EP4615866A1 - Talin-based mechanosensory hydrogel - Google Patents
Talin-based mechanosensory hydrogelInfo
- Publication number
- EP4615866A1 EP4615866A1 EP23817802.4A EP23817802A EP4615866A1 EP 4615866 A1 EP4615866 A1 EP 4615866A1 EP 23817802 A EP23817802 A EP 23817802A EP 4615866 A1 EP4615866 A1 EP 4615866A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- recombinant
- amino acid
- sequence
- mechanosensory
- monomer
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F41—WEAPONS
- F41H—ARMOUR; ARMOURED TURRETS; ARMOURED OR ARMED VEHICLES; MEANS OF ATTACK OR DEFENCE, e.g. CAMOUFLAGE, IN GENERAL
- F41H1/00—Personal protection gear
- F41H1/02—Armoured or projectile- or missile-resistant garments; Composite protection fabrics
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F42—AMMUNITION; BLASTING
- F42D—BLASTING
- F42D5/00—Safety arrangements
- F42D5/04—Rendering explosive charges harmless, e.g. destroying ammunition; Rendering detonation of explosive charges harmless
- F42D5/045—Detonation-wave absorbing or damping means
- F42D5/05—Blasting mats
Definitions
- the present invention relates to protein-based materials that sense and absorb forces, such as shock from impacts applied to the material, protects objects from impacts, as well as capturing and preserving projectiles.
- Extreme energy dissipating materials are essential for a range of applications.
- the military and police force require ballistic armour to ensure the safety of their personnel, while the aerospace industry requires materials that enable the capture, preservation and study of hypervelocity projectiles.
- current industry standards display at least one inherent limitation. When impacted by a projectile, a material is exposed to a variety of phenomena simultaneously. To survive the impact, a material must contend with wave propagation (elastic, shock and plastic), fragmentation, perforation and spallation (Qiao, P.Z.
- Body armour is commonly used by military and civilian forces to protect the wearer against penetration from projectiles, such as bullets or shrapnel (Park, J.L. et al supra). Frequently, this armour consists of a multi-layered system, commonly a ceramic face backed by a fibre- reinforced composite (Fejdys, M.
- the aerospace sector utilises impact energy dissipating materials for the unique task of capture and preservation of space debris, space dust and micrometeoroids (Kearsley, A.T. (2017) 14th Hypervelocity Impact Symposium (Hvis 2017) 204, 43-50).
- These captured projectiles contribute towards our understanding of the local environments of aerospace equipment, including that of the international space station (Woignier, T. et al (2013) Advances in Materials Science and Engineering 484153, 1–6). Data from these experiments facilitate aerospace equipment design, improving the safety of astronauts and the longevity of costly aerospace equipment.
- Aerogels are the current industry standard for projectile capture and preservation, achieving energy dissipation through conversion of projectile kinetic energy into both mechanical and thermal energy (Jones, S.M.
- Talin is the epitome of a mechanical protein, mediating the connection between the actin cytoskeleton and the integrin extracellular matrix receptors, acting as a mechanosensor.
- the helical bundles of both talin 1 and talin 2 exhibit switch like behaviour, and act as force-dependent binary switches, opening and closing in response to changes in mechanical force. This property of helical bundles located within force transmission pathways enable mechanical signalling, but also having multiple force-dependent binary switches in series provides shock absorbing properties. Other molecules such as vinculin, catenins, filamins, Hip1R and Sla2, that are also located within force transmission pathways, contain similar helical bundles with similar properties.
- the talin rod is comprised of 62 alpha helices that fold into 9, five-helix bundles and 4, four-helix bundles, producing 13 rod domains, R1-R13.
- Nine of the rod domains contains a vinculin binding site (VBS) composed of a hydrophobic surface spanning five turns of a helix.
- VBS vinculin binding site
- Figure 1 illustrates the boundaries of the talin 1 and talin 2 domains, and the complete amino acid sequence for mouse Talin 1 (UniProt P26039) is set out in SEQ ID NO:1: MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSD DDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDD SKTVTDMLMTICARIGITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKK MEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRD PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGF LDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVS FFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQ
- the present invention resides in the specific engineering of a helical bundle to impart or improve/enhance mechanosensory properties to/of the bundle.
- the present invention encompasses a recombinant monomer comprising an amino acid sequence of, or derived from, one or more rod domains of the protein talin, wherein the monomer comprises: one or more helical structure; at least one amino acid substitution in the monomer sequence; N- and C-terminal sequence adaptations; and means to enable cross-linking of the monomer and/or means for providing attachment to a cross- linking moiety.
- the at least one amino acid substitution is a cysteine/serine substitution if cysteine residues are present in the monomer sequence.
- the amino acid sequence may comprise sequences from consecutive rod domains. In other words, the sequences may be consecutive as found in the wild-type sequence of talin. Examples of such sequences include rod domains 1, 2 and 3, and domains 7 and 8.
- at least one of the consecutive rod domain sequences includes one or more cys/ser substitution. Ideally all the sequences in the monomer include at least one cys-serine substitution but it is not essential that substitutions are provided in all the sequences.
- the invention encompasses other, additional amino acid substitutions that enhance and/or improve the function of the monomer, either alone or when polymerised.
- modification of the R3 domain itself, via substitution of buried polar residues, with a so called “IVVI” mutant alters the mechanical properties of the domain as demonstrated previously (Yao M. et al (2014) Scientific Reports 4, 4610).
- the consecutive rod domain sequences may be, or may be derived from, rod domains R1, R2 and R3.
- the monomer may comprise an amino acid sequence from about amino acid number 482 to about 911 of talin (talin 1) or from about amino acid number 486 to about 915 of talin (talin 2) or variations and combinations thereof.
- the monomer may comprise the following sequence: RGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWR KNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGSAVTTISSNLT EMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQN LLQAAGNVGQASGELLQQIGESDTDPHFQDVLMQLANAVASAAAALVLKAK SVAQRTEDSGLQTQVIAAATQSALSTSQLVASTKVVAPTISSPVSQEQLVEA GRLVAKAVEGSVSASQAATEDGQLLRGVGAAATAVTQALNELLQHVKAHAT GAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKA DAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREA AEGLRMATNAAAQNAIKKGT (SEQ
- the monomer may comprise at least two (two or more) repeats of an amino acid sequence of, or derived from, a single rod domain.
- the single rod domain may be, or may be derived from, rod domain R1, rod domain R3, rod domain R9, or rod domain R13.
- the upper limit of the number of sequence repeats will be determined by the particular sequence used, the ability of the monomer to form a functional molecule, as well as having the desired function and properties, and the ability to produce the monomer cost effectively and accurately.
- wild type talin has thirteen rod domains but a recombinant monomer including up to at least twenty domains is conceivable and contemplated.
- the monomer may comprise at least two (two or more) repeats of an amino acid sequence of, or derived from, non-contiguous rod domains.
- the monomer may be, or may be derived from rod domains R3 and R9 and the sequences ordered in the monomer as R3-R9-R3-R9, R3-R9-R3 or R9-R3-R9.
- at least one of the rod domain sequences includes one or more cys/ser substitution.
- all the sequences in the monomer include at least one cys-serine substitution, where cysteine residues are present in the sequence, but it is not essential that substitutions are provided in all the sequences.
- the R1 rod domain may have the following sequence: RGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDE SKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGSAVTTISSNLTEMSRGVKLLAALL EDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQI (SEQ ID NO:3).
- the R3 rod domain may have the following sequence: AHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVN AIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRL REAAEGLRMATNAAAQNAIKK (SEQ ID NO:4).
- the R9 rod domain may have the following sequence: APGQLESETAIAALNSSLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAV QEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQ MALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVED LTTTLNEAASAA (SEQ ID NO:5).
- the R13 rod domain may have the following sequence: DPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSALV KAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMVAAATNNLSEAANAAVQG HASQEKLISSAKQVAASTAQLLVASKVKADQDSEAMKRLQAAGNAVKRASDNLVKAA QKAAAFED (SEQ ID NO:6).
- the repeats of the single (sequential or non- sequential) rod domain sequences may be separated by a linker.
- the linker sequence is GGGGGSGGGGGS (SEQ ID NO:8).
- glycine serine linkers are particularly suitable (see van Rosmalen et al (2017) Biochemistry 56, 50, 6565-6574), it will be appreciated that any suitable linker may be used.
- a particularly suitable linker is a short one that has sufficient flexibility and provides enough distance between the sequences, so the domains are not sterically hindered.
- the maximum number of repeats of a linker sequence is also easily derivable and depends on the length of the linker sequence and the distance required between domains.
- at least one of the rod domain sequences includes one or more cys/ser substitution.
- all the sequences in the monomer include at least one cys-serine substitution, where cysteine residues are present in the sequence, but it is not essential that substitutions are provided in all the sequences.
- the invention encompasses other, additional amino acid substitutions that enhance and/or improve the function of the monomer, either alone or when polymerised.
- This sequence acts as a flexible linker, the function of which is to remove the protein monomer bulk away from any cross-linker reaction site, assisting the reaction of a single cross-linker with multiple protein monomers. While it will be appreciated that any equivalent and/or suitable sequence may be used, a particular example of such a sequence may be CGGGGSGGGGSGGGGSGS (SEQ ID NO:10).
- the C-terminal adaptation also acts as a flexible linker and functions in the same way as the N-terminal adaptation sequence.
- the adaptation sequence may be GGGGSGGGGSGGGGSC (SEQ ID NO:12). It will be appreciated that any suitable adaption sequence(s) may be used and that SEQ ID NOs:11 and 12 are merely non-limiting examples of a flexible linker.
- the means to enable cross-linking of the monomer and/or for providing attachment to a cross-linking moiety may be any suitable means, such as an amino acid, an amino acid sequence, or a chemical entity, that enables one monomer to be attached or cross-linked to at least one other.
- the amino acid sequence may include a cysteine residue at the leading end of one or each of the terminal adaptor sequences allow the monomer to be attached to another moiety, such as a linker or cross-linking moiety.
- a linker or cross-linking moiety such as a linker or cross-linking moiety.
- the cysteine residue reacts with a cross-linking moiety added to the monomer sequence in its place.
- the terminal cysteine covalently couples the monomer sequence to other moieties.
- the invention encompasses monomer sequences that include other or additional entities that enable the cross-linking of monomers, for example protein interaction motifs such as SpyTag/SpyCatcher and AviTag TM , as well as the inclusion of binding sites for other proteins and sequences that impart selected characteristics to the monomer that encourage, promote or enable cross-linking.
- An example of means to encourage, promote or enable cross-linking includes non-covalent cross-linking via one or more amino acid sequences as part of the monomer sequence, in which the additional sequence imparts characteristics to the monomer that encourage, promote or enable cross-linking.
- additional sequences may be in the form of a coiled coil.
- coiled coils are built by two or more alpha helices that wind around each other to form a supercoil. There can be two, three or four helices in the bundle and they might either run in the same (parallel) or in the opposite (antiparallel) directions. Sequences in these coils impart a hydrophobic side or region and a hydrophilic side or region to the three-dimensional structure such that, in an aqueous environment, the hydrophobic sides interact with each other, shielding them from the aqueous polar environment.
- the non-covalent hydrophobic/hydrophilic effect may be used to drive self-association of the residues which, when attached to the terminal ends of the protein monomeric units will instigate cross-linking.
- the amino acid sequence of the monomer may further comprise an expression sequence.
- the expression sequence will be designed to facilitate expression of the monomer sequence in a particular expression system and is typically cleaved from the monomer sequence during expression. Therefore, while any suitable expression sequence or affinity tag may be used to enable the purification of the protein, an example of a particular expression sequence is: MHHHHHHGKPIPNPLLGLDSTENLYFQ (SEQ ID NO:13).
- An additional or alternative expression sequence is MHHHHHHENLYFQG (SEQ ID NO:14).
- a yet further additional or alternative expression sequence is MHHHHHHGCGGGGSGGGGSGGGGSGS (SEQ ID NO:15) where the His-tag is not cleavable.
- pGEL02 sequence engineered expression sequence of 3 copies of the R9 rod domain in series: MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTGCGGGGSGGGGSGGGGSGSAPGQLES ETAIAALNSSLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEA SQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGG NPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGGGGGSGGGGSAPGQLESETAIA ALNSSLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLG HKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQ AAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGGGGGGG
- pGEL04 sequence engineered expression sequence of 3 copies of the R1 rod domain in series: MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTGCGGGGSGGGGSGGGGSGSRGHMPPL TSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQVD AITAGTASVVNLTAGDPAETDYTAVGSAVTTISSNLTEMSRGVKLLAALLEDEGGNGRPLLQ AAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGGGGSGGGGSRGHM PPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHS QVDAITAGTASVVNLTAGDPAETDYTAVGSAVTTISSNLTEMSRGVKLLAALLEDEGGNGR PLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGGGGSGGSGGS
- pGEL05 sequence engineered expression sequence of R9-R3-R9 rod domains in series: MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTGCGGGGSGGGGSGGGGSGSAPGQLES ETAIAALNSSLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEA SQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGG NPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGGGGGSGGGGSAHATGAGPAG RYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLS AAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNAIKKGGGGSGG GGSAPGQLESETAIAALNSSLRDLDQASLAAVSQQLAPREGISQ
- pGEL06 sequence engineered expression sequence of R9-R3-R9 rod domains in series: MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTGCGGGGSGGGGSGGGGSGSAHATGAG PAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRK LLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNAIKKGGGG SGGGGSAPGQLESETAIAALNSSLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEI SHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAE SALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGGGGGSGG GGSAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATS
- pGEL07 sequence engineered expression sequence of 3 copies of the R13 rod domain in series MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTGCGGGGSGGGGSGGGGSGSDPTVIAE NELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRE LVAQGKVGAIPANALDDGQWSQGLISAARMVAAATNNLSEAANAAVQGHASQEKLISSAK QVAASTAQLLVASKVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFEDGGGGSG GGGSDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSA LVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMVAAATNNLSEAANAAVQGH ASQEKLISSAKQVAASTAQLLVASKVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFED
- the present invention also encompasses nucleotide sequences and expression systems comprising these nucleotide sequences that are suitable for expressing the amino acid sequences described herein above.
- the present invention resides in a recombinant mechanosensory amino acid polymer in which the polymer comprises at least two amino acid monomer sequences and cross-linking means, characterised in that the monomer sequences include: one or more helical structures; at least one amino acid substitution; N- and C-terminal sequence adaptations; and, means to enable cross-linking of the monomers and/or means for providing attachment to a cross-linker, wherein the monomers are cross-linked to form the polymer.
- the mechanosensory polymer of the invention may comprise monomers derived from a single protein or monomers derived from related or different proteins. It will be appreciated that the at least two monomers may be selected to impart particular properties to the polymer.
- the polymer may be designed to absorb and/or sense kinetic energy (i.e. a shock) from a force such as a mechanical impact. As a result, monomers may be selected based on their ability to impart these capabilities to the polymer.
- mechanosensory proteins include vinculin, Sla2, Hip1R, filamin, and catenins.
- a helical structure such as the helical bundles found in the protein talin, opens and closes in response to kinetic energy, such as provided by a mechanical force, thereby acting as a force-dependent “switch” domain. Therefore, in some embodiments the switch domains may open in response to kinetic energy (force) and remain open. In other embodiments, the domains may refold and effectively close. In this way, the former provides a polymer for a single use while the latter provides a polymer for multiple uses that is able to absorb (dissipate) and/or sense shock multiple times.
- the switch domains may be selected to respond to different amounts of force (kinetic energy) to give the polymer the ability to absorb and/or sense shock in a range, or selection of ranges, of forces.
- multiple switch domains may be activatable at different levels of force. For example, a particular force may cause the opening or unfolding of one or more helical structures while a greater or different force recruits the unfolding of additional or other helical structures.
- the polymer of the invention may be “tuneable” according to the amount of force absorbance and dissipation required.
- suitable amino acid monomers include those derived from the protein talin, such as a monomer derived from one or more rod domains of talin (talin 1 and /or talin 2) as described herein above, vinculin, Sla2, Hip1R, filamin, and catenins.
- all of the cysteine residues in the monomers are substituted with serine where native cysteine residues are present.
- all the sequences in each monomer that include native cysteine residues include at least one cys-serine substitution, but it is not essential that substitutions are provided in all the monomers or sequences of each monomer.
- the adaptation sequence acts as a flexible linker to position the monomer structure in such a way as to facilitate and/or maximise the ability of the cross-linking moiety to react with multiple monomers.
- the N-terminal adaptation may comprise the sequence CGGGGSGGGGSGGGGSGS (SEQ ID NO:10).
- the C terminal adaptation may comprise the sequence GGGGSGGGGSGGGGSC (SEQ ID NO:12).
- any suitable adaption sequence(s) performing the same function may be used and that the sequences set out hereinabove are purely for illustrative purposes.
- the means to enable cross-linking of the monomers and/or for providing attachment to a cross-linker may be any suitable means, such as an amino acid, an amino acid sequence, or a chemical entity, that enables one monomer to be attached to at least one other.
- cysteines at a or the leading end of the terminal adaptor sequences.
- a linker or crosslinking moiety is attached to the monomer sequence via reaction with cysteine.
- the invention encompasses alternative or additional entities that enable the cross-linking of monomers, for example protein interaction motifs such as SpyTag/SpyCatcher and AviTag TM , as well as the inclusion of binding sites for other proteins and/or, as described above, sequences that impart selected characteristics to the monomers that encourage, promote or enable non-covalent cross-linking, such as coiled coils.
- the polymer may further comprise a marker or binding entity which changes the properties of the polymer on unfolding and/or refolding of the helical structure.
- the marker or binding entity acts as a sensory marker to indicate when a change has occurred.
- the marker or binding entity may impart a fluorescence or a change in colour, luminescence, or opacity on either unfolding or refolding of the helical structure.
- the invention encompasses the embodiment where a dimensional or conformational change in the polymer structure that occurs as a result of unfolding/refolding causes the marker or binding entity to impart a colour change or fluorescence, as well as the embodiment where unfolding/refolding of the helical structures allows the binding or unbinding of the marker or binding entity to the helical structure, which interaction causes a fluorescence or a change in colour, luminescence, or opacity.
- the invention also encompasses markers and binding entities that specifically bind to the closed (folded) state of the helical structures, i.e. when the structures are in a state of low tension, or the open (unfolded) structures, i.e. when the structures are under tension or compression.
- the marker or binding entity may impart a reversible or non-reversible change to the polymer when the helical structure is in an unfolded state, i.e. when the structure is under tension or compression.
- suitable markers or binding entities include vinculin and a marker that includes one or more leucine-aspartic acid (LD) motifs, such as LD motifs derived from KANK1-4, Deleted in Liver Cancer 1 (DLC1) and Rap1-GTP-interacting adaptor molecule (RIAM) proteins, and aptamers, intrabodies or antibodies raised against specific domain states.
- LD leucine-aspartic acid
- DLC1 Deleted in Liver Cancer 1
- RAM Rap1-GTP-interacting adaptor molecule
- the present invention resides in the use of mechanosensory hydrogel comprising a recombinant mechanosensory monomer or polymer as described herein to absorb, dissipate and/or sense force applied to the hydrogel.
- the present invention also resides in a method of absorbing and/or sensing force, particularly a force or kinetic energy applied to a surface, wherein the force or energy is absorbed, dissipated and/or sensed by a mechanosensory hydrogel (applied to the surface) comprising a recombinant mechanosensory monomer or polymer as described herein.
- the present invention also resides in the use of a mechanosensory hydrogel comprising a recombinant mechanosensory monomer or polymer as described herein to protect an object from a force or impact by or with another object.
- a mechanosensory hydrogel comprising a recombinant mechanosensory monomer or polymer as described herein to protect an object from a force or impact by or with another object.
- Such protective use finds particular application in the protection of space equipment against micro impacts from the likes of micrometeoroids and orbital and space debris (MMOD).
- MMOD micrometeoroids and orbital and space debris
- space debris encompasses both natural meteoroid and artificial (human-made) orbital debris.
- use also encompasses a method of protecting an object from a force or impact by or with another external object by the application or inclusion of a mechanosensory hydrogel comprising a recombinant mechanosensory monomer or polymer as described herein.
- the mechanosensory hydrogel comprising a recombinant mechanosensory monomer or polymer as described herein finds a yet further use as an adhesive and/or coating of materials used in products designed to protect an object or person from a force or impact from or with another object.
- a method of adhering or coating materials used in products designed to protect an object or person from a force or impact from or with another object by coating or incorporating a mechanosensory hydrogel comprising a recombinant mechanosensory monomer or polymer as described herein.
- the force may be a mechanical shock or shock wave resulting from impact with an object, for example a high velocity, hypervelocity and/or explosive object such as a projectile, a bullet or space debris.
- the mechanosensory hydrogel additionally substantially retains the object within its structure.
- NMR spectra of pGEL02 and pGEL03 overlaid with the corresponding single talin rod domains a. NMR spectrum of pGEL02 alone and b. pGEL02 (red) overlaid with mouse talin1 R9 (sky blue). c. NMR spectrum of pGEL03 alone and d. pGEL03 (magenta) overlaid with mouse talin1 R3 (blue).
- Figure 14 NMR spectra of pGEL04 overlaid with the corresponding single talin rod domains. a. NMR spectrum of pGEL04 alone and b.
- Figure 21 HSQC spectra of 15 N-labelled mutated R1 with wild type R1 assignments from Banno et al. overlaid, centred on the region where the cysteine in wild type R1 is positioned.
- Figure 22 Resistance of 300 mg/mL TSAM to shear strain at 25°C. Five consecutive amplitude sweeps using Anton Parr rheometer were performed on the same piece of 700 ⁇ L TSAM gel (pGEL01), the amplitude range increased from 0.01 – 100 ⁇ shear strain per sweep. A 2-minute rest was set to occur between each sweep.
- b First sweep.
- pGEL01 When exposed to strain pGEL01 unfolds into a linear string of helices extending to ⁇ 65 nm in length. g. When exposed to higher strain, pGEL01 unfolds fully into extended polypeptide, increasing to a length of ⁇ 156 nm. Complete refolding can occur once strain is removed. h. Representation of the three-armed network structure with applied strain, causing extension of protein into opened helices form, increasing fibre length.
- Figure 24 The internal fibre structure of TSAM and its macroscale characterisation.
- TEM transmission electron microscopy
- f-h Rheological measurements of TSAM. f.
- g. Phase angle against shear strain for sweeps 1-5 on TSAM.
- h. Shear stress against shear strain for sweeps 1-5 on TSAM.
- Figure 25. a. Amplitude sweep 1 on TSAM (error bars SEM).
- GFP-VD1 green fluorescent protein tagged-vinculin domain 1 protein
- GFP-VD1 + pGEL01 at 1:1 solid black line
- GFP-VD1 + pGEL01 at 3:1 solid red line.
- FIG. 31 Effects of GFP-VD1 on TSAM.
- a Representation of GFP-VD1 binding to unfolded pGEL in TSAM fibres, with resulting cartoon protein figures created in PyMOL using VD1 PDB structure 1U6H (Fillingham, I. et al (2005) Structure 13, 65-74).
- b Shear stress as a product of shear strain for buffer (triangles), GFP-VD1 (squares) and GFP (circles), showing GFP-VD1 treated TSAM reaches its yield point between 46-68% shear strain.
- d Transmitted light image of GFP-VD1 localised to TSAM fibres
- FIG. 1 diagram of the light gas gun apparatus with the key stages after the shot is triggered.
- c image of TSAM and how it is prepared as a target.
- the TSAM is loaded into a target plate constructed of steel (Blast tank exit aperture (BTEA), stainless 304), with tape used to seal the back of the hole, followed by an aluminium back plate (Al 5083).
- BTEA Blast tank exit aperture
- Al 5083 Al 5083
- d-e. results from control gel
- e Hole formed in tape from basalt projectile.
- f Crater formed in aluminium back plate.
- g-I results from TSAM g. Mostly intact TSAM after basalt impact at 1.5 km/s. h.
- SEQ ID NO:5 engineered amino acid sequence of the R9 rod domain derived from mouse Talin 1.
- SEQ ID NO:6 engineered amino acid sequence of the R13 rod domain derived from mouse Talin 1.
- SEQ ID NO:7 linker sequence for use between single (non-sequential) rod domain sequences.
- SEQ ID NO:8 specific inter-sequence linker sequence.
- SEQ ID NO:9 N-terminal adaptation.
- SEQ ID NO:10 – specific N-terminal adaptation.
- SEQ ID NO:12 specific C-terminal adaptation.
- SEQ ID NO:13 example expression sequence.
- SEQ ID NO:14 example expression sequence.
- SEQ ID NO:15 example expression sequence.
- SEQ ID NO:16: – pGEL01 engineered expression sequence of R1-R2-R3 rod domains in series.
- SEQ ID NO:17 – pGEL02 engineered expression sequence of three copies of the R9 rod domain sequence in series.
- SEQ ID NO:18 – pGEL03 engineered expression sequence of three copies of the R3 rod domain sequence in series.
- SEQ ID NO:19 – pGEL04 engineered expression sequence of three copies of the R1 rod domain sequence in series.
- SEQ ID NO:20 – pGEL05 engineered expression sequence of R9-R3-R9 rod domain sequences in series.
- SEQ ID NO:21 – pGEL06 engineered expression sequence of R3-R9-R3 rod domain sequences in series.
- SEQ ID NO:22 – pGEL07 engineered expression sequence of three copies of the R13 rod domain sequence in series.
- SEQ ID NO:24 – Sequence for mutated R1 derived from mouse talin 1 and including an expression sequence.
- SEQ ID NO:25 Sequence for wild-type R2 derived from mouse talin 1 and including an expression sequence.
- SEQ ID NO:26 Sequence for mutated R2 derived from mouse talin 1 and including an expression sequence.
- N-butylamine (1.00 mL, 1.00 mmol) was added and the mixture was stirred at room temperature for 1 hour. The solvent was removed in vacuo and the resulting white powder was re-dissolved in acetic anhydride (6.00 mL). To this solution, sodium acetate (0.50 g, 6.10 mmol) was added, and the mixture was heated at 80 ⁇ C under reflux for 2 hours. The solution was diluted with distilled water (50.00 mL) and washed with diethyl ether (3 x 50.00 mL). The organic layer was collected and further washed with 0.1 M hydrochloric acid (1 x 50.00 mL) and 0.1 M sodium hydroxide (1 x 50.00 mL).
- Compound 2 (Cross-linker): Compound 2 (1,1',1''-(nitrilotris(ethane-2,1-diyl))tris(1H-pyrrole-2,5-dione; Figure 2b) was synthesised as described by Hanlon et al ((2017) Polymer Chemistry 8, 5120-5128) with minor modifications. A solution of maleic anhydride (0.59 g, 6.00 mmol) in anhydrous dimethyl formamide (DMF) (2.43 mL) was prepared under inert atmosphere and cooled to 0 °C.
- DMF dimethyl formamide
- the organic layer was collected, concentrated using rotary evaporation, resuspended in DCM (50.00 mL) and further washed with saturated sodium bicarbonate solution (6 x 50.00 mL). The organic layer was collected and concentrated using rotary evaporation to obtain the crude product.
- the crude product was purified using silica chromatography, 85:15 (ethyl acetate:hexane). The resulting pure yellow crystalline product was dried under vacuum overnight with a yield of 9% (0.21 g, 0.54 mM).
- Electrospray ionisation mass spectrometry was performed on an Agilent HPLC system connected to a Bruker micrOTOF-Q mass spectrum instrument. Spectra were analysed using Bruker’s Compass Data Analysis software. All samples were run using solvent A (0.05% TFA in water) and solvent B (80% acetonitrile, 0.045% TFA in water). Samples were prepared at a concentration of 100 ⁇ M peptide in phosphate buffer (20 mM NaH 2 PO 4 .2H 2 O, 50 mM NaCl, pH 7.4) and reduced with 5 mM TCEP. Following a 10 minute reduction time, the respective compound was added at a 10:1 ratio and allowed to react for two hours.
- FIG. 1 shows the LCMS characterisation of compounds 1 and 2, in which it was confirmed that all maleimide groups in both compound 1 and compound 2 were capable of binding biological macromolecules.
- C cysteine attachment sites for attachment of the crosslinker.
- pGEL01 engineered expression sequence of R1-R2-R3 rod domains: MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTGCGGGGSGGGGSGGGGSGSRGHMPPL TSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQVD AITAGTASVVNLTAGDPAETDYTAVGSAVTTISSNLTEMSRGVKLLAALLEDEGGNGRPLLQ AAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDTDPHFQDVLMQ LANAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQSALSTSQLVASTKVVAPTISSPVS QEQLVEAGRLVAKAVEGSVSASQAATEDGQLLRGVGAAATAVTQALNELLQHVKAHATGA GPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGES
- pGEL03 sequence engineered expression sequence of three copies of the R3 rod domain in series MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTGCGGGGSGGGGSGGGGSGSAHATGAG PAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRK LLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNAIKKGGGGGG SGGGGSAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIK ADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMAT NAAAQNAIKKGGGGSGGGGSAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQ ARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLR
- pGEL05 sequence engineered expression sequence of R9-R3-R9 rod domains MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTGCGGGGSGGGGSGGGGSGSAPGQLES ETAIAALNSSLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEA SQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGG NPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGGGGGSGGGGSAHATGAGPAG RYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLS AAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNAIKKGGGGSGG GGSAPGQLESETAIAALNSSLRDLDQASLAAVSQQLAPREGISQEALHT
- pGEL06 sequence engineered expression sequence of R9-R3-R9 rod domains MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTGCGGGGSGGGGSGGGGSGSAHATGAG PAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRK LLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNAIKKGGGG SGGGGSAPGQLESETAIAALNSSLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEI SHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAE SALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGGGGGSGG GGSAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNA
- pGEL07 sequence engineered expression sequence of three copies of the engineered R13 rod domain in series MHHHHHHGKPIPNPLLGLDSTENLYFQGIDPFTGCGGGGSGGGGSGGGGSGSDPTVIAE NELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRE LVAQGKVGAIPANALDDGQWSQGLISAARMVAAATNNLSEAANAAVQGHASQEKLISSAK QVAASTAQLLVASKVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFEDGGGGSG GGGSDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSA LVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMVAAATNNLSEAANAAVQGH ASQEKLISSAKQVAASTAQLLVASKVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAA
- Protein engineering The genes encoding pGEL01 (SEQ ID NO:16), pGEL02 (SEQ ID NO:17), pGEL03 (SEQ ID NO:18), pGEL04 (SEQ ID NO:19), pGEL05 (SEQ ID NO:20), pGEL06 (SEQ ID NO:21), pGEL07 (SEQ ID NO:22), wildtype R1 (SEQ ID NO:23), mutated_R1 (SEQ ID NO:24), wildtype R2 (SEQ ID NO:25), mutated_R2 (SEQ ID NO:26), wildtype R3 (SEQ ID NO:27), GFP (green fluorescent protein; SEQ ID NO:28) and GFP-labelled vinculin VD1 (GFP-VD1; SEQ ID NO:29) and were constructed in pET-151 vectors (GeneArt, ThermoFisher).
- the proteins were expressed in BL21(DE3)* E. coli (Fisher). Protein purification was achieved using HisTrap HP columns (Cytiva®) for His-tag based affinity chromatography using an AKTA start protein purification system (Cytiva). Following purification, proteins were dialysed in phosphate buffer (20 mM NaH2PO4.2H2O, 50 mM NaCl, pH 7.4). Protein expression and purification: pGEL01, GFP-VD1, wildtype R1, mutated_R1, wildtype R2, mutated_R2, wildtype R3 and GFP were transformed into BL21(DE3) cells.
- the resulting dialysed sample was loaded onto a HiTrap Q HP column connected to an AKTA start system (Cytiva®) and eluted with Q buffer B (20 mM Tris, 1M sodium chloride). Resulting pure protein was dialysed into phosphate buffer (20 mM NaH 2 PO 4 .2H 2 O, 50 mM NaCl, pH 7.4) overnight, ready for use.
- Q buffer B 20 mM Tris, 1M sodium chloride
- Resulting pure protein was dialysed into phosphate buffer (20 mM NaH 2 PO 4 .2H 2 O, 50 mM NaCl, pH 7.4) overnight, ready for use.
- the pGEL01, pGEL02, pGEL03, pGEL04, pGEL05 and pGEL06 were also expressed in minimal media containing 15 N-labelled ammonium chloride to produce 15 N-labelled proteins and purified by Ni affinity and anion exchange (Fig.6A-F).
- DNA sequence encoding either SpyTag or SpyCatcher can be recombinantly introduced into the DNA sequence encoding a protein or amino acid sequence of interest, forming a fusion protein.
- These fusion proteins can be covalently linked when mixed in a reaction through the SpyTag/SpyCatcher system. In this way, bioconjugation can be achieved between two recombinant proteins that would otherwise be restrictive or impossible with traditional direct genetic fusion between the two proteins.
- a pair of monomers were designed to be used together, one containing pGEL01 gene with two SpyTag peptides at each terminus separated by flexible linkers, and another containing pGEL01 gene with a SpyCatcher peptide at each termini ( Figure 8).
- Circular dichroism (CD) and 1 H- 15 N heteronuclear single quantum coherence (HSQC) nuclear magnetic resonance (NMR) were used to confirm that the R1-R3 domains of talin incorporated in pGEL01 retained the alpha helical folding of the wild type talin domains.
- All circular dichroism experiments were performed on the JASCO J-175 spectropolarimeter using a 1 mm pathlength quartz cuvette.
- Far UV-spectra were obtained between 200-260 nm with an average of 4 scans at 100 nm/min, 0.5 nm step resolution, 1.0 second response and 0.5 nm bandwidth.
- CD bandwidth was set to 222 nm.
- NMR spectrum of pGEL02 showed sharp peaks (Figure 13A), which overlaid well with a spectrum of 15 N-labelled mouse Talin1 R9 (Figure 13B).
- NMR spectrum of pGEL03 also has sharp clear peaks ( Figure 13C) and overlaid well with mouse talin1 R3 spectrum ( Figure 13D).
- the NMR spectrum of pGEL04 showed sharp, clear peaks ( Figure 14A) which overlaid well with the spectrum of 15 N-labelled mouse Talin1 R1 ( Figure 14B).
- pGEL05 and pGEL06 were designed to investigate properties of engineered monomer containing different rod domains, specifically R3 and R9 domains.
- Circular dichroism (CD) datasets were also collected for pGEL02, pGEL03, pGEL05, and pGEL06 to investigate their folding changes and thermal stabilities. These engineered monomers have alpha helical folding at 20°C, and the structures were completely lost at 90°C (pGEL02 and pGEL03) or 95°C (pGEL05 and pGEL06) ( Figures 16A-D, lower panels).
- pGEL02 presented a T m of 51.0°C (Figure 16A, upper panel) and pGEL03 showed much higher stability at high temperature (Figure 16B, upper panel), which is to be expected as the R3 domain is relatively thermally stable.
- the T m of pGEL03 was 76.2°C.
- the melting curve of pGEL01 showed three distinct melting steps ( Figure 17A), with T m1 occurring at 63.3°C, T m2 at 68.5°C and T m3 still not completely unfolded within the temperature range tested.
- CD scan data confirmed the helical structure, which was mostly gone at 95°C ( Figure 17B).
- the melting curve for pGEL04 showed only one unfolding step occurring at 68.9°C ( Figure 18A), as expected due to the presence of only one type of rod domain.
- CD scan data confirmed the helical structure, which was mostly gone at 95°C (Figure 18B).
- Figure 19 shows the melting curve of mouse talin1 R13 showing that R13 was still in the middle of unfolding phase at 90°C.
- R13 is known to have a similar mechanical strength to R9, while thermally stable rod domain R3 is known as the weakest rod domain under mechanical force.
- 2D HSQC spectra of 15 N-labelled mutated R1 ( Figure 20) show that folding was retained compared to the wild type R1 from Banno et al (Journal of Biological Chemistry (2012) 287, 13799-13812) overlaid and that very little change to the structure occurred from the single mutation in the mutated R1.
- Figure 21 is the HSQC spectra of 15 N-labelled mutated R1 with wild type R1 assignments from Banno et al (supra) overlaid, centred on the region where the cysteine in wild type R1 was positioned.
- TSAM Talin Shock Absorbing Material
- pGEL01 a monomer concentration of 300 mg/mL was tested in comparison with 200 mg/mL used in previous experiments.
- Rheometry was performed at a temperature of 25°C on a single piece of TSAM. Five amplitude sweeps were performed in total and the data from each amplitude sweep are shown in Figure 22.
- the R1-R3 domains of talin in pGEL01 provide a stepwise unfolding when exposed to force, with the wild type domains exhibiting threshold unfolding forces of 20, 15 and 5 pN respectively (Yao, M. et al supra).
- the resulting talin shock absorbing material is a hydrogel that contains monomeric units capable of refolding upon removal of force, retaining its energy dissipating mechanism following any potential impact events. Due to the endothermic energy dissipating mechanisms in the TSAM, the heating of the captured projectiles seen in aerogels would not be observed, offering a solution to several of the limitations seen with current state of the art impact absorption materials.
- a recombinant form of the mechanosensitive protein talin was incorporated into a monomeric unit and crosslinked, resulting in the production of a TSAM.
- TSAMs were shown not only to absorb the impact, but to capture/preserve the projectile.
- Engineered Talin Shock Absorbing Material (TSAM) structural characterisation Following formation of a TSAM using pGEL01 monomers, characterisation of the internal network structure was conducted. Preparation: A 30:1 ratio of TCEP:cysteine was slowly added to a solution of pGEL01 in phosphate buffer (pH 7.4).
- the pGEL01 solution was run through PD10 desalting columns (Cytiva) and the flow through was then re-applied to desalting columns for a second run through to ensure TCEP removal.
- the pGEL01 solution was concentrated to the desired concentration using 30 kDa MWCO concentrators (Sigma).
- the TSAM was then formed through the addition of compound 2 at 1:1 maleimide:sulfhydryl. Samples were left to set at 4 ⁇ C overnight.
- Immuno-gold staining and transmission electron microscopy A 2 ⁇ l of sample was applied to carbon/formvar 400 mesh gold grids (Agar Scientific) and allowed to settle on the grid for 5 minutes.
- the sample was then fixed in 2% formaldehyde and 0.5% glutaraldehyde in 100 mM sodium cacodylate buffer (CAB) pH 7.2 for 15 minutes at room temperature. Samples were washed 2 x 5 minutes in CAB and 2 x 5 minutes in 20 mM Tris, 500 mM NaCl, 0.1% BSA and 0.5% Tween 20 (TBST). Grids were blocked in 2% BSA in TBST for 30 minutes and then moved into a 20 ⁇ L drop of anti His-Tag primary antibody (Sigma) diluted 1:100.
- CAB sodium cacodylate buffer
- Grids were washed 6 x 2 minutes in drops of TBST before incubation in Goat anti-mouse IgG conjugated to 5 nm gold (British Biocell International) diluted 1:50 for 30 minutes. Grids were washed for 6 x 2 minutes in TBST and 6 x 2 minutes in distilled water. Negative controls were performed as above but primary antibody was replaced with TBST. Samples were then air dried and negative stained in 2% aqueous uranyl acetate. Samples were viewed in a Jeol 1230 Transmission electron microscope at 80 kV and images were recorded on a Gatan One View 16 MP digital camera.
- TSAM Scanning electron microscopy: The TSAM was dehydrated to form a xerogel and placed on a carbon tab mounted onto an aluminium stub. Imaging was achieved using a Hitachi S-3400N scanning electron microscope with elemental dispersive X-ray analysis and analysed using Oxford instruments AZtec software. His-tagged gold immunostaining of the TSAM, imaged using transmission electron microscopy (TEM), confirmed the presence of pGEL01 in a lattice formation, displaying pore sizes of approximately 100 nm ( Figure 24a).
- TEM transmission electron microscopy
- the TSAM was left in the respective solution at 2 mg/mL overnight before rheological measurements were performed. Subsequent rheological characterisation of TSAMs provided strong evidence for the induced unfolding of the talin domains within the material when exposed to shear strain, indicating that the energy dissipating mechanisms of talin were successfully incorporated into TSAMs.
- the dynamic shear storage (G’) and loss modulus (G”) as a product of shear strain presented a linear viscoelastic region (LVER) extending across the full range of shear strain tested ( Figure 24f).
- shear strain correlations corroborate these results, revealing an exponential increase in shear modulus (G), a measure of rigidity, with accumulated sweeps, further illustrating the strain stiffening within TSAM (Figure 24h). Furthermore, sweeps 4 and 5 reached apparent shear yield points, beginning to move into viscous stress as seen by the induction of a slope, subsequently transitioning back into a linear gradient indicating the reoccurrence of elastic behaviour.
- G shear modulus
- An optical density (OD) scan to measure at wavelengths between 300 – 1000 nm was performed on triplicate samples of pGEL01 before adding a tripodal maleimide crosslinker (Formula I) then, after setting, heating to 25°C, then 35°C then 45°C with wavelength scans repeated at each temperature.
- three repeats of 100 ⁇ L pGEL01 were placed in a 96 well plate along with controls of PBS buffer.
- An optical density scan was performed at wavelengths between 300 – 1000 nm in a plate reader at 25°C before the addition of crosslinker, using PBS as a blank. After setting overnight, the resulting TSAM was heated sequentially in the plate reader to 25, 35 then 45°C and optical density measured at each temperature.
- Optical density data was plotted against wavelength for each condition and is shown in Figure 27.
- the data showed pGEL01 pre- and post-crosslinker addition absorbs highly around 300 nm.
- maleimides like the crosslinker, reportedly absorb highly around 300 nm, the data shows pGEL01 before crosslinker addition also absorbs highly at this wavelength. This could be due to absorbance of certain amino acids around 280 nm.
- a small peak is observed around 410 nm, and another small peak at 660 nm, but neither appear unique to either crosslinked or uncrosslinked pGEL01. Statistical analysis has not yet been performed.
- plots from other samples also show a small peak in a similar region even if not picked for deconvolution ( Figures 28A, B, E). This is likely to be a small amount of protein aggregation formed during TSAM preparation, due to the high concentration of protein.
- Rheometry data collected using a single sample of set TSAM showed slightly lower moduli when amplitude sweeps were performed at 10°C compared to higher temperatures. This observation provides some early indication of TSAM’s resistance to strain at lower temperatures.
- Previous data Doolan J.A. et al (2023) Nat. Nanotech.18, 1060–1066) has indicated that TSAM’s resistance to strain improves with repeated strain, as the position of the gel fibres are optimised, rigidifying the material.
- Light gas gun (LGG) experiments The impact experiments were carried out using the Light Gas Gun facility at the University of Kent, Canterbury. The LGG is capable of accelerating projectiles smaller than 3.5 mm to speeds up to 7 km/s (Burchell, M.J. et al (1999) Measurement Science and Technology 10, 41-50.; Hibbert, R.
- the TSAM target was set in a blast tank exit aperture (BTEA) with a circular, 8 mm diameter aperture, sealed with tape, with an aluminium (5083) back plate placed behind.
- BTEA blast tank exit aperture
- Multiple 20-70 ⁇ m basalt particles were loaded into a single sabot utilising the “buckshot” method and were fired at roughly 1.5km/s, with the speeds recorded via the BTEA - Muzzle laser method as described by Burchell et al (supra).
- the target was removed prior to the air flushing procedure to reduce gun contamination on the TSAM.
- TSAM in addition to a commercially available polyvinylpyrrolidone hydrogel control, was placed in the target chamber of a light gas gun (LGG) and the following material properties investigated: (1) the ability of the TSAM to survive impact; (2) the ability of the TSAM to reduce the force of the projectile before impacting an aluminium back plate; and (3) the ability of the TSAM to capture the projectile in a preserved state. Spherical basalt particles between 20-70 ⁇ m were used as projectiles, loaded in a sabot as buckshot. A schematic for this experiment is given in Figures 32a-c.
- the transparency of the TSAM shown in Figure 32h and Figure 33 is an additional desirable property, allowing for the easy removal of caught projectiles from the TSAMs.
- SEM was performed on the impacted TSAM. Multiple basalt particles presenting a preserved circular shape were observed in the gel ( Figures 32j-k), confirmed as basalt with EDX analysis ( Figure 34).
- Figures 32j-k Multiple basalt particles presenting a preserved circular shape were observed in the gel
- Figures 32j-k confirmed as basalt with EDX analysis
- TSAM made using pGEL01 was applied to Twaron yarn (Teijin Aramid), supplied by National Institute of Standards and Technology, as well as to aluminium oxide ceramic beads. The aim of these experiments was to test the TSAM’s capability as an adhesive for these materials.
- Twaron yarn Teijin Aramid
- TSAM was applied to the aramid fibres or ceramic beads immediately after addition of the crosslinker then left to set at 10°C overnight. The next day, the results were observed.
- the aramid fibres appeared bonded together by a film of TSAM, which had dried ( Figure 36B). Upon manipulation, the aramid strands were firmly held together by TSAM.
- the ceramic beads were adhered together strongly by TSAM, and also adhered to the surface of the container (Figure 36C). Force applied to remove the ceramic beads from the container caused the surface of the ceramic to break. The beads could also be separated from each other by force, also breaking the surface of the ceramic ( Figure 36D).
- the materials were then taken forward for imaging by scanning electron microscopy (SEM). SEM imaging of the aramid fibres adhered by TSAM revealed the fibres embedded within TSAM ( Figure 37), where the TSAM shows some stretching/snapping behaviour. Elemental X-ray analysis showed the elemental distribution of the imaged material, where aramid fibres appear red indicating high carbon content, and the TSAM appears green/light blue indicating high sulphur and oxygen content ( Figure 37B).
- TSAMs can absorb the full force of supersonic impacts by basalt particles and larger pieces of aluminium shrapnel, providing the first example of a protein material capable of absorbing supersonic projectile impacts.
- talin domains within TSAM Through the refolding of talin domains within TSAM following the removal of force, potential reusability of TSAM is an additional property incurred if not directly penetrated.
- talin contains thirteen helical domains, each with unique unfolding forces, these TSAMs may be tuneable by modifying the talin domains featured in the monomer unit offering the potential for tailoring toward a diverse array of mechanical properties and resulting applications.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB2216633.4A GB202216633D0 (en) | 2022-11-08 | 2022-11-08 | Mechanosensory hydrogel |
| PCT/GB2023/052918 WO2024100399A1 (en) | 2022-11-08 | 2023-11-08 | Talin-based mechanosensory hydrogel |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP4615866A1 true EP4615866A1 (en) | 2025-09-17 |
Family
ID=84839829
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP23817802.4A Pending EP4615866A1 (en) | 2022-11-08 | 2023-11-08 | Talin-based mechanosensory hydrogel |
Country Status (3)
| Country | Link |
|---|---|
| EP (1) | EP4615866A1 (en) |
| GB (1) | GB202216633D0 (en) |
| WO (1) | WO2024100399A1 (en) |
-
2022
- 2022-11-08 GB GBGB2216633.4A patent/GB202216633D0/en not_active Ceased
-
2023
- 2023-11-08 WO PCT/GB2023/052918 patent/WO2024100399A1/en not_active Ceased
- 2023-11-08 EP EP23817802.4A patent/EP4615866A1/en active Pending
Also Published As
| Publication number | Publication date |
|---|---|
| WO2024100399A1 (en) | 2024-05-16 |
| GB202216633D0 (en) | 2022-12-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Doolan et al. | Next-generation protein-based materials capture and preserve projectiles from supersonic impacts | |
| JP5912077B2 (en) | Method for producing a polymer of spider silk protein | |
| EP2534484B1 (en) | Peptide tag systems that spontaneously form an irreversible link to protein partners via isopeptide bonds | |
| Drnovšek et al. | Size of silk fibroin β-sheet domains affected by Ca 2+ | |
| Ping et al. | Organized intrafibrillar mineralization, directed by a rationally designed multi-functional protein | |
| Sahoo et al. | Electrostatic-driven self-sorting and nanostructure speciation in self-assembling tetrapeptides | |
| Lefevre et al. | Sea star-inspired recombinant adhesive proteins self-assemble and adsorb on surfaces in aqueous environments to form cytocompatible coatings | |
| Mhuka et al. | Chemical, structural and thermal properties of Gonometa postica silk fibroin, a potential biomaterial | |
| WO2003056297A2 (en) | Self-assembling polymers, and materials fabricated therefrom | |
| WO2024100399A1 (en) | Talin-based mechanosensory hydrogel | |
| AU2016319289A1 (en) | Nepovirus coat protein fusion polypeptides and their use | |
| EP3765101B1 (en) | Beta-solenoid proteins and their application in textile production | |
| Zhang et al. | Supramolecular control over the variability of color and fluorescence in low-molecular-weight glass | |
| Choi et al. | Thermoresponsive, dually cross-linked elastin-like-polypeptide (ELP) micelle hydrogel with recovery properties | |
| de C. Bittencourt et al. | Molecular dynamics of synthetic flagelliform silk fiber assembly | |
| Hao et al. | Characterization and assembly investigation of a dodecapeptide hydrolyzed from the crystalline domain of Bombyx mori silk fibroin | |
| KR101189192B1 (en) | Fusion protein comprising ferritin and GALA peptide, cage protein formed thereby, and novel use thereof | |
| Wang et al. | Architectural control of rod-coil block polypeptide thermoresponsive self-assembly via de novo design of coiled-coil orientation | |
| KR20110003547A (en) | Artificial protein scaffold | |
| CN100489101C (en) | G-eGFP protein, preparation method, and application | |
| US10220098B2 (en) | Artificially engineered protein hydrogels to mimic nucleoporin selective gating | |
| Abe et al. | Novel observation of a circular dichroism band originating from amyloid fibril | |
| Hsia et al. | Identification and synthesis of novel biomaterials based on spider structural silk fibers | |
| WO2008024105A2 (en) | Nanocomposites of repeat sequence proteins and phyllosilicate clays and their preparation | |
| US9359457B2 (en) | Protein-based conjugates and self-assembled nanostructures |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20250602 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) | ||
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 40130352 Country of ref document: HK |