature.
Field Emission Scanning Electron Microscopy images (FESEM) of three different conditions: (Fig 8AI) VHSV- I FNNP control, (Fig 8BI) VHSV-IFNNP incubated at pH 2 and (Fig 8CI) VHSV-IFNNP at 100°C. The scale line reference's units are micrometers (pm).
Figures 8AII, 8BII, and 8CI I and 8AIII, 8BIII and 8CIII respectively refers to the corresponding size distribution histograms (n = 60) for length (8AII, 8BII and 8CII figures respectively for VHSV-IFNNP control, incubated at pH 2, and incubated at 100°C) and width (same correspondence for 8AIII, 8BIII and 8CIII figures). The x-axis respectively refers to length and width in nanometers (nm). The y axis refers to frequency.
Figure 9. VHSV-IFNNP vaccine administered via intubation.
(A) Presence of specific anti-VHSV IgM, in untreated control (represented with a diamond), VHSV-IFNNP vaccinated (represented by a circle), IRFPNP vaccinated (represented by a square), PBS control (represented by a triangle), and VHSV infection survival fish positive control (represented by an inverted triangle). Data are mean ± SD (n = 5). The X axis represents the inverse of sera dilution. The Y axis represents mean absorbance (Abs) read at 450 nanometers. Different letters (a, b and c) indicate significant differences.
(B) Neutralizing capacity of sera diluted at 1 :50 of rainbow trout immunized with VHSV-IFNNP. The y axis represents the focus forming units (FFFUs). Significance levels: ns, non significant; *p < 0.1 ; **p < 0.05; ***p < 0.01.
Figure 10. Field Emission Scanning Electron Microscopy images (FESEM) of IL-6 (A) and LCDV (B). The scale line reference's units are micrometers (pm)
Figure 11 . FESEM of zebrafish I FNy. The scale line reference's units are micrometers (pm)
Figure 12. Field Emission Scanning Electron Microscopy images (FESEM) of three different conditions: (Fig 12AI) SVCV-IFNNP control, (Fig 12BI) SVCV-IFNNP incubated at pH 2, (Fig 12CI) SVCV-IFNNP incubated at pH 10 and (Fig 12DI) SVCV-IFNNP at 100°C. The scale line reference's units are micrometers (pm).
Figures 12AII, 12BII, 12CII and 12DII and 12AIII, 12BIII, 12CIII and 12DIII respectively refers to the corresponding size distribution histograms (n = 60) for length (12AII, 12BII, 12CII and 12DII figures respectively for VHSV-IFNNP control, incubated at pH 2, incubated at pH 10 and incubated at 100°C) and width (same correspondence for 12Aiii, 12Biii, 12Ciii and 12Diii figures). The x-axis respectively refers to length and width in nanometers (nm). The y axis refers to frequency.
Detailed description of the invention
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of skill in the art to which this invention belongs at the time of filling. However, in the event of any latent ambiguity, definitions provided herein take precedent over any dictionary or extrinsic
definition. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular.
As used herein, the indefinite articles "a” and "an” are synonymous with "at least one” or "one or more.” Unless indicated otherwise, definite articles used herein, such as "the” also include the plural of the noun.
A "polypeptide” is a chain of amino acids linked by a peptide bond (i.e., amide bonds) including from more than 10 amino acids. They are biological polymers and are called "proteins” when the number of amino acid residues is over 50 amino acids. As the skilled person will know, they can be obtained by synthetic routes, for example by solid-phase peptide synthesis on a rink amide resin using Fmoc-o-amine-protected amino acid. They can also be obtained from the recombinant gene technology, through genetic engineering of a fusion gene. This typically involves removing the stop codon from a cDNA sequence coding for the first protein, then appending the cDNA sequence of the second protein in frame through ligation or overlap extension PCR. That DNA sequence will then be expressed by a cell as a single protein. The protein can be engineered to include the full sequence of both original proteins, or only a portion of either. If the two entities are proteins, often linker (or "spacer") peptides are also added, which make it more likely that the proteins fold independently and behave as expected. Translation of this fusion gene results in a single or multiple polypeptides with functional properties derived from each of the original proteins. For "polypeptide” in this description is also to be understood a molecule of peptide/protein nature comprising two independent polypeptides coded for different or the same genes that are linked by a linker molecule other than a peptide. In this later scenario the compound of formula (I) or formula (II) is still considered a polypeptide that could also be referred as a conjugate of formula (I) or formula (II), or as a compound of formula (I) or formula (II).
A "polynucleotide” is to be understood as a nucleic acid molecule (DNA or RNA) comprising deoxyribonucleotides or ribonucleotides. Nucleic acid can be single or double stranded, and it includes, but it is not limited to, nucleotide sequences coding for polypeptides. In this description, polynucleotides used for the obtaining of the polypeptides by recombinant technology have a varying length depending on the construct. They have a length from at least 1000 nt nucleotides up to 4000 nt, and the mean of sizes of different constructs is 2000 nt.
When the polynucleotides are fusion genes, they are also known as "gene constructs” A "gene construct” according to the invention can also be named as an "expression cassette”. It refers to a polynucleotide sequence including in turn a sequence coding for a protein of interest, which is operatively linked to an expression promoter, said promoter controlling expression of the sequence coding for the protein. For "operatively linked” is to be understood that the sequence coding for the protein is disposed after the sequence of the promoter (in the 5'-3' direction), or near the promoter in case restriction sites are included, or other stabilizing elements of the gene construction are present. The gene constructs (expression cassette) may also comprise small fragments with useful sequences to adapt it to more complex expression systems (vectors, plasmids), or a polyadenylation tail disposed after the sequence coding for the protein of interest. The expression cassette itself is also an expression system, being vectors or plasmids further used to protect
the gene construct, or to promote entrance to cells in case of viral vectors. The "promoters” are of DNA regions that initiate transcription of a particular genes. Promoters are located near the transcription start sites of genes, on the same strand and upstream on the DNA (towards the 5' region of the sense strand). Promoters can be about 100-1000 base pairs long. A "constitutive promoter” is a promoter that is active in all circumstances in the cell, contrary to others that are regulated, becoming active in the cell only in response to specific stimuli, such as "inducible promoters”. For the efficient expression of the polypeptide codified by the polynucleotide, the latter is inserted in a vector, which is a DNA molecule used as a vehicle to artificially carry foreign genetic material into another cell, where it can be replicated and/or expressed (e.g., plasmid, cosmid, Lambda phages). A vector containing foreign DNA is termed recombinant DNA. The four major types of vectors are plasmids, viral vectors, cosmids, and artificial chromosomes. These vectors may carry elements (sequences) the skilled person will know aiding in the expression and stability of the expressed sequence, as well as tags or labels to purify the recombinant expressed polypeptide. The vectors are transfected to appropriate cell systems (host cells), which by means of their replicative and expression biochemical machinery will allow the obtaining of the recombinant polypeptide.
The term "nanopellet” (usually written as NanoPellet and abbreviated NP) or "nanoparticle” as used herein, refers generally to a particle with at least two dimensions at the nanoscale, particularly with all three dimensions at the nanoscale (1-1000 nm), although few micras are also to be considered within the nanoscale (1-1200 nm). As regards the shape (i.e., morphology) of the nanoparticles/nanopellets described herein, there are included particles with an ellipsoid shape, spheres. In a particular embodiment the nanoparticle is an ellipsoid. As used herein, the term "size" refers to a characteristic physical dimension. For example, in the case of a nanoparticle that is substantially spherical, the size of the nanoparticle corresponds to the diameter of the nanoparticle. When referring to a set of nanoparticles as being of a particular size, it is contemplated that the set of nanoparticles can have a distribution of sizes around the specified size. Thus, as used herein, a size of a set of nanoparticles can refer to a mode of a distribution of sizes, such as a peak size of the distribution of sizes. In addition, when not perfectly spherical, such as an ellipsoid, the diameter is the equivalent diameter of the spherical body including the object. When in this description the diameter or any physical dimension (i.e., width and length and high) of the nanoparticle/nanopellet is mentioned, it relates to dimension measured by Electron Microscopy, in particular Field Emission Scanning Electron Microscopy images (FESEM). As indicated above, the term "nanopellets” was coined for nanostructured viral antigens as inclusion bodies. Therefore, in the context of the invention, the term "inclusion body” (or "IB”) is also suitable instead of nanopellet, i.e. they are interchangeable.
The term "food composition” or "food product” is used herein in its broadest meaning, including any type of product, in any form of presentation, which can be ingested by an animal, including humans. In particular it includes the common food that is used to feed aquatic animals, in particular fish or teleost and crustacean. An example of a fish diets are dry pellets made of 70% vegetable constituents and 30% marine raw matters such as fishmeal and fish oil. The fish feed contains vegetable components originating from plants such as soy, corn, rapeseed, sunflowers, broad beans, and wheat, which serve as proteins, carbohydrates, and fat
sources. Other marine ingredients, such as fishmeal and fish oil are made from byproducts of the seafood processing industry that are not suitable for human consumption.
As used herein, the term "immunogenic" or "immunological composition” refers to material which elicits an immunological response in the host of a cellular or antibody-mediated immune response type to the composition upon administration to a vertebrate, including humans. The immunogenic composition comprises molecules with antigenic properties, such as immunogenic polypeptides. An immunogenic polypeptide is generally referred to as antigenic. A molecule is "antigenic" when it is capable of specifically interacting with an antigen recognition molecule of the immune system, such as an immunoglobulin (antibody) or T cell antigen receptor. An antigenic polypeptide contains an epitope of at least about five, and particularly at least about 10, at least 15, at least 20 or at least 50 amino acids. An antigenic portion of a polypeptide, also referred to as an epitope, can be that portion that is immunodominant for antibody or T cell receptor recognition, or it can be a portion used to generate an antibody to the molecule by conjugating the antigenic portion to a carrier polypeptide for immunization. The immunogenic composition relates according to this description, to the active molecule, composition comprising said molecule, or composition comprising more than one antigenic molecule to which a particular immune reaction is desired.
The term "antigen" refers to a molecule against which a subject can initiate an immune response, e.g., a humoral and/or cellular immune response. Depending on the intended function of the composition, one or more antigens may be included.
In the sense of the present disclosure, the term "fragment thereof' refers to fragment or fragments that maintain the activity of the polypeptide from which they derive, for example, fragments with interferon activity as in-vaccine adjuvant or fragments with immunogenicity of the viral antigen
As for the expression "immunologically effective amount," or "immunologically effective dose” means the administration of that amount or dose of antigen, either in a single dose or as part of a series, that elicits, or is able to elicit, an immune response that reduces the incidence of or lessens the severity of Infection or incident of disease in an animal for either the treatment or prevention of disease. The immunologically effective amount or effective dose is also able for inducing the production of antibody for either the treatment or prevention of disease. This amount will vary depending upon a variety of factors, including the physical condition of the subject, and can be readily determined by someone of skill in the art.
The term "medicament” as used herein is synonymous of a pharmaceutical or veterinary drug (also referred to as medicine, medication, or simply drug) use to cure, treat, or prevent disease in animals, including humans, as widely accepted. Drugs are classified in various ways. One key distinction is between traditional smallmolecule drugs, usually derived from chemical synthesis, and biopharmaceuticals, which include recombinant proteins, vaccines, blood products used therapeutically (such as Intravenous Immunoglobulin (IVIG)), gene therapy, monoclonal antibodies and cell therapy (for instance, stem-cell therapies). In the present invention
medicament preferably is a veterinary medicament, and even more preferably is a vaccine for veterinary use.
The term "vaccine" as used herein, means an immunogenic composition of the invention accompanied by adequate excipients and/or carriers, that when administered to an animal, elicits, or is able to elicit, directly or indirectly, an immune response in the animal. Particularly, the vaccines of the present invention elicit an immunological response in the host of a cellular or antibody-mediated type upon administration to the subject that it is protective. The term "oral vaccine” means that the vaccine is in particular appropriated for oral administration, thus including the galenic for being stable and to deliver the immunogenic composition at the desired place and in an adequate conformation to induce the immunological reaction.
The term "carrier" is to be understood as a pharmaceutically acceptable component other than the immunogenic component. The carrier can be organic, inorganic, or both. Suitable carriers well known to those of skill in the art and include, without limitation, large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, lipid aggregates (such as oil droplets or liposomes) and inactive virus particles.
The expression "pharmaceutically acceptable excipients or carriers" refers to pharmaceutically acceptable materials, compositions or vehicles. Each component must be pharmaceutically acceptable in the sense of being compatible with the other ingredients of the pharmaceutical composition. It must also be suitable for use in contact with the tissue or organ of humans and animals without excessive toxicity, irritation, allergic response, immunogenicity or other problems or complications commensurate with a reasonable benefit/risk ratio.
As above exposed, the inventors propose for the first time a fusion polypeptide comprising at least a viral antigenic module and an interferon module, and an immunogenic composition and/or vaccine comprising said fusion polypeptide, for use as a medicament in fish or teleost and certain crustaceans.
All particular embodiments for the fusion polypeptide for use as a medicament disclosed herewith apply also to the immunogenic composition and/or the vaccine for use as a medicament comprising said fusion polypeptide.
As previously indicated, a first aspect of the invention is a polypeptide comprising the amino acid sequence of an interferon or a fragment thereof, the amino acid sequence of a viral antigen or a fragment thereof and, optionally, a linker between them.
In a particular embodiment of the first aspect the polypeptide has formula (I):
R1-(L)n-R2 (I) wherein:
n is an integer selected from 0 or 1;
R1 , which is at the N-terminal end of the polypeptide, comprises the amino acid sequence of an interferon or a fragment thereof;
L is a linker; and
R2, which is at the C-terminal end of the polypeptide, comprises the amino acid sequence of a viral antigen or a fragment thereof.
In other words, the polypeptide can be defined as having formula (I)
R1-(L)n-R2 (I) wherein: n is an integer selected from 0 or 1;
R1 , which is at the N-terminal end of the polypeptide, is an in-vaccine adjuvant;
L is a peptide linker; and
R2, which is at the C-terminal end of the polypeptide, is an antigenic protein module.
In fact, the polypeptide can be upside down. I.e. the antigenic protein module can be at the N-terminal end of the polypeptide and the in-vaccine adjuvant in the C-terminal end of the polypeptide.
Thus, in another particular embodiment of the first aspect the polypeptide has formula (II):
R2-(L)n-R1 (II) wherein: n is an integer selected from 0 or 1;
R2, which is at the N-terminal end of the polypeptide, comprises the amino acid sequence of a viral antigen or a fragment thereof;
L is a linker; and
R1 , which is at the C-terminal end of the polypeptide, comprises the amino acid sequence of an interferon or a fragment thereof.
In other words, the polypeptide can be defined as having formula (II)
R2-(L)n-R1 (II) wherein: n is an integer selected from 0 or 1;
R2, which is at the N-terminal end of the polypeptide, is an antigenic protein module;
L is a peptide linker; and
R1 , which is at the C-terminal end of the polypeptide, is an in-vaccine adjuvant.
The expression "the polypeptide has formula (I)” (or formula (II)) is understood as "the polypeptide comprises or consists of formula (I)” (or formula (II)). More in particular, it is understood as "the polypeptide consists of formula (I)” (or formula (II)).
Thus, these polypeptides of formula (I) and (II) are, in certain embodiments, a fusion protein.
In a particular embodiment of the first aspect, the polypeptide is one in which R2 comprises the amino acid sequence of a viral antigen of a virus causing disease in aquatic animals selected from fish or teleost and crustacean. More in particular, fish or teleost and crustacean selected from the group consisting of Salmonids, turbot, carp, cyprinids, seabass, common sole, turbot, barramundi, Seabream and prawns.
In another particular embodiment, the polypeptide is one in which R2 comprises the amino acid sequence of a viral antigen of a virus causing disease. In particular, said virus selected from the group of Infectious Pancreatic Necrosis Virus (IPNV), Viral Hemorrhagic Septicemia Virus (VHSV), Viral Nervous Necrosis Virus (VNNV) or its specific serotype Red-spotted Grouper Nervous Necrosis Virus/Striped Jack Nervous Necrosis Virus (RGNNV/SJNNV), Lymphocystis Disease Virus (LCDV) and Spring Viraemia of Carp Virus (SVCV).
In particular, said viral antigen is a viral protein or a fragment thereof selected from the group of glycoproteins, capsid proteins, major capsid proteins or fragments thereof. Thus, it is a protein or fragment capable of causing immune reaction.
In a more particular embodiment, the virus causing disease is Spring Viremia Carp Virus. And in particular, the antigen module of said virus contained in the polypeptide of the first aspect is the G3 region of the Glycoprotein G of said virus.
In another particular embodiment, of the first aspect the polypeptide is one in which R2 comprises SEQ ID NO: 1 or a sequence at least 85%, or at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% identical to SEQ ID NO: 1 .
In another particular embodiment of the first aspect, the polypeptide is one in which R2 consists of SEQ ID NO: 1.
In a more particular embodiment, the virus causing disease is Viral Hemorrhagic Septicemia Virus. And in particular, the antigen module of said virus contained in the polypeptide of the first aspect is the fragment 16 of the Glycoprotein G of said virus.
In another particular embodiment, of the first aspect the polypeptide is one in which R2 comprises SEQ ID NO: 5 or a sequence at least 85%, or at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% identical to SEQ ID NO: 5.
In another particular embodiment of the first aspect, the polypeptide is one in which R2 consists of SEQ ID NO: 5. In a more particular embodiment, the virus causing disease is Viral Nervous Necrosis Virus. And in particular, the antigen module of said virus contained in the polypeptide of the first aspect is a fragment of the coat protein gene of said virus. In a more particular embodiment the coat protein gene is from the Iberian betanodavirus isolate (strain SpSs-IAuscl60.03), which is a reassortant RGNNV/SJNNV strain. In another particular embodiment, of the first aspect the polypeptide is one in which R2 comprises SEQ ID NO: 6 or a sequence at least 85%, or at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% identical to SEQ ID NO: 6.
In another particular embodiment of the first aspect, the polypeptide is one in which R2 consists in SEQ ID NO: 6.
The amino acid sequences of viral antigens of particular embodiments of all the aspects of the invention are given in Table 1 :
In another particular embodiment of the first aspect, the polypeptide is one in which R1 comprises the amino acid sequence of an interferon or a fragment thereof of an animal species selected from fish or teleost and crustacean, the interferon selected from the group consisting of interferons Type I and Type II.
Particularly, the interferon or a fragment thereof is of fish and/or crustacean selected from the group consisting of Salmonids, turbot, carp, cyprinids, seabass, common sole, turbot, barramundi, Seabream and/or prawns.
And in a particular embodiment, the interferon or a fragment thereof from the above embodiment is selected from the Type II interferon group.
In a more particular embodiment, the polypeptide is one in which R1 comprises the amino acid sequence or a fragment thereof of the interferon y (gamma).
In a more particular embodiment, the interferon or fragment thereof is selected from the group of Trout interferon y, Turbot interferon y, Seabream interferon, Seabass interferon y, zebra fish and/or carp interferon
Yet in a more particular embodiment, the interferon y or a fragment thereof is the zebrafish or carp interferon
Y
In another particular embodiment, the polypeptide is one in which R1 comprises SEQ ID NO: 2 or a sequence at least 85%, or at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least
99% identical to SEQ ID NO: 2.
In another particular embodiment of the first aspect, the polypeptide is one in which R1 consists in SEQ ID NO: 2.
The amino acid sequences of interferon or fragments thereof of all the aspects of the invention are given in Table 2:
In a particular embodiment, the IFN gamma 1 from D. rerio (27-175) as defined in Table 2 is also useful for other cyprinids species. In a particular embodiment, for Cyprinus carpio.
In a particular embodiment, the trout I FNy (25-180) as defined in Table 2, is also useful for other salmonid species. In a particular embodiment, for Salmo salar.
In another particular embodiment, the polypeptide is one in which “n” is 1 , and the linker L is selected from a
peptide with a length from 2 to 15 amino acids.
In a particular embodiment, the peptide length is any selected from 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15.
In another particular embodiment, the polypeptide is one in which the linker L is a peptide comprising or consisting in SEQ ID NO: 3.
The amino acid sequence of the linker is given in T able 3:
Linkers of different nature would also work as long as the spatial distribution of the linker set forth in SEQ ID No. 3 is maintained.
In another particular embodiment, the linker L is selected from the group of consisting of the above-indicated peptides, PEGs, other polymeric compounds (such as nucleic acids, polylactide acid, polycaprolactones, polyvynilsuccinates, polyhidroxybutirates). Even in the case the linker (L) is not of peptide nature, the compound of formula (I) or formula (II) is still considered a polypeptide according to this description, although in such a case it could also be referred as a conjugate of formula (I) or formula (II).
Independently of the nature of the linker (L), when present in formula (I) or formula (II), it allows the spatial disposition that makes R1 and R2 more visible to the immune system (i.e., spatially disposed to allow a response of the immune system). Alternatively, when the linker L is absent (n=0), the protein nature of R1 and R2 also allows the activation of the immune system when administered to an animal.
As mentioned above the invention provides a polynucleotide which encodes the compound as defined in the first aspect. In a particular embodiment of the polynucleotide, optionally in combination with any of the embodiments provided above and below, the polynucleotide is DNA or RNA.
As mentioned before, the invention also provides a vector comprising the polynucleotide as disclosed above. Examples of suitable vectors include those conventionally used in biomedicine and known to the skilled person.
As mentioned above, the invention also provides a cell system which is transformed or transfected with the polynucleotide or the vector of the invention. More precisely, the invention provides a host cell which is transformed or transfected with the polynucleotide and/or the vector as defined above, and it also provides a cell culture comprising said host cell. The skilled person would know which host cells are suitable for the
synthesis of the protein of the invention.
As mentioned above, in a second aspect, the invention provides a protein nanopellet (i.e., nanoparticle) comprising one or more of the polypeptides defined in the first aspect and with a particle diameter from 400 nm to 1500 nm, measured by electron microscopy.
In other words, the invention provides a protein nanopellet comprising one or more polypeptides comprising the amino acid sequence of an interferon or a fragment thereof, the amino acid sequence of a viral antigen or a fragment thereof and, optionally, a linker between them; and with a particle diameter from 400 nm to 1500 nm, measured by electron microscopy.
The embodiments relating to the polypeptides defined in the first aspect apply for the polypeptides of this second aspect.
In a particular embodiment, the nanopellet is immunogenic.
In a more particular embodiment, the nanopellet is spheroid, and it has a width from 250 nm to 1000 nm, and a length from 500 nm to 1500 nm. The measures of these dimensions obtained, as indicated by EM, in particular by Field emission scanning electron microscopy (FESEM).
In a more particular embodiment, the nanopellet has a width from 500 nm to 750 nm and a length from 750 nm to 1200 nm.
In a more particular embodiment, the nanopellet has a width from 519.1 nm to 728.9 nm and a length from 765.1 nm to 1 198.9 nm.
In a more particular embodiment, the protein nanopellet comprises one or more of endotoxin, nucleic acids or peptidoglycans.
The obtention of the nanopellets is carried out by means of the current recombinant technology and protein expression techniques known by the skilled person in the art.
The invention also contemplates a method for the obtention of a protein nanopellet as defined in the second aspect comprising the following steps:
- Transformation of a host cell with plasmids or vectors comprising a polynucleotide encoding a polypeptide as described in the first aspect, or in any of its embodiments, to obtain a host transformed cell;
- Culture of the host transformed cell in an appropriated culture media;
- Induction of expression of the polypeptide encoded in the polynucleotide, to obtain such a polypeptide in
form of nanopellets; and
- Purification of the polypeptide nanopellets from the cell host culture media.
In a particular embodiment of the process, the host cell (I ,e. , cell system for the production of the nanopellets) is a bacterial cell.
In a more particular embodiment, the cell system for the production of the nanopellets is E. coli bacteria. More in particular it is strain BL21 of E. coli.
In a more particular embodiment of the process, the step of purification is carried out by enzymatic and/or mechanical disruption of the cell host, optionally in presence of a one or more of solvents, detergents, and surfactants, in particular non-ionic surfactants, and protease inhibitors.
The skilled person in the art will know which enzymes, reagents and/or physical means are currently employed for the purification of a compound of interest (i.e., a protein pellet or inclusion body) from a transformed cell culture.
Examples of enzymes include the lysozyme. Examples of physical or mechanical means include centrifugation steps, frozen and thaw cycles.
Examples of non-ionic surfactants include Triton X-100.
Other non-ionic surfactants are food grade non-ionic surfactants, in particular selected from polyglycerol alkyl ethers, glucosyl dialkyl ethers, crownethers, ester-linked surfactants, polyoxyethylene alkyl ethers, Brij, Spans (sorbitan esters) and Tweens (Polysorbates). Food grade means that are compounds useful in the processes for obtaining food without any danger for the final consumers.
The application of a short and simple enzymatic and/or mechanical purification procedure has particular advantages. In fact, not applying chromatographic purification steps minimizes costs and, additionally and importantly: unlike purification of recombinant proteins, such as IFN, for humans, chromatography is not used as bacterial contaminants produced during the purification process, such as lipopolysaccharide (LPS), membrane peptidoglycan (PGN), cell wall fragments, and DNA and RNA in variable amounts, are not toxic or generate adverse effects on the fish, and furthermore add an additional immunostimulatory benefit to the recombinant vaccine. In addition, the mechanical and enzymatic processes ensure that there is no contamination with viable bacterial cells. These features contribute to particular advantages for the vaccine to overstimulate the fish's immune system.
Thus, in a particular embodiment, the step of purification is carried out optionally performing a chromatographic step. In a more particular embodiment, the step of purification is carried out without
performing a chromatographic step.
Thus, in a more particular embodiment, the method comprises the following steps:
- Transformation of a host cell with plasmids or vectors comprising a polynucleotide encoding a polypeptide as described in the first aspect, or in any of its embodiments, to obtain a host transformed cell;
- Culture of the host transformed cell in an appropriated culture media;
- Induction of expression of the polypeptide encoded in the polynucleotide, to obtain such a polypeptide in form of nanopellets; and
- Purification of the polypeptide nanopellets from the cell host culture media, optionally performing a chromatographic step.
Thus, in another particular embodiment, the method comprises the following steps: - Transformation of a host cell with plasmids or vectors comprising a polynucleotide encoding a polypeptide as described in the first aspect, or in any of its embodiments, to obtain a host transformed cell;
- Culture of the host transformed cell in an appropriated culture media;
- Induction of expression of the polypeptide encoded in the polynucleotide, to obtain such a polypeptide in form of nanopellets; and
- Purification of the polypeptide nanopellets from the cell host culture media without performing a chromatographic step.
In even a more particular embodiment the method for obtaining the nanopellets of the invention comprises the following steps:
- Transformation of a host cell, in particular E.coli, with plasmids or vectors comprising a polynucleotide encoding a polypeptide as described in the first aspect, or in any of its embodiments, to obtain a host transformed cell;
- Culture of the host cell in LB medium supplemented with an antibiotic and incubated at a temperature optimal for the host cells, in particular at 37°C, with agitation in particular at 250 rpm until reaching and CD550 of 0.6;
- Induction of expression of the polypeptide encoded in the polynucleotide, to obtain such the polypeptide in form of nanopellets, by addition of an inductor, in particular the isopropyl p-D-thiogalactoside (IPTG), for a predetermined period of time, in particular from 3 to 6 h; and
- Purification of the polypeptide from the cell host culture media through the particular combination of enzymatic and mechanical disruption, said of enzymatic and mechanical disruption comprising: 1) digestion with lysozyme (1 pg/ml) and phenylmethylsulfonyl fluoride (PMSF) (0.4 mM) added to the culture and incubation for 2h-3h at 37°C, under agitation at 250 rpm; 2) Frozen and thawing the cells in the presence of a non-ionic surfactant and incubation for 1 h-2 h under agitation at room temperature (RT); 3) harvesting of the nanopellets by centrifugation and resuspended in Tris buffer; 4) DNAse treatment, for 1 h-2 h at 37°C under
agitation; 5) Optional freeze/thaw cycles to separate any cell and/or cell debris; 6) Centrifugation, in particular at 15000 x g 15 min, to pelletize the nanopellets , which are optionally stored until use (in particular at low temperatures, such as at -80°C).
The invention provides a protein nanopellet obtainable by the method defined in the previous embodiments. All the particular embodiments of the method are applicable to the nanopellets obtainable by means of the same.
As mentioned above, a third aspect of the invention is an immunogenic composition comprising one or more polypeptides as defined in the first aspect, and/or the protein nanopellet as defined in the second aspect.
As mentioned above, a fourth aspect of the invention is a vaccine comprising the immunogenic composition as defined above, and a pharmaceutically acceptable excipient and/or carrier. Thus, the vaccine comprises an immunogenically effective amount of the immunogenic composition.
In a particular embodiment, the vaccine further comprises an adjuvant.
In a more particular embodiment, the vaccine is an oral vaccine.
As mentioned above, the fifth aspect of the invention is a polypeptide as defined in the first aspect and/or the protein nanopellet as defined in the second aspect, and/or the immunogenic composition as defined in the third aspect, and/or the vaccine as defined in the fourth aspect, for use in therapy, that is, as a medicament.
In a particular embodiment, the polypeptide and/or the protein nanopellet, and/or the immunogenic composition, and/or the vaccine as defined above, is for use in the prevention and/or treatment of a viral disease in fish or teleost and crustaceans.
This embodiment can also be formulated as the use of the polypeptide and/or the protein nanopellet, and/or the immunogenic composition, and/or the vaccine as defined above for the manufacture of a medicament, for the treatment and/or prevention of infections or diseases caused by viral diseases in fish or crustacean. This embodiment can also be formulated as a method of immunizing fish or teleost and crustacean in need thereof with an immunologically effective amount of a polypeptide and/or a protein nanopellet, and/or an immunogenic composition, and/or a vaccine as defined above, in particular for treating and/or preventing infections or disease caused by viruses.
In a more particular embodiment, the infections or disease are caused by one or more viruses selected from the group consisting of pancreatic necrosis virus (IPNV), Viral Hemorrhagic Septicemia Virus (VHSV), Viral Nervous Necrosis Virus (VNNV) and Spring Viraemia of Carp Virus (SVCV). More in particular, the infections or disease are caused by SVCV and/or VHSV. More in particular, the infections or diseases are caused by SVCV. More in particular, the infections or diseases are caused by VHSV.
Particularly, the fish or crustacean is selected from the group of Salmonids, turbot, carp, cyprinids, seabass, common sole, turbot, barramundi, Seabream and/or prawns.
More particularly, the polypeptide and/or the protein nanopellet, and/or the immunogenic composition, and/or the vaccine is for use in preventing and/or treating SVCV in carp or zebrafish.
In another particular embodiment, the polypeptide and/or the protein nanopellet, and/or the immunogenic composition, and/or the vaccine are for use in preventing and/or treating VHSV in rainbow trout.
The vaccination of fish or teleost and crustacean can be achieved by several means, such as intubation, interperitoneal injection, immersion and oral, among other.
Thus, in a particular embodiment of the invention, the polypeptide as defined in the first aspect and/or the protein nanopellet as defined in the second aspect, and/or the immunogenic composition as defined in the third aspect, and/or the vaccine as defined in the fourth aspect, for use in therapy is administered by a mean selected from the group of intubation, immersion, interperitoneal ly injection and oral administration.
As pointed above, oral administration is highly desirable for therapy and prophylaxis for fish or teleost and crustacean viral diseases, particularly for species with moderate market value and high production. The present invention is a biocompatible, cheap and modular platform that allow the production of recombinant proteins in a highly stable conformation.
Thus, in a particular embodiment of the invention, the polypeptide as defined in the first aspect and/or the protein nanopellet as defined in the second aspect, and/or the immunogenic composition as defined in the third aspect, and/or the vaccine as defined in the fourth aspect, for use in therapy is orally administered.
Another particular embodiment of the invention is a vaccination kit of parts comprising:
(a) an immunogenic composition as defined in the third aspect;
(b) a pharmaceutically acceptable excipient and/or carrier;
(c) optionally an adjuvant; and
(d) optionally instructions for its use.
As mentioned above, the sixth aspect of the invention is a food, a feed, food or feed additive composition comprising a polypeptide, and/or a protein nanopellet, and/or the immunogenic composition, and/or the vaccine, as defined above. The food, feed, food or feed composition, or food or feed additive comprises at least one edible ingredient.
In a particular embodiment of the sixth aspect the at least one edible ingredient is selected from the group of vegetable components, soy, corn, rapeseed, sunflowers, broad beans, wheat, marine ingredients, fishmeal and fish oil.
The invention also provides a method for the obtention of the food, feed, or feed additive composition as defined in the sixth aspect comprising the following steps: a) mixing a polypeptide as defined in the first aspect, or a protein nanopellet as defined in the second aspect, or an immunogenic composition as defined in the third aspect, or a vaccine as defined in the fourth aspect with at least one edible ingredient; b) conditioning the mixture; c) extrusion of the mixture; d) drying of the mixture; e) oiling of the mixture; and f) optionally, packaging of the mixture.
In a more particular embodiment, the step b) is carried out by adding steam while the mixture is mixing. In a more particular embodiment, the mixture in step b) reaches a temperature of 120 to 160 °C. More in particular from 125 to 150 °C. In another particular embodiment, the mixture in step b) reaches a moisture of 15 to 30%. In a more particular embodiment, the mixture in step b) reaches a moisture of 20 to 24%.
In a more particular embodiment, the step c) is carried out at high pressure. The skilled person would be aware of high pressions suitable for extrusion processes. In a more in particular embodiment, the step c) is carried out at a pressure selected from around 2.5 to around 10 MPa. More in particular the pressure is selected from around 6 to around 8 MPa. More in particular, the pressure is of around 7 MPa.
In another particular embodiment, the step c) is carried out at a temperature selected from 0 to 100°C. More in particular, from 30 to 100°C. More in particular the step b) is carried out at around 100 °C. In another particular embodiment the step c) is carried out at around 40 °C.
Moisture refers to the water content, measured and expressed as the wet basis moisture content. It expresses the ratio of the mass of water to the total mass of the substance. In other terms, it is represented by the following Formula III: wet-basis moisture content [%] = (weightwater I weightwet )*100 (III)
Wherein weightwater refers to the weight of water in the wet material; and the weightwet refers to the weight of the wet material. It is expressed in percentage (%),and it can range from 0 to 100 percent. The skilled person knows well established methods for the measurement of moisture in food or feed products.
In a more particular embodiment, the step d) is carried out until a moisture between 0 to 25% is reached.
More in particular it is carried out until a moisture between 5 to 15% is reached. More in particular it is carried out until a moisture between 7 to 10% is reached. More in particular until a moisture of around 7%, or 8%, or 9% or 10% is reached.
In a more particular embodiment, in step e) the mixture is oiled until the fat content of the mixture is at least 10%, 15%, 20%, 25%, 30%, 40% or 45% (weight of fat/weight of the total mixture). In another particular embodiment, step e) is carried out by means of vacuum pressure.
In a particular embodiment, method comprises the following steps:
a) mixing a polypeptide as defined in the first aspect, or a protein nanopellet as defined in the second aspect, or an immunogenic composition as defined in the third aspect, or a vaccine as defined in the fourth aspect with at least one edible ingredient; b) conditioning the mixture by adding steam to the mixture until it reaches a temperature from 120 to 160 °C; c) extrusion of the mixture at a temperature selected from 30 to 100 °C; d) drying of the mixture until a moisture selected from 5 to 15% is reached; e) oiling of the mixture until the fat content of the mixture is from 15 to 40% (w/w); and f) optionally, packaging of the mixture.
In a particular embodiment, the method comprises the following steps: a) mixing a polypeptide as defined in the first aspect, or a protein nanopellet as defined in the second aspect, or an immunogenic composition as defined in the third aspect, or a vaccine as defined in the fourth aspect with at least one edible ingredient; b) conditioning the mixture by adding steam to the mixture until it reaches a temperature from 120 to 160 °C and a moisture from 15 to 30%; c) extrusion of the mixture at a pressure selected from 6 to 8 MPa and at a temperature selected from 30 to 100 °C; d) drying of the mixture until a moisture of around 7 to 9% is reached; e) oiling of the mixture until the fat content of the mixture is from 15 to 40% (w/w) by means of vacuum pressure; and f) optionally, packaging of the mixture.
In a particular embodiment, the method comprises the following steps: a) mixing a polypeptide as defined in the first aspect, or a protein nanopellet as defined in the second aspect, or an immunogenic composition as defined in the third aspect, or a vaccine as defined in the fourth aspect with at least one edible ingredient; b) conditioning the mixture by adding steam to the mixture until it reaches a temperature from 125 to 150 °C and a moisture from 20 to 24%; c) extrusion of the mixture at a pressure of around 7 MPa and at a temperature of around 40 °C; d) drying of the mixture until a moisture of around 8% is reached; e) oiling of the mixture until the fat content of the mixture is from 15 to 40% (w/w) by means of vacuum pressure; and f) optionally, packaging of the mixture.
In a particular embodiment, the method comprises the following steps: a) mixing a polypeptide as defined in the first aspect, or a protein nanopellet as defined in the second aspect, or an immunogenic composition as defined in the third aspect, or a vaccine as defined in the fourth aspect with at least one edible ingredient; b) conditioning the mixture by adding steam to the mixture until it reaches a temperature from 125 to 150 °C
and a moisture from 20 to 24%; c) extrusion of the mixture at a pressure of around 7 MPa and at a temperature of around 100 °C; d) drying of the mixture until a moisture of around 8% is reached; e) oiling of the mixture until the fat content of the mixture is from 15 to 40% (w/w) by means of vacuum pressure; and f) optionally, packaging of the mixture.
The invention also provides a food, feed, or feed additive obtainable by the method defined in the previous embodiments. All the particular embodiments of the method are applicable to the food, feed, or feed additive obtainable by means of the same.
For completeness, the present description is also disclosed in the following numbered embodiments:
1 . A polypeptide comprising the amino acid sequence of an interferon or a fragment thereof, the amino acid sequence of a viral antigen or a fragment thereof and, optionally, a linker between them.
2. The polypeptide according to embodiment 1 , wherein the polypeptide has formula (I):
R1-(L)n-R2 (I) wherein: n is an integer selected from 0 or 1;
R1 , which is at the N-terminal end of the polypeptide, comprises the amino acid sequence of an interferon or a fragment thereof;
L is a linker; and
R2, which is at the C-terminal end of the polypeptide, comprises the amino acid sequence of a viral antigen or a fragment thereof.
3.- The polypeptide according to any one of embodiments 1-2, wherein R2 is the amino acid sequence of a viral antigen of a virus causing disease in aquatic animals selected from fish or teleost and crustacean.
4.- The polypeptide according to any one of embodiments 1-3, wherein R2 the amino acid sequence of a viral antigen of a virus causing disease, said virus selected from Infectious pancreatic necrosis virus (IPNV), Viral Hemorrhagic Septicemia Virus (VHSV), Viral Nervous Necrosis Virus (VNNV) and Spring Viraemia of Carp Virus (SVCV).
5.- The polypeptide according to embodiment 4, wherein the virus is selected from SVCV and VHSV.
6.- The polypeptide according to any one of embodiments 1-5, wherein R2 comprises the amino acid sequence as set forth in SEQ ID NO: 1 , or a sequence at least 85% identical to SEQ ID NO: 1 ; or alternatively wherein R2 comprises the amino acid sequence as set forth in SEQ ID NO: 5, or a sequence at least 85% identical to SEQ ID NO: 5.
7.- The polypeptide according to any one of embodiments 1-6, wherein R1 comprises the amino acid sequence of an interferon or a fragment thereof of an animal species selected from fish or teleost and crustacean, the interferon selected from the group consisting of interferons Type I and Type II.
8.- The polypeptide according to any one of embodiments 1-7, wherein R1 comprises the amino acid
sequence of the interferon gamma-1.
9.- The polypeptide according to any one of embodiments 1-8, wherein R1 comprises the amino acid sequence as set forth in SEQ ID NO: 2 or a sequence at least 85% identical to SEQ ID NO: 2.
10.- The polypeptide according to any one of embodiments 1 -9, wherein n is 1 , and the linker L is a peptide comprising SEQ ID NO: 3 (GGSSRSS).
11 .- A protein nanopellet comprising one or more of the polypeptides as defined in any one of embodiments 1- 10, and with a particle diameter from 400 nm to 1500 nm, measured by electron microscopy.
12.- An immunogenic composition comprising one or more polypeptides as defined in any one of embodiments 1-10, and/or the protein nanopellet as defined in embodiment 11.
13.- A vaccine comprising the immunogenic composition as defined in embodiment 12, and a pharmaceutically acceptable excipient and/or carrier.
14.- A polypeptide as defined in any one of embodiments 1-10, and/or the protein nanopellet as defined in embodiment 11 , and/or the immunogenic composition as defined in embodiment 12, and/or the vaccine as defined in embodiment 13, for use in therapy, in particular, for the prevention and/or treatment of a viral disease.
15.- A food composition comprising a polypeptide as defined in any one of embodiments 1 -10, and/or the protein nanopellet as defined in embodiment 11 , and/or the immunogenic composition as defined in embodiment 12, and/or the vaccine as defined in embodiment 13.
Throughout the description and claims the word "comprise" and variations of the word, are not intended to exclude other technical features, additives, components, or steps. Furthermore, the word "comprise” encompasses the case of "consisting of'. Additional objects, advantages and features of the invention will become apparent to those skilled in the art upon examination of the description or may be learned by practice of the invention. The following examples are provided by way of illustration, and they are not intended to be limiting of the present invention. Furthermore, the present invention covers all possible combinations of particular and preferred embodiments described herein.
Examples
Example 1. Design, Production, and Characterization of Nanostructured Viral Antigenic Proteins Viral Strains and Plasmids
Recombinant SVCV G protein was designed based on the glycoprotein G sequence (G3 region, AA 254-381 , Uniprot acc. no: Q91 DS0 as set forth in SEQ ID NO: 1). Recombinant SVCV G antigen with the interferon gamma module (SVCV-IFN) was based on the sequence of the G3 region (254-381 . SEQ ID NO: 1) linked to the sequence of the IFN gamma 1 from D. rerio (27-175, SEQ ID NO: 2) (NCBI GenBank NP_998029.1 ) . Clones were designed using the ORF and pET22b removing the periplasmic location signal and including a C terminal poly His-tag. Clones were codon optimized for expression in E. coli, synthesized by GeneScript and subcloned into pET22b. Plasmids were transformed into E. coli BL21 (DE3) (Novagen). The red fluorescent protein (RFP), IRFP-His cloned into pET22b (Genscript), was used as a non-relevant control protein.
Production of NPs, Purification, Quantification, and Fluorescent Labeling
Methods for recombinant protein production and characterization were previously reported (Thwaite et al., 2018). Briefly, some modifications were introduced for these particular constructs:
E. coll bearing the plasmids coding for NPs were cultured overnight (O/N) in LB medium (Gibco) with ampicillin (100 pg/ml, Sigma-Aldrich) at 37°C and 250 rpm.
Recombinant protein expression in E. coll was induced with 1 mM Isopropyl p-D-1 -thiogalactopyranoside (IPTG, Panreac) when OD550 nm reached 0.5-0.8, in particular when OD550 reached 0.6. Protein expression was carried out for 4.5 h at 37°C and 250 rpm.
For NPs purification, the cell cultures were subjected to simple enzymatic and mechanical disruption processes (Torrealba, D., et al., 2016a). Lysozyme (1.5 pg/ml, Roche), protease inhibitor complete EDTA- free Tablets (Roche) and phenyl-methanesulfonyl fluoride (PMSF) (0.4 mM, Roche) were added and incubated at 37°C for 2 to 3 h, under shaking (250 rpm). Cultures were then frozen at -80°C overnight (O/N). After thawing, Triton X-100 (Roche) was added (0.2% v/v) and the solution was stirred for 1 h at room temperature (RT). Then, DNase I (1 pg/ml) and MgSO4 (1 mM) were added, and the cultures were incubated for 1 h at 37°C with shaking.
NPs were harvested by centrifugation at 15000 x g, 15 min at 4°C and resuspended in lysis buffer (50 mM Tris HOI pH 8, 100 mM NaCI, 1 mM EDTA) at 1/10 the original culture volume.
Finally, several freeze thaw cycles at -80°C were performed to remove any remaining viable bacteria. Once there was no bacterial growth on the culture plates, the batch was quantified and ready for inclusion in the fish feed. Pellets of purified NPs, named SVCVNP (SEQ ID NO: 13) and SVCV-IFNNP (SEQ ID NO: 14) were stored at -80°C until use. Protein was semi-quantified by western blot using an anti-His-tag antibody (Genscript A00186-100), and the protein concentration was calculated using Image Lab 6.0.1 software (BioRad). For flow cytometry or confocal microscopy, NPs were conjugated with Atto-488 NHS ester (Sigma- Aldrich) according to the manufacturer's instructions. Labeling efficiency was determined with the Nanodrop ND-1000 (Thermo Scientific).
SEQ ID NO: 13 is
VEKTAGTLTTIHDNVPKCVDGTLVSGHRPGLDLIDTVFNLENWEYTLCEGTKRKINKQEKLTSVDLSYLAPRIG GFGSVFRVRNGTLERGSTTYIRIEVEGPIVDSLNGTDPRTNASRVFWDDWELDHHHHHH.
SEQ ID NO: 14 is
SVPENLDKSIEELKAYYIKEDSQLHNAHPIFLRILKDLKVNLEESEQNLLMSIVMDTYSRIFTRMQNDSVDEATK ERLAHVQEHLKKLQESYFPGKSAELRTYAETLWAIKENDPIVQRKALFELKRVYREATLLKNLKNKERKRRQA KGGSSRSSVEKTAGTLTTIHDNVPKCVDGTLVSGHRPGLDLIDTVFNLENWEYTLCEGTKRKINKQEKLTSVD LSYLAPRIGGFGSVFRVRNGTLERGSTTYIRIEVEGPIVDSLNGTDPRTNASRVFWDDWELDHHHHHH.
Characterization of Viral Recombinant Protein NPs
Electron Microscopy was used to determine the external morphology and physical dimensions of the NPs. Samples were prepared by resuspending NPs at 100 pg/ml in mQ water, pipetting 20 pl onto silicon chips, and air-dried O/N. NPs were exposed to different in vitro conditions. For pH, NPs were incubated under gentle
stirring at pH 2 and 10 for 3 h together with a control sample. For temperature, NPs were incubated for 5 min at 100 °C. After incubation all NPs were centrifuged at 10.000 x g for 5 min at 4 °C and resuspended at 10 and 50 pg/ml in phosphate buffered saline (PBS, Sigma-Aldrich) and finally 20 pl were deposited onto silicon chips, and air-dried O/N. Electron microscopy images were taken with a FESEM (Zeiss Merlin) and analyzed using Fiji package (National Institute of Health, USA). At least 60 particles were measured, and size distribution histograms were generated using Past 4.04 software (University of Oslo).
Results
Two different recombinant viral proteins were produced in E. coli as bacterial IBs (i.e., NPs) with moderate to good yields: SVCVNP 0.3 mg/l and SVCV-IFNNP 3.6 mg/l. Expression of recombinant proteins is an empiric process with several experimental constraints that affect the production yield (see Example 9).
The size and morphology of both NPs were evaluated by FESEM (Figure 1 Ai and Figure 1 Bi). SVCV-IFNNP is generally oviform (elliptical shaped) while SVCVNP is rounder and smaller. Similar morphologies had been observed in other IBs produced in E. coli using the same strain BL21 (DE3) and in M15(pREP4) (Thwaite et al., 2018). The size range is shown in Figures 1 Ail, 1 Alii, 1 Bii and 1 Bill with average width and length being 420 ± 67.5 nm and 693 ± 154 nm for SVCVNP and 624 ± 104.9 nm and 982 ± 216.9 nm for SVCV-IFNNP, respectively. Morphological and structural integrity of NPs were evaluated under different environmental conditions of temperature and pH to assess the resistance of the NPs under industrial extrusion procedures and gastrointestinal pH conditions. SVCVNP and SVCV-IFNNP were subjected to high temperature (100°C) and extreme pH conditions (pH 2 and 10) and significant changes in size or morphology were not observed (data not shown).
Example 2. Uptake of modular nanostructured antigens by ZFL cells
Methods
Cell culture and virus
Zebrafish ZFL cells (CRL-2643, ATCC) were cultured according to Thwaite et al. (Thwaite et al., 2018) at 28°C and 5% CO2 in DMEM + GlutaMAX (Gibco), 10% heat-inactivated fetal bovine serum (FBS) (Gibco), 0.01 mg/ml insulin (Sigma-Aldrich), 50 ng/ml epidermal growth factor (Sigma-Aldrich), 2% (v/v) antibiotic/antimycotic (Gibco), and 0.5% (v/v) trout serum which had been filtered (0.20 pm filter Corning) and heat inactivated for 30 min at 56°C.
Zebrafish embryonic fibroblast (ZF4 cells) were cultivated at 28°C and 5 % CO2 in RPMI medium (Gibco) supplemented with 10% FBS (Cultek), 1 mM pyruvate (Gibco), 2 mM L-glutamine (Gibco), 50 pig/ml gentamicin (Gibco) and 2 pig/ml amphotericin B (Gibco).
Fathead minnow (Pimephales promelas) EPC cells were maintained at 28°C and 5 % CO2 in medium RPMI- 1640 supplemented with 10% FBS, 1 mM pyruvate, 2 mM L-glutamine, 50 pig/ml gentamicin and 2 pig/ml amphotericin B.
SVCV (strain 56/70) originally isolated from carp (Fijan, N., Petrinec, Z., Sulimanovic, D., & Zwillenberg, L.O.
(1971). Isolation of the viral causative agent from the acute form of Infectious dropsy of carp. Veterinarski Arhiv, 41 , 125-138) was propagated in EPC cells at 28°C until a cytopathic effect was observed. Then, the cell culture medium was harvested, centrifuged at 4000 x g for 30 min, and virus aliquots were stored at - 80°C.
Uptake of Nanostructured Viral Antigens by ZFL cells
To test cellular uptake, fluorescently labelled NPs were added to ZFL cells cultures at 70-80% confluence after 2-3 h incubation in minimal media (0-0.5% FBS) at the doses and times indicated below. For doseresponse assays, SVCVNP and SVCV-IFNNP were added at 2.5, 5, 10, 20 and 40 pig/ml and cultures were then incubated O/N (12-14 h). For time-course assays, SVCV NPs were added at 5 and 10 pig/ml and cultures were simultaneously incubated for 12 and 24 h. For comparative assays, SVCVNP and SVCV-IFNNP were added at 5 and 10 pig/ml and cultures were then incubated O/N (12-14 h). All experiments were performed in duplicate. Post treatment, ZFL cells were washed in PBS and incubated at 28°C and 5% CO2 with 1 mg/ml Trypsin (Gibco) for 15 min. This strong trypsinization step aimed to remove NPs attached to the cell surface (Seras-Franzoso, J., Sanchez -Chardi, A., Garcia-Fruitos, E., Vazquez, E., Villaverde, A., 2016. Cellular uptake and intracellular fate of protein releasing bacterial amyloids in mammalian cells. Soft Matter 12, 3451-3460. https://doi.Org/10, 1039/c5sm02930a). Then, two volumes of complete medium were added, and cells were pelleted by centrifugation at 300 x g for 5 min at RT. Pellets were resuspended in PBS for flow cytometry (FACSCalibur BD), and 10,000 events were counted. Data was analyzed using FlowJo 10.4 (Leland Stanford University) and plotted with Prism 8.01 (GraphPad Prism). To confirm the fluorescent NPs were inside the cells, confocal microscopy was performed (Zeiss LSM 700). ZFL cells were seeded on Ibid! plates (pi-Dish 35 mm) and incubated at 28°C and 5% CO2. The next day cells at approximately 50-60% confluence were placed in minimal media. SVCVNP and SVCV-IFNNP at 20 pg/ml were added 2 h later and cells were incubated for 16 h at 28°C. The cells were stained with Hoechst (nuclei) and CellMask Deep Red (membrane) (Life Technologies). Images were analyzed using Imaris software v8.2.1 (Bitplane) and Imaged (National Institute of Health, USA).
Results
Modular SVCV NPs were taken up by ZFL cells. In dose-response experiments, in both, SVCVNP and SVCV- I FNNP cases, the mean fluorescence intensity (MFI) increased with dose until 5 - 10 pg/ml (Figures 2A and 2C) and at higher doses dropped significati vely . This decrease was not related with toxicity or apoptosis since cell survival was 100% across doses and time. Possibly, the MFI had started to drop indicating cells were not able to take up more NP or there is a NP overload that had started to be metabolized, in which case the antigen is broken into small peptides which are presented by the antigen-presenting cells to other cells of the immune system. For time course experiments, a 10 pg/ml dose was chosen. In the time course experiments, at 12 and 24 h ZFL cells treated either with SVCVNP or SVCV-IFNNP reached the same percentage of fluorescence and the same MFI (Figures 2B and 2D). No differences in ZFL uptake at 5 or 10 pg/ml at 12 h incubation were observed between SVCVNP and SVCV-IFNNP when both NPs were assayed in parallel (Figure 2E). In addition, these results (Figure 2E) were highly consistent with the previous ones when the NPs were
assayed separately (Figures 2A-2B, 2C and 2D).
The confocal microscopy images of SVCVNP and SVCV-IFNNP treated ZFL cells showed that both NPs were internalized and accumulated inside the cytosol. The 3D images demonstrated the complete internalization of both SVCVNP and SVCV-IFNNP in ZFL cells (data not shown). Confocal microscopy assays were performed at 20 pg/ml of NPs at 24 h and the cytometry uptake data showed that 100% and 90 % of the cells were fluorescent at 20 pg/ml. However, the Mean Fluorescent Intensity (MFI) in SVCV-IFNNP treated cells (Figure 2C) was lower than in SVCVNP treated cells (Figure 2A). Apparently, confocal microscopy images did not show any difference between SVCVNP and SVCV-IFNNP treated cells in terms of size or intensity of the fluorescent agglomerates.
Example 3: Gene Expression Analysis in ZFL and ZF4 Stimulated with NPs Methods.
RNA extraction and Q-PCR
Total RNA of ZFL cells was extracted using TriReagent (Sigma-Aldrich) following the manufacturer's instructions and RNA yield and quality was determined on Nanodrop ND-1000 (Thermo Fisher Scientific) and integrity assessed on the Agilent 2100 Bioanalyzer using RNA 6000 Nano Lab-Chip kit (Agilent Technologies). Then, cDNA was synthesized from 1 pig high quality total RNA using iScript cDNA synthesis kit (Bio-Rad). Quantitative real-time PCR (qPCR) was performed at 60°C annealing temperature in a CFX384 touch real-time PCR detection system (Bio-Rad) using iTaq Universal SYBR Green Supermix kit (Bio-Rad). Each PCR mixture consisted of 5 pl SYBR Green Supermix, 0.4 pM specific primers, 2 pil diluted cDNA and 2.6 pl water (Sigma-Aldrich) in a final volume of 10 pil. The ef1 -a gene was used as a reference gene. The dilution factor for all the genes tested was 1 :10 ( ig1, mx, ccl4, Imp2, ifngrl and ef1-a). Amplification efficiencies for primers Imp2 and ifngrl were calculated. The primers of ifngrl are those of SEQ ID NO: 9 (TGTGAAGGCATTATGGAACGAA) for the forward primer, and SEQ ID NO: 10 (CTTCCATGTTGATTGAAGGTGAAT) for the reverse primer. The primers of Imp2 are those of SEQ ID NO: 11 (TTATTTCCAGAACCGGGATG) for the forward primer, and SEQ ID NO: 12 (ACTCCTGGCATTCCCTCTTT) for the reverse primer. All the samples (n=6 per treatment) were run in triplicate, and data were analyzed for individual replicates using the Livak method (Livak, K.J., Schmittgen, T.D., 2001. Analysis of Relative Gene Expression Data Using Real-Time Quantitative PCR and the 2-MCT Method. Methods 25, 402-408. https://doi.org/10, 1006/ meth, 2001 ,1262).
For total RNA isolation of ZF4 cells, the E.Z.N.A.® Total RNA Kit (Omega Bio-Tek Inc., Norcross, GA, USA) was used according to the manufacturer's instructions. Then, RNA was quantified with a NanoDrop Spectrophotometer (Nanodrop Technologies, Wilmington, DE, USA), and M-MLV reverse transcriptase (Invitrogen, Thermo Fisher Scientific) was used for cDNA synthesis from RNA, as previously described (Chico, V., Gomez, N., Estepa, A., Perez, L, 2006. Rapid detection and quantitation of viral hemorrhagic septicemia virus in experimentally challenged rainbow trout by real-time RT-PCR. J Virol Methods 132, 154- 159. https://doi.Org/10.1016/i.iviromet, 2005.10.005). To evaluate the gene expression in ZF4 cells, RT-qPCR was carried out in 20 pl reactions containing 24 ng of cDNA, 10 pl of SYBR green PCR master mix (Thermo
Fischer Scientific), and a 900 nM final concentration of each primer using the QUANTSTUDIO 3 System (Applied Biosystems, Thermo Fisher Scientific Inc.). The ef1-a gene was used as a reference gene.
Zebrafish husbandry
Wild type zebrafish were kept in a re-circulating aquarium with water temperature at 28 ± 1 °C. The lighting conditions were 14:10 h (light:dark) and adult fish were fed twice a day at a rate of 2% bodyweight. Ammonia, nitrite, nitrate and pH levels were measured once a week and were kept below toxic levels and pH at 7.5 ± 0.5. For in-tank breeding, two females and four males were transferred in groups to a breeding tank in the late afternoon. The next morning after 3 h of the onset of light embryos were collected and cultured in embryo medium (E3 medium) in a Petri dish (Deltalab). Fertilized eggs were separated from unfertilized eggs using a plastic pipette (Deltalab). All experiments involving zebrafish were performed following International Guiding Principles for Research Involving Animals (EU 2010/63) and the Ethics Committees of the Universitat Autbnoma de Barcelona (UAB, CEEH) and Generalitat Valenciana (2019A/SC/PEA/0203)
In vivo uptake in zebrafish larvae.
Groups of five larvae per treatment were distributed on 6-well plates (Thermo Fisher) in duplicate and immersed in 1 ml of E3 medium with PBS, fluorescent SVCVNP and SVCV-IFNNP (10 pig/ml), GFP (10 pig/ml) and LPS (10 pig/ml). Biodistribution after 24 and 48 h zebrafish larvae was evaluated using a fluorescence stereomicroscope (Nikon SMZ800) coupled with a camera (Nikon DS-FI2). In parallel groups of n=5 larvae were treated as indicated, washed and homogenized in TriReagent for gene expression analysis as indicated in RNA extraction and Q-PCR section.
Results
To see whether the antigenic NPs could induce an antiviral response in line with that provoked by viral Infection, ZFL cells were stimulated with the viral NPs overnight (16 h) at 10 pg/ml. Poly (l:C) (10 pg/ml) was also used as a viral dsRNA mimic, LPS as a bacterial mimic and IRFPNP (10 pg/ml) as a control NP made with an immunologically irrelevant protein. The expression of genes, markers of the immune response to viral Infection and the IFN response, was tested by qPCR (Figures 3A, 3B, 3C, 3D and 3E). In ZFL cells a typical strong antiviral response after Poly(l:C) treatment was previously reported (Ruyra, A., Torrealba, D., Morera, D., Tort, L, MacKenzie, S., Roher, N. , 2015. Zebrafish liver (ZFL) cells are able to mount an anti-viral response after stimulation with Poly (l:C). Comp Biochem Physiology Part B Biochem Mol Biology 182, 55-63. https://doi.org/10, 1016/j,cbpb.2014, 12,002). IRFPNP protein without a relevant immune role does not induce the expression of antiviral genes while SVCVNP and SVCV-IFNNP were able to stimulate ZFL cells by increasing the gene expression of anti-viral genes such as vig1, mx or ccl4. Importantly, the inclusion of the I FNy protein module enhanced the ability of SVCVNP to stimulate an antiviral response showing that IFNy could act as a potent adjuvant when included within the same NP (Figures 3A, 3B, 3C, 3D and 3E). Induction of the expression of IFNy receptor (jfngr) and low molecular mass polypeptide (lmp)-2 were observed after SVCV-IFNNP indicating a parallel induction of IFNy signaling pathways presumably after IFNy binds to its receptor.
Example 4. Uptake of SVCVNP and SVCV-IFNNP by zebrafish larvae
Methods
Zebrafish husbandry
Wild type zebrafish were kept in a re-circulating aquarium with water temperature at 28 ± 1 °C. The lighting conditions were 14:10 h (light:dark) and adult fish were fed twice a day at a rate of 2% bodyweight. Ammonia, nitrite, nitrate and pH levels were measured once a week and were kept below toxic levels and pH at 7.5 ± 0.5. For in-tank breeding, two females and four males were transferred in groups to a breeding tank in the late afternoon. The next morning after 3 h of the onset of light embryos were collected and cultured in embryo medium (E3 medium) in a Petri dish (Deltalab). Fertilized eggs were separated from unfertilized eggs using a plastic pipette (Deltalab). All experiments involving zebrafish were performed following International Guiding Principles for Research Involving Animals (EU 2010/63) and the Ethics Committees of the Universitat Autbnoma de Barcelona (UAB, CEEH) and Generalitat Valenciana (2019A/SC/PEA/0203).
In vivo uptake in zebrafish larvae
Groups of five larvae per treatment were distributed on 6-well plates (Thermo Fisher) in duplicate and immersed in 1 ml of E3 medium with PBS, fluorescent SVCVNP and SVCV-IFNNP (10 g/ml), GFP (10 g/ml) and LPS (10 g/ml). Biodistribution after 24 and 48 h zebrafish larvae was evaluated using a fluorescence stereomicroscope (Nikon SMZ800) coupled with a camera (Nikon DS-H2). In parallel groups of n=5 larvae were treated as indicated, washed, and homogenized in TriReagent for gene expression analysis as indicated in RNA extraction and Q-PCR section.
Results
Hatched zebrafish larvae (approximately at 72 hours post fertilization (hpf)) were incubated with 10 and 20 pg/ml of fluorescent SVCVNP and SVCV-IFNNP in E3 medium. After 24 and 48 h living larvae were anesthetized and imaged using a stereoscopic microscope (Figures 4A, 4B and 4C). Uptake of SVCVNP at 24 h was almost undetectable (n = 6 larvae) while observed high levels of fluorescence was observed at 48 h in around 100% of larvae mainly showing accumulation in the gastrointestinal tract and pancreas (Figures 4A, 4B and 4C). Importantly, SVCVNP and SVCV-IFNNP treated larvae died after 24 h incubation at the highest dose, 20 g/ml. At 10 g/ml the whole set of larvae survived after immersion in the SVCVNP and SVCV-IFNNP solution. Toxicity of IFNy has been previously described in microinjected zebrafish embryos overexpressing IFNy (Lopez-Munoz et al., Evolutionary conserved pro-inflammatory and antigen presentation functions of zebrafish IFNy revealed by transcriptomic and functional analysis, Molecular Immunology, Volume 48, Issues 9-10, 2011 , Pages 1073-1083, ISSN 0161-5890, https://doi.ora/10.1016/i.molimm.2011 .01 .015).
Example 5. Protective effect of the vaccines against SVCV Infection in zebrafish Methods
Zebrafish, average size 35 mm and 0.4 g, were purchased from a local pet store. Fish were acclimatized in 20 L tanks at 21 °C for 14 days before the vaccination trial. Zebrafish were divided into five groups (n=12): the
non-lnfected control, the SVCV-Infected control, the iRFPNP control group, SVCVNP group, and SVCV-IFNNP group. Each individual was anesthetized with tricaine (tricaine methanesulfonate, Sigma-Aldrich) (40 mg/l) and intraperitoneally (i.p.) injected with 30 l of PBS containing 5 pg of each antigen using 23G syringeneedle (Terumo Europe N.V.). At 30 days post-vaccination (dpv), fish were Infected by bath-immersion for 2 h in aquarium water containing SVCV (4 x 104 TCID50/ml). Individuals were maintained at 21 °C over the course of the challenge, and the mortality rate of each group was recorded daily.
Results
A preliminary test of NPs toxicity on adult animals was run after i.p injection of 5 and 10 pg of SVCVNP and SVCV-IFNNP and no signs of macrotoxicity were observed. A survival rate assay was performed on SVCV- Infected zebrafish after different nanoparticle vaccine treatments. Unvaccinated zebrafish had 83.3% cumulative percentage mortality after 16 days of Infection with SVCV. Mortality rates in the iRFPNP, SVCVNP and SVCV-IFNNP were 41 .7%, 50.0% and 20.0%, respectively (Figure 5B). The main onset of mortality occurred between 4 and 8 days post-infection (dpi), although this was delayed in the SVCV-IFNNP group where first mortalities were recorded at 7 dpi. Dead fish showed clinical signs of SVCV (Figure 5A) and presence of virus in the diseased fish was confirmed by RT-qPCR.
Example 6: Biomaterial physical-chemical features: nanosized material with extremely qood resistance properties. Manufacturinq proteins for inclusion in feed. (VHSV and VNNV)
The VHSV and VNNV antigens with the IFNy module were produced in E. coli and purified as nanosized structures at high yield (e.g 14.3 mg/l for VHSV-IFNNP) and high purity (see Table 4) using a short and simple enzymatic/mechanical purification procedure, which minimizes costs and not needing further chromatographic purification steps. Unlike purification of recombinant proteins, such as IFN, for humans, chromatography is not used as bacterial contaminants produced during the purification process, such as lipopolysaccharide (LPS), membrane peptidoglycan (PGN), cell wall fragments, and DNA and RNA in variable amounts, are not toxic or generate adverse effects on the fish, and furthermore add an additional immunostimulatory benefit to the recombinant vaccine. In addition, the mechanical and enzymatic processes ensure that there is no contamination with viable bacterial cells. These features contribute to particular advantages for the vaccine to overstimulate the fish's immune system. These biomaterials are extremely resistant to the harsh conditions of pH and temperature expected to occur during feed manufacturing (100°C temperature) and in vivo digestion (pH 2), thus not needing for an extra encapsulation. Same resistance against temperature and pH was found for VHSV-IFNNP (SEQ ID NO: 16) (See Figures 8Ai, 8Aii, 8Aiii, 8Bi, 8Bii, 8Biii 8Ci, 8Cii and 8Ciii), VNNV-IFNNP (SEQ ID NO: 17) and iRFPNP.
SEQ ID NO: is
SHVSARMNRTIQNLLLHYKIPPKDRFNGKPVFSREPLAGKVETKKLFMVGVLETYEKLIGQMLTHLPTPNPPTT GIHVRLGAATAAATAPGAGGEVGKELNFILKKVQELRKHRYQEQSELLQGLEALGKIQMDNFWQSKALWELP WLYEEASSISNGGSSRSSMVRKGDKKLAKPATTKAANPQPRRRATQRRRSGRADAPLAKASTITGFGRATN DVHISGMSRIAQAWPAGTGTDGKIIVDSTIVPELLPRLGHAARIFQRYAVETLEFEIQPMCPANTGGGYVAGFL PNPTDNDHTFDALQATRGAWAKWWESRTVRPQYTRTLLWTSTGKEQRLTSPGRLVLLCVGSNTDWNVSV
MCRWSVRLSVPSLETPEDTTAPITTQAPLHNDSINNGYTGFRSILLGSTQLDLAPANAVFVTDKPLPIDYSLGV
GDVDRAVYWHLRKKAGDTQVPAGYFDWGLWDDFNKTFTVGAPYYSDQQPRQILLPAGTLFTRVDSENHHH HHH.
A vaccinal feed was developed at small scale with VHSV-IFNNP using standard extrusion protocols. Once the feed was manufactured, VHSV-IFNNP can be isolated and detected after delipidation by a basic extraction from food pellets and it remains intact (Figure 6).
7: Biomaterial functional features: how these biomaterials ii
on fish immune
and
The modular system of the viral antigen together with species specific I FNy domain (effector) is also expressed at high levels by E. coli BL21 (e.g 11 .7 mg/l and 14.3 mg/l of culture for VHSV respectively without and with IFNy) (see Table 4). Functional properties of VHSVNP (SEQ ID NO: 15) and VHSV-IFNNP have been demonstrated in vitro, ex vivo and in vivo (data not shown). Representative data of the VHSV-IFNNP ability to stimulate the antiviral immune response in Antigen. The inclusion of IFNy module provided with in-vaccine adjuvant properties in in vitro assays showing improved stimulatory abilities compared with the VHSVNP.
SEQ ID NO: 15 is
TVTFCGTEWIKTDLGDLIQVTGPGGTRKLTPNKCVNTDIQMRGATDDFSYLNHLITNMAQRTECLDAHSDITAS GKVSSFLLSKFRPSHPGPGKAHYLLDGQIMRGDCDYEAWSINYNRAQYKTMNNTWKSWKRVDNNTDGYD GMIFGDKLIIPDIEKYQSVYDSGMLVQRNLVEVPHLSIVFVSNTSDLSTNHIHTHHHHHH
Not only HKM or RTGut cell line are stimulated by VHSV-IFNNP but also intraperitoneal injection of VHSV- IFNNP demonstrate that fluorescent NPs could be detected in immune relevant tissue and stimulate the gene expression of immune genes in Spleen, HK and erythrocytes (RBCs) (data not shown).
Moreover, regarding the protection conferred by the NPs vaccines, promising results were obtained since the presence of specific antibodies in response to VHSVNP and VHSV-IFNNP injected intraperitoneally, was detected, observing higher antibody titters in VHSV-IFNNP injected fish (data not shown).
Separately, a first laboratory-scale trial with VHSV-IFNNP vaccinal feed showed promising protection by in- feed VHSV-IFNNP. Rainbow trout were fed for 20 days with iRFPNP or VHSV-IFNNP in-feed. After 30 days, fish sera were collected and the presence of anti-VHSV-G protein specific antibodies was analyzed and detected by ELISA using concentrated VHSV (data not shown). 60 days after end of vaccinal feed administration, rainbow trout was infected with VHSV 1.5x108 TCID50/fish, by means of intramuscular injection. Fish injected with medium were used as the control. Fish mortality was monitored daily. Fish fed with VHSV-IFNNP presented lower cumulative mortality compared to iRFPNP fed fish (Figure 7A). The neutralizing activity of sera dilutions (1 :25 to 1 :1250) of rainbow trout immunized with VHSV-IFNNP was also measured (Figure 7B).
Furthermore, the I FNy incorporated in the NPs was able to enhance the induction of an adaptive response
through the production of specific and neutralizing antibodies in the case of VHSV-IFNNP, administered to trout also by intubation (Figures 9A and 9B). Adult rainbow trout were intubated on three consecutive days with an accumulative dose of 25 mg/kg fish of NPs. Sera was obtained 30 days post immunization from: untreated control, VHSV-IFNNP vaccinated, IRFPNP vaccinated, PBS control, and VHSV infection survival fish positive control. Differences between means were analyzed by a one-way ANOVA with Brown-Forsythe multiple comparisons test.
Example 8: Nanostructured NPs
Despite the advantages of this recombinant protein production platform, spontaneous nanostructuration is an empiric process not always possible.
In general, capsid viral antigens have an intrinsic ability to auto-organize to form viral capsids. Nevertheless, for example the LCDV viral antigen (without a linked cytokine) was produced as a nanopellet with an extremely low yield (0.07 mg/l) and it was observed an heterogenous pattern by FESEM (Figure 10B). Despite additional optimization of the expression and purification protocols (enzyme concentration, sonication, etc.), it was not possible to obtain any robust structure.
Regarding cytokines, these are soluble proteins usually found circulating in blood. For this reason, cytokines are not expected to easily form nanostructured NPs.
In this regard, the structuration as nanopellets of four cytokines were studied: CCL4, TNFo, IL-6 and IFN. CCL4 and TNFo were successfully produced as NPs.
IL-6 was not self-assembled and the recombinant protein was "trapped" inside the bacteria (Figure 10A). Despite additional optimization of the expression and purification protocols (enzyme concentration, sonication, etc.), it was not possible to obtain any robust structure.
Regarding IFN, it was found by FESEM that zebrafish I FNy does not self-assembled as a nanopelled when expressed alone (Figure 11 ). Surprisingly, when IFNy is linked to a viral antigen, it achieves the desired nanostructure and, additionally, it is stable under extreme pH and temperature conditions (Figures 12AI, 12AII, 12AIII, 12BI, 12BII, 12Biii, 12CI, 12CII, 12CIII, 12DI, 12DII and 12DIII).
Example 9: NPs production performance
As shown in Table 4, a mean production yield (mg/l) was calculated based on different batches produced from each NP. As can be seen in the table, surprisingly an increase in protein production yield is observed in all cases when IFN is linked to the viral antigen.
Yield production increase for the inclusion of IFNy is shown in Table 4:
Example 10: Inclusion of NPs in fish feed
In the context of oral vaccination, the vaccine is either pre-mixed with the feed during feed preparation, usually by extrusion, or mixed with the vaccine prior to feeding by simple homogenization with oil or vacuum coating (Makesh & Rajendran 2022). Although the simplest method is to mix the vaccine with an oily matrix at room temperature, both vacuum coating and, above all, extrusion allow the compound to remain homogeneous in the feed and to be released in the fish's digestive tract with the same dynamics as the normal nutrients. However, both processes involve thermal and mechanical treatments at different pressures and temperatures (Chaabani et al 2020), which may affect the integrity of the proteins.
The semi-industrial extrusion process may consist of the following steps (Dantagnan et al 2002; Hardy & Brezas et al 2002):
1.- Mixing of the vaccine and/or additive with the base feed: In this step, the ingredients of the production formulation are selected; the milling is started, in which the particle size reduction (to approximately 500 microns) is produced; and the mixing of all the ingredients including the additives (vaccines, probiotics, etc) is performed.
2.- Mixture conditioning: During the extrusion process, there are three factors to consider: heat, which is delivered to the mixture by injecting steam; moisture, which is achieved by spraying water to the mixture; and residence time, which is controlled by varying the speed and/or position of the conditioner paddles. During conditioning, steam is added to a chamber in which the feed mixture is agitated by counter-rotating augers. The steam and the friction associated with the mechanical force heat the feed mixture, which reaches a temperature between 125° and 150° C with a wet basis moisture content of 20%-24%. These conditions initiate starch gelatinization. It has been documented that the temperature at the outlet of the conditioner is approximately 90°C.
3.- Extrusion of the mixture: In the extruder, starches finish their gelatinization, with an increase in temperature and addition of water, turning the mixture of ingredients into an elastic and sticky mass. It is then pressurized into a long, conical barrel with steam holes containing an auger with increasingly narrower sections. The pressure inside the barrel keeps the steam in a liquid state until the mixture is passed through a fixed plate with conical holes (the matrix). Pressures may vary between 2.5 and 10 MPa, with pressures between 6 and 8 MPa being more common (depending on extruder characteristics). The feed is extruded through the matrix in the form of long noodles that are cut to the desired length by a rotating blade located on the outer surface of the die. The operating conditions of the extruder play a very important role, thus, the retention time and the steam injection contribute to the gelatinization of the starches, giving the characteristics to the final product. This process is carried out at high temperature (above 130°C) and short time not
exceeding 30 seconds (HTST, High Temperature Short Time). This step can also be done in low temperature (for example the inventors conducted a semi-industrial similar process with a cold extrusion at around 40 °C obtaining proper results), although it is very recommendable (or even mandatory in industrial scale) to use high temperatures for easily maintaining sterility, among other benefits.
4.- Feed drying: As the feed mixture exits the matrix, high pressure is released, which instantly converts the moisture in water to steam, creating small air pockets that form inside the pellets. This step is called expansion. Immediately after, the pellets pass through a moving belt dryer, where they are exposed to forced hot air, lowering the wet basis moisture content of the feed to 7-9%. After cooling and drying, the pellet density (0.25 - 0.3 g/cc) is such that the pellets float or sink slowly in water, depending on the operating conditions of the extruder.
5.- Feed oiling: the feed is coated with oil in an amount equivalent to approximately 12% of the feed weight. Reaching a total amount of lipids of around 15 to 40% in the mixture. Vacuum oiling allows large quantities of oil to enter the center of the pellet in a few seconds.
6.- Feed packaging.
Citation List
Non Patent Literature
Thwaite R, Ji J, Torrealba O, Col/ J, Sabes M, Villaverde A and Roher N (2018) Protein Nanoparticles Made of Recombinant Viral Antigens: A Promising Biomaterial for Oral Delivery of Fish Prophylactics. Front.
Immunol. 9:1652. https://doi,org/10,3389/fimmu, 2018, 01652
Fijan, N., Petrinec, Z., Sulimanovic, D., & Zwillenberg, L.O. (1971). Isolation of the viral causative agent from the acute form of Infectious dropsy of carp. Veterinarski Arhiv, 41 , 125-138
Torrealba, D., Parra, D., Seras-Franzoso, J., Vallejos- Vidal, E., Yero, D., Gibert, I., Villaverde, A., Garcia- Fruitos, E., Roher, N., 2016a. Nanostructured recombinant cytokines: A highly stable alternative to short-lived prophylactics. Biomaterials 107, 102-114. https://doi ,org/10.1016/j, biomaterials.2016,08,043
Seras-Franzoso, J., Sanchez-Chardi, A., Garcia-Fruitos, E., Vazquez, E., Villaverde, A., 2016. Cellular uptake and intracellular fate of protein releasing bacterial amyloids in mammalian cells. Soft Matter 12, 3451 -3460. h ttps://doi ,orq/10, 1039/c5sm02930a
Livak, K. J., Schmittgen, T.D., 2001 . Analysis of Relative Gene Expression Data Using Real-Time Quantitative
PCR and the 2-AACT Method. Methods 25, 402-408. h ttps://doi . orq/10.1006/meth,2001 .1262
Chico, V., Gomez, N., Estepa, A., Perez, L, 2006. Rapid detection and quantitation of viral hemorrhagic
septicemia virus in experimentally challenged rainbow trout by real-time RT-PCR. J Virol Methods 132, 154- 159. https://doi.orfl/1Q, 1016/j,iviromet.2005.10,005
Ruyra, A., Torrealba, D., Morera, D., Tort, L, MacKenzie, S., Roher, N., 2015. Zebrafish liver (ZFL) cells are able to mount an anti-viral response after stimulation with Poly (I :C). Comp Biochem Physiology Part B Biochem Mol Biology 182, 55-63. https://doi,org/10,1016/j,cbpb.2014, 12.002
Lopez-Munoz et al., Evolutionary conserved pro-inflammatory and antigen presentation functions of zebrafish IFNy revealed by transcriptomic and functional analysis, Molecular Immunology, Volume 48, Issues 9-10, 2011, Pages 1073-1083, ISSN 0161-5890, https://doi.Org/10.1016/i.molimm.2011.01.015
Makesh M, Rajendran KV, 2022. Methods of Vaccine Delivery. Fish Immune Syst Vaccines (Singapore: Springer) 95. https://doi.org/10.1007/978-981-19-1268-9 10
Chaabani, A., Labonne, L., Alburez-Tercero, C., Picard, J.P., Advenier, C., 2020. Optimization of vacuum coating conditions to improve oil retention in trout feed. Aquae. Eng. 91 , 1-14. https://doi .orq/10.1016/j .aquaeng.2020.102127
Hardy R, Brezas A., 2022. Diet formulation and manufacture. Fish nutrition. Fourth edition, Pages 643-708. h tips : //do i .org/10.1016/C2018-0-03211-9
Dantagnan, Patricio, Hernandez A, Cabrera A, Alex & Swiderski, N. , 2020. Formulation, fabrication y evaluation de dietas para peces. Salmonexpert N° 84 July 2020.
Claims
1 A protein nanopellet comprising one or more polypeptides comprising the amino acid sequence of an interferon or a fragment thereof, the amino acid sequence of a viral antigen or a fragment thereof and, optionally, a linker between them; and with a particle diameter from 400 nm to 1500 nm, measured by electron microscopy.
2. The nanopellet according to claim 1 , wherein the nanopellet is immunogenic.
3. The nanopellet according to any one of claims 1-2, wherein the polypeptide has formula (I):
R1-(L)n-R2 (I) wherein: n is an integer selected from 0 or 1 ;
R1 , which is at the N-terminal end of the polypeptide, comprises the amino acid sequence of an interferon or a fragment thereof;
L is a linker; and
R2, which is at the C-terminal end of the polypeptide, comprises the amino acid sequence of a viral antigen or a fragment thereof.
4.- The nanopellet according to any one of claims 1 -3, wherein R2 is the amino acid sequence of a viral antigen of a virus causing disease in aquatic animals selected from fish or teleost and crustacean.
5.- The nanopellet according to any one of claims 1 -4, wherein R2 the amino acid sequence of a viral antigen of a virus causing disease, said virus selected from Infectious pancreatic necrosis virus (IPNV), Viral Hemorrhagic Septicemia Virus (VHSV), Viral Nervous Necrosis Virus (VNNV) and Spring Viraemia of Carp Virus (SVCV).
6.- The nanopellet according to claim 5, wherein the virus is selected from SVCV and VHSV.
7.- The nanopellet according to any one of claims 1 -6, wherein R2 comprises the amino acid sequence as set forth in SEQ ID NO: 1 , or a sequence at least 85% identical to SEQ ID NO: 1 ; or alternatively wherein R2 comprises the amino acid sequence as set forth in SEQ ID NO: 5, or a sequence at least 85% identical to SEQ ID NO: 5.
8.- The nanopellet according to any one of claims 1-7, wherein R1 comprises the amino acid sequence of an interferon or a fragment thereof of an animal species selected from fish or teleost and crustacean, the interferon selected from the group consisting of interferons Type I and Type II.
9.- The nanopellet according to any one of claims 1 -8, wherein R1 comprises the amino acid sequence of the interferon gamma-1.
10.- The nanopellet according to any one of claims 1 -9, wherein R1 comprises the amino acid sequence as set forth in SEQ ID NO: 2 or a sequence at least 85% identical to SEQ ID NO: 2.
11.- The nanopellet according to any one of claims 1 -10, wherein n is 1 , and the linker L is a peptide comprising SEQ ID NO: 3 (GGSSRSS).
12.- An immunogenic composition comprising the protein nanopellet as defined in any one of claims 1-11.
13.- A vaccine comprising the immunogenic composition as defined in claim 12, and a pharmaceutically acceptable excipient and/or carrier.
14.- A protein nanopellet as defined in any one of claims 1 -11 , or an immunogenic composition as defined in claim 12, or a vaccine as defined in claim 13, for use in therapy, in particular, for the prevention and/or treatment of a viral disease.
15.- The protein nanopellet, or the immunogenic composition, or the vaccine, for use according to claim 14, wherein the protein nanopellet, immunogenic composition, or vaccine is administered orally.
16.- A food, feed, or feed additive composition comprising a protein nanopellet as defined in any one of claims 1-11 , or an immunogenic composition as defined in claim 12, or a vaccine as defined in claim 13.
17.- A method for the obtention of a protein nanopellet as defined in any one of claims 1 -11 comprising the steps of: a) transformation of a host cell with plasmids or vectors comprising a polynucleotide encoding a polypeptide as defined in any one of claims 1-11, to obtain a host transformed cell; b) culture of the host transformed cell in an appropriated culture media; c) induction of expression of the polypeptide encoded in the polynucleotide, to obtain such a polypeptide in form of nanopellets; and d) purification of the polypeptide nanopellets from the cell host culture media, optionally performing a chromatographic step.
18.- A protein nanopellet obtainable by a method as defined in claim 17.
19.- A method for the obtention of a food, feed, or feed additive composition as defined in claim 16 comprising the steps of: a) mixing a protein nanopellet as defined in any one of claims 1-1 1 , or an immunogenic composition as
defined in claim 12, or a vaccine as defined in any one of claims 13-14, with at least one edible ingredient; b) conditioning the mixture by adding steam to the mixture until it reaches a temperature from 120 to 160 °C and a moisture from 15 to 30%; c) extrusion of the mixture at a pressure selected from 6 to 8 MPa and at a temperature selected from 30 to 100 °C; d) drying of the mixture until a wet basis moisture content selected from 5 to 15% is reached; e) oiling of the mixture until the fat content of the mixture is from 15% to 40% (w/w); and f) optionally, packaging of the mixture.
20.- A food, feed, or feed composition obtainable by a method as defined in claim 19.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP22383185.0A EP4382533A1 (en) | 2022-12-05 | 2022-12-05 | Protein nanopellets for fish or teleost and crustacean vaccination |
| PCT/EP2023/084062 WO2024121028A1 (en) | 2022-12-05 | 2023-12-04 | Protein nanopellets for fish or teleost and crustacean vaccination |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP4630440A1 true EP4630440A1 (en) | 2025-10-15 |
Family
ID=84421169
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP22383185.0A Withdrawn EP4382533A1 (en) | 2022-12-05 | 2022-12-05 | Protein nanopellets for fish or teleost and crustacean vaccination |
| EP23821532.1A Pending EP4630440A1 (en) | 2022-12-05 | 2023-12-04 | Protein nanopellets for fish or teleost and crustacean vaccination |
Family Applications Before (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP22383185.0A Withdrawn EP4382533A1 (en) | 2022-12-05 | 2022-12-05 | Protein nanopellets for fish or teleost and crustacean vaccination |
Country Status (3)
| Country | Link |
|---|---|
| EP (2) | EP4382533A1 (en) |
| CL (1) | CL2025001619A1 (en) |
| WO (1) | WO2024121028A1 (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN119751592B (en) * | 2024-11-20 | 2025-11-18 | 海泰达生物科技(广州)有限公司 | Fish rhabdovirus binding protein and preparation method and application thereof |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2583113C (en) * | 2004-10-05 | 2015-11-10 | Diversa Corporation | Compositions comprising an antigen and a promiscuous t-cell epitope |
| US9358283B2 (en) * | 2011-10-28 | 2016-06-07 | The Regents Of The University Of California | Diatom-based vaccines |
-
2022
- 2022-12-05 EP EP22383185.0A patent/EP4382533A1/en not_active Withdrawn
-
2023
- 2023-12-04 EP EP23821532.1A patent/EP4630440A1/en active Pending
- 2023-12-04 WO PCT/EP2023/084062 patent/WO2024121028A1/en not_active Ceased
-
2025
- 2025-06-02 CL CL2025001619A patent/CL2025001619A1/en unknown
Also Published As
| Publication number | Publication date |
|---|---|
| CL2025001619A1 (en) | 2025-08-29 |
| WO2024121028A1 (en) | 2024-06-13 |
| EP4382533A1 (en) | 2024-06-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Ahmadivand et al. | Oral DNA vaccines based on CS-TPP nanoparticles and alginate microparticles confer high protection against infectious pancreatic necrosis virus (IPNV) infection in trout | |
| Kole et al. | Nanoencapsulation of inactivated-viral vaccine using chitosan nanoparticles: Evaluation of its protective efficacy and immune modulatory effects in olive flounder (Paralichthys olivaceus) against viral haemorrhagic septicaemia virus (VHSV) infection | |
| Kole et al. | PLGA encapsulated inactivated-viral vaccine: Formulation and evaluation of its protective efficacy against viral haemorrhagic septicaemia virus (VHSV) infection in olive flounder (Paralichthys olivaceus) vaccinated by mucosal delivery routes | |
| Plant et al. | Advances in fish vaccine delivery | |
| Behera et al. | Alginate–chitosan–PLGA composite microspheres induce both innate and adaptive immune response through parenteral immunization in fish | |
| US8257713B2 (en) | Vaccine | |
| Leal et al. | Oral and parenteral vaccines against Flavobacterium columnare: evaluation of humoral immune response by ELISA and in vivo efficiency in Nile tilapia (Oreochromis niloticus) | |
| Maurice et al. | Oral immunization of Carassius auratus with modified recombinant A-layer proteins entrapped in alginate beads | |
| EP4630440A1 (en) | Protein nanopellets for fish or teleost and crustacean vaccination | |
| Rojas-Peña et al. | How modular protein nanoparticles may expand the ability of subunit anti-viral vaccines: The spring viremia carp virus (SVCV) case | |
| JP6586077B2 (en) | Vaccines against ticks | |
| WO2007146359A2 (en) | Sea lice antigen vaccines | |
| Ishaq et al. | A systematic review on the development and efficacy of nano-based vaccine in aquaculture | |
| JP2010514412A (en) | DNA fish vaccine | |
| RU2580294C2 (en) | Application of pacap as molecular adjuvant for vaccines | |
| TN et al. | Vaccines to prevent diseases in aquaculture | |
| Harshitha et al. | Oral delivery of recombinant outer membrane protein 23-based nanovaccine can minimize Aeromonas hydrophila infection in Oreochromis niloticus | |
| Svirshchevskaya et al. | Immune System of Fish: Optimizing Vaccines for Aquaculture | |
| Chellapandian et al. | Mass Vaccination in Aquaculture: Possibilities and Limitations | |
| Aceituno et al. | An encapsulation-free oral subunit vaccine for VHSV: Inducing robust antiviral and antibody responses | |
| Nazar et al. | Novel advancements in vaccine delivery and methods of vaccination: experimental strategies | |
| JP5971625B2 (en) | Adjuvant and marine vaccine | |
| Thwaite | A new vaccine strategy to combat viral infections in European-farmed finfish | |
| KR102082600B1 (en) | Vaccine Composition for Viral Hemorrhagic Septicemia Using PLGA | |
| Chellapandian et al. | 11 Mass Vaccination in Aquaculture |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20250707 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) |