EP4577233A1 - Chimeric antigen receptor (car) to a tcr beta-chain variable region - Google Patents

Chimeric antigen receptor (car) to a tcr beta-chain variable region

Info

Publication number
EP4577233A1
EP4577233A1 EP23764369.7A EP23764369A EP4577233A1 EP 4577233 A1 EP4577233 A1 EP 4577233A1 EP 23764369 A EP23764369 A EP 23764369A EP 4577233 A1 EP4577233 A1 EP 4577233A1
Authority
EP
European Patent Office
Prior art keywords
seq
car construct
cell
car
fragment
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP23764369.7A
Other languages
German (de)
French (fr)
Inventor
Anastasios Karadimitris
Aileen ROWAN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ip2ipo Innovations Ltd
Original Assignee
Imperial College Innovations Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Imperial College Innovations Ltd filed Critical Imperial College Innovations Ltd
Publication of EP4577233A1 publication Critical patent/EP4577233A1/en
Pending legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/15Natural-killer [NK] cells; Natural-killer T [NKT] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/50Cellular immunotherapy characterised by the use of allogeneic cells

Definitions

  • the invention is especially concerned with conventional T cells and invariant natural killer T (iNKT) cells expressing anti-TCRV ⁇ CARs and methods for making the same.
  • the invention extends to nucleic acids and vectors encoding the anti-TCRV ⁇ CARs, and to pharmaceutical compositions comprising the constructs and cells, and to medical uses of the compositions, anti-TCRV ⁇ CAR constructs and T cells and iNKT cells expressing anti-TCRV ⁇ CARs.
  • TCR cell surface T-cell receptor
  • TCRV ⁇ subunits are encoded by TRBV genes, of which there are 23 families and 114 alleles in humans with each family comprising 0.5-9% of the normal T-cell repertoire, with TCRV ⁇ 2 being the most frequent.
  • Signals from the TCR determine cell fate in normal T cells, and components of the TCR signalling pathway are frequently mutated in TCL including ATL, indicating a driving role for the TCR in TCL oncogenesis.
  • CAR-T therapeutic approaches in B cell leukaemias and lymphomas targeting pan-B cell markers, such CD19 and CD20, can induce sustained clinical remissions in up to 40% of patients with relapsed/refractory disease, at the expense of clinically tolerable pan-B-cell depletion and hypoglobulinaemia .
  • pan-T cell depletion would result in profound immunosuppression that is not clinically tolerable.
  • anti-CD4 CAR-T treatment has also been proposed for these lymphomas (see, for example, the clinical trial NCT03829540). Unless rescued by a stem cell transplant, such an approach would also result in immunosuppression akin to acquired immunodeficiency syndrome.
  • Other CAR targets include CD5 and CD7; however, these are widely expressed on healthy T cells and can cause a fratricide reaction, unless CAR effector cells are additionally genetically edited to lack expression of these markers 8 .
  • T-cell malignancies such as T-cell lymphoma, including ATL
  • diseases such as certain autoimmune diseases caused directly or indirectly by pathogenic, non- malignant T cells, as well as for targeting normal, non-pathogenic T cells.
  • iNKT cells are restricted by CDid, a non-polymorphic, glycolipid-presenting HLA class I -like molecule expressed on monocytes, macrophages dendritic cells, B cells, thymocytes and some epithelial tissues 15 .
  • iNKT cells have a memory effector phenotype and can migrate to extra-lymphoid tissues 18 20 where they modulate a variety of immune responses, including anti-tumour and anti-pathogen responses 2122 .
  • clone BL37.2 for TCR V ⁇ 1, MPB2D5 for TCR V ⁇ 2, FIN9 for TCR V ⁇ 9 and C21 for TCR V ⁇ 11).
  • anti-V0 CAR-T cells and CAR-iNKT cells harbouring the CAR of the invention can successfully kill in-vitro expanded primary T cells and ex-vivo adult T cell leukaemia (ATL) cells, which express the corresponding TCRV ⁇ subunit, with surprisingly minimal off target killing of healthy T cells which express other TCRV ⁇ subunits.
  • ATL adult T cell leukaemia
  • the inventors have successfully demonstrated that CAR-iNKT activity was significantly enhanced when challenged with CD 1d-expressing targets that had been pulsed with a-Galactosylceramide, a selective ligand of iNKT cells that leads to their activation. Ligation of the anti-V0 CAR induced degranulation, secretion of IFN-y and
  • TNF- ⁇ TNF- ⁇
  • upregulation of expression of Perforin and Granzyme by T and iNKT effectors Targeting T cells, which express a single V0 subunit, spared virus-specific CTL.
  • CAR- mediated killing had no effect on the expression of the virus which causes ATL, Human T cell leukaemia virus type-1.
  • anti-TCRV ⁇ CAR-iNKT but not anti-CD19 CAR- iNKT
  • CARs targeting TCRV ⁇ subunits can efficiently kill malignant T cell clones with minimal off-target cytotoxicity.
  • CAR-iNKT effectors displayed enhanced killing activity in the presence of iNKT ligands, reducing the risk of acute graft versus host disease and are suitable for use as an off-the shelf product for infusion to third party donors.
  • the CAR construct is specific for a T-cell receptor (TCR) beta-chain variable region (V ⁇ ) subunit of a normal, non-pathogenic T cell.
  • the human CD8a when the CAR construct is expressed in a human effector T cell, the human CD8a provides optimal expression of the CAR construct in the human effector cell.
  • the human CD8a signalling peptide can have an amino acid sequence referred to herein as SEQ ID No:s, as follows:
  • the light chain of the scFv of the anti-TCRV ⁇ 2 antibody can have an amino acid sequence referred to herein as SEQ ID No:i, as follows: DIVLTQSPASLAVSLGQRATI SCRASKSVSILGTHLIHWYQQKPGQPPKLLIYAASNLESGVPARFSGSGSETVFTLN
  • TCRV ⁇ 2 antibody is referred to herein as SEQ ID No: 12, as follows:
  • the CAR construct comprises a VH chain having an amino acid sequence substantially as set out in SEQ ID NO:13, or a fragment or variant thereof.
  • nucleotide sequence encoding the VH of the scFv of the anti- TCRV ⁇ 1 antibody is referred to herein as SEQ ID No:iq, as follows:
  • the VH chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 14, or a fragment or variant thereof.
  • the CAR construct may comprise a scFv comprising a VL and/or a VH from an anti-TCRV ⁇ 9 antibody.
  • the CAR construct preferably comprises a scFv comprising a VL and a VH from an anti-TCRV ⁇ 9 antibody.
  • the VL and VH sequences may, in one embodiment, be derived from FIN9 (i.e. the hybridoma clone name of an anti-TCRV ⁇ 9 monoclonal antibody) and comprise a light chain variable region and a heavy chain variable region for binding the TCRV ⁇ 9 antigen.
  • the light chain of the scFv of the anti-TCRV ⁇ 9 antibody can have an amino acid sequence referred to herein as SEQ ID NO:15, as follows:
  • the CAR construct comprises a VL chain having an amino acid sequence substantially as set out in SEQ ID NO:15, or a fragment or variant thereof.
  • the nucleotide sequence encoding the VL of the scFv of the anti- TCRV ⁇ 9 antibody is referred to herein as SEQ ID No: 16, as follows:
  • nucleotide sequence encoding the VH of the scFv of the anti- TCRV ⁇ 9 antibody is referred to herein as SEQ ID No: 18, as follows:
  • the VH chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 18, or a fragment or variant thereof.
  • the CAR construct may comprise a scFv comprising a VL and/or a VH from an anti-TCRV ⁇ 11 antibody.
  • the CAR construct preferably comprises a scFv comprising a VL and a VH from an anti-TCRV ⁇ 11 antibody.
  • the VL and VH sequences may, in one embodiment, be derived from C21 (i.e. the hybridoma clone name of an anti-TCRV ⁇ 11 monoclonal antibody) and comprise a light chain variable region and a heavy chain variable region for binding the TCRV ⁇ 11 antigen.
  • the VL chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 20, or a fragment or variant thereof.
  • the heavy chain of the scFv of the anti-TCRV ⁇ 11 antibody can have an amino acid sequence referred to herein as SEQ ID No:2i, as follows:
  • the CAR construct comprises a VH chain having an amino acid sequence substantially as set out in SEQ ID No:2i, or a fragment or variant thereof.
  • nucleotide sequence encoding the VH of the scFv of the anti- TCRV ⁇ 11 antibody is referred to herein as SEQ ID No:22, as follows:
  • the VH chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 22, or a fragment or variant thereof.
  • the VH (e.g. SEQ ID No: 9, 13, 17 or 21) and VL (e.g. SEQ ID No: 7, 11, 15 or 19) sequences, when in either orientation, are separated by a linker sequence.
  • the linker sequence may comprise at least one a G4S linker sequence, which maybe referred to herein as SEQ ID No:23, as follows:
  • the CAR construct comprises a linker sequence comprising an amino acid sequence substantially as set out in SEQ ID No:23, or a fragment or variant thereof.
  • the linker sequence may comprise a plurality of repeats of the G4S linker sequence.
  • the linker sequence may comprise two or three repeats of the G4S linker sequence (i.e. 2x G 4 S, or 3x G 4 S).
  • the CAR construct preferably comprises a hinge domain.
  • the hinge domain comprises: (i) an extracellular domain, or a portion thereof; (ii) a transmembrane (TM) domain, or a portion thereof; and/or (iii) a cytoplasmic domain, or a portion thereof.
  • the hinge domain comprises: (i) an extracellular domain, or a portion thereof; (ii) a transmembrane (TM) domain, or a portion thereof; and (iii) a cytoplasmic domain, or a portion thereof.
  • the hinge domain is configured for CAR display and anchoring on the CAR-T cell.
  • the hinge domain is disposed C-term of the antigen-binding domain, more preferably the VH chain.
  • the hinge domain comprises a CD8 ⁇ sequence, or a portion thereof, and more preferably a human CD8 ⁇ sequence, or a portion thereof.
  • a longer CD8 ⁇ -derived hinge as compared to a shorter CD8 ⁇ -derived hinge significantly decreases the toxicity of the CAR construct.
  • the hinge domain comprises or consists of substantially the full length of human CD8 ⁇ , or a portion thereof.
  • amino acid sequence of human CD8 ⁇ is referred to herein as SEQ ID No: 51, as follows: MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKP KAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQP LSLRPEACRPAAGGAVHTRGLDFACDI YIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPWKSGDKPSLSARY V [SEQ ID No: 51]
  • the CAR construct comprises or consists of a hinge domain that is derived from human CD8 ⁇ comprising at least a portion of the extracellular domain.
  • the amino acid sequence of a human CD8 ⁇ extracellular domain or a portion thereof is referred to herein as SEQ ID No: 24, as follows:
  • the CAR construct comprises a hinge domain comprising an amino acid sequence substantially as set out in SEQ ID No: 24, or a fragment or variant thereof.
  • the CAR construct comprises or consists of a hinge domain that is derived from human CD8 ⁇ comprising a full transmembrane helical domain.
  • the amino acid sequence of a human CD8 ⁇ full transmembrane domain is referred to herein as SEQ ID No:49, as follows:
  • the CAR construct comprises or consists of a hinge domain comprising an amino acid sequence substantially as set out in SEQ ID No:49, or a fragment or variant thereof.
  • the CAR construct comprises or consists of a hinge domain that is derived from human CD8 ⁇ comprising at least a portion of the cytoplasmic domain.
  • the amino acid sequence of a human CD8 ⁇ cytoplasmic domain or a portion thereof is referred to herein as SEQ ID No:5O, as follows:
  • the CAR construct comprises or consists of a hinge domain comprising an amino acid sequence substantially as set out in SEQ ID No:so, or a fragment or variant thereof.
  • the hinge comprising a portion of human CD8 ⁇ extracellular domain, human CD8 ⁇ full transmembrane domain, and a portion of human CD8 ⁇ cytoplasmic domain is defined by amino acids 128-210 of human CD8 ⁇ can have an amino acid sequence referred to herein as SEQ ID No:25, as follows: FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI YIWAPLAGTCGVLLLSLVITLY
  • the CAR construct comprises or consists of a hinge domain having an amino acid sequence substantially as set out in SEQ ID No:25, or a fragment or variant thereof.
  • the CD8 ⁇ -derived hinge comprising the cytoplasmic domain of human CD8 ⁇ is at least one amino acid longer than amino acids 204-206 of human CD8 ⁇ , as represented by SEQ ID No: 51 on the C-terminus. Therefore, preferably the CD8 ⁇ - derived hinge comprises the cytoplasmic domain of human CD8 ⁇ defined by amino acids 204-207 of human CD8 ⁇ , as represented by SEQ ID No: 51.
  • the CD8 ⁇ -derived hinge comprises the cytoplasmic domain of human CD8 ⁇ defined by amino acids 204-209 of human CD8 ⁇ , as represented by SEQ ID No: 51.
  • the construct comprises a hinge domain encoded by a nucleotide sequence substantially as set out in SEQ ID No: 26, or a fragment or variant thereof.
  • the CAR construct preferably comprises an intracellular domain, which comprises a primary stimulatory (or signalling) CD ⁇ chain and/or a co-stimulatory (or signalling) domain of CD28, and more preferably a co-stimulatory/ signalling domain of CD28 and a stimulatory CD ⁇ chain.
  • the intracellular domain is disposed 3’ of the sequence encoding the hinge domain.
  • the co-stimulatory domain of CD28 may be N-terminus of the CD ⁇ chain.
  • CD28 co-stimulatory domain significantly improved the efficacy of CD 19 CAR T cells in patients with B cell lymphoma and B cell acute leukaemia and provides TCRV ⁇ CARs with significant efficacy against T cell lymphoma and leukaemia in vitro and in vivo.
  • One embodiment of the 4-1BB signalling domain can have an amino acid sequence, which is referred to herein as SEQ ID No: 46, as follows:
  • the construct comprises a nucleotide sequence encoding an amino acid sequence substantially as set out in SEQ ID No: 46, or a fragment or variant thereof.
  • the 4-1BB signalling domain can be encoded by a nucleic acid sequence, which is referred to herein as SEQ ID No: 47, as follows:
  • the construct comprises a nucleotide sequence substantially as set out in SEQ ID No: 47, or a fragment or variant thereof.
  • the co-stimulatory domain of CD28 is referred to herein as SEQ ID NO:27, as follows:
  • theCARconstruct comprisesaco-stimulatorydomainofCD28havinganaminoacidsequencesubstantiallyassetoutinSEQIDNo:27,orafragmentorvariantthereof.
  • anucleotidesequenceencodingtheco-stimulatorydomainofCD28isreferredtohereinasSEQIDNo:28 asfollows: agaagcaagcggagccggctgctgcacagcgactacatgaacatgacccccagacggcctggccccaccagaaag cactaccagccttacgcccctcccagagacttcgccgctaccggtcc [SEQIDNo:28]
  • theco-stimulatoiydomainofCD28 isencodedbyanucleotidesequencesubstantiallyassetoutinSEQIDNo:28,orafragmentorvariantthereof.
  • thestimulatoryproteinCD ⁇ canhaveanaminoacidsequencereferredtohereinasSEQIDNo:29,asfollows: RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR [SEQIDNo:29]
  • anucleotidesequenceencodingthestimulatoiyproteinCD ⁇ isreferredtohereinasSEQIDNo:3O,asfollows: agagtgaagttcagcagaagcgccgacgccctgcctatcagcagggccagaaccagctgtacaacgagctgaac ctgggcagacgggaagagtacgatgtgctggacaaaagacgtggccgggaccctgagatggggggaaagccgaga aggaagaaccctcaggaaggcctgtacaatgaactgcagaaagataagatggcggaggcctacaatgaactgcagaaagataagatggcggaggcctacagtgagattggg atgaaaggcgagcgccggaggggcaaggggcacgat
  • Figure 1 provides a schematic map of an exemplary embodiment of the anti-TCRV ⁇ CAR construct.
  • the CAR construct comprises each of the elements in the following order: a 3’/N-term variable light chain of an anti-TCRV ⁇ antibody - a variable heavy chain of an anti-TCRV ⁇ antibody - a hinge - a co- stimulatory domain comprising CD28 - 3’/C-term stimulatory protein CD ⁇ .
  • N- and C-term indicates that the features are either upstream or downstream in the construct (protein or DNA, respectively), and is not intended to indicate that the features are necessarily terminal features.
  • the CAR construct comprises a s’/N-term signal peptide - a variable light chain of an anti-TCRV ⁇ antibody - a linker - a variable heavy chain of an anti-
  • the anti-TCRV ⁇ CAR construct is an anti-TCRV ⁇ 1 CAR (known herein as “BL37.2 CAR”).
  • the anti-TCRV ⁇ i CAR comprises a 2x G 4 S linker.
  • the anti-TCRV ⁇ i CAR (having a 2x G 4 S linker) has an amino acid sequence referred to herein as SEQ ID NO:31, as follows: MALPVTALLLPLALLLHAARPDVQMTQSPYNLAASPGESVSINCKASKSINKYLAWYQQKPGKPNKLLI YDGSTLQSG
  • the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No 131, or a fragment or variant thereof.
  • SEQ ID No:33 amino acid sequence referred to herein as SEQ ID No:33, as follows:
  • the CAR construct is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 38, or a fragment or variant thereof.
  • the anti-TCRV ⁇ CAR construct is an anti-TCRV ⁇ 9 CAR (known as “FIN9 CAR”).
  • the anti-TCRV ⁇ 9 CAR comprises a 2x G 4 S linker.
  • the anti-TCRV ⁇ 9 CAR construct has an amino acid sequence referred to herein as SEQ ID No:39, as follows:
  • the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No:39, or a fragment or variant thereof.
  • a nucleotide sequence encoding the anti-TCRV ⁇ 9 CAR (with 2x G 4 S linker) is referred to herein as SEQ ID No: 40, as follows: atggctctgcctgtgacagctctgctgctgcctctggccctgctgctgcatgccgccagacctGAGACCACCGTGACC
  • the CAR construct is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 40, or a fragment or variant thereof.
  • the anti-TCRV ⁇ 9 CAR construct (known as “FIN9 CAR”) comprise a 3x G 4 S linker.
  • the anti-TCRV ⁇ 9 CAR (having a 3x G 4 S linker) can have an amino acid sequence referred to herein as SEQ ID No:4i, as follows:
  • the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No: 41, or a fragment or variant thereof.
  • a nucleotide sequence encoding the anti-TCRV ⁇ 9 CAR (with 3x G 4 S) is referred to herein as SEQ ID No: 42, as follows: atggctctgcctgtgacagctctgctgctgcctctggccctgctgctgcatgccgccagacctGAGACCACCGTGACC CAGAGCCCCGCCAGCCTGAGCGTGGCCACCGGCGAGAAGGTGACCATCAGGTGCATCAGCAGCACCGACATCGACGAC GACATGAACTGGTACCAGCAGAAGAGCGGCGAGCCCCCCAAGCTGCTGATCAGCGAGGGCAACACCCTGAGGCCCGGC GTGCCCAGCAGGTTCAGCAGCAGCGGCTACGGCACCGACTTCGTGTTCACCATCGAGAACATGCTGAGCGAGGACGTG GCCGACTTCGTGTTCACCATCGAGAACATGCTGAGCGAGGACGTG GCCGACTACTTCGTGTTCACCATCG
  • the construct is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 42, or a fragment or variant thereof.
  • the anti-TCRV ⁇ CAR construct is an anti- TCRV ⁇ 11 CAR (known as “C21 CAR”).
  • the anti-TCRV ⁇ 11 CAR comprises have a 2x G 4 S linker.
  • the anti-TCRV ⁇ 11 CAR construct (having a 2x G 4 S linker) can have an amino acid sequence referred to herein as SEQ ID No: 43, as follows: MALPVTALLLPLALLLHAARPDIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKAGKSPKTLIYRANRLVDG
  • the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No 143, or a fragment or variant thereof.
  • a nucleotide sequence encoding the anti-TCRV ⁇ 11 CAR (with a 2x G 4 S linker) is referred to herein as SEQ ID No: 52, as follows:
  • the construct is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 52, or a fragment or variant thereof.
  • the anti-TCRV ⁇ 11 CAR construct (known as “C21 CAR”) comprises a 3x G 4 S linker.
  • the anti-TCRV ⁇ 11 CAR construct (having a 3x G 4 S linker) can have an amino acid sequence referred to herein as SEQ ID NO:44, as follows:
  • the CAR construct an amino acid sequence substantially as set out in SEQ ID No: 44, or a fragment or variant thereof.
  • SEQ ID No: 45 a nucleotide sequence encoding the anti-TCRV ⁇ 11 CAR (with a 3x G 4 S linker) is referred to herein as SEQ ID No: 45, as follows:
  • the CAR construct is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 45, or a fragment or variant thereof.
  • the inducing condition is selected from the group consisting of: inducer, irradiation (such as ionizing radiation, light), temperature (such as heat), redox state, tumor environment, and the activation state of the engineered mammalian cell.
  • the method comprises an initial step of isolating the effector cell from peripheral blood cells (PBCs).
  • the effector cell is activated with one or both of CD3 and CD28 antibodies.
  • the effector cell is activated with an interleukin.
  • the interleukin may be IL- 15.
  • the effector cell is activated with CD3 and CD28 antibodies and IL-15.
  • the nucleic acid and/or vector encoding the anti-TCRV ⁇ CAR may comprise any of nucleic acids or vectors described herein.
  • the T-cell neoplasms may be precursor T-cell neoplasms, such as T-lymphoblastic leukaemia / lymphoma or mature T-cell neoplasms, or Peripheral T cell lymphoma (PTCL).
  • T-lymphoblastic leukaemia / lymphoma or mature T-cell neoplasms
  • PTCL Peripheral T cell lymphoma
  • mature T-cell neoplasms comprise a diverse group of uncommon and aggressive diseases in which the patient’s T cells become cancerous. They are divided into three categories, i.e. nodal, extranodal and leukaemic, each of which are encompassed by the invention.
  • Nelarabine Arat®
  • Angioimmunoblastic T-cell lymphoma exemplifies a neoplasm characterized by intense inflammatory and immune reactions, as evidenced by its clinical, pathologic, cellular, and biologic properties.
  • tumour cells phenotypically resemble T follicular helper (Tfh) cells, they are considered to function similarly to some extent to nonneoplastic Tfh cells seen in reactive follicular hyperplasia.
  • follicles are not hyperplastic but are rather depleted or destroyed in vast majority of AITL cases.
  • AITL was recently reported to account for 36.1% of PTCL.
  • Cutaneous T-cell lymphoma constitute about 70-75% of the primary cutaneous lymphomas.
  • the CTCL may be a CTCL subtype selected from a group consisting of:
  • the invention also provides in a tenth aspect, a process for making the pharmaceutical composition according to the sixth aspect, the process comprising combining a therapeutically effective amount of the CAR construct according to the first aspect, the nucleic acid of the second aspect, the vector of the third aspect, or the effector cell according to the fourth aspect, and a pharmaceutically acceptable vehicle.
  • a “subject” may be a vertebrate, mammal, or domestic animal. Most preferably, the subject is a human being.
  • a “therapeutically effective amount” of the CAR construct, nucleic acid, vector, effector cell of composition is any amount which, when administered to a subject, is the amount of agent that is needed to treat the disease being treated, for example cancer, or produce the desired effect.
  • a “pharmaceutically acceptable vehicle” as referred to herein is any known compound or combination of known compounds that are known to those skilled in the art to be useful in formulating pharmaceutical compositions.
  • the composition comprising the CAR-effector cell is prepared and then delivered as a cell suspension, most preferably intravenously.
  • the pharmaceutical vehicle may be a liquid, and the pharmaceutical composition is in the form of a solution.
  • Liquid vehicles are used in preparing solutions, suspensions, emulsions, syrups, elixirs and pressurized compositions.
  • the active agent according to the invention may be dissolved or suspended in a pharmaceutically acceptable liquid vehicle such as water, an organic solvent, a mixture of both or pharmaceutically acceptable oils or fats.
  • the liquid vehicle can contain other suitable pharmaceutical additives such as solubilisers, emulsifiers, buffers, preservatives, sweeteners, flavouring agents, suspending agents, thickening agents, colours, viscosity regulators, stabilizers or osmo-regulators.
  • liquid vehicles for oral and parenteral administration include water (partially containing additives as above, e.g. cellulose derivatives, preferably sodium carboxymethyl cellulose solution), alcohols (including monohydric alcohols and polyhydric alcohols, e.g. glycols) and their derivatives, and oils (e.g. fractionated coconut oil and arachis oil).
  • the vehicle can also be an oily ester such as ethyl oleate and isopropyl myristate.
  • Sterile liquid vehicles are useful in sterile liquid form compositions for parenteral administration.
  • the liquid vehicle for pressurized compositions can be a halogenated hydrocarbon or other pharmaceutically acceptable propellant.
  • Liquid pharmaceutical compositions which are sterile solutions or suspensions, can be utilized by, for example, intramuscular, intrathecal, epidural, intraperitoneal, intravenous and particularly subcutaneous injection.
  • the agent may be prepared as a sterile solid composition that may be dissolved or suspended at the time of administration using sterile water, saline, or other appropriate sterile injectable medium.
  • nucleic acid or peptide or variant, derivative or analogue thereof which comprises substantially the amino acid or nucleic acid sequences of any of the sequences referred to herein, including variants or fragments thereof.
  • substantially the amino acid/nucleotide/peptide sequence can be a sequence that has at least 40% sequence identity with the amino acid/ nucleotide/ peptide sequences of any one of the sequences referred to herein, for example 40% identity with the sequences identified herein, and so on.
  • amino acid/ polynucleotide/ polypeptide sequences with a sequence identity which is greater than 65%, more preferably greater than 70%, even more preferably greater than 75%, and still more preferably greater than 80% sequence identity to any of the sequences referred to are also envisaged.
  • the amino acid/polynucleotide/polypeptide sequence has at least 85% identity with any of the sequences referred to, more preferably at least 90% identity, even more preferably at least 92% identity, even more preferably at least 95% identity, even more preferably at least 97% identity, even more preferably at least 98% identity and, most preferably at least 99% identity with any of the sequences referred to herein.
  • the skilled technician will appreciate how to calculate the percentage identity between two amino acid/polynucleotide/polypeptide sequences.
  • an alignment of the two sequences must first be prepared, followed by calculation of the sequence identity value.
  • the percentage identity for two sequences may take different values depending on:- (i) the method used to align the sequences, for example, ClustalW, BLAST, FASTA, Smith-Waterman (implemented in different programs), or structural alignment from 3D comparison; and (ii) the parameters used by the alignment method, for example, local vs global alignment, the pair-score matrix used (e.g.
  • a substantially similar nucleotide sequence will be encoded by a sequence which hybridizes to DNA sequences or their complements under stringent conditions.
  • stringent conditions the inventors mean the nucleotide hybridises to filter-bound DNA or RNA in 3x sodium chloride/ sodium citrate (SSC) at approximately
  • a substantially similar polypeptide may differ by at least i, but less than 5, 10, 20, 50 or too amino acids from the sequences shown herein.
  • Suitable nucleotide variants are those having a sequence altered by the substitution of different codons that encode the same amino acid within the sequence, thus producing a silent (synonymous) change.
  • Other suitable variants are those having homologous nucleotide sequences but comprising all, or portions of, sequence, which are altered by the substitution of different codons that encode an amino acid with a side chain of similar biophysical properties to the amino acid it substitutes, to produce a conservative change.
  • small non-polar, hydrophobic amino acids include glycine, alanine, leucine, isoleucine, valine, proline, and methionine.
  • Large non-polar, hydrophobic amino acids include phenylalanine, tryptophan and tyrosine.
  • the polar neutral amino acids include serine, threonine, cysteine, asparagine and glutamine.
  • the positively charged (basic) amino acids include lysine, arginine and histidine.
  • the negatively charged (acidic) amino acids include aspartic acid and glutamic acid. It will therefore be appreciated which amino acids may be replaced with an amino acid having similar biophysical properties, and the skilled technician will know the nucleotide sequences encoding these amino acids.
  • Figure 1 shows a schematic map of one embodiment of a coding sequence of an expression vector for an anti-TCRV ⁇ CAR lentiviral CAR of the invention.
  • the sequence includes a human CD8 ⁇ signal peptide, an antigen binding domain comprising a VL, flexible linker and VH, a CD8 ⁇ hinge domain that includes a transmembrane domain and cytoplasmic domain, and an intracellular signalling domain comprising a CD28 costimulatory domain and CD ⁇ stimulatory domain.
  • Figure 2a shows the membrane topology of a mature CAR of the invention.
  • the CD8 ⁇ signal peptide, VL, linker, and VH domains form the extracellular ectodomain, and the
  • CD8 ⁇ hinge domain comprises an ectodomain part, a plasma membrane (P.M.) and a cytoplasmic fragment.
  • the CD28 co-stimulatory domain and CD ⁇ stimulatory domain form the endodomain inside the cell;
  • Figure 2b represents one embodiment of a CAR of the invention referred to as MPB2D5 CAR GS3 CD8283Z (TCRVB 2 CAR).
  • Figure 3 provides structural details of the design of the coding sequence of each of various embodiments of exemplary anti-TCRV ⁇ CAR of the invention. From top to bottom, the Figure shows CARs specific to TCRV ⁇ 1 CAR (i.e. anti-TCRV ⁇ i CAR), TCRV ⁇ 2 CAR (i.e. anti-TCRV ⁇ 2 CAR), TCRV ⁇ 9 CAR (i.e. anti-TCRV ⁇ 9 CAR), and TCRV ⁇ 11 CAR (i.e. anti-TCRV ⁇ 11 CAR).
  • TCRV ⁇ 1 CAR i.e. anti-TCRV ⁇ i CAR
  • TCRV ⁇ 2 CAR i.e. anti-TCRV ⁇ 2 CAR
  • TCRV ⁇ 9 CAR i.e. anti-TCRV ⁇ 9 CAR
  • TCRV ⁇ 11 CAR i.e. anti-TCRV ⁇ 11 CAR.
  • Figure 4 shows plasmid maps of the anti-TCRV ⁇ i CAR (called BL37.2 CAR) construct shown in Figure 3.
  • the top map is for a first embodiment of an anti-TCRV ⁇ i CAR comprising a 2 x G 4 S linker and the lower map is for a second embodiment of an anti- TCRV ⁇ 1 CAR comprising a 3 x G 4 S linker.
  • Figure 5 shows plasmid maps of the anti-TCRV ⁇ 2 CAR (called MPB2D5 CAR) shown in Figure 3.
  • the top map is for a first embodiment of an anti-TCRV ⁇ 2 CAR comprising a 2 x G 4 S linker and the lower map is for a second embodiment of an anti-TCRV ⁇ 2 CAR comprising a 3 x G 4 S linker.
  • Figure 6 shows the plasmid maps of the anti-TCRV ⁇ 9 CAR (called FIN9 CAR) shown in Figure 3.
  • the top map is for a first embodiment of an anti-TCRV ⁇ 9 CAR comprising a 2 x G 4 S linker and the lower map is for a second embodiment of an anti-TCRV ⁇ 9 CAR comprising a 3 x G 4 S linker.
  • Figure 7 shows the plasmid maps of an anti-TCRV ⁇ 11 CAR (called C21 CAR) shown in Figure 3.
  • the top map is for a first embodiment of an anti-TCRV ⁇ 11 CAR comprising a 2 x G 4 S linker and the lower map is for a second embodiment of an anti-TCRV ⁇ 11 CAR comprising a 3 x G 4 S linker.
  • FIG 8 shows the specificity, cytokine production and cytotoxic activity of anti- TCRV ⁇ CAR-T cells of the invention.
  • Peripheral blood mononuclear cells (PBMC) from a normal donor were cultured alone or transduced with lentivirus which encoded the anti-VPi, V ⁇ 2 and VP9 CAR constructs.
  • PBMC Peripheral blood mononuclear cells
  • Five days post transduction, transduction efficiency was evaluated by protein L staining (see Figures 8A and B), and the frequency of CD3+ cells expressing each of the 24 TCRV ⁇ subunits was quantified (see Figure 8C). Values shown are the mean percentage of cells expressing each subunit normalised to the frequency of cells expressing that subunit in the non-transduced PBMC control from two (n 2) individuals.
  • Target cells were stained with CFSE and cocultured with effectors at a range of effector to target (E:T) ratios in duplicate. After 24I1, the cells were harvested and stained with yaad. The frequency of dead targets in each culture condition was assayed by flow cytometry. Results are representative of two or more independent experiments.
  • FIG. 16 provides a comparison of the effect of linker size on CAR-T efficacy.
  • Target cells were stained with CFSE co-cultured with effectors at a range of effector to target (E:T) ratios in duplicate. After 24h cells were harvested and stained with 7aad. The frequency of dead targets in each culture condition was assayed by flow cytometry.
  • Transduction efficiency was evaluated from 5 days post-transduction.
  • Cells were washed twice in cold PBS, incubated with 1 ug/ml streptavidin protein L (Pierce) for 45 min at 4 °C.
  • Cells were washed twice with PBS, stained with Live/dead near-infrared for 5 min at RT, washed with PBS 0.5% FBS and stained for 20 min at RT with streptavidin-PE/BV42i and anti-CD3, -CD4, -CD8, -TCRV ⁇ 11 and -TCRVa24-Jai8.
  • Cells were acquired the same day using a BD Fortessa and analysed using Kaluza (Beckman Coulter).
  • HTLV-1 Taxii-19 or Influenza A M158-66 Pentamer-APC for 10 minutes, after which anti-CD3-BV5io and -CD8-AF700 were added. After a further 20 min incubation at RT, cells were washed and fixed for 30 minutes by resuspending cells in 150 pl with Fixation buffer (Biolegend). After one wash with PBS, the frequency of live pentamer positive Cell trace violet + CD8+ T cells in each culture was assessed by flow cytometry.
  • Example 4 Anti-TCRVB CAR-iNKT cells for ‘off-the -shelf immunotherapy ofT cell malignancies
  • Example 6 Effect of anti-V/3 CAR-iNKT on antiviral CTL immunity and HTLV-1 viral status
  • CD4+ T cells were first cultured alone or in the presence of anti-V0i, -V ⁇ 2 and -CD19 CAR-iNKT cells for 18 hrs followed by evaluation by intracellular staining of the frequency of Tax-expressing CD4+ T cells.
  • CAR-iNKT cells targeting TCRV ⁇ chains do not impair CTL immunity against viral antigens, neither do their promote replication activity of HTLV-1, both important considerations for the safe treatment of TCL and ATL.
  • PBMC T cells were transduced with TCRV ⁇ 1 and V ⁇ 2 CARs which contained either the (648)2 or (648)3 linkers and co-cultured with primary T cell target cells which expressed either TCRV ⁇ i or TCRV ⁇ 2.
  • the present invention demonstrates that anti-TCRV ⁇ CAR immunotherapy can be developed as a sensitive, specific and highly effective strategy for the treatment of TCRV ⁇ -expressing T cell malignancies.
  • TCL the distribution of the TCRV ⁇ repertoire in T cell malignacies is the same as in normal T cells, approximately 15% of TCL can be targeted by the CARs developed and tested here, thus paving the way for development of CARs against all TCRV ⁇ families for which mAbs are available (currently for roughly 70% of TCR0 chain families) or can be developed.
  • TCRV ⁇ CARs exemplifed, best in vitro killing was observed against TCRV ⁇ 1 and 2- and less so for TCRV ⁇ 9 -expressing targets. This pattern correlated with the intensity of staining of T cells by the corresponding mAbs, suggesting that the anti-TCRV ⁇ 9 mAb and thus the corresponding CAR are of lower affinity, highlighting the need to select high affinity mAb.
  • T and iNKT cells thus offering the prospect of either autologous or allogeneic, off-the-shelf cellular immunotherapy respectively.
  • the subcutaneous TCL model used to test the in vivo efficacy of TCRV ⁇ CAR-iNKT cells is faithful to human
  • anti-TCRV ⁇ CAR-iNKT immunotherapy does not appear to impact adaptive anti-viral immunity: there was no change in the frequency of flu-specific or HTLV-1 Tax-specific CD8+ T cells when PBMC from HTLV-1 carriers were cultured with and without anti-TCRV ⁇ CAR-iNKT.
  • the inventors also evaluated the effect of CAR-iNKT activity on proviral expression by by-standing HTLV-1 infected CD4+ T cells and observed no difference in HTLV-1 Tax expression in the presence or absence of CAR-iNKT cells. Thus, at least in short term in vitro assays, the inventors have excluded the possibility that bystander activation of HTLV-1 infected T cells favours HTLV-1 proviral reactivation.
  • the inventors have successfully demonstrated that the novel and innovative anti-TCRV ⁇ CARs precision medicine approach for the treatment of TCL and ATL disclosed herein, can be applied to all TCRV ⁇ chains. Because of their distinct advantages discussed above, the use of the allogeneic iNKT cell platform as the effector cell, which will allow the swift deployment of pre-manufactured allogeneic anti- TCRV ⁇ CAR-iNKT cells in HTLV-1 endemic areas and in combination with advanced clinical trial designs such as Bayesian optimal interval design, is preferred.
  • anti-TCRV ⁇ CAR-iNKT cells can be tested not only in patients with ATL but also in HTLV-1-infected individuals in whom, as the inventors recently showed, clonal T cell expansions above a certain threshold portend high risk of progression to ATL, a highly incurable cancer 2 '".

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Chemical & Material Sciences (AREA)
  • General Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The invention relates to chimeric antigen receptors (CARs) per se, to CAR constructs, and to T-cell receptor (TCR) beta-chain variable region beta (TCRVβ) CARs. The invention relates to the use of the CARs in immunotherapy, for example in treating, preventing or ameliorating cancer, such as T-cell malignancies, and also conditions caused or implicated by pathogenic T cells, such as autoimmune diseases. The invention is especially concerned with conventional T cells and invariant natural killer T (iNKT) cells expressing anti-TCRVβ CARs and methods for making the same. The invention extends to nucleic acids and vectors encoding the anti-TCRVβ CARs, and to pharmaceutical compositions comprising the constructs and cells, and to medical uses of the compositions, anti-TCRVβ CAR constructs and T cells and iNKT cells expressing anti-TCRVβ CARs.

Description

CHIMERIC ANTIGEN RECEPTOR (CAR) TO A TCR BETA-CHAIN VARIABLE REGION
The present invention relates to chimeric antigen receptors (CARs) per se, and to CAR constructs, and particularly, although not exclusively, to T-cell receptor (TCR) beta- chain variable region beta (TCRVβ) CARs. The invention relates to the use of the CARs in immunotherapy, for example in treating, preventing or ameliorating cancer, such as
T-cell malignancies, and also conditions caused or implicated by pathogenic T cells, such as autoimmune diseases. The invention is especially concerned with conventional T cells and invariant natural killer T (iNKT) cells expressing anti-TCRVβ CARs and methods for making the same. The invention extends to nucleic acids and vectors encoding the anti-TCRVβ CARs, and to pharmaceutical compositions comprising the constructs and cells, and to medical uses of the compositions, anti-TCRVβ CAR constructs and T cells and iNKT cells expressing anti-TCRVβ CARs.
Human T cell leukaemia virus type-i (HTLV-i)-associated-adult T cell leukaemia/lymphoma (ATL), and the majority of other T cell lymphomas (TCL), have a poor prognosis with current treatments. Carriers of HTLV-1, a virus that is endemic in many parts of the world, have a 5% risk of developing ATL in their lifetime2,3.
Expression of cell surface T-cell receptor (TCR) α/β chain heterodimers is restricted to normal, to non-malignant pathogenic and to malignant T-cells. TCR variable region P
(TCRVβ) subunits are encoded by TRBV genes, of which there are 23 families and 114 alleles in humans with each family comprising 0.5-9% of the normal T-cell repertoire, with TCRVβ2 being the most frequent. Signals from the TCR determine cell fate in normal T cells, and components of the TCR signalling pathway are frequently mutated in TCL including ATL, indicating a driving role for the TCR in TCL oncogenesis.
Expression of surface TCR is stable in blood and lymph node lymphoma T cells4-6 as well as in non-malignant pathogenic T cells.
CAR-T therapeutic approaches in B cell leukaemias and lymphomas targeting pan-B cell markers, such CD19 and CD20, can induce sustained clinical remissions in up to 40% of patients with relapsed/refractory disease, at the expense of clinically tolerable pan-B-cell depletion and hypoglobulinaemia . However, pan-T cell depletion would result in profound immunosuppression that is not clinically tolerable. Since most TCL are CD4+, anti-CD4 CAR-T treatment has also been proposed for these lymphomas (see, for example, the clinical trial NCT03829540). Unless rescued by a stem cell transplant, such an approach would also result in immunosuppression akin to acquired immunodeficiency syndrome. Other CAR targets include CD5 and CD7; however, these are widely expressed on healthy T cells and can cause a fratricide reaction, unless CAR effector cells are additionally genetically edited to lack expression of these markers8.
Recently, efficacy using CAR-T cells to target the TCRβ chain constant region 1 which is expressed in ~40-60% of TCRαβ lymphocytes was reported9. It remains to be seen what the impact of depleting 40-60% of the T cell repertoire will have on an individuals’ immune status. It may be that, as reported in murine models, loss of half of the TCR sequences significantly impairs immunity in humans10. Current anti-T cell lymphoma CAR-based immunotherapies eliminate either the whole or 50% of healthy T cells, thus rendering the treated patient with T cell lymphoma severely or profoundly immunosuppressed.
There is, therefore, a need to provide improved immunotherapies for T-cell malignancies, such as T-cell lymphoma, including ATL, and also for treating diseases, such as certain autoimmune diseases caused directly or indirectly by pathogenic, non- malignant T cells, as well as for targeting normal, non-pathogenic T cells.
In order to fight malignant and non-malignant pathogenic T cells, as well as non- pathogenic T cells, the inventors have developed CAR-iNKT (invariant natural killer T) cells as an ‘off-the-shelf allogenic immunotherapy. iNKT cells are a rare (i.e. they represent less than 0.1% of the T-cells population) and evolutionarily conserved subset of T cells which share features of innate and adaptive immune responses11 13. In humans, iNKT are characterised by the expression of an invariant TCRVα24Jα18 chain which mostly pairs with diverse TCRVβ11 chains (iTCR)14. iNKT cells are restricted by CDid, a non-polymorphic, glycolipid-presenting HLA class I -like molecule expressed on monocytes, macrophages dendritic cells, B cells, thymocytes and some epithelial tissues15. In addition, iNKT cells have a memory effector phenotype and can migrate to extra-lymphoid tissues 18 20 where they modulate a variety of immune responses, including anti-tumour and anti-pathogen responses2122.
Since iNKT cells protect against acute graft-versus-host disease (aGVHD)25 28, CAR- iNKT-cell immunotherapy can be sourced from allogeneic healthy donors as ‘off-the shelf treatment without need for deletion of the endogenous TCR as is the case with conventional T cells. Conversely, the standard autologous CAR-T immunotherapy can be limited by financial and logistical challenges and sub-optimal fitness of patient- derived T cells. Based on the above considerations, the inventors have explored targeting of ATL/TCL- specific TCRVβ chains through CAR engineering of T and iNKT cells. To address the pressing clinical need for new therapeutic approaches, the inventors have developed exemplary chimeric antigen receptors (CARs) which target a group of subunits of the T cell receptor (TCR) β chain, which is constitutively expressed by mature T cell leukaemias and lymphomas.
Thus, in a first aspect of the invention, there is provided a chimeric antigen receptor (CAR) construct specific for a T-cell receptor (TCR) beta-chain variable region (V0) subunit of a T cell.
As shown in the Examples, the inventors have developed various embodiments of exemplary CARs specific for several TCR Vβ subunits according to the invention (referred herein as clone BL37.2 for TCR Vβ1, MPB2D5 for TCR Vβ2, FIN9 for TCR Vβ9 and C21 for TCR Vβ11). Advantageously, using conventional T cells and innate natural killer (iNKT) cells as CAR effector cells, the inventors have surprisingly demonstrated that anti-V0 CAR-T cells and CAR-iNKT cells harbouring the CAR of the invention can successfully kill in-vitro expanded primary T cells and ex-vivo adult T cell leukaemia (ATL) cells, which express the corresponding TCRVβ subunit, with surprisingly minimal off target killing of healthy T cells which express other TCRVβ subunits. The inventors have successfully demonstrated that CAR-iNKT activity was significantly enhanced when challenged with CD 1d-expressing targets that had been pulsed with a-Galactosylceramide, a selective ligand of iNKT cells that leads to their activation. Ligation of the anti-V0 CAR induced degranulation, secretion of IFN-y and
TNF-α, and upregulation of expression of Perforin and Granzyme by T and iNKT effectors. Targeting T cells, which express a single V0 subunit, spared virus-specific CTL. Furthermore, in a short in vitro assay, the inventors have shown that CAR- mediated killing had no effect on the expression of the virus which causes ATL, Human T cell leukaemia virus type-1. Finally, anti-TCRVβ CAR-iNKT (but not anti-CD19 CAR- iNKT) significantly (p<o.oi) reduced tumour size in a sub-cutaneous model of T cell lymphoma. Tumour-bearing mice that received iNKT effectors showed no signs of graft-versus-host disease. Accordingly, through these experiments, the inventors have surprisingly demonstrated that CARs targeting TCRVβ subunits can efficiently kill malignant T cell clones with minimal off-target cytotoxicity. CAR-iNKT effectors displayed enhanced killing activity in the presence of iNKT ligands, reducing the risk of acute graft versus host disease and are suitable for use as an off-the shelf product for infusion to third party donors. In one embodiment, the CAR construct is specific for a T-cell receptor (TCR) beta-chain variable region (Vβ) subunit of a normal, non-pathogenic T cell.
In another embodiment, however, the CAR construct is specific for a T-cell receptor (TCR) beta-chain variable region (Vβ) subunit of a pathogenic T cell.
Pathogenic T cells are clonal in nature with tumour cells sharing expression of a single TCRVβ subunit, with no bias or preference in the usage of TCRVβ subunit families4 6. Advantageously, targeting the specific TCRVβ subunit expressed by pathogenic T cells in a clonal manner provides a highly selective and tumour-specific therapeutic solution with “on-target off-tumour” toxicity limited to less than 5-9% of normal T-cells. As the expression of each TCRVβ subunit is restricted to less than 9% of healthy T cells, this approach avoids treatment-induced immunosuppression and immune dysregulation, which might be caused by alternative CAR-based immunotherapies for ATL/TCL, because the novel construct preserves more than 90% of healthy T cells.
Based on the above considerations, therefore, the inventors have explored targeting of ATL/TCL-specific TCRVβ chains through CAR engineering of T and iNKT cells. To address the pressing clinical need for new therapeutic approaches, the inventors have developed chimeric antigen receptors (CAR) which target the T cell receptor (TCR) 0 chain, which is constitutively expressed by mature T cell leukaemias and lymphomas.
Preferably, therefore, the CAR construct of the invention is specific for the TCRVβ subunit of a pathogenic T cell. A “pathogenic T cell” can refer to a T cell expressed in a clinical disorder, such as a T cell malignancy, including TCL and ATL, infections, as well as auto-immune diseases. Hence, the anti-TCRVβ CAR can target in a highly selective manner, pathogenic T cells, such as those in involved in T cell lymphomas and T cell leukaemias, as well as those T cells causing auto-immune disease. Thus, the pathogenic T cell may be a malignant, pathogenic T cell. Alternatively, the pathogenic T cell may be a non-malignant, pathogenic T cell.
Healthy T cells express 23 different families of TCRVβ chain molecules.
Advantageously, each T cell expresses only one of the TCRVβ chains. Thus, pathological T cells, such as those in cancers, namely T cell lymphomas and T cell leukaemias, as well as those causing auto-immune disease, only express one type of TCRVβ chain. However, the same TCRVβ chain that is expressed in pathological T cells will also be expressed in less than 10% of normal, healthy T cells. Therefore, anti-TCRVβ CARs that selectively target pathological T cells will also target less than 10% of the patient’s healthy T cells, although more than 90% of the patient’s healthy T cells and T celldependent immunity will be left intact. Accordingly, in some embodiments, healthy T cells may be targeted by the CAR construct of the invention.
Table 1 below lists TCRVβ subunits on T-cells, with the associated encoding gene, and any one or more of these may be targeted by the CAR construct of the invention.
Table i - Beta-chain variable sub-units fvpi on T cells
Preferably, therefore, the vp subunit may be selected from a group of vp subunits shown in Table 1. The frequency of TCRVβ chain family use in T-cell lymphoma is similar to that in the normal T cell repertoire as shown in Table 1. In a preferred embodiment, the CAR construct targets a TCRVP subunit on a T-cell wherein the subunit is any one of those in the left hand column of Table i. As described in the examples, the inventors have made four embodiments of CAR construct, each of which is specific for TCR-VP1, TCR-Vβ2, TCR-VP9 and TCR-Vβ11 , respectively. Preferably, therefore, the CAR construct targets a TCR VP subunit on a T- cell selected from a group consisting of the following VP subunits: TCR-VP1, TCR-Vβ2, TCR-VP9 and TCR-Vβ11.
Thus, preferably the CAR construct is specific for TCR-VP1. One embodiment of the polypeptide sequence of TCR vpi subunit (encoded by H. sapiens TCRBV9 of which there are three alleles, TRBV9*OI to *039 - UniProtKB: A0A0B4J1U6) is represented herein as SEQ ID No: 1, as follows:
GVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIHYYNGEERAKGNILERFSAQQFPDLHSELNLSS LELGDSALYFCASSV [SEQ ID No:l]
Therefore, preferably the CAR construct is specific for the TCR-Vβ1 subunit, which comprises an amino acid sequence substantially as set out in SEQ ID No:i, or a variant or fragment thereof.
Preferably, the CAR construct is specific for TCR-Vβ2. One embodiment of the polypeptide sequence of TCR Vβ2 subunit (encoded by H. sapiens TCRBV20-1 of which there are seven alleles, TRBV2O-1*01 to *07 -UniProtKB: Aoo075B6N2) is represented herein as SEQ ID No: 2, as follows:
AWSQHPSRVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTL TVTSAHPEDSSFYI CSAR
[SEQ ID No:2]
Therefore, preferably the CAR construct is specific for the TCR-Vβ2 subunit, which comprises an amino acid sequence substantially as set out in SEQ ID No:2, or a variant or fragment thereof. Preferably, the CAR construct is specific for TCR-Vβ9. One embodiment of the polypeptide sequence of TCR Vβ9 subunit (encoded by H. sapiens TCRBV3-1 of which there are two alleles, TRBV3-1*01 and *02 - UniProtKB/Swiss-Prot.: A0A576) is represented herein as SEQ ID No: 3, as follows: AVSQTPKYLVTQMGNDKSIKCEQNLGHDTMYWYKQDSKKFLKIMFSYNNKELIINETVPNRFSPKSPDKAHLNLHINS LELGDSAVYFCASSQ
[SEQ ID No:3]
Therefore, preferably the CAR construct is specific for the TCR-Vβ9 subunit, which comprises an amino acid sequence substantially as set out in SEQ ID No:3, or a variant or fragment thereof.
Preferably, the CAR construct is specific for TCR-Vβ11. One embodiment of the polypeptide sequence of TCRVβ11 subunit (encoded by H. sapiens TCRBV25~I*01 of which there is one allele - UniProtKB: A0A075B6N4) is represented herein as SEQ ID No: 4, as follows: DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRI RTEHFPLTLES ARPSHTSQYLCASSE
[SEQ ID No:4]
Therefore, preferably the CAR construct is specific for the TCR-Vβ11 subunit, which comprises an amino acid sequence substantially as set out in SEQ ID No:4, or a variant or fragment thereof. Preferably, in one embodiment, the CAR construct comprises: a) a signalling peptide; b) an antigen-binding domain or moiety specific for the TCR-V0 subunit, preferably an anti-TCRVβ antibody or a functional fragment thereof specific for the TCR-VP subunit, and more preferably a single-chain variable fragment (scFv) domain of an anti-TCRVβ antibody; c) a hinge region or hinge domain, preferably comprising a transmembrane domain, and most preferably a transmembrane domain and cytoplasmic region; d) a primaiy stimulatory (or signalling) domain; and/or e) a co-stimulatoiy domain, preferably two or more co-stimulatory domains.
Surprisingly, the inventors have demonstrated that the combination of each of these components generates an anti-TCRVβ CAR construct with highly selective activity against the cognate TCRVβ family chain and significant activity against T cell lymphoma and leukaemia activity in vitro and in vivo.
Thus, preferably the CAR construct comprises a signalling peptide. Advantageously, the signalling peptide is configured to lead the CAR (i.e. which is a fusion protein) to the outer membrane of an effector cell (i.e. T-cell) expressing the CAR construct. The signalling peptide of the CAR construct may be a native immunoglobulin gene signalling peptide. Preferably, however, the signalling peptide comprises human CD8α, or a fragment or variant thereof. CD8α is highly expressed in human T cells.
Advantageously, therefore, when the CAR construct is expressed in a human effector T cell, the human CD8a provides optimal expression of the CAR construct in the human effector cell. In one embodiment, the human CD8a signalling peptide can have an amino acid sequence referred to herein as SEQ ID No:s, as follows:
MALPVTALLLPLALLLHAARP [SEQ ID No: 5]
Preferably, therefore, the CAR construct comprises a signalling peptide having an amino acid sequence substantially as set out in SEQ ID No:5, or a fragment or variant thereof.
In one embodiment, a nucleotide sequence encoding the signalling peptide is referred to herein as SEQ ID No:6, as follows: atggctctgcctgtgacagctctgctgctgcctctggccctgctgctgcatgccgccagacct
[SEQ ID No: 6]
Preferably, therefore, the signalling peptide is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 6, or a fragment or variant thereof.
Preferably, the antigen-binding domain or moiety specific for the TCR-VP subunit comprises an anti-TCRVβ antibody or a functional fragment thereof that is specific for the TCR-VP subunit. More preferably, the antigen-binding domain specific for the TCR- VP subunit comprises a single-chain variable fragment (scFv) domain of an anti-TCRVβ antibody. Preferably, the antigen-binding domain is disposed C-term of the signalling peptide.
The skilled person is aware that the scFv is a fusion protein that comprises the variable regions of the heavy (VH) and light chains (VL) of a given antibody. In the context of the present invention, the antibody is one that is specific for a TCRVβ subunit.
As discussed herein, there are 23 different families of TCRVβ chain molecules. It will be appreciated that any human TCRVβ chain may be targeted by the CAR construct of the invention. TCRP chain sequences are readily available in public databases. For example, any of the TCRVβ listed in Tables 1 and 2, which provides a summary of TCR gene (TRBV) and protein (TCRVβ), and indicates the proteins for which monoclonal antibodies are available or can be developed, may be targeted by the CAR construct. Therefore, in one embodiment, scFv domain of an anti-TCRVβ antibody is selected from any one of the TCRVβ chain genes and proteins recited in Table 1 and 2.
As shown in Figures 1 and 2, the CAR construct may comprise a scFv, which may comprise a VL (variable light chain) sequence and a VH (variable heavy chain) sequence. Preferably, the VL sequence is upstream (i.e. 5’ or N-term) of the VH sequence. In some embodiments, however, the VH sequence may be upstream of the VL sequence. Preferably, the VH and VL encoding sequences, in either orientation, are separated by a linker sequence, such as a G4S linker sequence. Preferably, the linker sequence is flexible.
TCRVβ1
In one preferred embodiment, the CAR construct may comprise a scFv comprising a VL and/or a VH from an anti-TCRVβ1 antibody. The CAR construct preferably comprises a scFv comprising a VL and a VH from an anti-TCRVβi antibody. The VL and VH sequences may, in one embodiment, be derived from BL37.2 (i.e. the hybridoma clone name of an anti-TCRVβi monoclonal antibody) and comprise a light chain variable region and a heavy chain variable region for binding the TCRVβ1 antigen. In one embodiment, the light chain of the scFv of the anti-TCRVβi antibody can have an amino acid sequence referred to herein as SEQ ID No:7, as follows:
DVQMTQSPYNLAASPGESVSINCKASKSINKYLAWYQQKPGKPNKLLIYDGSTLQSGIPSRFSGSGSGTDFTLTIRGL EPEDFGLYYCQQHNEYPPTFGAGTKLELK [SEQ ID No: 7]
Preferably, therefore, the CAR construct comprises a VL chain having an amino acid sequence substantially as set out in SEQ ID No: 7, or a fragment or variant thereof. In one embodiment, the nucleotide sequence encoding the VL of the scFv of the anti-
TCRVβ1 antibody is referred to herein as SEQ ID No:8, as follows:
GACGTGCAGATGACCCAGAGCCCCTACAACCTGGCCGCCAGCCCCGGCGAGAGCGTGAGCATCAACTGCAAGGCC AGCAAGAGCATCAACAAGTACCTGGCCTGGTACCAGCAGAAGCCCGGCAAGCCCAACAAGCTGCTGATCTACGAC GGCAGCACCCTGCAGAGCGGCATCCCCAGCAGGTTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATC
AGGGGCCTGGAGCCCGAGGACTTCGGCCTGTACTACTGCCAGCAGCACAACGAGTACCCCCCCACCTTCGGCGCC GGCACCAAGCTGGAGCTGAAG
[SEQ ID No: 8] Preferably, therefore, the VL chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 8, or a fragment or variant thereof. In one embodiment, the heavy chain of the scFv of the anti-TCRVβi antibody can have an amino acid sequence referred to herein as SEQ ID No:9, as follows:
QLQLVQSGPELREPGESVKISCKASGYTFTDYIVHWVKQAPGKGLKWMGWINTYTGTPTYADDFEGRFVFSLEASAST ANLQISNLKNEDTATYFCARSWRRGIRGIGFDYWGQGVMVTVSS [SEQ ID No: 9]
Preferably, therefore, the CAR construct comprises a VH chain having an amino acid sequence substantially as set out in SEQ ID No: 10, or a fragment or variant thereof. In one embodiment, the nucleotide sequence encoding the VH of the scFv of the anti- TCRVβ1 antibody is referred to herein as SEQ ID No:io, as follows:
CAGCTGCAGCTGGTGCAGAGCGGCCCCGAGCTGAGGGAGCCCGGCGAGAGCGTGAAGATCAGCTGCAAGGCCAGC GGCTACACCTTCACCGACTACATCGTGCACTGGGTGAAGCAGGCCCCCGGCAAGGGCCTGAAGTGGATGGGCTGG ATCAACACCTACACCGGCACCCCCACCTACGCCGACGACTTCGAGGGCAGGTTCGTGTTCAGCCTGGAGGCCAGC
GCCAGCACCGCCAACCTGCAGATCAGCAACCTGAAGAACGAGGACACCGCCACCTACTTCTGCGCCAGGAGCTGG AGGAGGGGCATCAGGGGCATCGGCTTCGACTACTGGGGCCAGGGCGTGATGGTGACCGTGAGCAGC
[SEQ ID No: to]
Preferably, therefore, the VH chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 10, or a fragment or variant thereof.
TCRVP2 In another preferred embodiment, the CAR construct may comprise a scFv comprising a VL and/ or a VH from an anti-TCRVβ2 antibody. The CAR construct preferably comprises a scFv comprising a VL and a VH from an anti-TCRVβ2 antibody. The VL and VH sequences may, in one embodiment, be derived from MPB2D5 (i.e. the hybridoma clone name of an anti-TCRVβ2 monoclonal antibody) and comprise a light chain variable region and a heavy chain variable region for binding the TCRVβ2 antigen.
In one embodiment, the light chain of the scFv of the anti-TCRVβ2 antibody can have an amino acid sequence referred to herein as SEQ ID No:i, as follows: DIVLTQSPASLAVSLGQRATI SCRASKSVSILGTHLIHWYQQKPGQPPKLLIYAASNLESGVPARFSGSGSETVFTLN
IHPVEEEDAATYFCQQSIEDPWTFGGGTKLGIK [SEQ ID No: 11]
Preferably, therefore, the CAR construct comprises a VL chain having an amino acid sequence substantially as set out in SEQ ID No:ii, or a fragment or variant thereof. In one embodiment, the nucleotide sequence encoding the VL of the scFv of the anti-
TCRVβ2 antibody is referred to herein as SEQ ID No: 12, as follows:
GACATCGTGCTGACCCAGAGCCCCGCCAGCCTGGCCGTGAGCCTGGGCCAGAGGGCCACCATCAGCTGCAGGGCCAGC AAGAGCGTGAGCATCCTGGGCACCCACCTGATCCACTGGTACCAGCAGAAGCCCGGCCAGCCCCCCAAGCTGCTGATC TACGCCGCtAGCAACCTGGAGAGCGGCGTGCCCGCCAGGTTCAGCGGCAGCGGCAGCGAGACCGTGTTCACCCTGAAC ATCCACCCCGTGGAGGAGGAGGACGCCGCCACCTACTTCTGCCAGCAGAGCATCGAGGACCCCTGGACCTTCGGCGGC G G GAG C AAG C T G G G CAT CAAG
[SEQ ID No: 12]
Preferably, therefore, the VL chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 12, or a fragment or variant thereof.
In one embodiment, the heavy chain of the scFv of the anti-TCRVβ2 antibody can have an amino acid sequence referred to herein as SEQ ID NO:13, as follows:
EVQLQQSVADLVRPGASLKLSCTASGFNIKSAYMHWVIQRPDQGPECLGRI DPATGKTKYAPKFQAKATITADTSSNT
AYLQLSSLTSEDTAIYYCTRSLNWDYGLDYWGQGTSVTVSS
[SEQ ID No: 13]
Preferably, therefore, the CAR construct comprises a VH chain having an amino acid sequence substantially as set out in SEQ ID NO:13, or a fragment or variant thereof.
In one embodiment, the nucleotide sequence encoding the VH of the scFv of the anti- TCRVβ1 antibody is referred to herein as SEQ ID No:iq, as follows:
GAGGTGCAGCTGCAGCAGAGCGTGGCCGACCTGGTGAGGCCCGGCGCCAGCCTGAAGCTGAGCTGCACCGCCAGC GGCTTCAACATCAAGAGCGCCTACATGCACTGGGTGATCCAGAGGCCCGACCAGGGCCCCGAGTGCCTGGGCAGG ATCGACCCCGCCACCGGCAAGACCAAGTACGCCCCCAAGTTCCAGGCCAAGGCCACCATCACCGCCGACACCAGC AGCAACACCGCCTACCTGCAGCTGAGCAGCCTGACCAGCGAGGACACCGCCATCTACTACTGCACCAGGAGCCTG
AACTGGGACTACGGCCTGGACTACTGGGGCCAGGGCACCAGCGTGACCGTGAGCAGC [SEQ ID No: 14]
Preferably, therefore, the VH chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 14, or a fragment or variant thereof.
TCRVB9
In yet another preferred embodiment, the CAR construct may comprise a scFv comprising a VL and/or a VH from an anti-TCRVβ9 antibody. The CAR construct preferably comprises a scFv comprising a VL and a VH from an anti-TCRVβ9 antibody. The VL and VH sequences may, in one embodiment, be derived from FIN9 (i.e. the hybridoma clone name of an anti-TCRVβ9 monoclonal antibody) and comprise a light chain variable region and a heavy chain variable region for binding the TCRVβ9 antigen. In one embodiment, the light chain of the scFv of the anti-TCRVβ9 antibody can have an amino acid sequence referred to herein as SEQ ID NO:15, as follows:
ETTVTQSPASLSVATGEKVTI RCISSTDIDDDMNWYQQKSGEPPKLLISEGNTLRPGVPSRFSSSGYGTDFVFTIENM LSEDVADYYCLQSDNMPLTFGAGTKLELK [SEQ ID No: 15]
Preferably, therefore, the CAR construct comprises a VL chain having an amino acid sequence substantially as set out in SEQ ID NO:15, or a fragment or variant thereof. In one embodiment, the nucleotide sequence encoding the VL of the scFv of the anti- TCRVβ9 antibody is referred to herein as SEQ ID No: 16, as follows:
GAGACCACCGTGACCCAGAGCCCCGCCAGCCTGAGCGTGGCCACCGGCGAGAAGGTGACCATCAGGTGCATCAGC AGCACCGACATCGACGACGACATGAACTGGTACCAGCAGAAGAGCGGCGAGCCCCCCAAGCTGCTGATCAGCGAG GGCAACACCCTGAGGCCCGGCGTGCCCAGCAGGTTCAGCAGCAGCGGCTACGGCACCGACTTCGTGTTCACCATC
GAGAACATGCTGAGCGAGGACGTGGCCGACTACTACTGCCTGCAGAGCGACAACATGCCCCTGACCTTCGGCGCC GGCACCAAGCTGGAGCTGAAG
[SEQ ID No: 16]
Preferably, therefore, the VL chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 16, or a fragment or variant thereof. In one embodiment, the heavy chain of the scFv of the anti-TCRVβ9 antibody can have an amino acid sequence referred to herein as SEQ ID NO:17, as follows:
EVQLQQSVAELVRPGASVKLSCTASGFNIKNTFMHWVKQRPEQGLEWIGRI DPTNGYTKFAPKFQGKATLTAVTSSNT VYLQLSSLTSEDTAIYYCAHDYDAPWFAYWGQGTLVIVSA
[SEQ ID No: 17]
Preferably, therefore, the CAR construct comprises a VH chain having an amino acid sequence substantially as set out in SEQ ID No:17, or a fragment or variant thereof.
In one embodiment, the nucleotide sequence encoding the VH of the scFv of the anti- TCRVβ9 antibody is referred to herein as SEQ ID No: 18, as follows:
GAGGTGCAGCTGCAGCAGAGCGTGGCCGAGCTGGTGAGGCCCGGCGCCAGCGTGAAGCTGAGCTGCACCGCCAGC GGCTTCAACATCAAGAACACCTTCATGCACTGGGTGAAGCAGAGGCCCGAGCAGGGCCTGGAGTGGATCGGCAGG
ATCGACCCCACCAACGGCTACACCAAGTTCGCCCCCAAGTTCCAGGGCAAGGCCACCCTGACCGCCGTGACCAGC AGCAACACCGTGTACCTGCAGCTGAGCAGCCTGACCAGCGAGGACACCGCCATCTACTACTGCGCCCACGACTAC GACGCCCCCTGGTTCGCCTACTGGGGCCAGGGCACCCTGGTGATCGTGAGCGCC [SEQ ID No: 18]
Preferably, therefore, the VH chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 18, or a fragment or variant thereof. TCRVP11
In yet another preferred embodiment, the CAR construct may comprise a scFv comprising a VL and/or a VH from an anti-TCRVβ11 antibody. The CAR construct preferably comprises a scFv comprising a VL and a VH from an anti-TCRVβ11 antibody. The VL and VH sequences may, in one embodiment, be derived from C21 (i.e. the hybridoma clone name of an anti-TCRVβ11 monoclonal antibody) and comprise a light chain variable region and a heavy chain variable region for binding the TCRVβ11 antigen.
In one embodiment, the light chain of the scFv of the anti-TCRVβ11 antibody can have an amino acid sequence referred to herein as SEQ ID No:i9, as follows:
DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKAGKSPKTLIYRANRLVDGVPSRFSGSGSGQDYSLTISSL EYEDMGIYYCLQYDEFPFTFGGGTRLEIK
[SEQ ID No: 19] Preferably, therefore, the CAR construct comprises a VL chain having an amino acid sequence substantially as set out in SEQ ID No:i9, or a fragment or variant thereof. In one embodiment, the nucleotide sequence encoding the VL chain of the scFv of the anti-TCRVβ11 antibody is referred to herein as SEQ ID No:2O, as follows:
GACATTAAGATGACCCAGTCCCCCTCCTCCATGTATGCCAGCCTCGGCGAGAGAGTCACCATCACATGCAAGGCC AG C C AAGACAT CAACAG CTACCTCAGCTGGTTCCAG C AGAAAG C C G G CAAGAG C C C CAAGACAC T GAT C T ATAG G GCTAATAGACTGGTGGACGGCGTGCCTAGCAGATTTTCCGGCAGCGGCAGCGGCCAAGACTATTCTCTGACCATC
AGCTCTCTGGAGTACGAGGACATGGGAATCTACTACTGTCTGCAGTACGACGAGTTCCCCTTCACCTTCGGAGGC G G GA CAAGAG T G GAAAT CAAA
[SEQ ID No: 20]
Preferably, therefore, the VL chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 20, or a fragment or variant thereof.
In one embodiment, the heavy chain of the scFv of the anti-TCRVβ11 antibody can have an amino acid sequence referred to herein as SEQ ID No:2i, as follows:
QVQLQQSGPEWRPGVSVKI S CKGSGYRFTDSAMHWVKQSHAKS LEWI GVI SSYNGNTNYNQKFKGKATMTVDKSSST
AYME LARMT S E D SAI Y YCARS RDAMD YWGQ GT S VTVS S
[SEQ ID No: 21]
Preferably, therefore, the CAR construct comprises a VH chain having an amino acid sequence substantially as set out in SEQ ID No:2i, or a fragment or variant thereof.
In one embodiment, the nucleotide sequence encoding the VH of the scFv of the anti- TCRVβ11 antibody is referred to herein as SEQ ID No:22, as follows:
CAAGTGCAGCTCCAGCAGTCCGGACCCGAGGTGGTGAGGCCCGGCGTGAGCGTGAAGATCAGCTGCAAGGGCAGC GGCTATAGGTTCACCGACTCCGCCATGCACTGGGTGAAGCAGTCCCATGCCAAGAGCCTCGAGTGGATCGGCGTG ATCAGCAGCTACAACGGCAACACCAACTACAACCAGAAGTTCAAGGGCAAGGCCACAATGACCGTGGACAAGAGC AGCTCCACCGCCTACATGGAGCTGGCCAGAATGACCAGCGAGGATAGCGCCATCTACTACTGTGCTAGGTCTAGA
GACGCCATGGACTACTGGGGCCAAGGCACATCCGTGACCGTGAGCTCC
[SEQ ID No: 22] Preferably, therefore, the VH chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 22, or a fragment or variant thereof. Preferably, the VH (e.g. SEQ ID No: 9, 13, 17 or 21) and VL (e.g. SEQ ID No: 7, 11, 15 or 19) sequences, when in either orientation, are separated by a linker sequence. In an embodiment, the linker sequence may comprise at least one a G4S linker sequence, which maybe referred to herein as SEQ ID No:23, as follows:
GGGGS
[SEQ ID No: 23]
Preferably, therefore, the CAR construct comprises a linker sequence comprising an amino acid sequence substantially as set out in SEQ ID No:23, or a fragment or variant thereof.
In other embodiments, the linker sequence may comprise a plurality of repeats of the G4S linker sequence. For example, the linker sequence may comprise two or three repeats of the G4S linker sequence (i.e. 2x G4S, or 3x G4S).
The CAR construct preferably comprises a hinge domain. Preferably, the hinge domain comprises: (i) an extracellular domain, or a portion thereof; (ii) a transmembrane (TM) domain, or a portion thereof; and/or (iii) a cytoplasmic domain, or a portion thereof. Most preferably, the hinge domain comprises: (i) an extracellular domain, or a portion thereof; (ii) a transmembrane (TM) domain, or a portion thereof; and (iii) a cytoplasmic domain, or a portion thereof. Advantageously, the hinge domain is configured for CAR display and anchoring on the CAR-T cell. Preferably, the hinge domain is disposed C-term of the antigen-binding domain, more preferably the VH chain.
Preferably, the hinge domain comprises a CD8α sequence, or a portion thereof, and more preferably a human CD8α sequence, or a portion thereof. Advantageously, a longer CD8α-derived hinge as compared to a shorter CD8α-derived hinge significantly decreases the toxicity of the CAR construct. Preferably, therefore, in one embodiment, the hinge domain comprises or consists of substantially the full length of human CD8α, or a portion thereof.
In one embodiment, the amino acid sequence of human CD8α is referred to herein as SEQ ID No: 51, as follows: MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKP KAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQP LSLRPEACRPAAGGAVHTRGLDFACDI YIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPWKSGDKPSLSARY V [SEQ ID No: 51]
Preferably, the CAR construct comprises or consists of a hinge domain that is derived from human CD8α comprising at least a portion of the extracellular domain. In one embodiment, the amino acid sequence of a human CD8α extracellular domain or a portion thereof is referred to herein as SEQ ID No: 24, as follows:
FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
[SEQ ID No: 24] Preferably, therefore, the CAR construct comprises a hinge domain comprising an amino acid sequence substantially as set out in SEQ ID No: 24, or a fragment or variant thereof.
Preferably, the CAR construct comprises or consists of a hinge domain that is derived from human CD8α comprising a full transmembrane helical domain. In one embodiment, the amino acid sequence of a human CD8α full transmembrane domain is referred to herein as SEQ ID No:49, as follows:
IYIWAPLAGTCGVLLLSLVIT [SEQ ID No: 49]
Preferably, therefore, the CAR construct comprises or consists of a hinge domain comprising an amino acid sequence substantially as set out in SEQ ID No:49, or a fragment or variant thereof.
Preferably, the CAR construct comprises or consists of a hinge domain that is derived from human CD8α comprising at least a portion of the cytoplasmic domain. In one embodiment, the amino acid sequence of a human CD8α cytoplasmic domain or a portion thereof is referred to herein as SEQ ID No:5O, as follows:
LYCNHRN
[SEQ ID No: 50] Preferably, therefore, the CAR construct comprises or consists of a hinge domain comprising an amino acid sequence substantially as set out in SEQ ID No:so, or a fragment or variant thereof.
In a preferred embodiment, the CAR construct comprises a hinge domain that is derived from human CD8α. Preferably, the hinge comprises or consists of amino acids 128-182 of human CD8α, as represented by SEQ ID No: 51, i.e. the extracellular domain. Preferably, the hinge comprising a portion of human CD8α extracellular domain, human CD8α full transmembrane domain, and a portion of human CD8α cytoplasmic domain is defined by amino acids 128-210 of human CD8α can have an amino acid sequence referred to herein as SEQ ID No:25, as follows: FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI YIWAPLAGTCGVLLLSLVITLY
CNHRN
[SEQ ID No: 25] Preferably, therefore, the CAR construct comprises or consists of a hinge domain having an amino acid sequence substantially as set out in SEQ ID No:25, or a fragment or variant thereof.
Advantageously, SEQ ID No: 25 comprises 55 amino acids from the extracellular domain
(FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD - SEQ ID No: 24), the full transmembrane helical domain (IYIWAPLAGTCGVLLLSLVIT - SEQ ID No: 49) and 7 amino acids of the cytoplasmic domain (LYCNHRN - SEQ ID No: 50). This configuration advantageously confers to the CAR construct less risk of cytokine release syndrome and neurotoxicity, which are side effects commonly associated with CAR-T therapy, without negatively impacting on the construct’s efficacy. In one embodiment, the CAR construct comprises or consists of a hinge domain that is derived from human CD8α comprising the extracellular domain of human CD8α defined by amino acids 138-182 of human CD8α, as represented by SEQ ID No: 51. Preferably, the CD8α-derived hinge comprising the extracellular domain of human CD8α is at least one, two or three amino acids longer than amino acids 138-182 of human CD8α on the N-terminus, as represented by SEQ ID No: 51. Therefore, preferably the CD8α-derived hinge comprises the extracellular domain of human CD8α defined by amino acids 137-182, 136-182, or 135-182 of human CD8α, as represented by SEQ ID No: 51.
More preferably, however, the CD8α-derived hinge comprising the extracellular domain of human CD8α is at least four, five or six amino acids longer amino acids 138- 182 of human CD8α on the N-terminus, as represented by SEQ ID No: 51. Therefore, more preferably the CD8α-derived hinge comprises the extracellular domain of human CD8α defined by amino acids 134-182, 133-182, or 132-182 of human CD8α, as represented by SEQ ID No: 51.
Most preferably, the CD8α-derived hinge comprising the extracellular domain of human CD8α is at least seven, eight, nine or ten amino acids longer amino acids 138- 182 of human CD8α on the N-terminus, as represented by SEQ ID No: 51. Therefore, most preferably the CD8α-derived hinge comprises the extracellular domain of human CD8α defined by amino acids 131-182, 130-182, 129-182 or 128-182 of human CD8α, as represented by SEQ ID No: 51.
In one embodiment, the CAR construct comprises or consists of a hinge domain that is derived from human CD8α comprising the transmembrane domain of human CD8α defined by amino acids 183-203 of human CD8α, as represented by SEQ ID No: 51. In another embodiment, the CAR construct comprises or consists of a hinge domain that is derived from human CD8α comprising the cytoplasmic domain of human CD8α defined by amino acids 204-206 of human CD8α.
Preferably, the CD8α-derived hinge comprising the cytoplasmic domain of human CD8α is at least one amino acid longer than amino acids 204-206 of human CD8α, as represented by SEQ ID No: 51 on the C-terminus. Therefore, preferably the CD8α- derived hinge comprises the cytoplasmic domain of human CD8α defined by amino acids 204-207 of human CD8α, as represented by SEQ ID No: 51.
More preferably, the CD8α-derived hinge comprising the cytoplasmic domain of human CD8α is at least two amino acids longer than amino acids 204-206 of human CD8α as represented by SEQ ID No: 51 on the C-terminus. Therefore, more preferably the CD8α-derived hinge comprises the cytoplasmic domain of human CD8α defined by amino acids 204-208 of human CD8α, as represented by SEQ ID No: 51. Even more preferably, the CD8α-derived hinge comprising the cytoplasmic domain of human CD8α is at least three amino acids longer than amino acids 204-206 of human CD8α as represented by SEQ ID No: 51 on the C-terminus.
Therefore, even more preferably, the CD8α-derived hinge comprises the cytoplasmic domain of human CD8α defined by amino acids 204-209 of human CD8α, as represented by SEQ ID No: 51.
Most preferably, the CD8α-derived hinge comprising the cytoplasmic domain of human CD8α is at least four amino acids longer than amino acids 204-206 of human CD8α, as represented by SEQ ID No: 51 on the C-terminus. Therefore, most preferably the CD8α- derived hinge comprises the cytoplasmic domain of human CD8α defined by amino acids 204-210 of human CD8α, as represented by SEQ ID No: 51.
In one embodiment, a nucleotide sequence encoding the hinge domain is referred to herein as SEQ ID No:26, as follows: ttcgtgcctgtgtttctgcctgccaagcccaccacaacccctgcccctagacctcctacacccgcccctacaatc gccagccagcctctgtctctgaggcccgaggcttgtagacctgctgctggcggagccgtgcacaccagaggactg gatttcgcctgcgacatctacatctgggcccctctggccggcacatgtggcgtgctgctgctgagcctcgtgatc accctgtactgcaaccaccggaac [SEQ ID No: 26]
Preferably, therefore, the construct comprises a hinge domain encoded by a nucleotide sequence substantially as set out in SEQ ID No: 26, or a fragment or variant thereof. The CAR construct preferably comprises an intracellular domain, which comprises a primary stimulatory (or signalling) CDЗζ chain and/or a co-stimulatory (or signalling) domain of CD28, and more preferably a co-stimulatory/ signalling domain of CD28 and a stimulatory CDЗζ chain. It will be appreciated that these components form the basis of a second generation CAR and are required for triggering the intracellular signalling pathway. Preferably, the intracellular domain is disposed 3’ of the sequence encoding the hinge domain. The co-stimulatory domain of CD28 may be N-terminus of the CDЗζ chain. Advantageously, CD28 co-stimulatory domain significantly improved the efficacy of CD 19 CAR T cells in patients with B cell lymphoma and B cell acute leukaemia and provides TCRVβ CARs with significant efficacy against T cell lymphoma and leukaemia in vitro and in vivo.
In another embodiment, the CAR construct may comprise one or two co-stimulatory domains, which may be selected from CD28, 4-1BB signalling domain and OX4O signalling domain.
One embodiment of the 4-1BB signalling domain can have an amino acid sequence, which is referred to herein as SEQ ID No: 46, as follows:
RFSWKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
[SEQ ID No: 46]
Preferably, therefore, the construct comprises a nucleotide sequence encoding an amino acid sequence substantially as set out in SEQ ID No: 46, or a fragment or variant thereof.
In an embodiment, the 4-1BB signalling domain can be encoded by a nucleic acid sequence, which is referred to herein as SEQ ID No: 47, as follows:
CGTTTCTCTGTTGTTAAACGGGGCAGAAAGAAGCTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAA ACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTG
[SEQ ID No: 47] Preferably, therefore, the construct comprises a nucleotide sequence substantially as set out in SEQ ID No: 47, or a fragment or variant thereof.
Therefore, in one embodiment, the co-stimulatory domain of CD28 is referred to herein as SEQ ID NO:27, as follows:
RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
[SEQ ID No: 27] Preferably,therefore,theCARconstructcomprisesaco-stimulatorydomainofCD28havinganaminoacidsequencesubstantiallyassetoutinSEQIDNo:27,orafragmentorvariantthereof. Inoneembodiment,anucleotidesequenceencodingtheco-stimulatorydomainofCD28isreferredtohereinasSEQIDNo:28,asfollows: agaagcaagcggagccggctgctgcacagcgactacatgaacatgacccccagacggcctggccccaccagaaag cactaccagccttacgcccctcccagagacttcgccgcctaccggtcc [SEQIDNo:28] Preferably,therefore,theco-stimulatoiydomainofCD28isencodedbyanucleotidesequencesubstantiallyassetoutinSEQIDNo:28,orafragmentorvariantthereof. Inapreferredembodiment,theCARconstructfurthercomprisesthestimulatoiyproteinCDЗζ.Inanembodiment,thestimulatoryproteinCDЗζ canhaveanaminoacidsequencereferredtohereinasSEQIDNo:29,asfollows: RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR [SEQIDNo:29] Preferably,therefore,theCARconstructcomprisesastimulatoryproteinCDЗζhavinganaminoacidsequencesubstantiallyassetoutinSEQIDNo:29,orafragmentorvariantthereof. Inoneembodiment,anucleotidesequenceencodingthestimulatoiyproteinCDЗζisreferredtohereinasSEQIDNo:3O,asfollows: agagtgaagttcagcagaagcgccgacgcccctgcctatcagcagggccagaaccagctgtacaacgagctgaac ctgggcagacgggaagagtacgatgtgctggacaaaagacgtggccgggaccctgagatggggggaaagccgaga aggaagaaccctcaggaaggcctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagattggg atgaaaggcgagcgccggaggggcaaggggcacgatggcctttaccagggtctcagtacagccaccaaggacacc tacgacgcccttcacatgcaggccctgccccctcgc [SEQIDNo:30] Preferably,therefore,thestimulatoiyproteinCDЗζisencodedbyanucleotidesequencesubstantiallyassetoutinSEQIDNo:30,orafragmentorvariantthereof. Accordingly, in a preferred embodiment, the intracellular domain of the CAR construct of the first aspect comprises both co-stimulating domain of CD28 and the CDЗζ stimulatory domain.
It will be appreciated that the position of each of the components in the CAR construct described herein is interchangeable. Figure 1 provides a schematic map of an exemplary embodiment of the anti-TCRVβ CAR construct.
Accordingly, in a preferred embodiment, the CAR construct comprises each of the elements in the following order: a 3’/N-term variable light chain of an anti-TCRVβ antibody - a variable heavy chain of an anti-TCRVβ antibody - a hinge - a co- stimulatory domain comprising CD28 - 3’/C-term stimulatory protein CDЗζ. The use of N- and C-term (and also 5’ and 3’) indicates that the features are either upstream or downstream in the construct (protein or DNA, respectively), and is not intended to indicate that the features are necessarily terminal features.
More preferably, the CAR construct comprises a s’/N-term signal peptide - a variable light chain of an anti-TCRVβ antibody - a linker - a variable heavy chain of an anti-
TCRVβ antibody - a hinge - a co-stimulatory domain comprising CD28 - 3’/C-term stimulatory protein CDЗζ.
“BL37.2 CAR” In one preferred embodiment, the anti-TCRVβ CAR construct is an anti-TCRVβ 1 CAR (known herein as “BL37.2 CAR”). Preferably, the anti-TCRVβi CAR comprises a 2x G4S linker. In an embodiment, the anti-TCRVβi CAR (having a 2x G4S linker) has an amino acid sequence referred to herein as SEQ ID NO:31, as follows: MALPVTALLLPLALLLHAARPDVQMTQSPYNLAASPGESVSINCKASKSINKYLAWYQQKPGKPNKLLI YDGSTLQSG
IPSRFSGSGSGTDFTLTIRGLEPEDFGLYYCQQHNEYPPTFGAGTKLELKGGGGSGGGGSQLQLVQSGPELREPGESV KISCKASGYTFTDYIVHWVKQAPGKGLKWMGWINTYTGTPTYADDFEGRFVFSLEASASTANLQISNLKNEDTATYFC ARSWRRGIRGIGFDYWGQGVMVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDF ACDI YIWAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSR SADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEI GMKGERRRGK
GHDGLYQGLSTATKDTYDALHMQALPPR
[SEQ ID No: 31] Preferably, therefore, the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No 131, or a fragment or variant thereof.
In one embodiment, a nucleotide sequence encoding the anti-TCRVβi CAR (having a 2x G4S linker) is referred to herein as SEQ ID No:32, as follows: atggctctgcctgtgacagctctgctgctgcctctggccctgctgctgcatgccgccagacctGACGTGCAGATGACC CAGAGCCCCTACAACCTGGCCGCCAGCCCCGGCGAGAGCGTGAGCATCAACTGCAAGGCCAGCAAGAGCATCAACAAG TACCTGGCCTGGTACCAGCAGAAGCCCGGCAAGCCCAACAAGCTGCTGATCTACGACGGCAGCACCCTGCAGAGCGGC ATCCCCAGCAGGTTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGGGGCCTGGAGCCCGAGGACTTC GGCCTGTACTACTGCCAGCAGCACAACGAGTACCCCCCCACCTTCGGCGCCGGCACCAAGCTGGAGCTGAAGGGAGGC GGAGGCTCTGGCGGAGGCGGCTCTCAGCTGCAGCTGGTGCAGAGCGGCCCCGAGCTGAGGGAGCCCGGCGAGAGCGTG AAGATCAGCTGCAAGGCCAGCGGCTACACCTTCACCGACTACATCGTGCACTGGGTGAAGCAGGCCCCCGGCAAGGGC CTGAAGTGGATGGGCTGGATCAACACCTACACCGGCACCCCCACCTACGCCGACGACTTCGAGGGCAGGTTCGTGTTC AGCCTGGAGGCCAGCGCCAGCACCGCCAACCTGCAGATCAGCAACCTGAAGAACGAGGACACCGCCACCTACTTCTGC
GCCAGGAGCTGGAGGAGGGGCATCAGGGGCATCGGCTTCGACTACTGGGGCCAGGGCGTGATGGTGACCGTGAGCAGC ttcgtgcctgtgtttctgcctgccaagcccaccacaacccctgcccctagacctcctacacccgcccctacaatcgcc agccagcctctgtctctgaggcccgaggcttgtagacctgctgctggcggagccgtgcacaccagaggactggatttc gcctgcgacatctacatctgggcccctctggccggcacatgtggcgtgctgctgctgagcctcgtgatcaccctgtac tgcaaccaccggaacagaagcaagcggagccggctgctgcacagcgactacatgaacatgacccccagacggcctggc cccaccagaaagcactaccagccttacgcccctcccagagacttcgccgcctaccggtccagagtgaagttcagcaga agcgccgacgcccctgcctatcagcagggccagaaccagctgtacaacgagctgaacctgggcagacgggaagagtac gatgtgctggacaaaagacgtggccgggaccctgagatggggggaaagccgagaaggaagaaccctcaggaaggcctg tacaatgaactgcagaaagataagatggcggaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaag gggcacgatggcctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggccctgccc cctcgc
[SEQ ID No: 32]
Preferably, therefore, the CAR construct is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 32, or a fragment or variant thereof.
In another preferred embodiment, the anti-TCRVβi CAR construct (known as “BL37.2
CAR”) comprises a 3x G4S linker. In an embodiment, the anti-TCRVβi CAR (having a
3x G4S linker) can have an amino acid sequence referred to herein as SEQ ID No:33, as follows:
MALPVTALLLPLALLLHAARPDVQMTQSPYNLAASPGESVSINCKASKSINKYLAWYQQKPGKPNKLLI YDGSTLQSG IPSRFSGSGSGTDFTLTIRGLEPEDFGLYYCQQHNEYPPTFGAGTKLELKGGGGSGGGGSGGGGSQLQLVQSGPELRE PGESVKISCKASGYTFTDYIVHWVKQAPGKGLKWMGWINTYTGTPTYADDFEGRFVFSLEASASTANLQISNLKNEDT ATYFCARSWRRGIRGIGFDYWGQGVMVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHT RGLDFACDI YIWAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSR VKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGE RRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
[SEQ ID No: 33] Preferably, therefore, the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No:33, or a fragment or variant thereof.
In one embodiment, a nucleotide sequence encoding the anti-TCRVβi CAR (with a 3x G4S linker) is referred to herein as SEQ ID No:34, as follows: atggctctgcctgtgacagctctgctgctgcctctggccctgctgctgcatgccgccagacctGACGTGCAGATGACC CAGAGCCCCTACAACCTGGCCGCCAGCCCCGGCGAGAGCGTGAGCATCAACTGCAAGGCCAGCAAGAGCATCAACAAG TACCTGGCCTGGTACCAGCAGAAGCCCGGCAAGCCCAACAAGCTGCTGATCTACGACGGCAGCACCCTGCAGAGCGGC ATCCCCAGCAGGTTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGACCATCAGGGGCCTGGAGCCCGAGGACTTC GGCCTGTACTACTGCCAGCAGCACAACGAGTACCCCCCCACCTTCGGCGCCGGCACCAAGCTGGAGCTGAAGGGAGGC GGAGGCTCTGGCGGAGGCGGCTCTGGCGGAGGCGGCTCTCAGCTGCAGCTGGTGCAGAGCGGCCCCGAGCTGAGGGAG CCCGGCGAGAGCGTGAAGATCAGCTGCAAGGCCAGCGGCTACACCTTCACCGACTACATCGTGCACTGGGTGAAGCAG GCCCCCGGCAAGGGCCTGAAGTGGATGGGCTGGATCAACACCTACACCGGCACCCCCACCTACGCCGACGACTTCGAG GGCAGGTTCGTGTTCAGCCTGGAGGCCAGCGCCAGCACCGCCAACCTGCAGATCAGCAACCTGAAGAACGAGGACACC GCCACCTACTTCTGCGCCAGGAGCTGGAGGAGGGGCATCAGGGGCATCGGCTTCGACTACTGGGGCCAGGGCGTGATG GTGACCGTGAGCAGCttcgtgcctgtgtttctgcctgccaagcccaccacaacccctgcccctagacctcctacaccc gcccctacaatcgccagccagcctctgtctctgaggcccgaggcttgtagacctgctgctggcggagccgtgcacacc agaggactggatttcgcctgcgacatctacatctgggcccctctggccggcacatgtggcgtgctgctgctgagcctc gtgatcaccctgtactgcaaccaccggaacagaagcaagcggagccggctgctgcacagcgactacatgaacatgacc cccagacggcctggccccaccagaaagcactaccagccttacgcccctcccagagacttcgccgcctaccggtccaga gtgaagttcagcagaagcgccgacgcccctgcctatcagcagggccagaaccagctgtacaacgagctgaacctgggc agacgggaagagtacgatgtgctggacaaaagacgtggccgggaccctgagatggggggaaagccgagaaggaagaac cctcaggaaggcctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagattgggatgaaaggcgag cgccggaggggcaaggggcacgatggcctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcac atgcaggccctgccccctcgc
[SEQ ID No: 34] Preferably, therefore, the CAR construct is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 34, or a fragment or variant thereof.
“MPB2D5 CAR”
In yet another preferred embodiment, the anti-TCRVβ CAR construct is an anti- TCRVβ2 CAR (known as “MPB2D5 CAR”). Preferably, the anti-TCRVβ2 CAR comprises a 2x G4S linker. In an embodiment, the anti-TCRVβ2 CAR (having a 2x G4S linker) has an amino acid sequence referred to herein as SEQ ID No:35, as follows:
MALPVTALLLPLALLLHAARPDIVLTQSPASLAVSLGQRATISCRASKSVSILGTHLIHWYQQKPGQPPKLLIYAASN LESGVPARFSGSGSETVFTLNIHPVEEEDAATYFCQQSIEDPWTFGGGTKLGIKGGGGSGGGGSEVQLQQSVADLVRP GASLKLSCTASGFNIKSAYMHWVIQRPDQGPECLGRI DPATGKTKYAPKFQAKATITADTSSNTAYLQLSSLTSEDTA IYYCTRSLNWDYGLDYWGQGTSVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLD FACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFS RSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRG KGHDGLYQGLSTATKDTYDALHMQALPPR
[SEQ ID No: 35] Preferably, therefore, the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No: 35, or a fragment or variant thereof.
In one embodiment, a nucleotide sequence encoding the anti-TCRVβ2 CAR (with 2x G4S linker) is referred to herein as SEQ ID No: 36, as follows: atggctctgcctgtgacagctctgctgctgcctctggccctgctgctgcatgccgccagacctGACATCGTGCTGACC CAGAGCCCCGCCAGCCTGGCCGTGAGCCTGGGCCAGAGGGCCACCATCAGCTGCAGGGCCAGCAAGAGCGTGAGCATC CTGGGCACCCACCTGATCCACTGGTACCAGCAGAAGCCCGGCCAGCCCCCCAAGCTGCTGATCTACGCCGCtAGCAAC CTGGAGAGCGGCGTGCCCGCCAGGTTCAGCGGCAGCGGCAGCGAGACCGTGTTCACCCTGAACATCCACCCCGTGGAG GAGGAGGACGCCGCCACCTACTTCTGCCAGCAGAGCATCGAGGACCCCTGGACCTTCGGCGGCGGCACCAAGCTGGGC ATCAAGGGAGGCGGAGGCTCTGGCGGAGGCGGCTCTGAGGTGCAGCTGCAGCAGAGCGTGGCCGACCTGGTGAGGCCC GGCGCCAGCCTGAAGCTGAGCTGCACCGCCAGCGGCTTCAACATCAAGAGCGCCTACATGCACTGGGTGATCCAGAGG CCCGACCAGGGCCCCGAGTGCCTGGGCAGGATCGACCCCGCCACCGGCAAGACCAAGTACGCCCCCAAGTTCCAGGCC AAG G C C AC CAT C AC C G C C GAC AC C AG C AGC AAC AC C G C C T AC C T G C AG C T G AGC AG C C T G AC C AG C GAG GAC AC C G C C
ATCTACTACTGCACCAGGAGCCTGAACTGGGACTACGGCCTGGACTACTGGGGCCAGGGCACCAGCGTGACCGTGAGC AGCttcgtgcctgtgtttctgcctgccaagcccaccacaacccctgcccctagacctcctacacccgcccctacaatc gccagccagcctctgtctctgaggcccgaggcttgtagacctgctgctggcggagccgtgcacaccagaggactggat ttcgcctgcgacatctacatctgggcccctctggccggcacatgtggcgtgctgctgctgagcctcgtgatcaccctg tactgcaaccaccggaacagaagcaagcggagccggctgctgcacagcgactacatgaacatgacccccagacggcct ggccccaccagaaagcactaccagccttacgcccctcccagagacttcgccgcctaccggtccagagtgaagttcagc agaagcgccgacgcccctgcctatcagcagggccagaaccagctgtacaacgagctgaacctgggcagacgggaagag tacgatgtgctggacaaaagacgtggccgggaccctgagatggggggaaagccgagaaggaagaaccctcaggaaggc ctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagattgggatgaaaggcgagcgccggaggggc aaggggcacgatggcctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggccctg ccccctcgc
[SEQ ID No: 36]
Preferably, therefore, the CAR construct is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 36, or a fragment or variant thereof.
In another preferred embodiment, the anti-TCRVβ2 CAR construct (known as “MPB2D5 CAR”) comprises a 3x G4S linker. In one embodiment, the anti-TCRVβ2 CAR (having a 3x G4S linker) can have an amino acid sequence referred to herein as SEQ ID NO:37, as follows:
MALPVTALLLPLALLLHAARPDIVLTQSPASLAVSLGQRATISCRASKSVSILGTHLIHWYQQKPGQPPK LLIYAASNLESGVPARFSGSGSETVFTLNIHPVEEEDAATYFCQQSIEDPWTFGGGTKLGIKGGGGSGGG GSGGGGSEVQLQQSVADLVRPGASLKLSCTASGFNIKSAYMHWVIQRPDQGPECLGRIDPATGKTKYAPK FQAKATITADTSSNTAYLQLSSLTSEDTAIYYCTRSLNWDYGLDYWGQGTSVTVSSFVPVFLPAKPTTTP
APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNR SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRRE EYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
[SEQ ID No: 37] Preferably, therefore, the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No: 37, or a fragment or variant thereof.
In one embodiment, a nucleotide sequence encoding the anti-TCRVβ2 CAR (with a 3x G4S linker) is referred to herein as SEQ ID No: 38, as follows: atggctctgcctgtgacagctctgctgctgcctctggccctgctgctgcatgccgccagacctGACATCGTGCTGACC CAGAGCCCCGCCAGCCTGGCCGTGAGCCTGGGCCAGAGGGCCACCATCAGCTGCAGGGCCAGCAAGAGCGTGAGCATC CTGGGCACCCACCTGATCCACTGGTACCAGCAGAAGCCCGGCCAGCCCCCCAAGCTGCTGATCTACGCCGCtAGCAAC CTGGAGAGCGGCGTGCCCGCCAGGTTCAGCGGCAGCGGCAGCGAGACCGTGTTCACCCTGAACATCCACCCCGTGGAG GAGGAGGACGCCGCCACCTACTTCTGCCAGCAGAGCATCGAGGACCCCTGGACCTTCGGCGGCGGCACCAAGCTGGGC ATCAAGGGAGGCGGAGGCTCTGGCGGAGGCGGCTCTGGCGGAGGCGGCTCTGAGGTGCAGCTGCAGCAGAGCGTGGCC GACCTGGTGAGGCCCGGCGCCAGCCTGAAGCTGAGCTGCACCGCCAGCGGCTTCAACATCAAGAGCGCCTACATGCAC TGGGTGATCCAGAGGCCCGACCAGGGCCCCGAGTGCCTGGGCAGGATCGACCCCGCCACCGGCAAGACCAAGTACGCC CCCAAGTTCCAGGCCAAGGCCACCATCACCGCCGACACCAGCAGCAACACCGCCTACCTGCAGCTGAGCAGCCTGACC AGCGAGGACACCGCCATCTACTACTGCACCAGGAGCCTGAACTGGGACTACGGCCTGGACTACTGGGGCCAGGGCACC AGCGTGACCGTGAGCAGCttcgtgcctgtgtttctgcctgccaagcccaccacaacccctgcccctagacctcctaca cccgcccctacaatcgccagccagcctctgtctctgaggcccgaggcttgtagacctgctgctggcggagccgtgcac accagaggactggatttcgcctgcgacatctacatctgggcccctctggccggcacatgtggcgtgctgctgctgagc ctcgtgatcaccctgtactgcaaccaccggaacagaagcaagcggagccggctgctgcacagcgactacatgaacatg acccccagacggcctggccccaccagaaagcactaccagccttacgcccctcccagagacttcgccgcctaccggtcc agagtgaagttcagcagaagcgccgacgcccctgcctatcagcagggccagaaccagctgtacaacgagctgaacctg ggcagacgggaagagtacgatgtgctggacaaaagacgtggccgggaccctgagatggggggaaagccgagaaggaag aaccctcaggaaggcctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagattgggatgaaaggc gagcgccggaggggcaaggggcacgatggcctttaccagggtctcagtacagccaccaaggacacctacgacgccctt cacatgcaggccctgccccctcgc
[SEQ ID No: 38] Preferably, therefore, the CAR construct is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 38, or a fragment or variant thereof.
“FIN9 CAR”
In one preferred embodiment the anti-TCRVβ CAR construct is an anti-TCRVβ9 CAR (known as “FIN9 CAR”). Preferably, the anti-TCRVβ9 CAR comprises a 2x G4S linker.
In one embodiment, the anti-TCRVβ9 CAR construct has an amino acid sequence referred to herein as SEQ ID No:39, as follows:
MALPVTALLLPLALLLHAARPETTVTQSPASLSVATGEKVTIRCISSTDIDDDMNWYQQKSGEPPKLLISEGNTLRPG VPSRFSSSGYGTDFVFTIENMLSEDVADYYCLQSDNMPLTFGAGTKLELKGGGGSGGGGSEVQLQQSVAELVRPGASV KLSCTASGFNIKNTFMHWVKQRPEQGLEWI GRIDPTNGYTKFAPKFQGKATLTAVTSSNTVYLQLSSLTSEDTAIYYC AHDYDAPWFAYWGQGTLVIVSAFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI YIWAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADA PAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG LYQGLSTATKDTYDALHMQALPPR
[SEQ ID No: 39] Preferably, therefore, the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No:39, or a fragment or variant thereof.
In one embodiment, a nucleotide sequence encoding the anti-TCRVβ9 CAR (with 2x G4S linker) is referred to herein as SEQ ID No: 40, as follows: atggctctgcctgtgacagctctgctgctgcctctggccctgctgctgcatgccgccagacctGAGACCACCGTGACC
CAGAGCCCCGCCAGCCTGAGCGTGGCCACCGGCGAGAAGGTGACCATCAGGTGCATCAGCAGCACCGACATCGACGAC
GACATGAACTGGTACCAGCAGAAGAGCGGCGAGCCCCCCAAGCTGCTGATCAGCGAGGGCAACACCCTGAGGCCCGGC GTGCCCAGCAGGTTCAGCAGCAGCGGCTACGGCACCGACTTCGTGTTCACCATCGAGAACATGCTGAGCGAGGACGTG GCCGACTACTACTGCCTGCAGAGCGACAACATGCCCCTGACCTTCGGCGCCGGCACCAAGCTGGAGCTGAAGGGAGGC GGAGGCTCTGGCGGAGGCGGCTCTGAGGTGCAGCTGCAGCAGAGCGTGGCCGAGCTGGTGAGGCCCGGCGCCAGCGTG AAGCTGAGCTGCACCGCCAGCGGCTTCAACATCAAGAACACCTTCATGCACTGGGTGAAGCAGAGGCCCGAGCAGGGC
CTGGAGTGGATCGGCAGGATCGACCCCACCAACGGCTACACCAAGTTCGCCCCCAAGTTCCAGGGCAAGGCCACCCTG ACCGCCGTGACCAGCAGCAACACCGTGTACCTGCAGCTGAGCAGCCTGACCAGCGAGGACACCGCCATCTACTACTGC
GCCCACGACTACGACGCCCCCTGGTTCGCCTACTGGGGCCAGGGCACCCTGGTGATCGTGAGCGCCttcgtgcctgtg tttctgcctgccaagcccaccacaacccctgcccctagacctcctacacccgcccctacaatcgccagccagcctctg tctctgaggcccgaggcttgtagacctgctgctggcggagccgtgcacaccagaggactggatttcgcctgcgacatc tacatctgggcccctctggccggcacatgtggcgtgctgctgctgagcctcgtgatcaccctgtactgcaaccaccgg aacagaagcaagcggagccggctgctgcacagcgactacatgaacatgacccccagacggcctggccccaccagaaag cactaccagccttacgcccctcccagagacttcgccgcctaccggtccagagtgaagttcagcagaagcgccgacgcc cctgcctatcagcagggccagaaccagctgtacaacgagctgaacctgggcagacgggaagagtacgatgtgctggac aaaagacgtggccgggaccctgagatggggggaaagccgagaaggaagaaccctcaggaaggcctgtacaatgaactg cagaaagataagatggcggaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaaggggcacgatggc ctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggccctgccccctcgc
[SEQ ID No: 40]
Preferably, therefore, the CAR construct is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 40, or a fragment or variant thereof.
In another preferred embodiment, the anti-TCRVβ9 CAR construct (known as “FIN9 CAR”) comprise a 3x G4S linker. In one embodiment, the anti-TCRVβ9 CAR (having a 3x G4S linker) can have an amino acid sequence referred to herein as SEQ ID No:4i, as follows:
MALPVTALLLPLALLLHAARPETTVTQSPASLSVATGEKVTIRCISSTDIDDDMNWYQQKSGEPPKLLISEGNTLRPG
VPSRFSSSGYGTDFVFTIENMLSEDVADYYCLQSDNMPLTFGAGTKLELKGGGGSGGGGSGGGGSEVQLQQSVAELVR
PGASVKLSCTASGFNIKNTFMHWVKQRPEQGLEWIGRIDPTNGYTKFAPKFQGKATLTAVTSSNTVYLQLSSLTSEDT AIYYCAHDYDAPWFAYWGQGTLVIVSAFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLD
FACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFS
RSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRG
KGHDGLYQGLSTATKDTYDALHMQALPPR
[SEQ ID No: 41] Preferably, therefore, the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No: 41, or a fragment or variant thereof.
In one embodiment, a nucleotide sequence encoding the anti-TCRVβ9 CAR (with 3x G4S) is referred to herein as SEQ ID No: 42, as follows: atggctctgcctgtgacagctctgctgctgcctctggccctgctgctgcatgccgccagacctGAGACCACCGTGACC CAGAGCCCCGCCAGCCTGAGCGTGGCCACCGGCGAGAAGGTGACCATCAGGTGCATCAGCAGCACCGACATCGACGAC GACATGAACTGGTACCAGCAGAAGAGCGGCGAGCCCCCCAAGCTGCTGATCAGCGAGGGCAACACCCTGAGGCCCGGC GTGCCCAGCAGGTTCAGCAGCAGCGGCTACGGCACCGACTTCGTGTTCACCATCGAGAACATGCTGAGCGAGGACGTG GCCGACTACTACTGCCTGCAGAGCGACAACATGCCCCTGACCTTCGGCGCCGGCACCAAGCTGGAGCTGAAGGGAGGC GGAGGCTCTGGCGGAGGCGGCTCTGGCGGAGGCGGCTCTGAGGTGCAGCTGCAGCAGAGCGTGGCCGAGCTGGTGAGG CCCGGCGCCAGCGTGAAGCTGAGCTGCACCGCCAGCGGCTTCAACATCAAGAACACCTTCATGCACTGGGTGAAGCAG AGGCCCGAGCAGGGCCTGGAGTGGATCGGCAGGATCGACCCCACCAACGGCTACACCAAGTTCGCCCCCAAGTTCCAG GGCAAGGCCACCCTGACCGCCGTGACCAGCAGCAACACCGTGTACCTGCAGCTGAGCAGCCTGACCAGCGAGGACACC GCCATCTACTACTGCGCCCACGACTACGACGCCCCCTGGTTCGCCTACTGGGGCCAGGGCACCCTGGTGATCGTGAGC GCCttcgtgcctgtgtttctgcctgccaagcccaccacaacccctgcccctagacctcctacacccgcccctacaatc gccagccagcctctgtctctgaggcccgaggcttgtagacctgctgctggcggagccgtgcacaccagaggactggat ttcgcctgcgacatctacatctgggcccctctggccggcacatgtggcgtgctgctgctgagcctcgtgatcaccctg tactgcaaccaccggaacagaagcaagcggagccggctgctgcacagcgactacatgaacatgacccccagacggcct ggccccaccagaaagcactaccagccttacgcccctcccagagacttcgccgcctaccggtccagagtgaagttcagc agaagcgccgacgcccctgcctatcagcagggccagaaccagctgtacaacgagctgaacctgggcagacgggaagag tacgatgtgctggacaaaagacgtggccgggaccctgagatggggggaaagccgagaaggaagaaccctcaggaaggc ctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagattgggatgaaaggcgagcgccggaggggc aaggggcacgatggcctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggccctg ccccctcgc
[SEQ ID No: 42] Preferably, therefore, the construct is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 42, or a fragment or variant thereof.
“C21 CAR”
In yet another preferred embodiment, the anti-TCRVβ CAR construct is an anti- TCRVβ11 CAR (known as “C21 CAR”). Preferably, the anti-TCRVβ11 CAR comprises have a 2x G4S linker. In one embodiment, the anti-TCRVβ11 CAR construct (having a 2x G4S linker) can have an amino acid sequence referred to herein as SEQ ID No: 43, as follows: MALPVTALLLPLALLLHAARPDIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKAGKSPKTLIYRANRLVDG
VPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPFTFGGGTRLEIKGGGGSGGGGSQVQLQQSGPEWRPGVSV KISCKGSGYRFTDSAMHWVKQSHAKSLEWI GVISSYNGNTNYNQKFKGKATMTVDKSSSTAYMELARMTSEDSAIYYC ARSRDAMDYWGQGTSVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYI WAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPA YQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR
[SEQ ID No: 43] Preferably, therefore, the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No 143, or a fragment or variant thereof. In one embodiment, a nucleotide sequence encoding the anti-TCRVβ11 CAR (with a 2x G4S linker) is referred to herein as SEQ ID No: 52, as follows:
ATGGCTCTGCCCGTCACAGCTCTGCTGCTGCCTCTGGCTCTGCTGCTGCACGCTGCTAGACCCGACATTAAGATGACC CAGTCCCCCTCCTCCATGTATGCCAGCCTCGGCGAGAGAGTCACCATCACATGCAAGGCCAGCCAAGACATCAACAGC TACCTCAGCTGGTTCCAGCAGAAAGCCGGCAAGAGCCCCAAGACACTGATCTATAGGGCTAATAGACTGGTGGACGGC GTGCCTAGCAGATTTTCCGGCAGCGGCAGCGGCCAAGACTATTCTCTGACCATCAGCTCTCTGGAGTACGAGGACATG GGAATCTACTACTGTCTGCAGTACGACGAGTTCCCCTTCACCTTCGGAGGCGGCACAAGACTGGAAATCAAAGGAGGA GGAGGATCCGGAGGCGGAGGAAGCCAAGTGCAGCTCCAGCAGTCCGGACCCGAGGTGGTGAGGCCCGGCGTGAGCGTG AAGATCAGCTGCAAGGGCAGCGGCTATAGGTTCACCGACTCCGCCATGCACTGGGTGAAGCAGTCCCATGCCAAGAGC C T C GAG T G GAT C G G C GT GAT C AG C AG C T AC AAC G G C AAC AC CAAC T ACAAC C AGAAG T T C AAG G G C AAG G C C AC AAT G AC C GT G GACAAGAG C AG C T C C AC C G C C T AC AT G GAG C T G G C C AGAAT GAC C AGC GAG GAT AG C G C C AT C T AC T AC T GT GCTAGGTCTAGAGACGCCATGGACTACTGGGGCCAAGGCACATCCGTGACCGTGAGCTCCTTTGTGCCCGTGTTTCTG CCCGCCAAGCCTACAACCACACCCGCTCCTAGACCTCCCACCCCCGCCCCTACCATCGCTTCCCAGCCTCTGTCTCTG AGACCCGAGGCTTGCAGACCCGCCGCTGGAGGCGCTGTGCACACCAGAGGActggatttcgcctgcgacatctacatc tgggcccctctggccggcacatgtggcgtgctgctgctgagcctcgtgatcaccctgtactgcaaccaccggaacaga agcaagcggagccggctgctgcacagcgactacatgaacatgacccccagacggcctggccccaccagaaagcactac cagccttacgcccctcccagagacttcgccgcctaccggtccagagtgaagttcagcagaagcgccgacgcccctgcc tatcagcagggccagaaccagctgtacaacgagctgaacctgggcagacgggaagagtacgatgtgctggacaaaaga cgtggccgggaccctgagatggggggaaagccgagaaggaagaaccctcaggaaggcctgtacaatgaactgcagaaa gataagatggcggaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaaggggcacgatggcctttac cagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggccctgccccctcgc
[SEQ ID No: 52] Preferably, therefore, the construct is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 52, or a fragment or variant thereof.
In another preferred embodiment, the anti-TCRVβ11 CAR construct (known as “C21 CAR”) comprises a 3x G4S linker. In one embodiment, the anti-TCRVβ11 CAR construct (having a 3x G4S linker) can have an amino acid sequence referred to herein as SEQ ID NO:44, as follows:
MALPVTALLLPLALLLHAARPDI KMTQSPS SMYASLGERVTITCKASQDINSYLSWFQQKAGKSPKTLIYRANRLVDG
VPSRFS GSGSGQDYSLTI SSLEYEDMGIYYCLQYDEFPFTFGGGTRLEI KGGGGSGGGGS GGGGSQVQLQQSGPEWR PGVSVKI SCKGSGYRFTDSAMHWVKQSHAKSLEWI GVI SSYNGNTNYNQKFKGKATMTVDKSSSTAYMELARMTSEDS
AIYYCARSRDAMDYWGQGTSVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA GDI YIWAPLAGTCGVLLLSLVITLYCNHRNRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRS ADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEI GMKGERRRGKG HDGLYQGLSTATKDTYDALHMQALPPR
[SEQ ID No: 44] Preferably, therefore, the CAR construct an amino acid sequence substantially as set out in SEQ ID No: 44, or a fragment or variant thereof.
In one embodiment, a nucleotide sequence encoding the anti-TCRVβ11 CAR (with a 3x G4S linker) is referred to herein as SEQ ID No: 45, as follows:
ATGGCTCTGCCCGTCACAGCTCTGCTGCTGCCTCTGGCTCTGCTGCTGCACGCTGCTAGACCCGACATTAAGATGACC CAGTCCCCCTCCTCCATGTATGCCAGCCTCGGCGAGAGAGTCACCATCACATGCAAGGCCAGCCAAGACATCAACAGC TACCTCAGCTGGTTCCAGCAGAAAGCCGGCAAGAGCCCCAAGACACTGATCTATAGGGCTAATAGACTGGTGGACGGC GTGCCTAGCAGATTTTCCGGCAGCGGCAGCGGCCAAGACTATTCTCTGACCATCAGCTCTCTGGAGTACGAGGACATG GGAATCTACTACTGTCTGCAGTACGACGAGTTCCCCTTCACCTTCGGAGGCGGCACAAGACTGGAAATCAAAGGAGGA GGAGGATCCGGAGGCGGAGGAAGCGGAGGCGGAGGAAGCCAAGTGCAGCTCCAGCAGTCCGGACCCGAGGTGGTGAGG CCCGGCGTGAGCGTGAAGATCAGCTGCAAGGGCAGCGGCTATAGGTTCACCGACTCCGCCATGCACTGGGTGAAGCAG TCCCATGCCAAGAGCCTCGAGTGGATCGGCGTGATCAGCAGCTACAACGGCAACACCAACTACAACCAGAAGTTCAAG GGCAAGGCCACAATGACCGTGGACAAGAGCAGCTCCACCGCCTACATGGAGCTGGCCAGAATGACCAGCGAGGATAGC GCCATCTACTACTGTGCTAGGTCTAGAGACGCCATGGACTACTGGGGCCAAGGCACATCCGTGACCGTGAGCTCCTTT GTGCCCGTGTTTCTGCCCGCCAAGCCTACAACCACACCCGCTCCTAGACCTCCCACCCCCGCCCCTACCATCGCTTCC CAGCCTCTGTCTCTGAGACCCGAGGCTTGCAGACCCGCCGCTGGAGGCGCTGTGCACACCAGAGGActggatttcgcc tgcgacatctacatctgggcccctctggccggcacatgtggcgtgctgctgctgagcctcgtgatcaccctgtactgc aaccaccggaacagaagcaagcggagccggctgctgcacagcgactacatgaacatgacccccagacggcctggcccc accagaaagcactaccagccttacgcccctcccagagacttcgccgcctaccggtccagagtgaagttcagcagaagc gccgacgcccctgcctatcagcagggccagaaccagctgtacaacgagctgaacctgggcagacgggaagagtacgat gtgctggacaaaagacgtggccgggaccctgagatggggggaaagccgagaaggaagaaccctcaggaaggcctgtac aatgaactgcagaaagataagatggcggaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaagggg cacgatggcctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggccctgccccct cgc
[SEQ ID No: 45] Preferably, therefore, the CAR construct is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 45, or a fragment or variant thereof.
In a second aspect, there is provided a nucleic acid encoding the CAR construct of the first aspect.
Preferably, the nucleic acid comprises a promoter operably linked to the sequence encoding the CAR construct. The promoter is preferably disposed 5’ of the sequence encoding the signalling peptide. The promoter drives expression of the CAR construct in a host cell.
The promoter may be any suitable promoter, including a constitutive promoter, an activatable promoter, an inducible promoter, or a tissue-specific promoter. Constitutive promoters allow heterologous genes (also referred to as transgenes) to be expressed constitutively in the host cells. Exemplary constitutive promoters contemplated herein include, but are not limited to, Cytomegalovirus (CMV) promoters, human elongation factors-1 alpha (hEFla), ubiquitin C promoter (UbiC), phosphoglycerokinase promoter (PGK), simian virus 40 early promoter (SV40), and chicken β- Actin promoter coupled with CMV early enhancer (CAGG). Inducible promoters belong to the category of regulated promoters. The inducible promoter can be induced by one or more conditions, such as a physical condition, microenvironment of the engineered immune effector cell, or the physiological state of the engineered immune effector cell, an inducer (i.e., an inducing agent), or a combination thereof. In some embodiments, the inducing condition does not induce the expression of endogenous genes in the engineered mammalian cell, and/ or in the subject that receives the pharmaceutical composition. In some embodiments, the inducing condition is selected from the group consisting of: inducer, irradiation (such as ionizing radiation, light), temperature (such as heat), redox state, tumor environment, and the activation state of the engineered mammalian cell.
In one embodiment, the promoter may be the PGK promoter (EMBL NO: A19297.1). In an embodiment, the PGK promoter is referred to herein as SEQ ID No: 48, as follows:
GGGTAGGGGAGGCGCTTTTCCCAAGGCAGTCTGGAGCATGCGCTTTAGCAGCCCCGCTGGGCACTTGGCGCTACACAA GTGGCCTCTGGCCTCGCACACATTCCACATCCACCGGTAGGCGCCAACCGGCTCCGTTCTTTGGTGGCCCCTTCGCGC CACCTTCTACTCCTCCCCTAGTCAGGAAGTTCCCCCCCGCCCCGCAGCTCGCGTCGTGCAGGACGTGACAAATGGAAG TAGCACGTCTCACTAGTCTCGTGCAGATGGACAGCACCGCTGAGCAATGGAAGCGGGTAGGCCTTTGGGGCAGCGGCC AATAGCAGCTTTGCTCCTTCGCTTTCTGGGCTCAGAGGCTGGGAAGGGGTGGGTCCGGGGGCGGGCTCAGGGGCGGGC TCAGGGGCGGGGCGGGCGCCCGAAGGTCCTCCGGAGGCCCGGCATTCTGCACGCTTCAAAAGCGCACGTCTGCCGCGC TGTTCTCCTCTTCCTCATTCTCCGGGCCTTTCG
[SEQ ID No: 48]
Preferably, therefore, the promoter may comprise a nucleotide sequence substantially as set out in SEQ ID No: 48, or a fragment or variant thereof.
In a preferred embodiment, the nucleic acid of the second aspect is selected from any of the nucleic acid sequences described herein.
In a third aspect, there is provided an expression vector or a plasmid encoding the CAR construct of the first aspect, or comprising the nucleic acid of the second aspect. Preferably, the vector is recombinant. Preferably, the vector is a viral vector, more preferably a retroviral vector, even more preferably a lentivirus. Maps showing the vector’s plasmid structure of exemplary anti-TCRVβ CAR constructs tested in the present invention are shown in Figures 4-7.
Preferably, the vector comprises left (i.e. N-term) and/or right (i.e. C-term) Long Terminal Repeat sequences (LTRs). Preferably, each LTR is disposed at the N-term and/or C-term of the construct. In a preferred embodiment, the vector comprises a 5’/N-term LTR - a promoter - a variable light chain of a scFv domain of an anti-TCRVβ antibody - a linker - a variable heavy chain of a scFv domain of an anti-TCRVβ antibody - a hinge - a co-stimulatory domain comprising CD28 - a stimulatory protein CDЗζ - a 3’/C-term LTR. Preferably, the hinge comprises a CD8α hinge, and optionally, a transmembrane and/ or cytoplasmic domain.
In a fourth aspect, there is provided an effector cell expressing the CAR construct of the first aspect, or comprising the nucleic acid of the second aspect or the vector according to the third aspect.
The vector may be a lenti-virus vector. The vector may be a retroviral vector.
Preferably, the effector cell is a normal or conventional ocpT-cell, or an innate lymphocyte, such as an invariant natural killer T (iNKT) cell, y8T cell or NK cell.
The skilled person is aware that conventional apT-cells are one of two primary types of lymphocytes (B cells being the second type) which determ i ne the specificity of an immune response to antigens (foreign substances) in the body. T cells coordinate multiple aspects of adaptive immunity throughout life, including responses to pathogens, allergens, and tumours through the production of cytokines and effector molecules. In humans, T cells control multiple insults simultaneously throughout the body and maintain immune, homeostasis over decades. Thus, in one embodiment, the effector cell of the invention is a conventional T-cell. A “conventional T-cell” may be defined as a T lymphocyte that expresses an op T cell receptor (TCR), as well as a co-receptor CD4 or CD8, and is present in the peripheral blood, lymph nodes, and tissues.
In another preferred embodiment, however, the effector cell is an iNKT cell. iNKT cells are a subset of immunoregulatory and effector T cells representing less than 0.1 % of the total T cell numbers in human.
There are several structural and functional differences between iNKT cells and conventional T cells. In particular, iNKT cells express an invariant Va24Jai8 chain which is almost always paired with the same TCRVβ11 diverse chain. Furthermore, iNKT cells are also restricted by the non-polymorphic HLA class I -like molecule CDid presenting endogenous or exogenous, glyco- or phospho-lipid ligands to iTCR. In contrast to conventional T-cells, which are restricted by highly polymorphic MHC presenting peptides, iNKT cells require the expression of CDid on thymocytes in order to be selected and activated. Conversely, conventional T-cells require the expression of MHC molecules on epithelial thymic epithelial cells for their selection and activation. iNKT cells provide effective immune responses against infectious agents, tumour, allo- and auto-reactivity and atheromatosis. Several pre-clinical studies have demonstrated the ability of adoptively transferred donor iNKT cells to prevent or even abrogate established experimental acute graft-versus-host disease (aGVHD), an alloreactive phenomenon that occurs in the context of allogeneic haemopoietic stem cell transplantation. aGVHD is driven primarily by donor alloreactive T cells activated in response to major or minor histocompatibility antigen disparities between donor and recipient. In line with the pre-clinical evidence, several clinical observational studies have demonstrated that a higher dose or frequency of donor iNKT cells transferred to the recipient with the peripheral blood stem cell graft impart significant protection from aGVHD without compromising the graft-versus-tumour effect.
In humans, iNKT cells are quantitatively and qualitatively altered in different types of tumours, including blood cancers such as multiple myeloma, while tumour bed infiltration by iNKT cells appears to confer favourable prognosis in colorectal cancer. Much of the anti-tumour effect of iNKT cells depends on their ability to be cytolytic directly, through perforin/granzymes and other cell death pathways against tumours that express CDid, or indirectly, through their secretion of copious amounts of (interferon-gamma) IFNy, and/or secondary activation of NK cells or conventional T cell-dependent anti-tumour responses.
It will be appreciated that the effector cell of the fourth aspect is produced by transducing a T-cell or an iNKT cell with the nucleic acid or the vector encoding the CAR construct.
Thus, in a fifth aspect, there is provided a method of producing an effector cell expressing an anti-TCRVβ CAR, the method comprising transducing an effector cell with the nucleic acid according to the second aspect or the vector according to the third aspect, such that the effector cell expresses an anti-TCRVβ CAR.
Preferably, the effector cell is a normal or conventional ocpT-cell, or an innate lymphocyte, such as an invariant natural killer T (iNKT) cell, y8T cell or NK cell.
Preferably, the method comprises an initial step of isolating the effector cell from peripheral blood cells (PBCs). Preferably, the effector cell is activated with one or both of CD3 and CD28 antibodies. Preferably, the effector cell is activated with an interleukin. The interleukin may be IL- 15. In a preferred embodiment, the effector cell is activated with CD3 and CD28 antibodies and IL-15. In a preferred embodiment, the nucleic acid and/or vector encoding the anti-TCRVβ CAR may comprise any of nucleic acids or vectors described herein.
In a sixth aspect, there is provided a pharmaceutical composition comprising a therapeutically effective amount of the CAR construct according to the first aspect, the nucleic acid of the second aspect, the vector of the third aspect, or the effector cell according to the fourth aspect and a pharmaceutically acceptable excipient.
Preferably, the effector cell is a normal (i.e., conventional ocpT-cell), or an innate lymphocyte, such as an invariant natural killer T (iNKT) cell, y8T cell or NK cell. Preferably, the pharmaceutical composition comprises a plurality of the effector cell of the invention, preferably a T cell, or iNKT cell. For example, the composition may comprise at least too, 1000, or 10,000 effector cells. Preferably, the composition comprises at least 100,000, or at least 1,000,000 or at least 10,000,000 effector cells.
In a seventh aspect, there is provided the CAR construct according to the first aspect, the nucleic acid of the second aspect, the vector of the third aspect, the effector cell according to the fourth aspect, or the pharmaceutical composition of the six aspect, for use in therapy or diagnosis.
In an eighth aspect, there is provided the CAR construct according to the first aspect, the nucleic acid of the second aspect, the vector of the third aspect, the effector cell according to the fourth aspect, or the pharmaceutical composition of the six aspect, for use in (i) immunotherapy; (ii) for treating, preventing or ameliorating cancer; (iii) for treating, preventing or ameliorating an autoimmune disease; or (iv) for treating, preventing or ameliorating any disease characterised by the presence of pathogenic T cells.
In a ninth aspect, the invention provides a method of: (i) treating, preventing or ameliorating a disease in a subject with immunotherapy; (ii) treating, preventing or ameliorating cancer; (iii) for treating, preventing or ameliorating an autoimmune disease in a subject; or (iv) for treating, preventing or ameliorating any disease characterised by the presence of pathogenic T cells , the method comprising administering, or having administered, to a patient in need of such treatment, a therapeutically effective amount of the CAR construct according to the first aspect, the nucleic acid of the second aspect, the vector of the third aspect, the effector cell according to the fourth aspect, or the pharmaceutical composition of the six aspect.
In one embodiment of the eighth or ninth aspect of the invention, the CAR construct, effector cell or pharmaceutical composition is for use in treating, preventing or ameliorating cancer. Preferably, the cancer is a T-cell malignancy, which may be a solid tumour or a liquid tumour.
As per WHO 2022 classification of haematolymphoid neoplasms, the T-cell neoplasms may be precursor T-cell neoplasms, such as T-lymphoblastic leukaemia / lymphoma or mature T-cell neoplasms, or Peripheral T cell lymphoma (PTCL). Collectively, with current treatments, the five year survival is 35-40%. As per WHO 2022 classification, mature T-cell neoplasms comprise a diverse group of uncommon and aggressive diseases in which the patient’s T cells become cancerous. They are divided into three categories, i.e. nodal, extranodal and leukaemic, each of which are encompassed by the invention.
Mature T-cell neoplasm may be a TCL subtype selected from a group consisting of: Mature T-cell leukaemias; Primary cutaneous T-cell lymphoid proliferations and lymphomas; Intestinal T-cell lymphoid proliferations and lymphomas; Hepatosplenic T-cell lymphoma; Anaplastic large cell lymphoma; Nodal T-follicular helper (TFH) cell lymphoma; Peripheral T-cell lymphoma, NOS; EBV-positive NK-cell and T-cell lymphomas; EBV-positive T-cell lymphoid proliferations and lymphomas of childhood and all specific TCL entities within each of these subtypes as per WHO classification.
Adult T-Cell Leukaemia/Lymphoma (ATL) is more commonly found in Japan and the Caribbean than in the United States, and is associated with the human T-cell leukaemia virus type-1 (HTLV-1), rare and aggressive disease that starts in the liver or spleen and usually affects young adults in their 20s and 30s. Treatment for patients with hepatosplenic T-cell lymphoma includes anthracycline-based chemotherapy and, in some cases, stem cell transplantation.
Subcutaneous Panniculitis-Like Lymphoma (SPTCL) is the rarest and least well- defined of the T-cell lymphomas. This lymphoma occurs primarily in the subcutaneous fat tissue, where it causes nodules to form. Symptoms include fever, chills, weight loss and oral mucosal ulcers. SPTCL may be either rapidly aggressive or indolent (slow growing). Treatment includes combination anthracycline-based chemotherapy or localized radiation. Precursor T-Cell Acute Lymphoblastic Lymphoma or Leukaemia may be diagnosed as leukaemia or lymphoma or both. This cancer is found in both children and adults and is most commonly diagnosed in adolescent and adult males.
Treatment for newly diagnosed patients with precursor T-cell acute lymphoblastic lymphoma or leukemia is aggressive chemotherapy and radiation. Nelarabine (Arranon®) is approved for the treatment of relapsed or refractory precursor T-cell acute lymphoblastic lymphoma or leukemia in adults and children. Angioimmunoblastic T-cell lymphoma (AITL) exemplifies a neoplasm characterized by intense inflammatory and immune reactions, as evidenced by its clinical, pathologic, cellular, and biologic properties. Because tumour cells phenotypically resemble T follicular helper (Tfh) cells, they are considered to function similarly to some extent to nonneoplastic Tfh cells seen in reactive follicular hyperplasia. However, follicles are not hyperplastic but are rather depleted or destroyed in vast majority of AITL cases. AITL was recently reported to account for 36.1% of PTCL.
Cutaneous T-cell lymphoma (CTCL) constitute about 70-75% of the primary cutaneous lymphomas. The CTCL may be a CTCL subtype selected from a group consisting of:
Mycosis fungoides (MF); Sezary syndrome (SS); and CD4+ small medium pleomorphic T-cell lymphoproliferative disorder.
Mycosis fungoides (MF) is the most common subtype. Sezary syndrome (SS) is a more aggressive type of CTCL. Patients with SS have eiythroderma (i.e. rash affecting >80% body surface area [BSA]), lymphadenopathy, and high numbers of circulating neoplastic CD4+ T cells in the peripheral blood.
In other embodiments, the CAR construct, effector cell or pharmaceutical composition may be used in treating any disease caused by pathogenic T cells.
In other embodiments, the CAR construct, effector cell or pharmaceutical composition maybe used in treating, preventing or ameliorating an autoimmune disease. The autoimmune disease may be caused by pathogenic autoreactive T cells, or selected from a group consisting of: systemic lupus erythematosus, rheumatoid arthritis, and myasthenia gravis.
It will be appreciated that the CAR construct, nucleic acid, vector, effector cell or pharmaceutical composition according to the invention (collectively referred to herein as “agents”) may be used in a monotherapy (e.g. the use of the CAR construct, nucleic acid, vector, effector cell or pharmaceutical composition alone), for therapy, preferably use in (i) immunotherapy; (ii) for treating, preventing or ameliorating cancer; (iii) for treating, preventing or ameliorating an autoimmune disease; or (iv) for treating, preventing or ameliorating any disease characterised by the presence of pathogenic T cells. Alternatively, CAR construct, effector cell or pharmaceutical composition according to the invention may be used as an adjunct to, or in combination with, known immunotherapies or for treating disease caused by pathogenic T cells, as well as cancers or autoimmune disease.
The agents according to the invention may be combined in compositions having a number of different forms depending, in particular, on the manner in which the composition is to be used. Thus, for example, the composition may be in the form of a liquid, preferably delivered intravenously to a person in need of treatment. It will be appreciated that the vehicle of medicaments according to the invention should be one which is well-tolerated by the subject to whom it is given.
In a preferred embodiment, agents and medicaments according to the invention may be administered to a subject by injection into the blood stream or directly into a site requiring treatment. Injections maybe intravenous (bolus or infusion) or subcutaneous (bolus or infusion), or intradermal (bolus or infusion), or directly into tumours.
It will be appreciated that the amount of the CAR construct or the vector or effector cell (i.e. agent) that is required is determined by its biological activity and bioavailability, which in turn depends on the mode of administration, the physiochemical properties of the agent, and whether it is being used as a monotherapy or in a combined therapy. The frequency of administration will also be influenced by the in vivo persistence of the agent within the subject being treated. Optimal dosages to be administered may be determined by those skilled in the art, and will vary with the particular agent in use, the strength of the pharmaceutical composition, the mode of administration, and the advancement of the disease being treated, for example cancer, T-cell malignancies, or autoimmune disease. Additional factors depending on the particular subject being treated will result in a need to adjust dosages, including subject age, weight, gender, diet, and time of administration.
The invention also provides in a tenth aspect, a process for making the pharmaceutical composition according to the sixth aspect, the process comprising combining a therapeutically effective amount of the CAR construct according to the first aspect, the nucleic acid of the second aspect, the vector of the third aspect, or the effector cell according to the fourth aspect, and a pharmaceutically acceptable vehicle. A “subject” may be a vertebrate, mammal, or domestic animal. Most preferably, the subject is a human being. A “therapeutically effective amount” of the CAR construct, nucleic acid, vector, effector cell of composition is any amount which, when administered to a subject, is the amount of agent that is needed to treat the disease being treated, for example cancer, or produce the desired effect.
For example, the therapeutically effective amount of the effector cell used may be at least too, 1000, or 10,000 effector cells. Preferably, at least 100,000, or at least 1,000,000 or at least 10,000,000 effector cells is used.
A “pharmaceutically acceptable vehicle” as referred to herein, is any known compound or combination of known compounds that are known to those skilled in the art to be useful in formulating pharmaceutical compositions. Preferably, for a successful CAR effective therapy, the composition comprising the CAR-effector cell is prepared and then delivered as a cell suspension, most preferably intravenously.
The pharmaceutical vehicle may be a liquid, and the pharmaceutical composition is in the form of a solution. Liquid vehicles are used in preparing solutions, suspensions, emulsions, syrups, elixirs and pressurized compositions. The active agent according to the invention may be dissolved or suspended in a pharmaceutically acceptable liquid vehicle such as water, an organic solvent, a mixture of both or pharmaceutically acceptable oils or fats. The liquid vehicle can contain other suitable pharmaceutical additives such as solubilisers, emulsifiers, buffers, preservatives, sweeteners, flavouring agents, suspending agents, thickening agents, colours, viscosity regulators, stabilizers or osmo-regulators. Suitable examples of liquid vehicles for oral and parenteral administration include water (partially containing additives as above, e.g. cellulose derivatives, preferably sodium carboxymethyl cellulose solution), alcohols (including monohydric alcohols and polyhydric alcohols, e.g. glycols) and their derivatives, and oils (e.g. fractionated coconut oil and arachis oil). For parenteral administration, the vehicle can also be an oily ester such as ethyl oleate and isopropyl myristate. Sterile liquid vehicles are useful in sterile liquid form compositions for parenteral administration. The liquid vehicle for pressurized compositions can be a halogenated hydrocarbon or other pharmaceutically acceptable propellant. Liquid pharmaceutical compositions, which are sterile solutions or suspensions, can be utilized by, for example, intramuscular, intrathecal, epidural, intraperitoneal, intravenous and particularly subcutaneous injection. The agent may be prepared as a sterile solid composition that may be dissolved or suspended at the time of administration using sterile water, saline, or other appropriate sterile injectable medium.
It will be appreciated that the invention extends to any nucleic acid or peptide or variant, derivative or analogue thereof, which comprises substantially the amino acid or nucleic acid sequences of any of the sequences referred to herein, including variants or fragments thereof. The terms “substantially the amino acid/nucleotide/peptide sequence”, “variant” and “fragment”, can be a sequence that has at least 40% sequence identity with the amino acid/ nucleotide/ peptide sequences of any one of the sequences referred to herein, for example 40% identity with the sequences identified herein, and so on. Amino acid/ polynucleotide/ polypeptide sequences with a sequence identity which is greater than 65%, more preferably greater than 70%, even more preferably greater than 75%, and still more preferably greater than 80% sequence identity to any of the sequences referred to are also envisaged. Preferably, the amino acid/polynucleotide/polypeptide sequence has at least 85% identity with any of the sequences referred to, more preferably at least 90% identity, even more preferably at least 92% identity, even more preferably at least 95% identity, even more preferably at least 97% identity, even more preferably at least 98% identity and, most preferably at least 99% identity with any of the sequences referred to herein. The skilled technician will appreciate how to calculate the percentage identity between two amino acid/polynucleotide/polypeptide sequences. In order to calculate the percentage identity between two amino acid/polynucleotide/polypeptide sequences, an alignment of the two sequences must first be prepared, followed by calculation of the sequence identity value. The percentage identity for two sequences may take different values depending on:- (i) the method used to align the sequences, for example, ClustalW, BLAST, FASTA, Smith-Waterman (implemented in different programs), or structural alignment from 3D comparison; and (ii) the parameters used by the alignment method, for example, local vs global alignment, the pair-score matrix used (e.g. BLOSUM62, PAM250, Gonnet etc.), and gap-penalty, e.g. functional form and constants. Having made the alignment, there are many different ways of calculating percentage identity between the two sequences. For example, one may divide the number of identities by: (i) the length of shortest sequence; (ii) the length of alignment; (iii) the mean length of sequence; (iv) the number of non-gap positions; or (v) the number of equivalenced positions excluding overhangs. Furthermore, it will be appreciated that percentage identity is also strongly length dependent. Therefore, the shorter a pair of sequences is, the higher the sequence identity one may expect to occur by chance.
Hence, it will be appreciated that the accurate alignment of protein or DNA sequences is a complex process. The popular multiple alignment program ClustalW (Thompson et al., 1994, Nucleic Acids Research, 22, 4673-4680; Thompson etal., 1997, Nucleic Acids Research, 24, 4876-4882) is a preferred way for generating multiple alignments of proteins or DNA in accordance with the invention. Suitable parameters for ClustalW maybe as follows: For DNA alignments: Gap Open Penalty = 15.0, Gap Extension Penalty = 6.66, and Matrix = Identity. For protein alignments: Gap Open Penalty = 10.0, Gap Extension Penalty = 0.2, and Matrix = Gonnet. For DNA and Protein alignments: ENDGAP = -1, and GAPDIST = 4. Those skilled in the art will be aware that it may be necessary to vary these and other parameters for optimal sequence alignment. Preferably, calculation of percentage identities between two amino acid/polynucleotide/polypeptide sequences may then be calculated from such an alignment as (N/T)*ioo, where N is the number of positions at which the sequences share an identical residue, and T is the total number of positions compared including gaps and either including or excluding overhangs. Preferably, overhangs are included in the calculation. Hence, a most preferred method for calculating percentage identity between two sequences comprises (i) preparing a sequence alignment using the ClustalW program using a suitable set of parameters, for example, as set out above; and (ii) inserting the values of N and T into the following formula:- Sequence Identity = (N/T)*ioo.
Alternative methods for identifying similar sequences will be known to those skilled in the art. For example, a substantially similar nucleotide sequence will be encoded by a sequence which hybridizes to DNA sequences or their complements under stringent conditions. By stringent conditions, the inventors mean the nucleotide hybridises to filter-bound DNA or RNA in 3x sodium chloride/ sodium citrate (SSC) at approximately
45°C followed by at least one wash in o.2x SSC/0.1% SDS at approximately 2O-65°C. Alternatively, a substantially similar polypeptide may differ by at least i, but less than 5, 10, 20, 50 or too amino acids from the sequences shown herein.
Due to the degeneracy of the genetic code, it is clear that any nucleic acid sequence described herein could be varied or changed without substantially affecting the sequence of the protein encoded thereby, to provide a functional variant thereof.
Suitable nucleotide variants are those having a sequence altered by the substitution of different codons that encode the same amino acid within the sequence, thus producing a silent (synonymous) change. Other suitable variants are those having homologous nucleotide sequences but comprising all, or portions of, sequence, which are altered by the substitution of different codons that encode an amino acid with a side chain of similar biophysical properties to the amino acid it substitutes, to produce a conservative change. For example, small non-polar, hydrophobic amino acids include glycine, alanine, leucine, isoleucine, valine, proline, and methionine. Large non-polar, hydrophobic amino acids include phenylalanine, tryptophan and tyrosine. The polar neutral amino acids include serine, threonine, cysteine, asparagine and glutamine. The positively charged (basic) amino acids include lysine, arginine and histidine. The negatively charged (acidic) amino acids include aspartic acid and glutamic acid. It will therefore be appreciated which amino acids may be replaced with an amino acid having similar biophysical properties, and the skilled technician will know the nucleotide sequences encoding these amino acids.
All of the features described herein (including any accompanying claims, abstracts and drawings), and/or all of the steps of any method or process so disclosed, may be combined with any of the above aspects in any combination, except combinations where at least some features and/or steps are mutually exclusive.
For a better understanding of the invention, and to show how embodiments of the same may be carried into effect, reference will now be made, by way of example, to the accompanying Figures, in which:-
Figure 1 shows a schematic map of one embodiment of a coding sequence of an expression vector for an anti-TCRVβ CAR lentiviral CAR of the invention. The sequence includes a human CD8α signal peptide, an antigen binding domain comprising a VL, flexible linker and VH, a CD8α hinge domain that includes a transmembrane domain and cytoplasmic domain, and an intracellular signalling domain comprising a CD28 costimulatory domain and CDЗζ stimulatory domain.
Figure 2a shows the membrane topology of a mature CAR of the invention. The CD8α signal peptide, VL, linker, and VH domains form the extracellular ectodomain, and the
CD8α hinge domain comprises an ectodomain part, a plasma membrane (P.M.) and a cytoplasmic fragment. The CD28 co-stimulatory domain and CDЗζ stimulatory domain form the endodomain inside the cell; Figure 2b represents one embodiment of a CAR of the invention referred to as MPB2D5 CAR GS3 CD8283Z (TCRVB 2 CAR).
Figure 3 provides structural details of the design of the coding sequence of each of various embodiments of exemplary anti-TCRVβ CAR of the invention. From top to bottom, the Figure shows CARs specific to TCRVβ1 CAR (i.e. anti-TCRVβi CAR), TCRVβ2 CAR (i.e. anti-TCRVβ2 CAR), TCRVβ9 CAR (i.e. anti-TCRVβ9 CAR), and TCRVβ11 CAR (i.e. anti-TCRVβ 11 CAR). For each embodiment, a construct with 2 x G4S linker and a construct with a 3 x G4S linker, respectively, are illustrated. The position of each of the components of the construct (5’ to 3’) follows the order disclosed in the schematic map of Figure 1. Figure 4 shows plasmid maps of the anti-TCRVβi CAR (called BL37.2 CAR) construct shown in Figure 3. The top map is for a first embodiment of an anti-TCRVβi CAR comprising a 2 x G4S linker and the lower map is for a second embodiment of an anti- TCRVβ1 CAR comprising a 3 x G4S linker. Figure 5 shows plasmid maps of the anti-TCRVβ2 CAR (called MPB2D5 CAR) shown in Figure 3. The top map is for a first embodiment of an anti-TCRVβ2 CAR comprising a 2 x G4S linker and the lower map is for a second embodiment of an anti-TCRVβ2 CAR comprising a 3 x G4S linker. Figure 6 shows the plasmid maps of the anti-TCRVβ9 CAR (called FIN9 CAR) shown in Figure 3. The top map is for a first embodiment of an anti-TCRVβ9 CAR comprising a 2 x G4S linker and the lower map is for a second embodiment of an anti-TCRVβ9 CAR comprising a 3 x G4S linker. Figure 7 shows the plasmid maps of an anti-TCRVβ11 CAR (called C21 CAR) shown in Figure 3. The top map is for a first embodiment of an anti-TCRVβ11 CAR comprising a 2 x G4S linker and the lower map is for a second embodiment of an anti-TCRVβ11 CAR comprising a 3 x G4S linker.
Figure 8 shows the specificity, cytokine production and cytotoxic activity of anti- TCRVβ CAR-T cells of the invention. Peripheral blood mononuclear cells (PBMC) from a normal donor were cultured alone or transduced with lentivirus which encoded the anti-VPi, Vβ2 and VP9 CAR constructs. Five days post transduction, transduction efficiency was evaluated by protein L staining (see Figures 8A and B), and the frequency of CD3+ cells expressing each of the 24 TCRVβ subunits was quantified (see Figure 8C). Values shown are the mean percentage of cells expressing each subunit normalised to the frequency of cells expressing that subunit in the non-transduced PBMC control from two (n=2) individuals. Killing of in-vitro expanded autologous primaiy T cell lines by anti-TCR CAR-T cells and anti-CDig CAR-T (see Figure 8D) and killing of non-transduced (UT) andTCR-GFP-transduced (VP+) JRT3-T3.5 cells by anti-VP CAR-T cells (see Figure 8E). Target cells were stained with CFSE and cocultured with effectors at a range of effector to target (E:T) ratios in duplicate. After 24I1, the cells were harvested and stained with yaad. The frequency of dead targets in each culture condition was assayed by flow cytometry. Results are representative of two or more independent experiments. CDioya mobilisation, IFN-y and TNF-a production by CD3+ anti-Vβ2 and anti-CDig CAR-T when cultured alone or in the presence of untransduced JRT3-T3.5 cells (JRT), JRT3-T3.5 cells transduced with Vβ2+ TCR-GFP (TCR GFP), or primaiy cells expressing Vβ2 (1YT) (see Figure 8F). Results are from a single experiment and are representative of two independent experiments. Figure 9 shows the cytokine production and cytotoxic activity of anti-TCRVβ CAR- iNKT cells of the invention. Killing of in-vitro expanded autologous primaiy T cell lines by anti-TCR CAR-iNKT cells and anti-CDig CAR-iNKT (see Figure 9A). Killing of untransduced (UT) and TCR-GFP-transduced (TCR-GFP) JRT-3 T 3.5 cells by anti-VP CAR-iNKT cells (see Figure 9B). Target cells were stained with CFSE co-cultured with effectors at a range of effector to target (E:T) ratios in duplicate. After 24b cells were harvested and stained with yaad. The frequency of dead targets in each culture condition was assayed by flow cytometry. Results are representative of two or more independent experiments. CDioya mobilisation, IFN-y and TNF-a production by CD3+ anti-Vβ2 and anti-CDig CAR-T when cultured alone or in the presence of untransduced JRT3-T3.5 cells (JRT), JRT3-T3.5 cells transduced with Vβ2+ TCR-GFP (VP +), or primaiy cells expressing Vβ2 (1YT) (see Figure 9C). Results are from a single experiment and are representative of 2 independent experiments. Enhancement of killing of a-gal loaded untransduced and TCRVβi or -Vβ2-GFP-transduced JRT3-T3.5 cells by anti-VPi (see Figure 9D) or Vβ2 CAR-iNKT but not anti VP1 or Vβ2 CAR-T cells (see Figure 9E). Where indicated, target cells were incubated with 2oong/ml a-gal before co-culture with effectors. Results shown are representative of two repeat experiments. In vivo protocol used is represented in Figure 9F. 5X to6 TCRVβ+ JRT cells were suspended in matrigel and injected subcutaneously. On day 18, 1 x to6 effector cells were injected intravenously into the tail vein. The challenged groups consisted of untreated (n=5), Vβ2 CAR-iNKT (n=7) or CD19 CAR-iNKT (n=5). Tumour volume for each group was measured periodically using calipers (see Figure 9G) .
Tumours were excised and weighed at the end of the experiment (see Figure 9H).
Figure 10 shows the killing of ex-vivo Adult T cell Leukaemia/Lymphoma (ATL) cells by anti-VP CAR-iNKT cells of the invention. Patient ATL01 had a malignant clone which expressed TCRVβi, and ATL02 had a malignant clone which expressed TCRVβ2 (see Figure 10A). Killing ex vivo of CD4+CCR4+CD26- ATL cells expressing TCRVβi (see Figure 10B) and Vβ2 (see Figure 10C) by anti-VP CAR-iNKT. Cryopreserved PBMC from two ATL patients and normal donor (ND) were stained with cell-trace violet and co-incubated with anti-VPi -Vβ2 or-CDig CAR-iNKT at the indicated effector:target (PBMC) ratios in triplicate. After 24b co-culture, cells were stained with a viability stain, anti-CD4, CCR4, CD26, TCRVβi or 2 and TCRaP, fixed, and the frequency of dead CD4+CCR4+CD26- T cells and CCR4-CD26+/- cells (‘rest’ of CD4+ T cells) was determined by flow cytometry. *There were an insufficient number of cells to determine viability on CD4+ expressing other TCRVβ subunits in patient 2.
Figure 11 shows the effect of CAR-iNKT cells on the frequency of antiviral CTL and HTLV-1 expressing CD4+ T cells. Frequency of M158-66 and Taxii-19 HLA-A*020i pentamer + CD3+ T cells after co-culture with CAR-iNKT (see Figures nA and 11B). CDq-depleted PBMC from three HLA-A*020i+ HTLV-1 carriers were stained with CellTraceViolet and were cultured alone or with an 1:1 ratio of anti-VPi -Vβ2 or -CD19
CAR-iNKT. After i6-i8h co-culture, cells were stained with a viability stain, and antiCDs, -CD8 antibodies and MI5866 or Taxu-i9 pentamers. Cells were analysed by flow cytometry and the frequency of live Pentamer+CellTraceViolet+CD3+ cells was determined. The frequency of HTLV-1 Tax expressing CD4+ cells ( see Figures 11C and 11D) after co-culture with CAR-iNKT is shown in Figures 11C and 11D. CellTraceViolet stained, positively selected CD4+ cells from the same donors were cultured alone or in the presence of Vβ2- or CD19-CAR iNKT. After i6-i8h, cells were stained with a viability stain, anti-CD3,-CD4, -CD8 and -TCRVβ2. Cells were subsequently fixed, and stained intracellularly with anti-Tax antibody. Cells were analysed by flow cytometiy and the frequency of liveTCRVβ2+CD3+ cells and live Tax+CDq+ cells was determined.
Figure 12 shows the raw data from Figure 8c: i.e. the absolute frequency of CD3+ T cells expressing each TCRVβ subunit expressed as a percentage of total CD3+ T cells Figure 13 shows target cell lines for the CAR T cells of the invention. Primary T cells expressing VP subunits of interest were enriched using anti-TCRVβ-subunit antibodies and magnetic beads (see Figure 13A). JRT3-T3.5 cells were transduced with lentiviral expression vectors encoding TCRP chains and GFP (see Figure 13B). Cells were sorted to enrich cells which expressed CD3 on the cell surface. One week post sorting, cells were stained with antibodies specific for CD3 and the relevant TCRVβ subunit and analysed by flow cytometiy.
Figure 14 shows the role played by iNKT iTCR cells of the invention in the killing of T cells. CD id expression by in-vitro expanded primary T cells and JRT3-T3.5 cells (JRT) (see Figure 14A). Cells were stained with a viability stain, anti-CD3 and anti-CDid and were analysed by flow cytometry. CD3 and CD id expression by live cells is shown. Mouse weight over the course of the in vivo experiment described in Figures 9F-9H. (see Figure 14B). Figure 15 shows the effect of CAR-iNKT cells of the invention on HTLV-1 expressing CD4+ T cell. The frequency of HTLV-1 Tax expressing CD4+ cells after co-culture with CAR-iNKT (see Figures 15A and 15B). Figure 15C shows the frequency of TCRVβ1 and TCRVβ2+ CD3+ T cells after co-culture. CellTraceViolet stained, positively selected CD4+ cells from the same donors were cultured alone or in the presence of vpi- or CD19-CAR iNKT. After i6-i8h, the cells were stained with a viability stain, anti-CD3,- CD4, -CD8 and -TCRVβ1. The cells were subsequently fixed, and stained intracellularly with anti-Tax antibody. The cells were then analysed by flow cytometry and the frequency of live TCRVβ1+ or TCRVβ2+CD3+ cells and liveTax+CD4+ cells was determined. Figure 16 provides a comparison of the effect of linker size on CAR-T efficacy. Killing of in-vitro expanded autologous primary T cell lines by anti-TCR CAR-T cells and anti- CD19 CAR-T. Target cells were stained with CFSE co-cultured with effectors at a range of effector to target (E:T) ratios in duplicate. After 24h cells were harvested and stained with 7aad. The frequency of dead targets in each culture condition was assayed by flow cytometry.
Examples
As discussed below, the inventors have generated exemplary anti-TCRVβ CAR constructs (referred herein as clone BL37.2 for TCR Vβ1, MPB2D5 for TCR Vβ2, FIN9 for TCR Vβ9 and C21 for TCR vβ11 ) (see Example 1) and tested their activities against primaiy T cells and cancer T-cell lines specifically expressing a selected TCRVβ (see Example 2). Subsequently, the inventors have generated effector T cells expressing the selected anti-TCRVβ CAR constructs, in particular, iNKT cells expressing the selected anti-TCRVβ CAR constructs, and have analysed their suitability for immunotherapy of T-cell malignancies (see Example 3). Then, the inventors have successfully demonstrated that the anti-TCRVβ CAR-iNKT cells are highly active against ATL (see Example 4) and do not impair CTL immunity against viral antigen, nor do they promote replication activity of HTLV-1, thereby exhibiting an important safety feature required for the treatment of ATL and TCL.
Materials and methods
Ethics Statement Patients with ATL attended the National Centre for Human Retrovirology (Imperial
College Healthcare NHS Trust, St Mary's Hospital, London), where written informed consent was obtained. Research involving samples from patients with ATL was conducted under the governance of the Communicable Diseases Research Group Tissue Bank, approved by the UK National Research Ethics Service (09/H0606/ 106, 15/SC/0089, 20/SC/0226).
Cell lines and chemicals
HEK 293T were passaged twice a week by trypsinisation and maintained at 30-70% confluency in complete Dulbecco’s modified eagle medium (DMEM) with 10% (v/v) Foetal bovine serum (FBS), too units/ml penicillin, too μg/mL streptomycin and 2mM
L-glutamine. JRT3-T3.5 were obtained from the ATCC and maintained at 1x105 - 1x106 cells/ml in complete RPMI medium with 10% (v/v) FBS, too units/ml penicillin, too pg/mL streptomycin and 2mM L-glutamine or iNKT medium (RPMI with 10% FBS, 15 mM Hepes, 1 mM Sodium Pyruvate, lx MEM nonessential amino acids, 4 mM L- Glutamine, 0.05 mM beta-mercaptoethanol, too units/ml penicillin and too ug/mL streptomycin). CiR-CDid cells (a gift from Vincenzo Cerundolo, Oxford University) were maintained at txto5- txto6 cells /ml in complete RPMI.
Generation of CAR constructs
Four monoclonal antibodies were identified for proof of principle studies targeting each ofTCR Vβ1 (clone BL37.2), Vβ2 (MPB2D5), Vβ9 (FIN9) and Vβ11 (C21) purchased unconjugated from Beckman Coulter. The amino acid sequence of the variable region of the heavy and light chains of BL37.2, MPB2D5 and FIN9 were determined by mass spectrometry (Rapid Novor, Canada). For clone C21, total RNA was extracted from hybridoma cells, reverse transcribed, and heavy and light chain fragments were amplified using isotype-specific primers. Amplified fragments were cloned into a standard cloning vector, transformed into E. coli, and five colonies from each region of interest were sequenced by Sanger sequencing (GenScript). Codon optimised gene fragments were synthesised by Genewiz and cloned into a lentiviral expression vector to generate the construct shown in Figures 1 and 12.
Production oflentiviruses
HEK293T cells were seeded at a density of 4 x to6/ 10 cm plate in 10 ml complete DMEM. After 24b, the cells were transfected with lentiviral expression vectors and second-generation packaging plasmids using GeneJuice (from Merck). Supernatants were collected 48 h post-transfection and clarified by centrifugation at 500g for 5 minutes, and then passed through a 0.45 LIM filter. Lentiviral particles were concentrated by ultracentrifugation at 23,000 rpm for 2h at 4°C, resuspended in 200- 300 pl serum-free RPMI and stored at -8o° C until use. The viral titre was determined by titration using HEK-293T cells.
Isolation of peripheral blood mononuclear cells
Peripheral blood mononuclear cells (PBMCs) were purified from apheresis cones or EDTA anticoagulated blood by density gradient centrifugation. Briefly, cells were harvested from the cones and diluted in PBS up to too ml. 25 ml diluted cells were layered over 15 ml histopaque (Sigma) and centrifuged at 800g for 20 minutes. The buffy coat was harvested, washed with PBS (400g, 5 min at RT) and ciyopreserved in FBS with 10% dimethyl sulfoxide (DMSO) until use.
Lentiviral transduction ofT and iNKT cells PBMCs were thawed rapidly, washed twice in RPMI with 10% FBS and resuspended in a small volume of media. iNKT were positively selected using magnetic bead separation according to the manufacturer's instructions (Miltenyi Biotech), passing the cells over two consecutive LS columns. The purity of the positive fraction was evaluated by flow cytometric staining using a fixable viability stain (Live/Dead Near-Infrared, Life Sciences) and anti-TCRVa24-Jai8 BV42i(clone 6B11), -TCRVB11 APC,-CD3 BV510, - CD4 BV605, -CD8 FITC. For iNKT cultures, the positively selected fraction was placed in culture with a 1:1 ratio of irradiated (35 Gy) autologous feeder cells prepared from the negative fraction. For T cell cultures, the iNKT-depleted flow through fraction was placed in culture alone. T and iNKT cells were cultured in iNKT media and stimulated with 50 ng/ml anti-CD3 and 50 ng/ml anti-CD28 (Miltenyi-Biotech) and 150 lU/ml IL- 15. After 48b culture, the required volume of each lentivirus was placed in retronectin- coated plates to give a multiplicity of infection (MOI) of 2.5-5 infectious units per cell. Cells were harvested, counted and added to the transduction plate, then centrifuged at 1000g for 40 min at 32 °C. On day 7 of iNKT cultures, CD id-expressing feeder cells were loaded with 200 ng/ ml a-Galactosylceramide (aGalCer, BioVision) for 2-4 h, irradiated and added to the culture at a ratio of 1:1. Cells were fed twice weekly with fresh media containing 150 lU/ml IL-15.
Quantification of lentiviral transduction efficiency Transduction efficiency was evaluated from 5 days post-transduction. Cells were washed twice in cold PBS, incubated with 1 ug/ml streptavidin protein L (Pierce) for 45 min at 4 °C. Cells were washed twice with PBS, stained with Live/dead near-infrared for 5 min at RT, washed with PBS 0.5% FBS and stained for 20 min at RT with streptavidin-PE/BV42i and anti-CD3, -CD4, -CD8, -TCRVβ11 and -TCRVa24-Jai8. Cells were acquired the same day using a BD Fortessa and analysed using Kaluza (Beckman Coulter).
Isolation and culture of primary T cell targets
Autologous primary T cell lines expressing TCRVβ subunits of interest were established by magnetic enrichment and expansion in vitro. PBMC were stained for 20 min with PE-conjugated anti-TCRVβ antibodies (Beckman Coulter) at RT, washed once in complete RPMI and incubated for a further 20 minutes at 4° C with anti-PE microbeads (Miltenyi Biotech). After one further wash, the cells were passed over two consecutive LS columns. The positive fraction was placed in culture with anti-CD3, anti-CD28 and 150 lU/ml IL-2.
Generation ofGFP-TCR - expressing JRT3-T3.5 cells
TCR β-chain sequences which contained Vβ subunits of interest were identified in publicly available databases. The Table below summarises TCR gene (TRBV) and protein (TCRVβ) nomenclature, and specifies the proteins for which monoclonal antibodies are commercially available. The codon optimised nucleotide sequence corresponding to the full-length beta chain was synthesised (using Genewiz) and cloned into a third-generation lentiviral expression vector (LeG0-iG2).
Table 2: TCR gene (TRBV) and protein (TCRVβ) nomenclature, including proteins for which monoclonal antibodies are commercially available.
7aad aitotoxicity assay
One day before the assessment of cytotoxicity, effector cells were counted and fed with fresh media. Target cells were washed twice with PBS, incubated in 0.5 LIM CFSE/Cell trace violet for 10 min at 37°C, and washed twice in iNKT media and placed back in culture with or without aGalCer as required. On the day of the assay, cells were centrifuged, resuspended in iNKT media with 15 lU/ml IL-15. Cells were mixed to achieve a range of effector:target (E:T) ratios, placed in duplicate in U bottomed 96 well plates, centrifuged for 1 min at 100g. Cells were cultured for 4-2411, centrifuged for 3 min at 800g and resuspended in PBS with aad (5 pg/ ml). After 20 min incubation, each well was washed with 150 pl PBS, centrifuged for 3 min at 800g and resuspended in too pl PBS. In each well, the frequency of dead (7AAD+) target cells was enumerated by flow cytometry. Fresh PBMC cytotoxicity assay
One day before the assessment of cytotoxicity, effector cells were counted and fed with fresh media. On the day of the assay, cryopreserved PBMC were thawed were washed (400g for 5 min) once with iNKT media, once with PBS, incubated in o.spM CFSE/Cell trace violet for 10 min at 37°C, and washed twice in iNKT media. PBMC were placed in a U bottomed 96 well plate with 15 lU/ml IL-15 with and without CAR-iNKT cells at a range of effector Parget ratios in triplicate. The plate was centrifuged for 1 min at 100g and cultured for 24b. Wells were washed with isopl PBS (800g 3 min), stained with Live/dead near-infrared for 5 min at RT, washed with FACS buffer (PBS 7% (v/v) NGS) and stained with anti- TCRVβ-PE, -TCRctp- FITC, -CD4-BV605, -CCR4-APC and - CD26-PeCy7 for 20 min at RT in FACS buffer. Cells were washed with 150 pl FACS buffer, fixed for 20 min with 150 pl fixation buffer (Biolegend) and washed once more with FACS buffer before storing at 4°C until acquisition.
Intracellular cytokine staining and degranulation assay Twenty four hours (24 h) before evaluating intracellular cytokine production/degranulation, effector cells were fed, and target cells were stained with CFSE. On the day of the experiment, target and effector cells were harvested, counted and mixed to give a 1:1 E:T ratio in iNKT media containing 20 pg/ml DNase, 15 lU/ml IL-15, 10.6 pM brefeldin, 2pM monensin (lx protein transport inhibitor, eBioscience) and 2.5 pl anti-CDiO7a-BV42i (clone H4A3)/2OO pl culture well. Cells were cultured for 6 h, centrifuged at 800g for 3 minutes to remove the culture supernatant and resuspended in live/dead NIR viability stain. After 5 minutes incubation at RT, 150 pl PBS 0.5% FBS was added to each well, and the plate was washed again. Cells were resuspended in 150 pl Fixation/permeabilisation buffer (eBiosciences F0XP3 buffer set, Life Technologies) incubated for 30 min at RT and washed once in Permeabilisation buffer. Cells were stained with anti-CD3-BV5io (clone UCHT-1) -CD4-BV605 (RPA- T4) -CD8-AF700 (RPA-T8) -IFN-Y-BV711 (4S.B3), -TNF-a-PeCy7 (Mabll), Granzyme B-PE (QA16A02) and Perforin-APC (B-D48) diluted in permeabilisation buffer. After 30 min incubation at RT, cells were washed once in 150 pl permeabilisation buffer and resuspended in PBS 0.5% FBS until acquisition.
Pentamer staining
HTLV-1-infected CD4+ cells express viral antigens on short term culture ex vivo, and thus could present the Taxii-19 peptide in the context of HLA-A*020i. Thus, to minimise the possibility of downregulation of the cognate TCR on CTL due to antigen encounter during the culture period, CD4+ T cells were depleted from PBMCs from HLA-A*020i+ HTLV-1 carriers using anti-CD4 PE and anti-PE microbeads as described above. CD4-depleted PBMCs were stained with cell-trace violet. The positive and negative fractions were cultured in iNKT media with 15 lU/ml IL-15 in the presence or absence of CAR-iNKT cells. After i6-i8h co-culture, cells were stained with live/dead near-infrared as described above and resuspended in 40 pl PBS with 10 pl
HTLV-1 Taxii-19 or Influenza A M158-66 Pentamer-APC for 10 minutes, after which anti-CD3-BV5io and -CD8-AF700 were added. After a further 20 min incubation at RT, cells were washed and fixed for 30 minutes by resuspending cells in 150 pl with Fixation buffer (Biolegend). After one wash with PBS, the frequency of live pentamer positive Cell trace violet + CD8+ T cells in each culture was assessed by flow cytometry.
Similarly, the CD4+ fraction was stained with live/dead, anti-CD4-BV6os, -CD3- BV510, washed with PBS 7%NGS and fixed for 30 minutes with 150 pl ebioscience F0XP3 fixation/permeabilisation buffer. Cells were then washed once in ebioscience permeabilisation buffer, and stained intracellularly with anti-Tax AF647 for 30 minutes. Cells were washed once more with 150 pl permeabilisation buffer, reusupended in PBS and stored at 4°C in the dark until acquisition. The number of Tax+CDq+Cell trace violet + cells was measured by flow cytometry.
In vivo experiment 5x to6 TCRVβ+ JRT cells were suspended in matrigel and injected subcutaneously to the flank of NSG mice. On day 18, 1 x to6 effector cells were injected intravenously into the tail vein. Groups consisted of untreated (n=5), Vβ2 CAR-iNKT (n=7) or CD19 CAR- iNKT (n=5). Tumour volume for each group was measured periodically using calipers. At the end of the experiment, tumours were excised and weighed. Off-target killing assay
PBMC from two normal donors were cultured alone or transduced with lentivirus which encoded Vβ1, Vβ2, Vβ9 and vβ11 -specific CAR constructs. Five days post transduction, transduction efficiency was evaluated by protein L staining, and the frequency of CD3+ cells expressing each of 24 TCRVβ subunits was quantified. Values were reported as mean percentage of cells expressing each subunit normalised to the frequency of cells expressing that subunit in the untransduced PBMC control from each individual. Results
Example 1: Generation of CAR constructs targeting TCRVβ1 , -2, -g and -11
The inventors generated four lentiviral CAR constructs to target TCRVβ1 (expressed on 3.5% of CD3+ T cells in healthy donors), TCRVβ2 (8.3%), TCRVβ9 (3.2%) and TCRVβ11 (1%). The anti-TCRVβi CAR is called the “BL37.2 CAR”, the anti-TCRVβ2 CAR is called the “MPB2D5 CAR”, the anti-TCRVβ9 CAR is called the “FIN9 CAR”, and the anti- TCRVβ11 CAR is called the “C21 CAR”.
Since hybridoma clones were not available for the first three mAbs, the inventors employed reverse engineering of CARs after determining the amino acid sequence of mAbs by mass spectrometry. The corresponding nucleotide sequence was codon optimised for expression in human cells, and used to construct second-generation CARs in which the ectodomain comprises CD8α leader peptide-VL-(GGGGS)2 linker- VH-CD8α hinge-CD8α transmembrane domain, while the endodomain is composed of a portion of the CD8α cytoplasmic domain and the signalling (i.e. stimulatory and costimulatory) domains of CD28-CDЗζ (see Figures 1 and 2).
Referring to Figure 1 and 2, there is shown a schematic map of one embodiment of a coding sequence of an expression vector for an anti-TCRVβ CAR lentiviral CAR of the invention. It will be appreciated that the vector (DNA) also corresponds to the CAR (protein). The CAR includes a human CD8α signal peptide, an antigen binding domain comprising a VL, flexible linker and VH, a CD 8α hinge domain comprising a transmembrane domain and cytoplasmic domain, and an intracellular signalling domain comprising a CD28 co-stimulatory domain and CDЗζ stimulatory domain. To generate an anti-TCRVβ11 CAR with codon optimised VH/VL sequence, the inventors amplified the expressed VH and VL chains using mRNA extracted from the hybridoma C21. The resulting CAR constructs are represented in Figure 3. For each of the four types of CAR (i.e. “BL37.2 CAR”, “MPB2D5 CAR”, “FIN9 CAR”, and “C21 CAR”), a construct with 2x G4S linker and a construct with a 3x G4S linker, respectively, was created and is illustrated. The position of each of the components of the construct (5’ to 3’) follows the order disclosed in the schematic map of Figure 1.
The signal peptide is identical to that of human CD8α. As the signal peptide matches the species of the effector cells (as described later), and as CD8α is highly expressed in
T cells, the inventors believe that their signal peptide will provide optimal expression of the CAR construct in the effector cells. The hinge region of the CAR contains amino acids 128-210 of human CD8α, which includes 55 amino acids from the extracellular domain, the full transmembrane helical domain and 7 amino acids of the cytoplasmic domain. The intracellular domain of the CAR includes the CDЗζ stimulatory domain and the CD28 co-stimulatory domain.
Plasmids encoding the lentiviral CAR constructs targeting TCRVβ1, -2, -9 and -11 are shown in Figures 4, 5, 6 and 7, respectively.
Example 2: Assessment of the specificity, cytokine production and cytotoxic activity of effector cell expressing the anti-TCRVf CAR construct
To begin testing the activity and specificity of CARs described in Example 1, the inventors transduced them into PBMC T cells of two healthy donors though lentivirus transduction. Five days post-transduction, CAR expression on T cells was over 50% (Figures 8A and 8B). Simultaneously, with reference to untransduced T cells, the inventors quantified the frequency of T cells expressing each of 24 TCRVβ chains in CAR-transduced PBMC. The inventors found that T cells expressing TCRVβ 1, Vβ2, Vβ9 and Vβ11 were almost entirely depleted from PBMCs transduced with the respective cognate CAR construct (median 98% reduction; range 90-100%) (Figure 8C, and
Figure 12). In contrast, the inventors observed a 4% increase in the median frequency of untargeted Vβ subunits in transduced cultures relative to the untransduced control indicating lack of ‘off-target; killing by TCRVβ family-specific CAR-T cells. In summary, anti-TCRVβ1,-2, -9 and -11 CAR are robustly expressed, active and selective against their cognate TCRVβ chain targets. Example 3: Anti-TCRVf chain CAR against primary and cancer T cell lines
To further investigate the anti-T cell activity and TCRVβ specificity of the four CAR constructs, the inventors first tested TCRVβ CAR-T cells against expanded autologous primaiy T cell lines highly purified to express TCRVβ chains of interest (Figure 13A).
The inventors found that all four anti-TCRVβ CAR-T cells selectively killed their cognate T cell line. However, the level of cytotoxicity differed and reflected the intensity of staining with the corresponding mAb, with both being highest for anti- TCRVβ1 and β2 lowest for TCRVβ9 (Figure 8D).
Next, the inventors engineered the JRT3-T3.5 T cell line to express the TCRVβ1 or 2 chains as targets. JRT3-T3.5 is a derivative of the Jurkat T cell line, itself derived from a patient with TCRVβ+ lymphoblastic T cell lymphoma. Due to deletion of the endogenous TCRVβ chain gene, JRT3-T3.5 cells lack expression of TCR as well as of CD3 and, therefore, as expected, introduction of an exogenous TCRVβ cDNA restored expression of both (Figure 13B). Accordingly, the inventors found that anti-TCRVβi and two CAR-T cells kill JRT3-T3.5 cells expressing their cognate target TCRVβ, but not the parental cell line (Figure 8E). In a complementaiy functional approach, the inventors found that upon intracellular staining, anti-TCRVβ2 CAR-T cells expressed IFNg, TNFa and CDio a (denoting cytotoxic degranulation) when co-cultured with TCRVβ2-expressing JRT3-T3.5 cells or primaiy T cell line, but not when cultured in the presence of the parental JRT3-T3.5 or alone, with more than 30% of CD4+ and CD8+ CAR-T cells being poly-functional, i.e. co-expressing at least two molecules (Figures 8E and 8F).
Together, these findings show that the anti-TCRVβ CARs of the invention, which have been developed by reverse engineering are highly specific and active in vitro. Example 4: Anti-TCRVB CAR-iNKT cells for ‘off-the -shelf immunotherapy ofT cell malignancies
The feasibility of deploying iNKT cells as effector cells for CAR immunotherapy of blood cancers has been demonstrated by earlier studies. Therefore, using their own established manufacturing protocol, the inventors have generated anti-TCRVβi, 2, 9 & 11 CAR-iNKT cells. Anti-TCRVβl, 2 & 9 CAR-iNKT cells efficiently killed JRT3-T3.5 as well as primary T cell lines expressing the corresponding TCR0 chain (Figure 9A and 9B) while CD4+ and CD4- CAR-iNKT cells specifically expressed or co-expressed IFNg, TNFa and CDio a upon stimulation with TCRVβ2-expressing JRT3-T3.5 and primary T cells (Figure 9C). Since JRT3-T3.5 cells express CDid (Figure 14A), the inventors tested whether reactivity of anti-TCRVβ CAR-iNKT cell could be enhanced in the presence of aGC, a glycolipid ligand of CDid that powerfully and selectively activates iNKT-cells l6 '7. The inventors found that while anti-TCRVβ 1&2 CAR-T cytotoxicity against parental and cognate TCRVβ-expressing JRT3-T3.5 cells was not enhanced in the presence of aGC, cytotoxicity of anti-TCRVβi&2 CAR-iNKT was enhanced against both targets and more so against the parental JRT3-T3.5 T cells (Figures 9D and 9E) thus indicating the functional relevance of iTCR in the anti-tumour activity of CAR-iNKT cells.
The inventors further tested the activity of TCRVβ CAR-iNKT cells in an in vivo model of T cell lymphoma in which TCRVβ2-expressing JRT3-T3.5 T cells were injected subcutaneously to the flank of NSG mice (Figure 9F). After tumour engraftment, mice were left untreated or treated with iv transfer of to6 TCRVβ2 or CD19 CAR-iNKT cells per mouse. Consistent with lack of expression of CD19 by JRT3-T3.5 T cells, CD19 CAR-iNKT failed to impact the growth of T cell lymphoma tumours; by contrast, TCRVβ2 CAR-iNKT cells significantly inhibited tumour volume and weight (Figures 9G and 9H).
Finally, CAR-iNKT cell-treated mice showed no evidence of excess weight loss or other clinical signs of aGVHD after 42 days of monitoring (Figure 14B), thus supporting the notion of using allogeneic iNKT cells as an ‘off-the-shelf platform for immunotherapy of cancer without risk of aGVHD.
Together these data demonstrate the therapeutic potential of the allogeneic TCRVβ CAR-iNKT cells of the invention for the treatment of T cell lymphomas.
Example 3: Anti-TCRVB CAR-iNKT cells are active against ATL Similar to the test conducted on JRT3-T3.5 T cell lymphoma cells, the inventors also tested the reactivity of allogeneic anti-TCRVβi&2 CAR-iNKT cells against PBMC from a normal donor and against PBMCs from two ATL patients enriched in lymphoma cells clonally expressing TCRVβ1 or TCRVβ2 (Figure 10A). In addition to their clonal TCR, as the inventors previously demonstrated, ATL malignant cells also co-express CD4 and CCR4 and are negative for CD26 (Figure 10A). Therefore, the inventors co-culture matched anti-TCR0 CAR-iNKT and anti-CDig CAR-iNKT with PBMC from each ATL and normal donor at a range of E:T ratios. Because co-culture with the anti-TCRVβ CAR-iNKT cells could block subsequent staining with the same anti-TCRVβ antibody clone, as the inventors previously reported, the inventors used the immunophenotype
CD4+CCR4med/hiCD26- to identify the lymphoma/leukaemia cells in PBMC from patients with ATL. The inventors found that in patients 1 and 2, CCR4+CD26- cells comprised 90% of CD4+ cells and nearly all expressed TCRVβ1 or TCRVβ2 respectively while in the normal donor CCR4+CD26- cells comprised 25% of CD4+ cells and TCRVβ1 and TCRVβ2 comprised less than 8%.
At an Effector:CD4+ T cell ratio of 1:1, anti-TCRVβi CAR-iNKT killed 75% of CD4+CCR4+CD26- cells in patient 1, and 10% of the ‘rest’ (i.e., CCR4-CD26-) of CD4+ cells. At the same ratio in patient 2, anti-TCRVβ2 CAR-iNKT killed 54% of CD4+CCR4+CD26- cells. The frequency of CD4+ cells expressing other TCRVβ subunits was too low to determine whether there was no off-target killing of normal CD4+ cells in this patient. Minimal killing of CD4+CCR4+CD26- cells and ‘other CD4+’ cells was observed when PBMC from patients or the normal donor were co-cultured with anti-CDig CAR-iNKT cells. Similarly, minimal killing was observed after PBMC from the normal donor were co-cultured with anti-TCRVβi and -TCRVβ2 CAR-iNKT cells, likely because of the low frequency of target cells present in the populations analysed (Figures 10B and 10C).
In conclusion, anti-TCRVβ CAR-iNKT cells are highly active and specific against primaiy ATL cancer cells.
Example 6: Effect of anti-V/3 CAR-iNKT on antiviral CTL immunity and HTLV-1 viral status
In order to further demonstrate selective targeting, the inventors studied the in-vitro impact of the anti-TCRVβ CAR-iNKT cells of the invention on antiviral CD8+ T cells in
HTVL-1 infected individuals. For this purpose, the inventors cultured PBMC from three HLA-A*020i+ HTLV-1 infected individuals (i.e., carrier) alone or in the presence of CAR-iNKT cells and evaluated the frequency of T cells which bound HLA-A*020i HTLV-1 Taxii-19 or Influenza A M158-66 peptide-MHC pentamers (Figures nA and 11B). When cultured alone, the frequency of Influenza A M158-66 pentamer+ CD3+ T cells ranged from O.14-.23% of CD3+ cells, and the frequency of HTLV-1 Taxii-19 pentamer+ CD3+ T cells ranged from 0.23-0.88%. When co-cultured with Vβ1-, Vβ2- or CD19- CAR-iNKT cells, there was no change in the frequency of pentamer+ cells (Figures 11A and 11B). Efficient depletion of T cells expressing TCRVβ1 and -β2 by their cognate CAR-iNKT ells was confirmed in parallel cultures from the same donors (Figure 15C).
Since killing of target cells by CAR-iNKT cells is associated with secretion of inflammatory cytokines, the inventors asked whether killing by CAR-iNKT would enhance spontaneous expression of HTLV-1 Tax, a process that might facilitate HTLV-1 infection of non-infected CD4+ T cells. For this purpose, positively selected CD4+ T cells from the same three HTLV-1 infected individuals were first cultured alone or in the presence of anti-V0i, -Vβ2 and -CD19 CAR-iNKT cells for 18 hrs followed by evaluation by intracellular staining of the frequency of Tax-expressing CD4+ T cells. Despite clear evidence of CAR-mediated depletion of T cells expressing the target TCRVβ molecules, there was no change in the frequency of Tax+CD4+ T cells in any of the CAR-iNKT co-cultures when compared with cells cultured alone (Figures 11C and 11D, Figures 15A and 15B).
Therefore, CAR-iNKT cells targeting TCRVβ chains do not impair CTL immunity against viral antigens, neither do their promote replication activity of HTLV-1, both important considerations for the safe treatment of TCL and ATL.
Example 7: Comparison of CAR constructs with (G4S)2 and(G4S).3 linkers
In order to compare the effect of the linker length on CAR efficiency in vitro, PBMC T cells were transduced with TCRVβ1 and Vβ2 CARs which contained either the (648)2 or (648)3 linkers and co-cultured with primary T cell target cells which expressed either TCRVβi or TCRVβ2.
Discussion The present invention demonstrates that anti-TCRVβ CAR immunotherapy can be developed as a sensitive, specific and highly effective strategy for the treatment of TCRVβ-expressing T cell malignancies. Given that the distribution of the TCRVβ repertoire in T cell malignacies is the same as in normal T cells, approximately 15% of TCL can be targeted by the CARs developed and tested here, thus paving the way for development of CARs against all TCRVβ families for which mAbs are available (currently for roughly 70% of TCR0 chain families) or can be developed. Of the three TCRVβ CARs exemplifed, best in vitro killing was observed against TCRVβ1 and 2- and less so for TCRVβ9-expressing targets. This pattern correlated with the intensity of staining of T cells by the corresponding mAbs, suggesting that the anti-TCRVβ9 mAb and thus the corresponding CAR are of lower affinity, highlighting the need to select high affinity mAb.
The robust anti-TCL activity of anti-TCRVβ CARs was shown using two effector platforms: T and iNKT cells thus offering the prospect of either autologous or allogeneic, off-the-shelf cellular immunotherapy respectively. The subcutaneous TCL model used to test the in vivo efficacy of TCRVβ CAR-iNKT cells is faithful to human
TCLs in which skin is often the primary or secondary site of disease. Although potential toxicity of allogeneic CAR-iNKT cells will be ultimately determined in clinical trials, early clinical experience with allogeneic CAR-iNKT cells against B cell lymphoma suggested absence of significant toxicity and aGVHD 30,31. The data also suggest that CAR-iNKT cells would offer additional therapeutic advantages over CAR-T cells in TCRVβ and CDid co-expressing cases of T cell malignancies such as T lymphoblastic lymphoma, as exemplified by the Jurkat T cell line. Incorporation of αGalCer in the therapeutic armamentarium could result in further enhancement of the CAR-iNKT cell- mediated anti-leukaemia/lymphoma effect.
Reassuringly, anti-TCRVβ CAR-iNKT immunotherapy does not appear to impact adaptive anti-viral immunity: there was no change in the frequency of flu-specific or HTLV-1 Tax-specific CD8+ T cells when PBMC from HTLV-1 carriers were cultured with and without anti-TCRVβ CAR-iNKT. The inventors also evaluated the effect of CAR-iNKT activity on proviral expression by by-standing HTLV-1 infected CD4+ T cells and observed no difference in HTLV-1 Tax expression in the presence or absence of CAR-iNKT cells. Thus, at least in short term in vitro assays, the inventors have excluded the possibility that bystander activation of HTLV-1 infected T cells favours HTLV-1 proviral reactivation.
Summary
In the present disclosure, the inventors have successfully demonstrated that the novel and innovative anti-TCRVβ CARs precision medicine approach for the treatment of TCL and ATL disclosed herein, can be applied to all TCRVβ chains. Because of their distinct advantages discussed above, the use of the allogeneic iNKT cell platform as the effector cell, which will allow the swift deployment of pre-manufactured allogeneic anti- TCRVβ CAR-iNKT cells in HTLV-1 endemic areas and in combination with advanced clinical trial designs such as Bayesian optimal interval design, is preferred. Such off- the-shelf, anti-TCRVβ CAR-iNKT cells can be tested not only in patients with ATL but also in HTLV-1-infected individuals in whom, as the inventors recently showed, clonal T cell expansions above a certain threshold portend high risk of progression to ATL, a highly incurable cancer 2 '".
References
1. Cancer Research UK. Cancer Statistics for the UK. Available at: https://www.cancerresearchuk.org/health-professional/cancer-statistics-for-the-uk. (Accessed: 18th October 2021)
2. Watanabe, T. Current status of HTLV-i infection. Int. J. Hematol. 94, 430-4 (2011).
3. Cook, L. B. M. & Taylor, G. P. HTLV-i: the silent impact revealed. Lancet Infect. Dis. (2019). doi:io.1016/81473-3099(19)30432-3
4. Tembhare, P. et al. Flow cytometric immunophenotypic assessment of T-cell clonality by vp repertoire analysis: detection of T-cell clonality at diagnosis and monitoring of minimal residual disease following therapy. Am. J. Clin. Pathol. 135, 890-900 (2011).
5. Tembhare, P. et al. Flow cytometric immunophenotypic assessment of T-cell clonality by v repertoire analysis in fine-needle aspirates and cerebrospinal fluid. Am. J. Clin. Pathol. 137, 220-6 (2012).
6. Rowan, A. G. et al. T Cell Receptor vp Staining Identifies the Malignant Clone in Adult T cell Leukemia and Reveals Killing of Leukemia Cells by Autologous CD8+ T cells. PLOS Pathog. 12, 61006030 (2016).
7. June, C. H. & Sadelain, M. Chimeric Antigen Receptor Therapy. N. Engl. J. Med. 379, 64-73 (2018).
8. Fleischer, L. C., Spencer, H. T. & Raikar, S. S. Targeting T cell malignancies using CAR-based immunotherapy: challenges and potential solutions. J. Hematol. Oncol. 12, 141 (2019).
9. Maciocia, P. M. et al. Targeting the T cell receptor P-chain constant region for immunotherapy of T cell malignancies. Nat. Med. 23, (2017).
10. Nikolich-Zugich, J., Slifka, M. K. & Messaoudi, I. The many important facets of T-cell repertoire diversity. Nat. Rev. Immunol. 4, 123-32 (2004).
11. Karadimitris, A. et al. Human CDid-glycolipid tetramers generated by in vitro oxidative refolding chromatography. Proc. Natl. Acad. Sci. U. S.A. 98, 3294-8 (2001).
12. Exley, M. A., Wilson, S. B. & Balk, S. P. Isolation and Functional Use of Human NKT Cells. Curr. Protoc. Immunol. 119, 14.11.1-14.11.20 (2017).
13. Godfrey, D. I. & Kronenberg, M. Going both ways: immune regulation via CD id-dependent NKT cells. J. Clin. Invest. 114, 1379-88 (2004).
14. Dellabona, P., Padovan, E., Casorati, G., Brockhaus, M. & Lanzavecchia, A. An invariant V alpha 24-J alpha Q/V beta 11 T cell receptor is expressed in all individuals by clonally expanded CD4-8- T cells. J. Exp. Med. 180, 1171-6 (1994).
15. Exley, M. et al. CD id structure and regulation on human thymocytes, peripheral blood T cells, B cells and monocytes. Immunology 100, 37-47 (2000).
16. Kawano, T. et al. CD id-restricted and TCR-mediated activation of valphai4 NKT cells by glycosylceramides. Science 278, 1626-9 (1997).
17. Brossay, L. et al. CDid-mediated recognition of an alpha-galactosylceramide by natural killer T cells is highly conserved through mammalian evolution. J. Exp. Med. 188, 1511-8 (1998).
18. Slauenwhite, D. & Johnston, B. Regulation of NKT Cell Localization in Homeostasis and Infection. Front. Immunol. 6, 255 (2015).
19. Johnston, B., Kim, C. H., Soler, D., Emoto, M. & Butcher, E. C. Differential chemokine responses and homing patterns of murine TCR alpha beta NKT cell subsets. J. Immunol. 171, 2960-9 (2003).
20. Kim, C. H., Johnston, B. & Butcher, E. C. Trafficking machinery of NKT cells: shared and differential chemokine receptor expression among V alpha 24(+)V beta n(+) NKT cell subsets with distinct cytokine-producing capacity. Blood 100, 11-6 (2002).
21. Salio, M., Silk, J. D., Yvonne Jones, E. & Cerundolo, V. Biology of CDi- and MRi-Restricted T Cells. Annu. Rev. Immunol. 32, 323-366 (2014).
22. Chaudhry, M. S. & Karadimitris, A. Role and regulation of CDid in normal and pathological B cells. J. Immunol. 193, 4761-8 (2014).
23. Gumperz, J. E., Miyake, S., Yamamura, T. & Brenner, M. B. Functionally distinct subsets of CDid- restricted natural killer T cells revealed by CDid tetramer staining. J. Exp. Med. 195, 625-36 (2002).
24. Lee, P. T. et al. Testing the NKT cell hypothesis of human IDDM pathogenesis. J. Clin. Invest. no, 793-800 (2002).
25. Chaidos, A. et al. Graft invariant natural killer T-cell dose predicts risk of acute graft-versus-host disease in allogeneic hematopoietic stem cell transplantation. Blood 119, 5030-6 (2012).
26. Rubio, M.-T. et al. Pre-transplant donor CD4- invariant NKT cell expansion capacity predicts the occurrence of acute graft-versus-host disease. Leukemia 31, 903-912 (2017).
27. Schneidawind, D. et al. Third-party CD4+ invariant natural killer T cells protect from murine GVHD lethality. Blood 125, 3491-3500 (2015).
28. Mavers, M., Maas-Bauer, K. & Negrin, R. S. Invariant Natural Killer T Cells As Suppressors of Graft-versus-Host Disease in Allogeneic Hematopoietic Stem Cell Transplantation. Front. Immunol. 8, 900 (2017).
29. Rotolo, A. et al. Enhanced Anti-lymphoma Activity of CARuj-i N KT Cells Underpinned by Dual CD19 and CDid Targeting. Cancer Cell 34, 596-610.611 (2018).
30. Exley, M. A. et al. Adoptive Transfer of Invariant NKT Cells as Immunotherapy for Advanced Melanoma: A Phase I Clinical Trial. Clin. Cancer Res. 23, 3510-3519 (2017). 31- Heczey, A. et al. Anti-GD2 CAR-NKT cells in patients with relapsed or refractory neuroblastoma: an interim analysis. Nat. Med. 26, 1686-1690 (2020).
32. Rowan, A. G. et al. Evolution of retrovirus-infected premalignant T-cell clones prior to adult T-cell leukemia/lymphoma diagnosis. Blood 135, 2023-2032 (2020).
33. Wolf, S. N. et al. Quantification of T cell clonality in human T cell leukaemia virus type-1 carriers can detect the development of adult T cell leukaemia early. Blood Cancer J. 11, 66 (2021).

Claims

Claims
1. A chimeric antigen receptor (CAR) construct specific for a T-cell receptor (TCR) beta-chain variable region ( VP) subunit of a T cell. 2. A CAR construct according to claim 1, which is specific for a pathogenic T cell.
3. A CAR construct according to claim 2, wherein the pathogenic T cell is either (i) a malignant, pathogenic T cell, or (ii) a non-malignant, pathogenic T cell. 4. A CAR construct according to any preceding claim, wherein the VP subunit is selected from a group of vp subunits shown in Table 1.
5. A CAR construct according to any preceding claim, wherein the CAR construct targets a TCR V subunit on a T-cell selected from a group consisting of the following Vp subunits: TCR-Vpi, TCR-Vp2, TCR-Vp9 and TCR-Vβ11.
6. A CAR construct according to any preceding claim, wherein the CAR construct is specific for TCR-VP1, optionally wherein the TCR-VP1 subunit comprises an amino acid sequence substantially as set out in SEQ ID No:i, or a variant or fragment thereof.
7. A CAR construct according to any preceding claim, wherein the CAR construct is specific for TCR-Vβ2, optionally wherein the TCR-Vβ2 subunit comprises an amino acid sequence substantially as set out in SEQ ID No: 2, or a variant or fragment thereof. 8. A CAR construct according to any preceding claim, wherein the CAR construct is specific for TCR-VP9, optionally wherein the TCR-VP9 subunit comprises an amino acid sequence substantially as set out in SEQ ID No:3, or a variant or fragment thereof.
9. A CAR construct according to any preceding claim, wherein the CAR construct is specific for TCR-Vβ11 , optionally wherein the TCR-Vβ11 subunit comprises an amino acid sequence substantially as set out in SEQ ID No:4, or a variant or fragment thereof.
10. A CAR construct according to any preceding claim, wherein the CAR construct comprises: a) a signalling peptide; b) an antigen-binding domain or moiety specific for the TCR-V0 subunit, preferably an anti-TCRVβ antibody or a functional fragment thereof specific for the TCR-VP subunit, and more preferably a single-chain variable fragment (scFv) domain of an anti-TCRVβ antibody; c) a hinge region, preferably comprising a transmembrane domain, and most preferably a transmembrane domain and cytoplasmic region; d) a primaiy stimulatory domain; and/ or e) a co-stimulatoiy domain, preferably two or more co-stimulatory domains. n. A CAR construct according to any preceding claim, wherein the CAR construct comprises a signalling peptide, which comprises human CD8α, or a fragment or variant thereof.
12. A CAR construct according claim 11, the CAR construct comprises a signalling peptide comprising an amino acid sequence substantially as set out in SEQ ID No:5, or a fragment or variant thereof and/ or wherein the signalling peptide is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 6, or a fragment or variant thereof. 13. A CAR construct according to any preceding claim, wherein the CAR construct comprises an antigen-binding domain or moiety specific for the TCR-VP subunit, wherein the antigen-binding domain or moiety comprises an anti-TCRVβ antibody or a functional fragment thereof that is specific for the TCR-VP subunit, optionally wherein the antigen-binding domain specific for the TCR-VP subunit comprises a single-chain variable fragment (scFv) domain of an anti-TCRVβ antibody.
14. A CAR construct according to claim 13, wherein the CAR construct comprises a scFv comprising a VL and/or a VH from an anti-TCRVβi antibody, wherein the CAR construct :- (i) comprises a VL chain having an amino acid sequence substantially as set out in SEQ ID No: , or a fragment or variant thereof and/or the VL chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 8, or a fragment or variant thereof; and/or
(ii) comprises a VH chain having an amino acid sequence substantially as set out in SEQ ID No:io, or a fragment or variant thereof and/ or the VH chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 11, or a fragment or variant thereof.
15. A CAR construct according to any preceding claim, wherein the CAR construct comprises a scFv comprising a VL and/or a VH from an anti-TCRVβ2 antibody, wherein the CAR construct
(i) comprises a VL chain having an amino acid sequence substantially as set out in SEQ ID No:ii, or a fragment or variant thereof and/ or the VL chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 12, or a fragment or variant thereof; and/or
(ii) comprises a VH chain having an amino acid sequence substantially as set out in SEQ ID NO:13, or a fragment or variant thereof and/or the VH chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 14, or a fragment or variant thereof.
16. A CAR construct according to any preceding claim, wherein the CAR construct comprises a scFv comprising a VL and/or a VH from an anti-TCRVβ9 antibody, wherein the CAR construct :-
(i) comprises a VL chain having an amino acid sequence substantially as set out in SEQ ID NO:15, or a fragment or variant thereof and/ or the VL chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 16, or a fragment or variant thereof; and/or
(ii) comprises a VH chain having an amino acid sequence substantially as set out in SEQ ID NO:17, or a fragment or variant thereof and/or the VH chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 18, or a fragment or variant thereof.
17. A CAR construct according to any preceding claim, wherein the CAR construct comprises a scFv comprising a VL and/or a VH from an anti-TCRVβ11 antibody, wherein the CAR construct :-
(i) comprises a VL chain having an amino acid sequence substantially as set out in SEQ ID No:i9, or a fragment or variant thereof and/or the VL chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 20, or a fragment or variant thereof; and/or (ii) comprises a VH chain having an amino acid sequence substantially as set out in SEQ ID No:2i, or a fragment or variant thereof and/or the VH chain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 22, or a fragment or variant thereof.
18. A CAR construct according to any one of claims 14-17, wherein the VH and VL sequences are separated by at least one linker sequence comprising an amino acid sequence substantially as set out in SEQ ID No:23, or a fragment or variant thereof.
19. A CAR construct according to any preceding claim, wherein the CAR construct comprises a hinge domain, which comprises: (i) an extracellular domain, or a portion thereof; (ii) a transmembrane (TM) domain, or a portion thereof; and (iii) a cytoplasmic domain, or a portion thereof.
20. A CAR construct according to claim 19, wherein:-
(i) the hinge domain comprises a CD8α sequence, or a portion thereof, and more preferably a human CD8α sequence, or a portion thereof;
(ii) the hinge domain comprises an amino acid sequence substantially as set out in SEQ ID No: 24, or a fragment or variant thereof;
(iii) the hinge comprises or consists of an amino acid sequence substantially as set out in SEQ ID No:25, or a fragment or variant thereof; and/or (iv) the hinge domain is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 26, or a fragment or variant thereof.
21. A CAR construct according to claim 20, wherein the hinge domain comprises or is derived from a human CD8α sequence, or a portion thereof comprising an amino acid sequence substantially as set out in SEQ ID No: 51, or a fragment or variant thereof.
22. A CAR construct according to claim 21, wherein:
(i) the hinge domain comprises an extracellular domain of human CD8α or a portion thereof defined by amino acids 138-182 of human CD8α, or a portion thereof, as represented by SEQ ID No: 51;
(ii) the hinge domain is at least one, two or three amino acids longer than amino acids 138-182 of human CD8α on the N-terminus, as represented by SEQ ID No: 51;
(iii) the hinge domain is at least four, five or six amino acids longer amino acids 138-182 of human CD8α on the N-terminus, as represented by SEQ ID No: 51; and/or (iv) the hinge domain is at least seven, eight, nine or ten amino acids longer amino acids 138-182 of human CD8α on the N-terminus, as represented by SEQ ID No: 51- 23. A CAR construct according to claim 22, wherein:
(i) the hinge domain comprises the extracellular domain of human CD8α or a portion thereof defined by amino acids 137-182, 136-182, or 135-182 of human CD8α, as represented by SEQ ID No: 51;
(ii) the hinge domain comprises the extracellular domain of human CD8α or a portion thereof defined by amino acids 134-182, 133-182, or 132-182 of human CD8α, as represented by SEQ ID No: 51; and/or
(iii) the hinge domain comprises the extracellular domain of human CD8α or a portion thereof defined by amino acids 131-182, 130-182, 129-182 or 128-182 of human CD8α, as represented by SEQ ID No: 51.
24. A CAR construct according to claim 21, wherein the hinge domain comprises a cytoplasmic domain of human CD8α or a portion thereof defined by amino acids 204- 206 of human CD8α, or a portion thereof, as represented by SEQ ID No: 51. 25. A CAR construct according to claim 24, wherein:
(i) the cytoplasmic domain is at least one amino acid longer than amino acids 204-206 of human CD8α on the C-terminus, as represented by SEQ ID No: 51;
(ii) the cytoplasmic domain is at least two amino acids longer than amino acids 204-206 of human CD8α on the C-terminus, as represented by SEQ ID No: 51; (iii) the cytoplasmic domain is at least three amino acids longer than amino acids 204-206 of human CD8α on the C-terminus, as represented by SEQ ID No: 51; and/or
(iv) the cytoplasmic domain is at least four amino acids longer than amino acids 204-206 of human CD8α on the C-terminus, as represented by SEQ ID No: 51.
26. A CAR construct according to claim 25, wherein:
(i) the cytoplasmic domain is defined by amino 204-207 of human CD8α of human CD8α, as represented by SEQ ID No: 51;
(ii) the cytoplasmic domain is defined by amino 204-208 of human CD8α of human CD8α, as represented by SEQ ID No: 51; (iii) the cytoplasmic domain is defined by amino 204-209 of human CD8α of human CD8α, as represented by SEQ ID No: 51; and/or
(iv) the cytoplasmic domain is defined by amino 204-210 of human CD8α of human CD8α, as represented by SEQ ID No: 51.
27. A CAR construct according to claim 19, wherein the CAR construct comprises a hinge domain, which comprises:
(i) a human CD8α extracellular domain, or a portion thereof having an amino acid sequence substantially as set out in SEQ ID No: 24, or a fragment or variant thereof;
(ii) a human CD8α transmembrane (TM) domain, or a portion thereof having an amino acid sequence substantially as set out in SEQ ID No: 49, or a fragment or variant thereof; and
(iii) a human CD8α cytoplasmic domain, or a portion thereof having an amino acid sequence substantially as set out in SEQ ID No: 50, or a fragment or variant thereof.
28. A CAR construct according to any preceding claim, wherein the CAR construct comprises an intracellular domain, which comprises a primaiy stimulatory CDЗζ chain and a co-stimulatoiy domain of CD28. 29. A CAR construct according to claim 28, wherein the CAR construct comprises a co-stimulatoiy domain of CD28 having an amino acid sequence substantially as set out in SEQ ID No:27, or a fragment or variant thereof and/ or wherein the co-stimulatoiy domain of CD28 is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 28, or a fragment or variant thereof.
30. A CAR construct according to either claim 28 or claim 29, wherein the CAR construct comprises one or two co-stimulatoiy domains, optionally selected from a CD28, 4-1BB signalling domain and OX4O signalling domain. 31. A CAR construct according to any one of claims 28-30, wherein the CAR construct comprises a stimulatory protein CDЗζ having an amino acid sequence substantially as set out in SEQ ID No: 29, or a fragment or variant thereof and/or wherein the stimulatory protein CDЗζ is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 30, or a fragment or variant thereof.
32. A CAR construct according to any preceding claim, wherein the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No:3i or 33, or a fragment or variant thereof; and/or is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 32 or 34, or a fragment or variant thereof.
33. A CAR construct according to any preceding claim, wherein the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No:35 or 37, or a fragment or variant thereof; and/or is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 36 or 38, or a fragment or variant thereof.
34. A CAR construct according to any preceding claim, wherein the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No:39 or 41, or a fragment or variant thereof; and/or is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 40 or 42, or a fragment or variant thereof.
35. A CAR construct according to any preceding claim, wherein the CAR construct comprises an amino acid sequence substantially as set out in SEQ ID No:43 or 45, or a fragment or variant thereof; and/or is encoded by a nucleotide sequence substantially as set out in SEQ ID No: 44 or 46, or a fragment or variant thereof.
36. A nucleic acid encoding the CAR construct according to any one of claims 1-35.
37. An expression vector or a plasmid encoding the CAR construct according to any one of claims 1-35, or comprising the nucleic acid according to claim 36.
38. An effector cell expressing the CAR construct according to any one of claims 1- 35, or comprising the nucleic acid according to claim 36 or the vector according to claim 37. 39. The effector cell according to claim 38, wherein the effector cell is (i) a normal or conventional ocpT-cell, or (ii) an innate lymphocyte, optionally an invariant natural killer T (iNKT) cell, yST cell or NK cell.
40. The effector cell according to either claim 38 or claim 39, wherein the effector cell is an iNKT cell.
41. A method of producing an effector cell expressing an anti-TCRVβ CAR, the method comprising transducing an effector cell with the nucleic acid according to claim 29 or the vector according to claim 37, such that the effector cell expresses an anti- TCRVβ CAR.
42. The method according to claim 41, wherein the effector cell is (i) a normal or conventional ocpT-cell, or (ii) an innate lymphocyte, preferably an invariant natural killer T (iNKT) cell, yST cell or NK cell. 43. The method according to either claim 41 or claim 42, wherein the method comprises an initial step of isolating the effector cell from peripheral blood cells (PBCs), and the effector cell is activated with one or both of CD3 and CD28 antibodies.
44. The method according to any one of claims 41-43, wherein the effector cell is activated with an interleukin, preferably wherein the interleukin is IL-15.
45. A pharmaceutical composition comprising a therapeutically effective amount of the CAR construct according to any one of claims 1-35, the nucleic acid according to claim 29, the vector according to claim 37, or the effector cell according to any one of claims 38-40, and a pharmaceutically acceptable excipient.
46. The pharmaceutical composition according to claim 45, wherein the pharmaceutical composition comprises a plurality of the effector cell, preferably a T cell, or iNKT cell, and wherein the composition comprises at least too, 1000, 10,000, 100,000, 1,000,000 or at least 10,000,000 effector cells.
47. The CAR construct according to any one of claims 1-35, the nucleic acid according to claim 36, the vector according to claim 37, or the effector cell according to any one of claims 38-40, for use in therapy or diagnosis.
48. The CAR construct according to any one of claims 1-35, the nucleic acid according to claim 36, the vector according to claim 37, or the effector cell according to any one of claims 38-40, for use in (i) immunotherapy; (ii) for treating, preventing or ameliorating cancer; (iii) for treating, preventing or ameliorating an autoimmune disease; or (iv) for treating, preventing or ameliorating any disease characterised by the presence of pathogenic T cells.
49. The CAR construct according to any one of claims 1-35, the nucleic acid according to claim 36, the vector according to claim 37, or the effector cell according to any one of claims 38-40, for use according to either claim 47 or claim 48, wherein the cancer is a T-cell malignancy, which is a solid tumour or a liquid tumour.
50. The CAR construct according to any one of claims 1-35, the nucleic acid according to claim 36, the vector according to claim 37, or the effector cell according to any one of claims 38-40, for use according to any one of claims 47-49, wherein the T- cell malignancy is selected from a group consisting of: a haematolynphoid neoplasm; a precursor T-cell neoplasm; T-lymphoblastic leukaemia / lymphoma; mature T-cell neoplasms; Peripheral T cell lymphoma (PRCL); mature T-cell leukaemias; Primary cutaneous T-cell lymphoid proliferations and lymphomas; Intestinal T-cell lymphoid proliferations and lymphomas; Hepatosplenic T-cell lymphoma; Anaplastic large cell lymphoma; Nodal T-follicular helper (TFH) cell lymphoma; Peripheral T-cell lymphoma, NOS; EBV-positive NK-cell and T-cell lymphomas; EBV-positive T-cell lymphoid proliferations; Subcutaneous Panniculitis-Like Lymphoma (SPTCL); Angioimmunoblastic T-cell lymphoma (AITL); and Cutaneous T-cell lymphoma (CTCL).
51. The CAR construct according to any one of claims 1-35, the nucleic acid according to claim 36, the vector according to claim 37, or the effector cell according to any one of claims 38-40, for use according to either claim 47 or 48, wherein the autoimmune disease is one caused by pathogenic autoreactive T cells, or selected from a group consisting of: systemic lupus erythematosus, rheumatoid arthritis, and myasthenia gravis. 51. A process for making the pharmaceutical composition according to either claim
45 or claim 46, the process comprising combining a therapeutically effective amount of the CAR construct according to any one of claims 1-35, the nucleic acid according to claim 36, the vector according to claim 37, or the effector cell according to any one of claims 38-40, and a pharmaceutically acceptable vehicle.
EP23764369.7A 2022-08-23 2023-08-22 Chimeric antigen receptor (car) to a tcr beta-chain variable region Pending EP4577233A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GR20220100703 2022-08-23
PCT/GB2023/052187 WO2024042318A1 (en) 2022-08-23 2023-08-22 Chimeric antigen receptor (car) to a tcr beta-chain variable region

Publications (1)

Publication Number Publication Date
EP4577233A1 true EP4577233A1 (en) 2025-07-02

Family

ID=87889233

Family Applications (1)

Application Number Title Priority Date Filing Date
EP23764369.7A Pending EP4577233A1 (en) 2022-08-23 2023-08-22 Chimeric antigen receptor (car) to a tcr beta-chain variable region

Country Status (6)

Country Link
EP (1) EP4577233A1 (en)
JP (1) JP2025527559A (en)
CN (1) CN119997968A (en)
AU (1) AU2023327927A1 (en)
CA (1) CA3264498A1 (en)
WO (1) WO2024042318A1 (en)

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB201803376D0 (en) * 2018-03-01 2018-04-18 Imperial Innovations Ltd Transduction and expansion of cells
EP3801568A4 (en) * 2018-05-31 2022-03-16 Washington University GENOME EDITED INVARIANT NATURAL KILLER T CELLS FOR THE TREATMENT OF HEMATOLOGICAL MALIGNITIES
WO2020156335A1 (en) * 2019-01-29 2020-08-06 上海交通大学 Chimeric antigen receptor and use thereof
US20230108300A1 (en) * 2020-01-29 2023-04-06 The Trustees Of The University Of Pennsylvania Compositions and methods of t cell receptor vb family member targeting for the treatment of t cell associated disease
CN115427440A (en) * 2020-02-25 2022-12-02 圭尔医疗有限公司 Chimeric receptors for engineered cells
AU2021331075A1 (en) * 2020-08-26 2023-04-06 Marengo Therapeutics, Inc. Multifunctional molecules that bind to calreticulin and uses thereof
GB202105684D0 (en) * 2021-04-21 2021-06-02 Imperial College Innovations Ltd Chimeric antigen receptor (CAR)-T cells

Also Published As

Publication number Publication date
JP2025527559A (en) 2025-08-22
CA3264498A1 (en) 2024-02-29
WO2024042318A1 (en) 2024-02-29
AU2023327927A1 (en) 2025-02-20
CN119997968A (en) 2025-05-13

Similar Documents

Publication Publication Date Title
CN108026151B (en) PD-1-CD28 fusion protein and its use in medicine
CA3119403C (en) Artificial hla-positive feeder cell lines for nk cells and uses thereof
JP2023071774A (en) Cancer treatment using multispecific chimeric t-cell receptor protein
JP2023527049A (en) Polypeptides Useful for Adoptive Cell Therapy
ES2749903T3 (en) Chimeric protein
JP2026054469A (en) Methods and compositions for the modification and delivery of lymphocytes
WO2017027392A1 (en) Treatment of cancer using chimeric cd3 receptor proteins
US12551558B2 (en) Compositions and methods for promoting hematopoietic cell cytotoxicity
HK1243107A1 (en) Chimeric protein
JP2024514355A (en) Chimeric antigen receptor (CAR)-T cells
EP4532727A2 (en) Compositions and methods comprising chimeric adaptor polypeptides
US20250108069A1 (en) Chimeric adaptor polypeptides
JP2025160456A (en) Targeting B-cell activating factor receptor (BAFF-R) using ligand-based chimeric antigen receptor (CAR)-T cells
EP4577233A1 (en) Chimeric antigen receptor (car) to a tcr beta-chain variable region
US12479903B2 (en) CD5 specific T cell receptor cell or gene therapy
JP2024534537A (en) Terminal deoxynucleotidyl transferase (TdT) binding protein
WO2025021915A1 (en) Cd277 targeting costimulatory receptor
KR20260054689A (en) CD277 target co-stimulatory receptor
WO2026030538A1 (en) Cd84+/mertk+ myeloid derived suppressor cells and methods of use for transplantation tolerance
CN119894923A (en) Chimeric antigen receptor comprising TMIGD2 costimulatory domains and related methods of use
HK40114137A (en) Modified cells and uses thereof
Arcangeli Optimization of Chimeric Antigen Receptor (CAR) design strategy for a specific anti-CD123 targeted therapy in pediatric Acute Myeloid Leukemia (AML)
Han Engineering Chimeric Antigen Receptor T Cells towards Enhanced Safety and Efficacy in Cancer Immunotherapy

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20250205

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)