EP4573110A1 - Interferon proproteins and uses thereof - Google Patents
Interferon proproteins and uses thereofInfo
- Publication number
- EP4573110A1 EP4573110A1 EP23772061.0A EP23772061A EP4573110A1 EP 4573110 A1 EP4573110 A1 EP 4573110A1 EP 23772061 A EP23772061 A EP 23772061A EP 4573110 A1 EP4573110 A1 EP 4573110A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- ifn
- proprotein
- domain
- targeting moiety
- linker
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/555—Interferons [IFN]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
- C07K14/7156—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interferons [IFN]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/522—CH1 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
Definitions
- Type I interferons are thought to directly suppress tumor cell proliferation.
- Type I IFNs have utility in treatment of several types of cancer, including hematological tumors (chronic myeloid leukemia, hairy cell leukemia, multiple myeloma, and non-Hodgkin’s lymphomas) and solid tumors (melanoma, renal carcinoma, and Kaposi’s sarcoma). See, e.g., Zitvogel et al., 2015, Nat Rev Immunol 15:405-414 and Antonelli et al., 2015, Cytokine Growth Factor Rev 26:121-131.
- Type I IFN treatment is its ability to intervene at multiple points in the generation of anti-tumor immune responses, including stimulation of the innate and adaptive cytotoxic lymphocyte populations, negative regulation of suppressive cell types, its impact on tumor cells by inhibiting proliferation, and by modulating apoptosis, differentiation, migration, and cell surface antigen expression (Parker et al., 2016, Nature Reviews Cancer 16:131-144).
- Type I IFNs One of the biggest barriers to the use of Type I IFNs in the clinic is the severe side effects associated with such treatments. The most frequently encountered side effects are flulike symptoms, hematological toxicity, elevated transaminases, nausea, fatigue, and psychiatric sequelae. These side effects hamper reaching and maintaining the doses needed for maximal therapeutic effect, and their occurrence can outweigh clinical benefit of Type I IFN treatment entirely (Lotrich, 2009, Dialogues Clin Neurosci 11 :417-425). Type I IFNs signal through IFNAR1/IFNAR2 complex that are expressed on most cells and tissues in the body.
- Type I IFNs to tumor-reactive immune cells (see, e.g., Diamond et al., 2011 , J Exp Med. 208(10): 1989-2003; Cauwels et al., 2018, Cancer Res. 78 (2): 463—474) or to the tumor microenvironment is imperative for continued clinical use of Type I IFN.
- Strategies are needed to modify Type I IFN in order to obtain new forms of the drug which preferentially exert their activity on tumor-reactive immune cells and/or at the tumor, and also to reduce side effects on normal IFNAR-expressing cells.
- the IFN proproteins comprise an IFN moiety that is sterically hindered from binding to its receptor, configured so the IFN moiety is activated by cleavage of a linker in the IFN proprotein by a protease, resulting in alleviation of the steric hindrance of the IFN moiety.
- the IFN proproteins may further comprise a targeting moiety that directs the IFN proprotein to a particular tissue or cell type.
- the IFN proproteins of the disclosure comprise two polypeptide chains, each comprising, from N- to C-terminus, a first linker, an interferon (IFN) moiety, a second linker, and an Fc domain.
- the first linker and the second linker are both protease- cleavable linkers (PCLs).
- PCLs protease- cleavable linkers
- only one of the first linker and the second linker is a PCL, with the other being a non-cleavable linker (NCL).
- the first linker is a PCL
- the second linker is an NCL.
- the first linker is an NCL
- the second linker is a PCL.
- the IFN proproteins may further comprise, e.g., N-terminal to one or both Fc domains, a targeting moiety (or a component thereof, e.g., one chain of a Fab).
- the targeting moiety comprises an antigen-binding domain (“ABD”) that can, for example, bind to a target molecule present on the tumor surface (e.g., a tumor associated antigen) or other component in the tumor microenvironment (e.g., extracellular matrix (“ECM”) or tumor lymphocytes).
- ABS antigen-binding domain
- IFN moieties that can be used in the IFN proproteins of the disclosure are described in Section 6.3.
- Protease-cleavable linkers that can be used in the IFN proproteins of the disclosure are described in Section 6.4.
- Non-cleavable linkers that can be used in the IFN proproteins of the disclosure are described in Section 6.5.
- Fc domains that can be incorporated into the IFN proproteins of the disclosure are described in Section 6.8.
- IFN proproteins of the disclosure are described in Section 6.2 and numbered embodiments 1 to 146.
- the disclosure further provides nucleic acids encoding the IFN proproteins of the disclosure.
- the nucleic acids encoding the IFN proproteins can be a single nucleic acid (e.g., a vector encoding all polypeptide chains of an IFN proprotein) or a plurality of nucleic acids (e.g., two or more vectors encoding the different polypeptide chains of an IFN proprotein).
- the disclosure further provides host cells and cell lines engineered to express the nucleic acids and IFN proproteins of the disclosure.
- the disclosure further provides methods of producing an IFN proprotein of the disclosure. Exemplary nucleic acids, host cells, and cell lines, and methods of producing an IFN proprotein are described in Section 6.9 and numbered embodiments 147 to 149.
- the disclosure further provides pharmaceutical compositions comprising the IFN proproteins of the disclosure.
- exemplary pharmaceutical compositions are described in Section 6.10 and numbered embodiment 150.
- FIGS. 1A-1C are cartoons representing configurations of three IFN proproteins of the disclosure with protease-cleavable linkers flanking the interferon moiety.
- FIG. 1A represents an IFN proprotein having the overall configuration antibody-PCL-IFN-PCL-Fc
- FIG. 1B represents a single hinge IFN proprotein having the configuration Fab-PCL-IFN-PCL-hinge-Fc
- FIG. 1C represents a double hinge IFN proprotein having the configuration Fab-hinge-PCL-IFN-PCL- hinge-Fc.
- the VH, VL and CL domains of the Fabs are optional for non-targeted IFN proproteins or could be replaced by other targeting moieties such as scFvs.
- FIGS. 2A-2F are cartoons representing configurations of six IFN proproteins of the disclosure with protease-cleavable linkers (PCLs) only on one side of the interferon moiety and non-cleavable linkers (NCLs) on the other side of the interferon moiety.
- FIG. 2A represents an IFN proprotein having the overall configuration antibody-NCL-IFN-PCL-Fc
- FIG. 2B represents a single hinge IFN proprotein having the configuration Fab-NCL-IFN-PCL-hinge-Fc
- FIG. 2C represents a double hinge IFN proprotein having the configuration Fab-hinge-NCL-IFN-PCL- hinge-Fc
- FIG. 2D represents an IFN proprotein having the overall configuration antibody-PCL- IFN-NCL-Fc
- FIG. 2E represents a single hinge IFN proprotein having the configuration Fab- PCL-IFN-NCL-hinge-Fc
- FIG. 2F represents a double hinge IFN proprotein having the configuration Fab-hinge-PCL-IFN-NCL-hinge-Fc.
- the VH, VL and CL domains of the Fabs are optional for non-targeted IFN proproteins or could be replaced by other targeting moieties such as scFvs.
- FIG. 3 is a table of exemplary targeted IFN proproteins according to FIG. 1 and their constituent polypeptide chains.
- TM refers to a targeting moiety
- HC refers to an antibody heavy chain
- LC refers to an antibody light chain
- IFN refers to an interferon (IFN) moiety
- AN and AC refers to N- and C-terminal truncations, respectively, in the IFN sequence of the IFN moiety (e.g., as described in Section 6.3)
- PCL refers to a protease-cleavable linker (e.g., as described in Section 6.4)
- Fc refers to an Fc domain (e.g., as described in Section 6.8)
- hinge refers to a hinge sequence of an antibody and LongHinge and ShortHinge refer to full length or truncated versions of an immunoglobulin hinge sequence (e.g., as described in Section 6.8.3).
- PCLs protease-cleavable linkers
- NCL non-cleavable linker
- FIGS. 4A-4C are the size exclusion ultra-performance liquid chromatography (SE-UPLC) profiles of exemplary IFN molecules that may be incorporated into the IFN proprotein constructs of the disclosure.
- FIG. 4A illustrates the SEC profile of an IFN molecule, Fc-IFNa1 , with an N- terminal Fc domain and C-terminal IFN moiety
- FIG. 4B illustrates the SEC profile of an IFN molecule, Fc-IFNa2b, with an N-terminal Fc and C-terminal IFN moiety
- FIG. 4C illustrates the SEC profile of an IFN molecule, IFNa2b-Fc, with an N-terminal IFN moiety and C-terminal Fc domain.
- FIGS. 5A-5C depict the in vitro activity of exemplary IFN molecules that were linked to an Fc molecule either on the N- or the C-terminus.
- the cartoon images in FIG. 5A represent the N- and C-terminus Fc-fusions of IFN.
- Fc-IFN is the overall representation of IFN molecules with an N-terminal Fc domain and a C-terminal IFN moiety
- IFN-Fc is the overall representation of IFN molecules with an N-terminal IFN moiety and a C-terminal Fc domain.
- FIG. 5B is a graph showing the in vitro activity of exemplary IFN molecules, Fc-IFNa2b and IFNa2b-Fc, in comparison to unlinked IFNa2b.
- FIG. 5C is a graph showing the activity of Fc-IFN molecules in comparison to different unlinked IFNs.
- FIGS. 6A-6D are the SE-UPLC profiles of exemplary mutant IFN molecules that may be incorporated into the IFN proprotein constructs of the disclosure.
- FIG. 6A illustrates the SE- UPLC profile of a mutant IFN molecule, Fc-IFNa2bR33A.
- FIG. 6B illustrates the SE-UPLC profile of a mutant IFN molecule, Fc-IFNa2bR149A.
- FIG. 6C illustrates the SE-UPLC profile of a mutant IFN molecule, Fc-IFNa2bR120A.
- FIG. 6D illustrates the SE-UPLC profile of a mutant IFN molecule, Fc-IFNa2bS152A.
- FIGS. 7A-7B depict the in vitro activity of exemplary mutant IFN molecules that may be incorporated into the IFN proprotein constructs of the disclosure.
- the cartoon images in FIG. 7A represent the overall structure of wildtype (WT) or mutant (Mut) Fc-IFN molecules.
- FIG. 7B is a graph showing the in vitro activity of Fc-IFNa2b molecules with mutations affecting either the IFNAR1 or IFNAR2 interface.
- FIGS. 8A-8C are the SE-UPLC profiles of exemplary IFN proprotein constructs.
- FIG. 8A illustrates the SE-UPLC profile of a single hinge full-length IFN proprotein, aPD1-singleHinge- FLIFN.
- Fig. 8B illustrates the SE-UPLC profile of a double hinge IFN proprotein, aPD1- doubleHingeLong-IFN.
- FIG. 8C illustrates the SEC profile of an IFN proprotein with two Fc regions.
- FIGS. 9A-9B show the in vitro enzymatic cleavage of single and double hinge IFN proproteins.
- FIG. 9A is a gel image that illustrates the cleavage of three single hinge proproteins, two double hinge IFN proproteins, and a positive control by uPA.
- FIG. 9B is a gel image that illustrates the cleavage of the same single and double IFN proproteins by MMP2 and MMP9.
- FIGS. 10A-10B depict the in vitro activity of exemplary IFN proproteins in comparison to IFNa2b and Fc-IFNa2b.
- FIG. 10A is a graph showing the in vitro activity of two single hinge IFN proproteins (full length and truncated) and one double hinge IFN proprotein.
- FIG. 10B is a graph that illustrates changes in activity of the same IFN proproteins in FIG. 10A by the addition of MMP buffer alone (dashed line) or MMP buffer and enzyme mixture (dotted line).
- ABD chain, targeting moiety chain Targeting moieties and antigen binding sites (ABDs) within them can exist as one (e.g., in the case of an scFv or scFab) polypeptide chain or form through the association of more than one polypeptide chains (e.g., in the case of a Fab or an Fv).
- ABSD chain and “targeting moiety chain” refer to all or a portion of an ABD or targeting moiety that exists on a single polypeptide chain.
- the use of the term “ABD chain” or “targeting moiety chain” is intended for convenience and descriptive purposes only and does not connote a particular configuration or method of production.
- an ABD or targeting moiety when describing an IFN proprotein encompasses an ABD chain or targeting moiety chain unless the context dictates otherwise.
- the Fc domain when describing an IFN proprotein in which an Fc domain is operably linked to a targeting moiety, the Fc domain may be covalently linked directly or indirectly (e.g., via a linker) through a peptide bond to, e.g., (1) a first ABD or targeting moiety chain of a Fab or Fv (with the other components of the Fab or Fv on a second, associated ABD or targeting moiety chain) or (2) an ABD or targeting moiety chain containing an scFv or scFab.
- activation refers to the protease-mediated enzymatic cleavage of a protease-cleavable linker that results in the release of an IFN moiety from a sterically-blocking constant domain.
- an “or” conjunction is intended to be used in its correct sense as a Boolean logical operator, encompassing both the selection of features in the alternative (A or B, where the selection of A is mutually exclusive from B) and the selection of features in conjunction (A or B, where both A and B are selected).
- the term “and/or” is used for the same purpose, which shall not be construed to imply that “or” is used with reference to mutually exclusive alternatives.
- Antibody refers to a polypeptide (or set of polypeptides) of the immunoglobulin family that is capable of binding an antigen non-covalently, reversibly and specifically.
- a naturally occurring “antibody” of the IgG type is a tetramer comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
- VH heavy chain variable region
- the heavy chain constant region is comprised of three domains, CH1 , CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
- the light chain constant region is comprised of one domain (abbreviated herein as CL).
- CL light chain constant region
- the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FRs arranged from amino-terminus to carboxy-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- the term “antibody” includes, but is not limited to, monoclonal antibodies, human antibodies, humanized antibodies, camelized antibodies, chimeric antibodies, bispecific or multispecific antibodies and anti-idiotypic (anti-id) antibodies.
- the antibodies can be of any isotype/class (e.g., IgG, IgE, IgM, IgD, IgA and IgY) or subclass (e.g., lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2).
- IgG isotype/class
- IgG2, lgG3, lgG4, lgA1 and lgA2 subclass
- Both the light and heavy chains are divided into regions of structural and functional homology.
- the terms “constant” and “variable” are used functionally.
- the variable domains of both the light (VL) and heavy (VH) chain portions determine antigen recognition and specificity.
- the constant domains of the light chain (CL) and the heavy chain (CH1 , CH2 or CH3) confer important biological properties such as secretion, transplacental mobility, Fc receptor binding, complement binding, and the like.
- CL light chain
- CH2 or CH3 heavy chain
- the numbering of the constant region domains increases as they become more distal from the antigen-binding domain or amino-terminus of the antibody.
- the N-terminus is a variable region and at the C- terminus is a constant region; the CH3 and CL domains represent the carboxy-terminus of the heavy and light chain, respectively, of natural antibodies.
- the reference to an antibody also refers to antibody fragments as well as engineered antibodies that include non-naturally occurring antigen-binding domains and/or antigen-binding domains having non-native configurations.
- Antigen-binding domain refers to a portion of an antibody or antibody fragment (e.g., a targeting moiety) that has the ability to bind to an antigen non-covalently, reversibly and specifically.
- an antibody fragment that can comprise an ABD include, but are not limited to, a single-chain Fv (scFv), a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the VH and CH1 domains; a Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et al., 1989, Nature 341 :544-546), which consists of a VH domain; and an isolated complementarity determining region (CDR).
- scFv single-chain Fv
- Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH1 domains
- F(ab)2 fragment a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at
- antibody fragment encompasses both proteolytic fragments of antibodies (e.g., Fab and F(ab) 2 fragments) and engineered proteins comprising one or more portions of an antibody (e.g., an scFv).
- Antibody fragments can also be incorporated into single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, 2005, Nature Biotechnology 23: 1126-1136).
- association in the context of an IFN proprotein refers to a functional relationship between two or more polypeptide chains.
- association means that two or more polypeptides are associated with one another, e.g., non- covalently through molecular interactions or covalently through one or more disulfide bridges or chemical cross-linkages, so as to produce a functional IFN proprotein.
- associations that might be present in an IFN proprotein of the disclosure include (but are not limited to) associations between Fc domains to form an Fc region (homodimeric or heterodimeric as described in Section 6.8), associations between VH and VL regions in a Fab or Fv, and associations between CH1 and CL in a Fab.
- cancer refers to a disease characterized by the uncontrolled (and often rapid) growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers are described herein and include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, adrenal gland cancer, autonomic ganglial cancer, biliary tract cancer, bone cancer, endometrial cancer, eye cancer, fallopian tube cancer, genital tract cancers, large intestinal cancer, cancer of the meninges, esophageal cancer, peritoneal cancer, pituitary cancer, penile cancer, placental cancer, pleura cancer, salivary gland cancer, small intestinal cancer, stomach cancer, testicular cancer, thymus cancer, thyroid cancer, upper aerodigestive cancers, urinary tract cancer, vaginal cancer, vulva cancer, lymphoma,
- Complementarity determining region refers to the sequences of amino acids within antibody variable regions which confer antigen specificity and binding affinity. For example, in general, there are three CDRs in each heavy chain variable region (e.g., CDR-H1 , CDR-H2, and CDR- H3) and three CDRs in each light chain variable region (CDR-L1 , CDR-L2, and CDR-L3).
- CDR-H1 , CDR-H2, and CDR- H3 three CDRs in each light chain variable region
- CDR-L1 , CDR-L2, and CDR-L3 three CDRs in each light chain variable region.
- the precise amino acid sequence boundaries of a given CDR can be determined using any of a number of well-known schemes, including those described by Kabat et al., 1991 , “Sequences of Proteins of Immunological Interest,” 5th Ed.
- CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (CDR-H1), 50-65 (CDR- H2), and 95-102 (CDR-H3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (CDR-L1), 50-56 (CDR-L2), and 89-97 (CDR-L3).
- CDR amino acids in the VH are numbered 26-32 (CDR-H1), 52-56 (CDR-H2), and 95-102 (CDR-H3); and the amino acid residues in VL are numbered 26-32 (CDR-L1), 50-52 (CDR-L2), and 91-96 (CDR-L3).
- the CDRs consist of amino acid residues 26-35 (CDR-H1), 50-65 (CDR-H2), and 95-102 (CDR-H3) in human VH and amino acid residues 24-34 (CDR-L1), 50-56 (CDR-L2), and 89-97 (CDR-L3) in human VL.
- Constant domain The terms “constant domain” refers to a CH 1 , CH2, CH3 or CL domain of an immunoglobulin.
- CH1 domain refers to the heavy chain constant region linking the variable domain to the hinge in a heavy chain constant domain.
- CH1 domain refers to the region of an immunoglobulin molecule spanning amino acids 118 to 215 (EU numbering).
- the term “CH1 domain” encompasses wildtype CH1 domains as well as variants thereof (e.g., non-naturally-occurring CH1 domains or modified CH1 domains).
- CH1 domain includes wildtype lgG1 , lgG2, lgG3 and lgG4 CH1 domains and variants thereof having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions and/or additions.
- Exemplary CH1 domains include CH1 domains with mutations that modify a biological activity of an antibody, such as ADCC, CDC or half-life.
- CH2 domain refers to the heavy chain constant region linking the hinge to the CH3 domain in a heavy chain constant domain.
- CH2 domain refers to the region of an immunoglobulin molecule spanning amino acids 238 to 340 (EU numbering).
- the term “CH2 domain” encompasses wildtype CH2 domains as well as variants thereof (e.g., non-naturally-occurring CH2 domains or modified CH2 domains).
- CH2 domain includes wildtype lgG1 , lgG2, lgG3 and lgG4 CH2 domains and variants thereof having 1 , 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions and/or additions.
- Exemplary CH2 domains include CH2 domains with mutations that modify a biological activity of an antibody, such as ADCC, CDC, purification, dimerization and half-life.
- CH3 domain refers to the heavy chain constant region that is C-terminal to the CH2 domain in a heavy chain constant domain.
- CH3 domain refers to the region of an immunoglobulin molecule spanning amino acids 341 to 447 (EU numbering).
- the term “CH3 domain” encompasses wildtype CH3 domains as well as variants thereof (e.g., non-naturally-occurring CH3 domains or modified CH3 domains).
- CH3 domain includes wildtype lgG1 , lgG2, lgG3 and lgG4 CH3 domains and variants thereof having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions and/or additions.
- Exemplary CH3 domains include CH3 domains with mutations that modify a biological activity of an antibody, such as ADCC, CDC, purification, dimerization and half-life.
- CL domain refers to the constant region of an immunoglobulin light chain.
- CL domain encompasses wildtype CL domains (e.g., kappa or lambda light chain constant regions) as well as variants thereof (e.g., non-naturally-occurring CL domains or modified CL domains).
- CL domain includes wildtype kappa and lambda constant domains and variants thereof having 1 , 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions and/or additions.
- Effector function refers to an activity of an antibody molecule that is mediated by binding through a domain of the antibody other than the antigenbinding domain, usually mediated by binding of effector molecules.
- Effector function includes complement-mediated effector function, which is mediated by, for example, binding of the C1 component of the complement to the antibody. Activation of complement is important in the opsonization and lysis of cell pathogens. The activation of complement also stimulates the inflammatory response and may also be involved in autoimmune hypersensitivity. Effector function also includes Fc receptor (FcR)-mediated effector function, which may be triggered upon binding of the constant domain of an antibody to an Fc receptor (FcR).
- FcR Fc receptor
- Binding of antibody to Fc receptors on cell surfaces triggers a number of important and diverse biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells (called antibody- dependent cell- mediated cytotoxicity, or ADCC), release of inflammatory mediators, placental transfer and control of immunoglobulin production.
- An effector function of an antibody may be altered by altering, e.g., enhancing or reducing, the affinity of the antibody for an effector molecule such as an Fc receptor or a complement component. Binding affinity will generally be varied by modifying the effector molecule binding site, and in this case, it is appropriate to locate the site of interest and modify at least part of the site in a suitable way.
- an alteration in the binding site on the antibody for the effector molecule need not alter significantly the overall binding affinity but may alter the geometry of the interaction rendering the effector mechanism ineffective as in non-productive binding. It is further envisaged that an effector function may also be altered by modifying a site not directly involved in effector molecule binding, but otherwise involved in performance of the effector function.
- Epitope An epitope, or antigenic determinant, is a portion of an antigen recognized by an antibody or other antigen-binding moiety as described herein.
- An epitope can be linear or conformational.
- Fab refers to a pair of polypeptide chains, the first comprising a variable heavy (VH) domain of an antibody operably linked (typically N-terminal to) to a first constant domain (referred to herein as C1), and the second comprising variable light (VL) domain of an antibody N-terminal operably linked (typically N-terminal) to a second constant domain (referred to herein as C2) capable of pairing with the first constant domain.
- VH variable heavy
- VL variable light domain of an antibody N-terminal operably linked (typically N-terminal) to a second constant domain (referred to herein as C2) capable of pairing with the first constant domain.
- the VH is N-terminal to the first constant domain (CH1) of the heavy chain
- VL is N-terminal to the constant domain of the light chain (CL).
- the Fabs of the disclosure can be arranged according to the native orientation or include domain substitutions or swaps that facilitate correct VH and VL pairings. For example, it is possible to replace the CH1 and CL domain pair in a Fab with a CH3-domain pair to facilitate correct modified Fab-chain pairing in heterodimeric molecules. It is also possible to reverse CH1 and CL, so that the CH1 is attached to VL and CL is attached to the VH, a configuration generally known as Crossmab.
- the term “Fab” encompasses single chain Fabs.
- Fc Domain and Fc Region refers to a portion of the heavy chain that pairs with the corresponding portion of another heavy chain.
- an Fc domain comprises a CH2 domain followed by a CH3 domain, with or without a hinge region N- terminal to the CH2 domain.
- the term “Fc region” refers to the region of formed by association of two heavy chain Fc domains. The two Fc domains within the Fc region may be the same or different from one another. In a native antibody the Fc domains are typically identical, but one or both Fc domains might be modified to allow for heterodimerization, e.g., via a knob-in-hole interaction.
- Fv refers to the minimum antibody fragment derivable from an immunoglobulin that contains a complete target recognition and binding site. This region consists of a dimer of one heavy and one light chain variable domain in a tight, noncovalent association (VH-VL dimer). It is in this configuration that the three CDRs of each variable domain interact to define a target binding site on the surface of the VH-VL dimer. Often, the six CDRs confer target binding specificity to the antibody. However, in some instances even a single variable domain (or half of an Fv comprising only three CDRs specific for a target) can have the ability to recognize and bind target.
- VH-VL dimer When present on a single polypeptide chain (e.g., a scFv), the VH and be N- terminal or C-terminal to the VL.
- a single polypeptide chain e.g., a scFv
- Half Antibody refers to a molecule that comprises at least one Fc domain and can associate with another molecule comprising an Fc through, e.g., a disulfide bridge or molecular interactions.
- a half antibody can be composed of one polypeptide chain or more than one polypeptide chains (e.g., the two polypeptide chains of a Fab).
- An example of a half antibody is a molecule comprising a heavy and light chain of an antibody (e.g., an IgG antibody).
- a half antibody is a molecule comprising a first polypeptide comprising a VL domain and a CL domain, and a second polypeptide comprising a VH domain, a CH1 domain, a hinge domain, a CH2 domain, and a CH3 domain, wherein said VL and VH domains form an ABD.
- a half antibody is a polypeptide comprising an scFv domain, a CH2 domain and a CH3 domain.
- the IFN proproteins of the disclosure typically comprise two half antibodies, each comprising an IFN moiety flanked by protease-cleavable linkers, with an Fc domain C-terminal to the C-terminal protease-cleavable linker and a constant domain N-terminal to the N-terminal protease cleavable linker.
- One or both half antibodies in the IFN proproteins may further comprise a targeting moiety.
- half antibody is intended for descriptive purposes only and does not connote a particular configuration or method of production. Descriptions of a half antibody as a “first” half antibody, a “second” half antibody, a “left” half antibody, a “right” half antibody or the like are merely for convenience and descriptive purposes.
- Host cell or recombinant host cell refer to a cell that has been genetically-engineered, e.g., through introduction of a heterologous nucleic acid. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term “host cell” as used herein.
- a host cell may carry the heterologous nucleic acid transiently, e.g., on an extrachromosomal heterologous expression vector, or stably, e.g., through integration of the heterologous nucleic acid into the host cell genome.
- a host cell is preferably a cell line of mammalian origin or mammalian-like characteristics, such as monkey kidney cells (COS, e.g., COS-1 , COS-7), HEK293 ), baby hamster kidney (BHK, e.g., BHK21), Chinese hamster ovary (CHO), NSO, PerC6, BSC-1 , human hepatocellular carcinoma cells (e.g., Hep G2), SP2/0, HeLa, Madin- Darby bovine kidney (MDBK), myeloma and lymphoma cells, or derivatives and/or engineered variants thereof.
- the engineered variants include, e.g., derivatives that grow at higher density than the original cell lines and/or glycan profile modified derivatives and and/or site- specific integration site derivatives.
- Interferon refers to a full-length interferon or to a modified interferon, for example a truncated and/or mutant interferon.
- the modified interferon is attenuated as compared to the corresponding wildtype interferon(e.g., retains less than 50%, less than 40%, less than 30%, less than 20%, or less than 10%, less than 1%, less than 0.1% or less than 0.05% activity in an in vitro luciferase reporter assay as described in Section 8.2.4).
- the modified interferon is attenuated by a range bounded by any two of the foregoing values, e.g., 0.05%-50%, 0.1%-20%, 0.1 %-10%, 0.05%-5%, 1 %-20%, and so on and so forth.
- the modified interferon substantially retains the biological activity of the corresponding wildtype interferon (e.g., retains at least 50% activity in an in vitro luciferase reporter assay as described in Section 8.2.4).
- Interferons include Type I interferons (e.g., interferon-a and interferon-P) as well as Type II interferons (e.g., interferon-y).
- Linker refers to a protease-cleavable linker or a non- cleavable linker.
- Non-cleavable linker refers to a peptide whose amino acid sequence lacks a substrate sequence for a protease, e.g., a protease as described in Section 6.4.1 , that recognizes and cleaves a specific sequence motif, e.g., a substrate as described in Section 6.4.2.
- operably linked refers to a functional relationship between two or more peptide or polypeptide domains or nucleic acid (e.g., DNA) segments.
- nucleic acid e.g., DNA
- operably linked means that two or more amino acid segments are linked so as to produce a functional polypeptide.
- separate components e.g., an Fc domain and an IFN moiety
- operably linked means that the two nucleic acids are joined such that the amino acid sequences encoded by the two nucleic acids remain in-frame.
- transcriptional regulation the term refers to the functional relationship of a transcriptional regulatory sequence to a transcribed sequence.
- a promoter or enhancer sequence is operably linked to a coding sequence if it stimulates or modulates the transcription of the coding sequence in an appropriate host cell or other expression system.
- Polypeptide, Peptide and Protein The terms “polypeptide”, “peptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues.
- Proprotein A “proprotein” is a protein precursor that is inactive, and which can be activated by proteolysis by a protease. Thus, proproteins are “protease activatable”.
- proteases refers to any enzyme that catalyzes hydrolysis of a peptide bond.
- the proteases useful in the present disclosure e g., the proteases described in Section 6.4.1, recognize and cleaves a specific sequence motif, e.g., a substrate as described in Section 6.4.2.
- the proteases are expressed at higher levels in cancer tissues as compared to normal tissues.
- Protease-cleavable linker As used herein, the term “protease-cleavable linker” or “PCL” refers to a peptide whose amino acid sequence contains one or more (e.g., two, three or more) substrate sequences for one or more proteases. Exemplary protease-cleavable linkers are described in Section 6.4 and exemplary protease-cleavable linker sequences are disclosed in Section 6.4.4.
- Recognize refers to an antibody or antibody fragment (e.g., a targeting moiety) that finds and interacts (e.g., binds) with its epitope.
- Single Chain Fab or scFab refers an ABD comprising a VH domain, a CH1 domain, a VL domain, a CL domain and a linker.
- the foregoing domains and linker are arranged in one of the following orders in a N-terminal to C-terminal orientation: (a) VH-CH1-linker-VL-CL, (b) VL-CL-linker-VH- CH1 , (c) VH-CL-linker-VL-CH1 or (d) VL-CH1-linker-VH-CL.
- Linkers are suitably noncleavable linkers of at least 30 amino acids, preferably between 32 and 50 amino acids.
- Single chain Fab fragments are typically stabilized via the natural disulfide bond between the CL domain and the CH1 domain.
- these single chain Fab molecules might be further stabilized by generation of interchain disulfide bonds via insertion of cysteine residues (e.g., at position 44 in the VH domain and position 100 in the VL domain according to Kabat numbering).
- Single Chain Fv or scFv refers to ABDs comprising the VH and VL domains of an antibody, wherein these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen-binding.
- spacer refers to a peptide, the amino acid sequence of which is not a substrate for a protease, incorporated into a linker containing a substrate.
- a spacer can be used to separate the substrate from other domains in a molecule, for example an ABD.
- residues in the spacer minimize aminopeptidase and/or exopeptidase action to prevent cleavage of N-terminal amino acids.
- the term “specifically (or selectively) binds” to an antigen or an epitope refers to a binding reaction that is determinative of the presence of a cognate antigen or an epitope in a heterogeneous population of proteins and other molecules.
- the binding reaction can be but need not be mediated by an antibody or antibody fragment.
- the term “specifically binds” does not exclude cross-species reactivity.
- an antigen-binding domain e.g., an antigen-binding fragment of an antibody
- that “specifically binds” to an antigen from one species may also “specifically bind” to that antigen in one or more other species.
- an antigen-binding domain of the disclosure that specifically binds to a human antigen has cross-species reactivity with one or more non-human mammalian species, e.g., a primate species (including but not limited to one or more of Macaca fascicularis, Macaca mulatta, and Macaca nemestrina) or a rodent species, e.g., Mus musculus.
- a primate species including but not limited to one or more of Macaca fascicularis, Macaca mulatta, and Macaca nemestrina
- rodent species e.g., Mus musculus.
- Subject includes human and non-human animals.
- Non-human animals include all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, and reptiles.
- the subject is human.
- Substrate refers to peptide sequence on which a protease will act and within which the protease will cleave a peptide bond.
- Target Molecule refers to any biological molecule (e.g., protein, carbohydrate, lipid or combination thereof) expressed on a cell surface or in the extracellular matrix that can be specifically bound by a targeting moiety in an IFN proprotein of the disclosure.
- biological molecule e.g., protein, carbohydrate, lipid or combination thereof
- Targeting Moiety refers to any molecule or binding portion (e.g., an immunoglobulin or an antigen binding fragment) thereof that can bind to a cell surface or extracellular matrix molecule at a site to which an IFN proprotein of the disclosure is to be localized, for example on tumor cells or on lymphocytes in the tumor microenvironment.
- the targeting moiety binds to a TAA.
- the targeting moiety binds to a TCA.
- the targeting moiety can also have a functional activity in addition to localizing an IFN proprotein to a particular site.
- a targeting moiety that binds to a checkpoint inhibitor such as PD1 can also exhibit anti-tumor activity or enhance the anti-tumor activity by IFN, for example by inhibiting PD1 signaling.
- T-Cell Antigen refers to a molecule (typically a protein, carbohydrate, lipid or some combination thereof) that is expressed on the surface of a T-lymphocyte and is useful for the preferential targeting of a pharmacological agent to a particular site.
- the site is cancer tissue and/or the T-cell antigen is a tumor reactive lymphocyte antigen, a cell surface molecule of tumor or viral lymphocytes, or a checkpoint inhibitor expressed on a T-lymphocyte.
- Tumor The term “tumor” is used interchangeably with the term “cancer” herein, e.g., both terms encompass solid and liquid, e.g., diffuse or circulating, tumors. As used herein, the term “cancer” or “tumor” includes premalignant, as well as malignant cancers and tumors.
- Tumor-Associated Antigen refers to a molecule (typically a protein, carbohydrate, lipid or some combination thereof) that is expressed on the surface of a cancer cell, either entirely or as a fragment (e.g., MHC/peptide), and which is useful for the preferential targeting of a pharmacological agent to the cancer cell.
- TAA tumor-associated antigen
- a TAA is a marker expressed by both normal cells and cancer cells, e.g., a lineage marker.
- the terms “treat”, “treatment” and “treating” refer to the inhibition of the progression of a proliferative disorder, either physically by, e.g., stabilization of a discernible symptom, physiologically by, e.g., stabilization of a physical parameter, or both. In other embodiments the terms “treat”, “treatment” and “treating” refer to the reduction or stabilization of tumor size or cancerous cell count.
- VH refers to the variable region of an immunoglobulin heavy chain of an antibody, including the heavy chain of an Fv, scFv, dsFv or Fab.
- the IFN proproteins are composed of two half antibodies, comprising a pair of Fc domains that associate to form an Fc region (typically comprising hinge sequences), N- terminal to which are linkers which may be cleavable or non-cleavable, the IFN moieties, and additional linkers which may be cleavable or non-cleavable.
- each half antibody comprises two protease-cleavable linkers, flanking the IFN moiety. Exemplary IFN proproteins with two protease-cleavable linkers in each half antibody are illustrated in FIGS. 1A- 1C.
- each half antibody comprises a single protease-cleavable linker, on one side of the IFN moiety, with the linker on the other side of the IFN moiety being a non- cleavable linker.
- Exemplary IFN proproteins with one protease-cleavable linker in each half antibody are illustrated in FIGS. 2A-2F.
- Further to the N-terminal of the protease-cleavable linkers are antibody constant domains, either entire constant domains comprising Fc domains, which associate to form another Fc region, or only portions of constant domains (e.g., CH1 domains).
- the IFN proprotein comprises: a) a first polypeptide chain comprising: i) a first immunoglobulin constant domain; ii) a first linker; iii) a first Type I interferon (IFN) moiety; iv) a second linker and v) a first Fc domain; and b) a second polypeptide chain comprising: i) a second immunoglobulin constant domain; ii) a third linker; iii) a second Type I interferon (IFN) moiety; iv) a fourth linker; and v) a second Fc domain associated with the first Fc domain to form an Fc region; [0082]
- the first, second, third and fourth linkers are all protease- cleavable linkers.
- first, second, third and fourth linkers are protease-cleavable linkers.
- first and third linkers are protease-cleavable linkers and the second and four linkers are non-cleavable linkers.
- first and third linkers are non-cleavable linkers and the second and four linkers are protease-cleavable linkers.
- the IFN moieties in the IFN proprotein are sterically hindered from binding to an IFN receptor by the Fc domains and/or constant domains.
- FIG. 1A An exemplary IFN proprotein is depicted in FIG. 1A, where the targeting moiety (depicted as a Fab domain represented by a VH-CH1 paired with a VL-CL) is optional.
- the IFN proprotein of FIG. 1A depicted in FIG. 1A, where the targeting moiety (depicted as a Fab domain represented by a VH-CH1 paired with a VL-CL) is optional.
- first polypeptide chain comprises: i) an optional first VH1 domain; ii) a first CH 1 domain; iii) a first Fc domain comprising a hinge domain, a CH2 domain and a CH3 domain, wherein the CH3 domain is the first immunoglobulin constant domain; iv) a first protease cleavable linker (PCL); v) a first Type I interferon (IFN) moiety; vi) a second protease cleavable linker (PCL); and vii) a second Fc domain; b) the second polypeptide chain comprises; i) an optional second VH1 domain; ii) a second CH1 domain; iii) a third Fc domain comprising a hinge domain, a CH2 domain and a CH3 domain, wherein the CH
- the third polypeptide chain associates with the first polypeptide chain such that the first VH, CH1 , VL and CL form a first targeting moiety and the fourth polypeptide chain associates with the second polypeptide chain polypeptide such that the second VH, CH1 , VL and CL form the second targeting moiety.
- the first and second polypeptide chains may include scFvs at their N-termini.
- the first polypeptide chain (together with the third polypeptide chain, if present) represents a first half antibody and the second polypeptide chain (together with the fourth polypeptide chain, if present) represents a second half antibody.
- FIG. 1 B Another exemplary IFN proprotein is depicted in FIG. 1 B, where the targeting moiety (depicted as a Fab domain represented by a VH-CH1 paired with a VL-CL) is optional.
- the IFN proprotein of FIG. 1 B comprises a first polypeptide chain, a second polypeptide chain, an optional third polypeptide chain and an optional fourth polypeptide chain, wherein: a) the first polypeptide chain comprises: i) an optional first VH1 domain; ii) a first CH 1 domain;
- the second polypeptide chain comprises; i) an optional second VH1 domain; ii) a second CH1 domain; iii) a third protease cleavable linker (PCL); iv) a second Type I interferon (IFN) moiety; v) a fourth protease cleavable linker (PCL); and vi) a second Fc domain; c) the optional third polypeptide chain comprises: i) a first VL domain; ii) a first CL domain; and d) the fourth polypeptide chain comprises: i) a second VL domain; and ii) a second CL domain; wherein the first polypeptide chain is associated with the second poly
- the third polypeptide chain associates with the first polypeptide chain such that the first VH, CH1 , VL and CL form a first targeting moiety and the fourth polypeptide chain associates with the second polypeptide chain polypeptide such that the second VH, CH1 , VL and CL form the second targeting moiety.
- the first and second polypeptide chains may include scFvs at their N-termini.
- FIG. 1C A variant of the IFN proprotein of FIG. 1 B is depicted in FIG. 1C.
- the IFN proprotein of FIG. 1C further includes a first hinge domain between the first CH1 domain and the first protease-cleavable linker and a second hinge domain between the second CH1 domain and the third protease cleavable linker.
- the first polypeptide chain (together with the third polypeptide chain, if present) represents a first half antibody and the second polypeptide chain (together with the fourth polypeptide chain, if present) represents a second half antibody.
- FIG. 2D Another exemplary IFN proprotein is depicted in FIG. 2D, where the targeting moiety (depicted as a Fab domain represented by a VH-CH1 paired with a VL-CL) is optional.
- the targeting moiety depicted as a Fab domain represented by a VH-CH1 paired with a VL-CL.
- 2D comprises a first polypeptide chain, a second polypeptide chain, an optional third polypeptide chain and an optional fourth polypeptide chain, wherein: a) the first polypeptide chain comprises: i) an optional first VH1 domain; ii) a first CH 1 domain; iii) a first Fc domain comprising a hinge domain, a CH2 domain and a CH3 domain, wherein the CH3 domain is the first immunoglobulin constant domain; iv) a first protease-cleavable linker (PCL); v) a first Type I interferon (IFN) moiety; vi) a first non-cleavable linker (NCL); and vii) a second Fc domain; b) the second polypeptide chain comprises; i) an optional second VH1 domain; ii) a second CH1 domain; ill) a third Fc domain comprising a hinge domain, a CH2 domain and a CH3 domain, wherein the CH3 domain is the
- the third polypeptide chain associates with the first polypeptide chain such that the first VH, CH1 , VL and CL form a first targeting moiety and the fourth polypeptide chain associates with the second polypeptide chain polypeptide such that the second VH, CH1 , VL and CL form the second targeting moiety.
- the first and second polypeptide chains may include scFvs at their N-termini.
- the second polypeptide chain comprises: i) an optional first VH1 domain; ii) a first CH 1 domain; iii) a first protease cleavable linker (PCL); iv) a first Type I interferon (IFN) moiety; v) a first non-cleavable linker (NCL); and vi) a first Fc domain; b) the second polypeptide chain comprises; i) an optional second VH1 domain; ii) a second CH1 domain; iii) a second protease cleavable linker (PCL); iv) a second Type I interferon (IFN) moiety; v) a second non-cleavable linker (NCL); and vi) a second Fc domain; c) the optional third polypeptide chain comprises: i) an optional first VH1 domain; ii) a first CH 1 domain; iii) a first protease cleavable
- FIG. 2F A variant of the IFN proprotein of FIG. 2E is depicted in FIG. 2F.
- the IFN proprotein of FIG. 2E further includes a first hinge domain between the first CH1 domain and the first protease-cleavable linker and a second hinge domain between the second CH1 domain and the second protease cleavable linker.
- the IFN proproteins typically include two to four protease-cleavable linkers. Cleavage of all protease-cleavable linkers in IFN proproteins with four protease-cleavable linkers results in release of an activated IFN protein comprising the IFN moiety and lacking the C-terminal Fc moiety, the N-terminal constant domain, and, if present, a targeting moiety.
- IFN proproteins Cleavage of all protease-cleavable linkers in IFN proproteins with two protease-cleavable linkers results in removal of one of the sterically blocking portions and yields an IFN molecule comprising a targeting moiety (antibody-IFN) or an Fc domain (IFN-Fc).
- antibody-IFN antibody-IFN
- IFN-Fc Fc domain
- this configuration is advantageously utilized for IFN proproteins comprising a targeting moiety that binds to a TAA or ECM target molecule that is expressed in the tumor environment.
- the targeting moiety targets the IFN proprotein to the tumor environment, where proteases cleave the protease-cleavable linkers resulting in the release of an IFN protein comprising the IFN moiety and linker sequences. This locally activated IFN protein then induces an immune response against the cancer cells.
- sequence and length of hinge and linker sequences can be varied, as can the sequence of the IFN moiety (containing either the full-length or N- and/or C-terminal truncated IFN sequence).
- IFN moieties are described in Section 6.3 and include IFNa- and IFN
- Exemplary protease cleavable linker sequences as disclosed in Section 6.4.
- Exemplary non-cleavable linker and hinge sequences are disclosed in Sections 6.5 and 6.8.3, respectively.
- Exemplary targeting moieties are disclosed in Section 6.6.
- IFNs There are two major classes of IFNs: Type I (IFN-a subtypes, I FN-p, etc.) and Type II (IFN-y). Additional IFNs (IFN-like cytokines; IFN- subtype) have also been identified.
- the Type I IFN moiety is an interferon-a (IFNa) moiety. In other embodiments, Type I IFN moiety is an interferon-p (I FNP) moiety.
- IFNa interferon-a
- I FNP interferon-p
- the Type I IFN moiety is an interferon-co (IFNco), interferon-c (I FNE) or interferon-K (I FNK) moiety.
- IFNco interferon-co
- I FNE interferon-c
- I FNK interferon-K
- the Type I IFN moiety may comprise a sequence that varies from a wild-type IFN sequence by one or more mutations, e.g., substitutions, deletions, or insertions. Substitutions that attenuate IFN activity by reducing receptor binding may suitably be used. Amino acids with N- or C-terminal deletions (or truncations) may also be used, e.g., a truncation of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 amino acids from the N-and/or C-termini of a mature Type I IFN.
- the present inventors believe that the terminal truncations impose additional steric constraints on the IFN moiety and reduce IFN activity until cleavage of a protease-cleavable linker in the IFN proproteins.
- the IFNa gene is a member of the alpha interferon gene cluster on chromosome 9.
- the encoded cytokine is a member of the Type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties.
- IFNa refers to a family of proteins, with at least 15 known subtypes of human IFNa. The major subtypes identified are IFNal , IFNa2, IFNa8, IFNalO, IFNa14 and IFNa21.
- the IFNal gene has two allelic variants: IFNala and IFNalb.
- the amino acid sequence of human IFNala is assigned UniProtKB accession number P01562, reproduced below with the signal peptide is underlined:
- the human IFNalb gene differs the IFNala allelic variant by one base change in the coding region, leading to a single change in amino acid sequence (Val114 instead of Ala114 in the mature protein, corresponding to Vai 137 instead of Ala137 in the full-length polypeptide).
- IFNa2a There are three allelic variants of IFNa2 alleles, IFNa2a, IFNa2b and IFNa2c. Allele IFNa2b is the predominant allele while allele IFNa2a is less predominant and IFNa2c only a minor allelic variant.
- the amino acid sequence of human IFNa2 is assigned UniProtKB accession number P01563. The sequence of the IFNa2b allele is reproduced below with the signal peptide is underlined:
- IFNa2b has an arginine (R) at position 23 of the mature protein while IFNa2a has a lysine (K).
- the IFNa2 moiety has an arginine at the position corresponding to position 23 of the mature protein. In other embodiments, the IFNa2 moiety has a lysine at the position corresponding to position 23 of the mature protein.
- the IFNa moiety comprises an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, about at least 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or 100% sequence identity to the amino acid sequence of mature IFNcHa, IFNcHb, and/or IFNa2b, IFNa2a, or IFNa2c or a fragment thereof having a truncation of up to 15 amino acids at its N- and/or C-terminus (e.g., a truncation of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids from the N-and/or C-termini of mature IFNcda, IFNalb, and/or IFNa2b, IFNa2a, or IFNa2c).
- a truncation of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids
- the IFNa moiety has one or more amino acid substitutions, e.g., substitutions that alter IFNAR binding and/or agonism.
- amino acid substitutions e.g., substitutions that alter IFNAR binding and/or agonism.
- Exemplary substitutions are found in WO 2013/107791 , U.S. Pat. No. 8,258,263, W02007/000769A2, W02008/124086, WO2010/030671 , WO2018/144999A1, and WO2015/007520, WO 2013/059885, WO2020156467A1 , WO2021/126929A1.
- the IFNa moiety comprises: a) one or more substitutions selected from L15A, A19W, R22A, R23A, L26A, F27A, L30A, L30V, K31A, D32A, R33K or R33A or R33Q, H34A, D35A, Q40A, H57Y, E58N, Q61S, F64A, N65A, T69A, L80A, D82E, Y85A, T86I, Y89A, D114R or D114A, L117A, R120A or R120E or R120K, K121 E, R125A, K133A, K134A, R144A, A145G or A145M, M148A, R149A, R149K, S152A, L153A, N156A; and/or b) one or more substitutions at amino acids 57-89 and 159-165 described in W02007000769A2; and/or c) one or more amino acid substitutions at amino acids
- the IFNa moiety comprises one or more amino acid substitutions set forth in Table 1.
- Table 1 sets forth IFNa substitutions identified by reference to the amino acid position within the sequence of IFNa2.
- the IFNa moiety comprises an amino acid sequence comprising the amino acid substitution R33A or R33K, Q90A, E96A, R120A, A145M, R149A or R149K, S152A, or any combination of two or more of the foregoing, e.g., Q90A + R120A or A145M + R149K.
- Interferon 1-0 is a cytokine that is naturally produced by the immune system in response to biological and chemical stimuli.
- IFN 10 is a glycosylate, secreted monomer having a molecular weight of around 22kDa that is produced in large quantities by fibroblasts and as such it is also known as fibroblast interferon.
- IFN 10 binds to the IFNAR receptor composed of the IFNAR1 and IFNAR2 dimers to induce signaling via the JAK/STAT pathway and other pathways.
- IFN 10 can also function by binding to IFNAR1 alone and signal independently of the Jak-STAT pathways (see, e.g., Stanifer et al., 2019, Int. J Mol. Sci.
- IFN10 contains 5 a-helices designated A (YNLLGFLQRSSNFQCQKLL (SEQ ID NO: 18)), B (KEDAALTIYEMLQNIFAIF (SEQ ID NO: 19)), C (ETIVENLLANVYHQINHLKTVLEEKL (SEQ ID NO: 20)), D (SSLHLKRYYGRILHYLKA (SEQ ID NO: 21)), and E (HCAWTIVRVEILRNFYFINRLT (SEQ ID NO: 22)).
- the five a-helices are interconnected by loops of 2-28 residues designated AB, BC, CD and DE loops. It has been reported that the A helix in the AB loop and the E helix in the DE loop are involved in the binding of IFN 10 to the IFNAR receptor.
- IFN10 Interferon 1-01
- IFN103 Interferon 1-03
- the IFN0 moiety comprises an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, about at least 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or 100% sequence identity to the amino acid sequence of mature I FN 1 (31 or a fragment thereof having a truncation of up to 15 amino acids at its N- and/or C-terminus (e.g., a truncation of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids from the N- and/or C-termini of I FN 1 (31).
- a protease-cleavable linker can range from 8 amino acids to 100 or more amino acids. In various embodiments, the protease-cleavable linker ranges from 8 amino acids to 15 amino acids, from 10 amino acids to 20 amino acids, 20 amino acids to 80, and in certain aspects a non-cleavable peptide linker ranges from 20 amino acids to 60 amino acids, 20 amino acids to 40 amino acids, from 30 amino acids to 50 amino acids, from 20 amino acids to 80 amino acids, or from 30 amino acids to 70 amino acids in length. [0141]
- the protease-cleavable linkers comprise one or more substrate sequences for one or more proteases, for example one or more of the proteases set forth in Section 6.4.1.
- the first and third protease-cleavable linkers are cleavable by the same protease and/or the second and fourth protease-cleavable linkers are cleavable by the same protease.
- the protease is a protease set forth in Table A.
- the different linkers may be cleavable by the same protease, different proteases, or when a linker comprises multiple substrate sequences, the different linkers may be cleavable by multiple proteases, one or more of which are common and one or more of which are different.
- Exemplary protease-cleavable linker sequences are set forth in Section 6.4.4
- protease whose substrate sequences can be incorporated into the protease- cleavable linkers are set forth in Table A below.
- Exemplary substrate sequences that are cleavable by a tumor protease and can be incorporated into the protease-cleavable linkers are set forth in Table B below. 6.4.3. Spacers
- the present disclosure provides IFN proproteins in which two or more components of an IFN proprotein are connected to one another by a peptide linker.
- linkers can be used to connect an Fc domain and a targeting moiety or different domains within a targeting moiety (e.g., VH and VL domains in an scFv).
- a non-cleavable linker is at least 5 amino acids, at least 6 amino acids or at least 7 amino acids in length and optionally is up to 30 amino acids, up to 40 amino acids, up to 50 amino acids or up to 60 amino acids in length.
- the non-cleavable linker ranges from 5 amino acids to 50 amino acids in length, e.g., ranges from 5 to 50, from 5 to 45, from 5 to 40, from 5 to 35, from 5 to 30, from 5 to 25, or from 5 to 20 amino acids in length.
- the non-cleavable linker ranges from 6 amino acids to 50 amino acids in length, e.g., ranges from 6 to 50, from 6 to 45, from 6 to 40, from 6 to 35, from 6 to 30, from 6 to 25, or from 6 to 20 amino acids in length.
- Charged (e.g., charged hydrophilic linkers) and/or flexible non-cleavable linkers are particularly preferred.
- Examples of flexible non-cleavable linkers that can be used in the IFN proproteins of the disclosure include those disclosed by Chen et al., 2013, Adv Drug Deliv Rev. 65(10): 1357-1369 and Klein et al., 2014, Protein Engineering, Design & Selection 27(10): 325-330.
- Particularly useful flexible non-cleavable linkers are or comprise repeats of glycines and serines, e.g., a monomer or multimer of G n S (SEQ ID NO: 299) or SG n (SEQ ID NO: 300), where n is an integer from 1 to 10, e.g., 1 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- the non-cleavable linker is or comprises a monomer or multimer of repeat of G4S (SEQ ID NO: 301) e.g., (GGGGS) n (SEQ ID NO: 301).
- targeting moieties in the IFN proproteins of the disclosure permits the delivery of high concentrations of IFN into the tumor microenvironment with a concomitant reduction of systemic exposure, resulting in fewer side effects than obtained with untargeted IFN molecules.
- the IFN proproteins are intended to treat cancer, e.g., by inducing a local immune response against tumor tissue.
- the targeting molecule can be any local tumor and associated target molecule.
- ECM antigens include syndecan, heparanase, integrins, osteopontin, link, cadherins, laminin, laminin type EGF, lectin, fibronectin, notch, nectin (e.g., nectin-4), tenascin, collagen (e.g., collagen type X) and matrixin.
- the target molecules are checkpoint inhibitors, for example CTLA-4, PD1 , PDL1, PDL2, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK1 , CHK2.
- the target molecule is PD1.
- the target molecule is LAG3.
- the target molecule is PDL1.
- the target molecules are on the surfaces of natural killer (NK) cells such as CD335, CD38, CD2, NKG2D, NKp44, NKp30, CD16, LFA-1 , CD27, KIR, NKH1A, and NKp46.
- NK natural killer
- the antibodies and antigen-binding portions generally bind to specific antigenic determinants and are able to direct the IFN proprotein to a target site, for example to a specific type of tumor cell or tumor stroma that bears the antigenic determinant.
- the targeting moiety recognizes a tumor-associated antigen (TAA).
- TAA tumor-associated antigen
- the TAA is a human TAA.
- the antigen may or may not be present on normal cells.
- the TAA is preferentially expressed or upregulated on tumor cells as compared to normal cells.
- the TAA is a lineage marker.
- TAAs include Fibroblast Activation Protein (FAP), the A1 domain of Tenascin-C (TNC A1), the A2 domain of Tenascin-C (TNC A2), the Extra Domain B of Fibronectin (EDB), the Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), MART-1/Melan-A, gp100, Dipeptidyl peptidase IV (DPPIV), adenosine deaminase-binding protein (ADAbp), cyclophilin b, colorectal associated antigen (CRC)-C017-1A/GA733, Carcinoembryonic Antigen (CEA) and its immunogenic epitopes CAP-1 and CAP-2, etv6, aml1 , Prostate Specific Antigen (PSA) and its immunogenic epitopes PSA-1 , PSA-2, and PSA-3, prostate-specific membrane antigen (PSMA), T-cell receptor/
- the targeting moiety is preferably an antigen binding moiety, for example an antibody or an antigen-binding portion of an antibody, e.g., an scFv, as described in Section 6.7.2 or a Fab, as described in Section 6.7.1.
- an antigen binding moiety for example an antibody or an antigen-binding portion of an antibody, e.g., an scFv, as described in Section 6.7.2 or a Fab, as described in Section 6.7.1.
- the target molecule is PDL1.
- Table F-1 below provides exemplary anti-PDL1 antibodies and/or antibody sequences upon which the targeting moiety can be based, e.g., which can be incorporated into a targeting moiety for use in the interferon proproteins of the disclosure.
- the targeting moiety of an IFN proprotein of the disclosure can be any type of antibody or fragment thereof that retains specific binding to an antigenic determinant.
- the targeting moiety is an immunoglobulin molecule or fragment thereof, particularly an IgG class immunoglobulin molecule, more particularly an IgGi or lgG 4 immunoglobulin molecule.
- Antibody fragments include, but are not limited to, VH (or V H ) fragments, VL (or V L ) fragments, Fab fragments, F(ab’)2 fragments, scFv fragments, Fv fragments, minibodies, diabodies, triabodies, and tetrabodies. 6.7.1.
- the modifications introduced in the VH and CH1 and/or VL and CL domains are complementary to each other.
- Complementarity at the heavy and light chain interface can be achieved on the basis of steric and hydrophobic contacts, electrostatic/charge interactions or a combination of the variety of interactions.
- the complementarity between protein surfaces is broadly described in the literature in terms of lock and key fit, knob into hole, protrusion and cavity, donor and acceptor etc., all implying the nature of structural and chemical match between the two interacting surfaces.
- the one or more introduced modifications introduce a new hydrogen bond across the interface of the Fab components. In one embodiment, the one or more introduced modifications introduce a new salt bridge across the interface of the Fab components. Exemplary substitutions are described in WO 2014/150973 and WO 2014/082179, the contents of which are hereby incorporated by reference.
- the Fab domain comprises a 192E substitution in the CH1 domain and 114A and 137K substitutions in the CL domain, which introduces a salt-bridge between the CH1 and CL domains (see, e.g., Golay et al., 2016, J Immunol 196:3199-211).
- the Fab domain comprises a 143Q and 188V substitutions in the CH1 domain and 113T and 176V substitutions in the CL domain, which serves to swap hydrophobic and polar regions of contact between the CH1 and CL domain (see, e.g., Golay et al., 2016, J Immunol 196:3199-211).
- the Fab domain can comprise modifications in some or all of the VH, CH1 , VL, CL domains to introduce orthogonal Fab interfaces which promote correct assembly of Fab domains (Lewis et al., 2014 Nature Biotechnology 32:191-198).
- 39K, 62E modifications are introduced in the VH domain
- H172A, F174G modifications are introduced in the CH1 domain
- 1 R, 38D, (36F) modifications are introduced in the VL domain
- L135Y, S176W modifications are introduced in the CL domain.
- a 39Y modification is introduced in the VH domain and a 38R modification is introduced in the VL domain.
- the VL of common light chain (also referred to as a universal light chain) can be used for each unique ABD in the IFN proproteins of the disclosure.
- employing a common light chain as described herein reduces the number of inappropriate species in the IFN proproteins as compared to employing original cognate VLs.
- the VL domains of ABDs are identified from monospecific antibodies comprising a common light chain.
- Single chain Fv or “scFv” antibody fragments comprise the VH and VL domains of an antibody in a single polypeptide chain, are capable of being expressed as a single chain polypeptide, and retain the specificity of the intact antibodies from which they are derived.
- the scFv polypeptide further comprises a polypeptide linker between the VH and VL domain that enables the scFv to form the desired structure for target binding.
- linkers suitable for connecting the VH and VL chains of an scFv are the non-cleavable linkers identified in Section 6.5.
- the scFv can comprise VH and VL sequences from any suitable species, such as murine, human or humanized VH and VL sequences.
- the VH and VL-encoding DNA fragments are operably linked to another fragment encoding a linker, e.g., encoding any of the linkers described in Section 6.5 (typically a repeat of a sequence containing the amino acids glycine and serine, such as the amino acid sequence (Gly4 ⁇ Ser)3 (SEQ ID NO: 180), such that the VH and VL sequences can be expressed as a contiguous single-chain protein, with the VL and VH regions joined by the flexible linker (see, e.g., Bird et al., 1988, Science 242:423-426; Huston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; McCafferty et al., 1990, Nature 348:552- 554).
- a linker typically a repeat of a sequence containing the amino acids glycine and serine, such as the amino acid sequence (Gly4 ⁇ Ser)3 (S
- the IFN proproteins of the disclosure typically include a pair of Fc domains that associate to form an Fc region.
- Fc regions comprise hinge regions at their N-termini to form a constant domain.
- the reference to an Fc domain encompasses an Fc domain with a hinge domain at its N-terminus unless specified otherwise.
- the Fc domains can be derived from any suitable species operably linked to an ABD or component thereof.
- the Fc domain is derived from a human Fc domain.
- the targeting moiety or component thereof is fused to an IgG Fc molecule.
- a targeting moiety or component thereof may be fused to the N-terminus or the C- terminus of the IgG Fc domain or both.
- an Fc domain comprises an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, about at least 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO: 411.
- an Fc domain comprises at least 90% sequence identity and less than 100% sequence identity to SEQ ID NO: 411 (e.g., between 90% and 99% sequence identity to SEQ ID NO: 411)
- an Fc domain may also comprise one or more amino acid substitutions described herein, for example one or more substitutions that reduce effector function (e.g., as described in Section 6.8.1) and/or one or more substitutions that promote Fc heterodimerization (e.g., as described in Section 6.8.2).
- an Fc domain comprises an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, about at least 93%, at least about 94%, at eat least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO: 412.
- an Fc domain may also comprise one or more amino acid substitutions described herein, for example one or more substitutions that reduce effector function (e.g., as described in Section 6.8.1) and/or one or more substitutions that promote Fc heterodimerization (e.g., as described in Section 6.8.2).
- an Fc domain comprises an amino acid sequence having at least about 90%, at least about 91%, at least about 92%, about at least 93%, at least about 94%, at eat least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO: 413.
- an Fc domain comprises at least 90% sequence identity and less than 100% sequence identity to SEQ ID NO: 413 (e.g., between 90% and 99% sequence identity to SEQ ID NO: 413)
- an Fc domain may also comprise one or more amino acid substitutions described herein, for example one or more substitutions that reduce effector function (e.g., as described in Section 6.8.1) and/or one or more substitutions that promote Fc heterodimerization (e.g., as described in Section 6.8.2).
- the two Fc domains within the Fc region can be the same or different from one another.
- the Fc domains are typically identical, but for the purpose of producing multispecific binding molecules, e.g., the IFN proproteins of the disclosure and MBMs produced by their activation, the Fc domains might advantageously be different to allow for heterodimerization, as described in Section 6.8.2 below.
- the heavy chain Fc domain of IgA, IgD and IgG is composed of two heavy chain constant domains (CH2 and CH3) and that of IgE and IgM is composed of three heavy chain constant domains (CH2, CH3 and CH4). These dimerize to create an Fc region.
- the Fc region, and / or the Fc domains within it can comprise heavy chain constant domains from one or more different classes of antibody, for example one, two or three different classes.
- the Fc region comprises CH2 and CH3 domains derived from lgG1.
- the Fc region comprises CH2 and CH3 domains derived from lgG2.
- the Fc region comprises CH2 and CH3 domains derived from lgG3.
- the Fc region comprises CH2 and CH3 domains derived from lgG4.
- the Fc region comprises a CH4 domain from IgM.
- the IgM CH4 domain is typically located at the C-terminus of the CH3 domain.
- the Fc region comprises CH2 and CH3 domains derived from IgG and a CH4 domain derived from IgM.
- the heavy chain constant domains for use in producing an Fc region for the IFN proproteins of the present disclosure may include variants of the naturally occurring constant domains described above. Such variants may comprise one or more amino acid variations compared to wild type constant domains.
- the Fc region of the present disclosure comprises at least one constant domain that varies in sequence from the wildtype constant domain. It will be appreciated that the variant constant domains may be longer or shorter than the wild-type constant domain.
- the variant constant domains are at least 60% identical or similar to a wild-type constant domain.
- the variant constant domains are at least 70% identical or similar.
- the variant constant domains are at least 80% identical or similar.
- the variant constant domains are at least 90% identical or similar.
- the variant constant domains are at least 95% identical or similar.
- IgM and IgA occur naturally in humans as covalent multimers of the common H2L2 antibody unit.
- IgM occurs as a pentamer when it has incorporated a J-chain, or as a hexamer when it lacks a J-chain.
- IgA occurs as monomer and dimer forms.
- the heavy chains of IgM and IgA possess an 18 amino acid extension to the C-terminal constant domain, known as a tailpiece.
- the tailpiece includes a cysteine residue that forms a disulfide bond between heavy chains in the polymer and is believed to have an important role in polymerization.
- the tailpiece also contains a glycosylation site.
- the IFN proproteins of the present disclosure do not comprise a tailpiece.
- the Fc domains that are incorporated into the IFN proproteins of the present disclosure may comprise one or more modifications that alter the functional properties of the proteins, for example, binding to Fc-receptors such as FcRn or leukocyte receptors, binding to complement, modified disulfide bond architecture, or altered glycosylation patterns. Exemplary Fc modifications that alter effector function are described in Section 6.8.1 .
- the Fc domains can also be altered to include modifications that improve manufacturability of asymmetric IFN proproteins, for example by allowing heterodimerization, which is the preferential pairing of non-identical Fc domains over identical Fc domains. Heterodimerization permits the production of IFN proproteins in which different polypeptide components are connected to one another by an Fc region containing Fc domains that differ in sequence. Examples of heterodimerization strategies are exemplified in Section 6.8.2. [0224] It will be appreciated that any of the modifications mentioned above can be combined in any suitable manner to achieve the desired functional properties and/or combined with other modifications to alter the properties of the IFN proproteins.
- the Fc domain comprises one or more amino acid substitutions that reduces binding to an Fc receptor and/or effector function.
- the Fc domain e.g., an Fc domain of an IFN proprotein half antibody
- the Fc region e.g., one or both Fc domains of an IFN proprotein that can associate to form an Fc region
- the Fc domain or the Fc region comprises an amino acid substitution at a position selected from the group of L234, L235 and P329 (numberings according to Kabat EU index).
- the Fc domain or the Fc region comprises the amino acid substitutions L234A and L235A (numberings according to Kabat EU index).
- the Fc domain or region is an Igd Fc domain or region, particularly a human Igd Fc domain or region.
- the Fc domain or the Fc region comprises an amino acid substitution at position P329.
- the amino acid substitution is P329A or P329G, particularly P329G (numberings according to Kabat EU index).
- each Fc domain of the Fc region comprises the amino acid substitutions L234A, L235A and P329G (Kabat EU index numbering), i.e. in each of the first and the second Fc domains in the Fc region the leucine residue at position 234 is replaced with an alanine residue (L234A), the leucine residue at position 235 is replaced with an alanine residue (L235A) and the proline residue at position 329 is replaced by a glycine residue (P329G) (numbering according to Kabat EU index).
- the Fc domain is an lgG1 Fc domain, particularly a human lgG1 Fc domain.
- the IgG 1 Fc domain is a variant IgG 1 comprising D265A, N297A mutations (EU numbering) to reduce effector function.
- the Fc domain is an lgG4 Fc domain with reduced binding to Fc receptors.
- Exemplary lgG4 Fc domains with reduced binding to Fc receptors may comprise an amino acid sequence selected from Table H below.
- the Fc domain includes only the bolded portion of the sequences shown below: [0231]
- the lgG4 with reduced effector function comprises the bolded portion of the amino acid sequence of SEQ ID NO:31 of W02014/121087, sometimes referred to herein as lgG4s or hlgG4s, having the amino acid sequence: ESKYGPPCPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDG VEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPR EPQVYTLPPSQEEMTKNQVSLTCLVKGFY
- an Fc region comprising an Fc domain comprising the amino acid sequence of SEQ ID NQ:30 of WQ2014/121087 (or the bolded portion thereof) and an Fc domain comprising the amino acid sequence of SEQ ID NO:37 of WQ2014/121087 (or the bolded portion thereof) or an Fc region comprising an Fc domain comprising the amino acid sequence of SEQ ID NO:31 of WQ2014/121087 (or the bolded portion thereof) and an Fc domain comprising the amino acid sequence of SEQ ID NO:38 of WQ2014/121087 (or the bolded portion thereof).
- IFN proproteins entail dimerization between two Fc domains that, unlike a native immunoglobulin, are operably linked to non-identical N-terminal or C-terminal regions.
- the present disclosure provides IFN proproteins comprising Fc heterodimers, i.e., Fc regions comprising heterologous, non-identical Fc domains.
- Fc heterodimers i.e., Fc regions comprising heterologous, non-identical Fc domains.
- each Fc domain in the Fc heterodimer comprises a CH3 domain of an antibody.
- the CH3 domains are derived from the constant region of an antibody of any isotype, class or subclass, and preferably of IgG (lgG1 , lgG2, lgG3 and lgG4) class, as described in the preceding section.
- the polypeptides that associate to form an IFN proprotein of the disclosure will contain CH3 domains with modifications that favor heterodimeric association relative to unmodified Fc domains.
- said modification promoting the formation of Fc heterodimers is a so-called “knob-into-hole” or “knob-in-hole” modification, comprising a “knob” modification in one of the Fc domains and a “hole” modification in the other Fc domain.
- the knob-into-hole technology is described e.g., in U.S. Patent No. 5,731 ,168; US 7,695,936; Ridgway et al., 1996, Prot Eng 9:617-621 , and Carter, 2001 , Immunol Meth 248:7-15.
- said amino acid residue having a larger side chain volume is selected from the group consisting of arginine (R), phenylalanine (F), tyrosine (Y), and tryptophan (W).
- said amino acid residue having a smaller side chain volume is selected from the group consisting of alanine (A), serine (S), threonine (T), and valine (V).
- the protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g., by site-specific mutagenesis, or by peptide synthesis.
- An exemplary substitution is Y470T.
- the first Fc domain comprises the amino acid substitutions S354C and T366W
- the second Fc domain comprises the amino acid substitutions Y349C, T366S, L368A and Y407V (numbering according to Kabat EU index).
- the IFN proproteins comprise a first CH3 domain and a second Ig CH3 domain, wherein the first and second Ig CH3 domains differ from one another by at least one amino acid, and wherein at least one amino acid difference reduces binding of the IFN proprotein to Protein A as compared to a corresponding IFN proprotein lacking the amino acid difference.
- the first CH3 domain binds Protein A and the second CH3 domain contains a mutation/modification that reduces or abolishes Protein A binding such as an H95R modification (by IMGT exon numbering; H435R by EU numbering).
- the second CH3 may further comprise a Y96F modification (by IMGT; Y436F by EU). This class of modifications is referred to herein as “star” mutations.
- the Fc can contain one or more mutations (e.g., knob and hole mutations) to facilitate heterodimerization as well as star mutations to facilitate purification.
- mutations e.g., knob and hole mutations
- the IFN proproteins of the disclosure can comprise an Fc domain comprising a hinge domain at its N-terminus.
- the hinge region can be a native or a modified hinge region. Hinge regions are typically found at the N-termini of Fc regions.
- the natural hinge region may be altered by converting one or more cysteine or other residues into neutral residues, such as serine or alanine, or by converting suitably placed residues into cysteine residues. By such means the number of cysteine residues in the hinge region may be increased or decreased.
- Other modified hinge regions may be entirely synthetic and may be designed to possess desired properties such as length, cysteine composition and flexibility.
- an IFN proprotein of the disclosure comprises an Fc region in which one or both Fc domains possesses an intact hinge domain at its N-terminus.
- positions 233-236 within a hinge region may be G, G, G and unoccupied; G, G, unoccupied, and unoccupied; G, unoccupied, unoccupied, and unoccupied; or all unoccupied, with positions numbered by EU numbering.
- the core hinge region of human lgG4 contains the sequence CPSC (SEQ ID NO: 376) compared to lgG1 that contains the sequence CPPC (SEQ ID NO: 375).
- the serine residue present in the lgG4 sequence leads to increased flexibility in this region, and therefore a proportion of molecules form disulfide bonds within the same protein chain (an intrachain disulfide) rather than bridging to the other heavy chain in the IgG molecule to form the interchain disulfide. (Angel et al., 1993, Mol Immunol 30(1):105-108).
- the hinge sequences incorporated into the IFN proproteins of the disclosure may be full length (“long”) or truncated (“short”).
- An example of a full-length hinge sequence is ESKYGPPCPPCPAPPVA (SEQ ID NO: 377).
- An example of a truncated hinge sequence is ESKYGPPCPPC (SEQ ID NO: 378).
- ESKYGPPCPPC (SEQ ID NO: 378) is truncated by 6 amino acids as compared to the full-length hinge sequence ESKYGPPCPPCPAPPCA (SEQ ID NO: 379).
- the hinge domain can be a chimeric hinge domain.
- a chimeric hinge region comprises the amino acid sequence EPKSCDKTHTCPPCPAPPVA (SEQ ID NO: 380) (previously disclosed as SEQ ID NO:8 of W02014/121087, which is incorporated by reference in its entirety herein) or ESKYGPPCPPCPAPPVA (SEQ ID NO: 377) (previously disclosed as SEQ ID NO:9 of W02014/121087).
- EPKSCDKTHTCPPCPAPPVA amino acid sequence EPKSCDKTHTCPPCPAPPVA
- ESKYGPPCPPCPAPPVA SEQ ID NO: 377
- Such chimeric hinge sequences can be suitably linked to an lgG4 CH2 region (for example by incorporation into an lgG4 Fc domain, for example a human or murine Fc domain, which can be further modified in the CH2 and/or CH3 domain to reduce effector function, for example as described in Section 6.8.1).
- positions 233-236 can be combined with position 228 being occupied by P.
- Position 228 is naturally occupied by P in human IgG 1 and lgG2 but is occupied by S in human lgG4 and R in human lgG3.
- An S228P mutation in an lgG4 antibody is advantageous in stabilizing an lgG4 antibody and reducing exchange of heavy chain light chain pairs between exogenous and endogenous antibodies.
- positions 226-229 are occupied by C, P, P and C respectively.
- the modified hinge sequences can be linked to an lgG4 CH2 region (for example by incorporation into an lgG4 Fc domain, for example a human or murine Fc domain, which can be further modified in the CH2 and/or CH3 domain to reduce effector function, for example as described in Section 6.8.1).
- the disclosure provides nucleic acids encoding the IFN proproteins of the disclosure.
- the IFN proproteins are encoded by a single nucleic acid.
- the IFN proproteins can be encoded by a plurality (e.g., two, three, four or more) nucleic acids.
- a single nucleic acid can encode an IFN proprotein that comprises a single polypeptide chain, an IFN proprotein that comprises two or more polypeptide chains, or a portion of an IFN proprotein that comprises more than two polypeptide chains (for example, a single nucleic acid can encode two polypeptide chains of an IFN proprotein comprising three, four or more polypeptide chains, or three polypeptide chains of an IFN proprotein comprising four or more polypeptide chains).
- the open reading frames encoding two or more polypeptide chains can be under the control of separate transcriptional regulatory elements (e.g., promoters and/or enhancers).
- the open reading frames encoding two or more polypeptides can also be controlled by the same transcriptional regulatory elements and separated by internal ribosome entry site (IRES) sequences allowing for translation into separate polypeptides.
- IFS internal ribosome entry site
- an IFN proprotein comprising two or more polypeptide chains is encoded by two or more nucleic acids.
- the number of nucleic acids encoding an IFN proprotein can be equal to or less than the number of polypeptide chains in the IFN proprotein (for example, when more than one polypeptide chains are encoded by a single nucleic acid).
- the nucleic acids of the disclosure can be DNA or RNA (e.g., mRNA).
- the disclosure provides host cells and vectors containing the nucleic acids of the disclosure.
- the nucleic acids may be present in a single vector or separate vectors present in the same host cell or separate host cell, as described in more detail herein below.
- the disclosure provides vectors comprising nucleotide sequences encoding an IFN proprotein or a component thereof described herein, for example one or two of the polypeptide chains of a half antibody of an IFN proprotein.
- the vectors include, but are not limited to, a virus, plasmid, cosmid, lambda phage or a yeast artificial chromosome (YAC).
- vectors utilize DNA elements which are derived from animal viruses such as, for example, bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (Rous Sarcoma Virus, MMTV or MOMLV) or SV40 virus.
- DNA elements which are derived from animal viruses such as, for example, bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (Rous Sarcoma Virus, MMTV or MOMLV) or SV40 virus.
- RNA elements derived from RNA viruses such as Semliki Forest virus, Eastern Equine Encephalitis virus and Flaviviruses.
- cells which have stably integrated the DNA into their chromosomes can be selected by introducing one or more markers which allow for the selection of transfected host cells.
- the marker may provide, for example, prototropy to an auxotrophic host, biocide resistance (e.g., antibiotics), or resistance to heavy metals such as copper, or the like.
- the selectable marker gene can be either directly linked to the DNA sequences to be expressed or introduced into the same cell by co-transformation. Additional elements may also be needed for optimal synthesis of mRNA. These elements may include splice signals, as well as transcriptional promoters, enhancers, and termination signals.
- the expression vectors can be transfected or introduced into an appropriate host cell.
- Various techniques may be employed to achieve this, such as, for example, protoplast fusion, calcium phosphate precipitation, electroporation, retroviral transduction, viral transfection, gene gun, lipid-based transfection or other conventional techniques. Methods and conditions for culturing the resulting transfected cells and for recovering the expressed polypeptides are known to those skilled in the art, and may be varied or optimized depending upon the specific expression vector and mammalian host cell employed, based upon the present description. 6.9.2. Cells
- the disclosure also provides host cells comprising a nucleic acid of the disclosure.
- the host cells are genetically engineered to comprise one or more nucleic acids described herein.
- the host cells are genetically engineered by using an expression cassette.
- expression cassette refers to nucleotide sequences, which are capable of affecting expression of a gene in hosts compatible with such sequences.
- Such cassettes may include a promoter, an open reading frame with or without introns, and a termination signal. Additional factors necessary or helpful in effecting expression may also be used, such as, for example, an inducible promoter.
- the disclosure also provides host cells comprising the vectors described herein.
- the cell can be, but is not limited to, a eukaryotic cell, a bacterial cell, an insect cell, or a human cell.
- Suitable eukaryotic cells include, but are not limited to, Vero cells, HeLa cells, COS cells, CHO cells, HEK293 cells, BHK cells and MDCKII cells.
- Suitable insect cells include, but are not limited to, Sf9 cells.
- the IFN proproteins of the disclosure may be in the form of compositions comprising the IFN proprotein and one or more carriers, excipients and/or diluents.
- the compositions may be formulated for specific uses, such as for veterinary uses or pharmaceutical uses in humans.
- the form of the composition e.g., dry powder, liquid formulation, etc.
- the excipients, diluents and/or carriers used will depend upon the intended uses of the IFN proprotein and, for therapeutic uses, the mode of administration.
- the compositions may be supplied as part of a sterile, pharmaceutical composition that includes a pharmaceutically acceptable carrier.
- This composition can be in any suitable form (depending upon the desired method of administering it to a patient).
- the pharmaceutical composition can be administered to a patient by a variety of routes such as orally, transdermally, subcutaneously, intranasally, intravenously, intramuscularly, intratumorally, intrathecally, topically or locally.
- routes for administration in any given case will depend on the particular IFN proprotein, the subject, and the nature and severity of the disease and the physical condition of the subject.
- the pharmaceutical composition will be administered intravenously or subcutaneously.
- compositions can be conveniently presented in unit dosage forms containing a predetermined amount of an IFN proprotein of the disclosure per dose.
- the quantity of IFN proprotein included in a unit dose will depend on the disease being treated, as well as other factors as are well known in the art.
- Such unit dosages may be in the form of a lyophilized dry powder containing an amount of IFN proprotein suitable for a single administration, or in the form of a liquid.
- Dry powder unit dosage forms may be packaged in a kit with a syringe, a suitable quantity of diluent and/or other components useful for administration.
- Unit dosages in liquid form may be conveniently supplied in the form of a syringe pre-filled with a quantity of IFN proprotein suitable for a single administration.
- compositions may also be supplied in bulk from containing quantities of IFN proprotein suitable for multiple administrations.
- compositions may be prepared for storage as lyophilized formulations or aqueous solutions by mixing an IFN proprotein having the desired degree of purity with optional pharmaceutically-acceptable carriers, excipients or stabilizers typically employed in the art (all of which are referred to herein as “carriers”), /.e., buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives. See, Remington’s Pharmaceutical Sciences, 16th edition (Osol, ed. 1980). Such additives should be nontoxic to the recipients at the dosages and concentrations employed.
- Buffering agents help to maintain the pH in the range which approximates physiological conditions. They may be present at a wide variety of concentrations, but will typically be present in concentrations ranging from about 2 mM to about 50 mM.
- Suitable buffering agents for use with the present disclosure include both organic and inorganic acids and salts thereof such as citrate buffers (e.g., monosodium citrate-disodium citrate mixture, citric acid-trisodium citrate mixture, citric acid-monosodium citrate mixture, etc.), succinate buffers (e.g., succinic acid- monosodium succinate mixture, succinic acid-sodium hydroxide mixture, succinic acid-disodium succinate mixture, etc.), tartrate buffers (e.g., tartaric acid-sodium tartrate mixture, tartaric acid- potassium tartrate mixture, tartaric acid-sodium hydroxide mixture, etc.), fumarate buffers (e.g., fumaric acid-monos
- Preservatives may be added to retard microbial growth and can be added in amounts ranging from about 0.2%-1 % (w/v).
- Suitable preservatives for use with the present disclosure include phenol, benzyl alcohol, meta-cresol, methyl paraben, propyl paraben, octadecyldimethylbenzyl ammonium chloride, benzalconium halides (e.g., chloride, bromide, and iodide), hexamethonium chloride, and alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, and 3-pentanol.
- Isotonicifiers sometimes known as “stabilizers” can be added to ensure isotonicity of liquid compositions of the present disclosure and include polyhydric sugar alcohols, for example trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol and mannitol.
- Stabilizers refer to a broad category of excipients which can range in function from a bulking agent to an additive which solubilizes the therapeutic agent or helps to prevent denaturation or adherence to the container wall.
- Typical stabilizers can be polyhydric sugar alcohols (enumerated above); amino acids such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2-phenylalanine, glutamic acid, threonine, etc., organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myoinisitol, galactitol, glycerol and the like, including cyclitols such as inositol; polyethylene glycol; amino acid polymers; sulfur containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, a- monothioglycerol and sodium thio sulfate; low mo
- Non-ionic surfactants or detergents may be added to help solubilize the glycoprotein as well as to protect the glycoprotein against agitation-induced aggregation, which also permits the formulation to be exposed to shear surface stressed without causing denaturation of the protein.
- Suitable non-ionic surfactants include polysorbates (20, 80, etc.), polyoxamers (184, 188, etc.), and pluronic polyols.
- Non-ionic surfactants may be present in a range of about 0.05 mg/mL to about 1.0 mg/mL, for example about 0.07 mg/mL to about 0.2 mg/mL.
- Additional miscellaneous excipients include bulking agents (e.g., starch), chelating agents e.g., EDTA), antioxidants (e.g., ascorbic acid, methionine, vitamin E), and cosolvents.
- bulking agents e.g., starch
- chelating agents e.g., EDTA
- antioxidants e.g., ascorbic acid, methionine, vitamin E
- cosolvents e.g., ascorbic acid, methionine, vitamin E
- the IFN proproteins of the disclosure can be formulated as pharmaceutical compositions comprising the IFN proproteins, for example containing one or more pharmaceutically acceptable excipients or carriers.
- a IFN proprotein preparation can be combined with one or more pharmaceutically acceptable excipient or carrier.
- formulations of IFN proproteins can be prepared by mixing IFN proproteins with physiologically acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions, lotions, or suspensions (see, e.g., Hardman et al., 2001 , Goodman and Gilman’s The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N.Y.; Gennaro, 2000, Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y.; Avis, et al.
- An effective amount for a particular subject may vary depending on factors such as the condition being treated, the overall health of the subject, the method route and dose of administration and the severity of side effects (see, e.g., Maynard, et al. (1996) A Handbook of SOPs for Good Clinical Practice, Interpharm Press, Boca Raton, Fla.; Dent (2001) Good Laboratory and Good Clinical Practice, Urch Publ., London, UK).
- Exemplary viral vectors include recombinant adenovirus and adeno-associated virus vectors (rAAV).
- rAAV vectors are based on the defective and nonpathogenic parvovirus adeno- associated type 2 virus. Most such vectors are derived from a plasmid that retains only the AAV inverted terminal repeats flanking the transgene expression cassette. Efficient gene transfer and stable transgene delivery due to integration into the genomes of the transduced cell are key features for this vector system.
- Ad Replication-deficient recombinant adenoviral vectors
- Ad can be produced at high titer and readily infect a number of different cell types.
- Most adenovirus vectors are engineered such that a transgene replaces the Ad Ela, Elb, and/or E3 genes; subsequently the replication defective vector is propagated in human 293 cells that supply deleted gene function in trans.
- Ad vectors can transduce multiple types of tissues in vivo, including non-dividing, differentiated cells such as those found in liver, kidney and muscle. Conventional Ad vectors have a large carrying capacity.
- Packaging cells are used to form virus particles that are capable of infecting a host cell. Such cells include 293 cells, which package adenovirus, and w2 cells or PA317 cells, which package retrovirus.
- Viral vectors used in gene therapy are usually generated by a producer cell line that packages a nucleic acid vector into a viral particle. The vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host (if applicable), other viral sequences being replaced by an expression cassette encoding the protein to be expressed. The missing viral functions are supplied in trans by the packaging cell line.
- AAV vectors used in gene therapy typically only possess inverted terminal repeat (ITR) sequences from the AAV genome which are required for packaging and integration into the host genome.
- ITR inverted terminal repeat
- Exemplary other agents and excipients that can be included in the compositions include, for example, water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite; oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, a-tocopherol; and metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid and phosphoric acid.
- water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite
- oil-soluble antioxidants such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), le
- the present disclosure further provides a method of administering to the subject IFN therapy with reduced systemic exposure and/or reduced systemic toxicity, comprising administering to a subject the IFN therapy in the form of an IFN proprotein or pharmaceutical composition as described herein, where the IFN proprotein has one or more protease-cleavable linkers, each comprising one or more substrates for one or more proteases expressed by a tissue for which IFN therapy is desirable and/or intended.
- the foregoing methods permit IFN therapy with reduced off-target side effects by virtue of preferential activation of an IFN proprotein at a locale intended for IFN treatment.
- the IFN proprotein is also targeted and comprises one or more targeting moieties that recognize a target molecule expressed in the locale (e.g., by the tissue) intended for treatment.
- the present disclosure provides a method of targeted delivery of an activated IFN protein to a locale intended for treatment, e.g., cancer tissue, comprising administering to a subject an IFN proprotein or pharmaceutical composition as described herein, wherein the IFN comprises one or more targeting moieties that recognize a target molecule expressed in the locale or by the tissue intended for treatment (e.g., cancer tissue) and which has one or more protease-cleavable linkers, each comprising one or more substrates for one or more proteases expressed by a tissue for which IFN therapy is desirable and/or intended.
- the tissue intended for treatment e.g., cancer tissue
- protease-cleavable linkers each comprising one or more substrates for one or more proteases expressed by a tissue for which IFN therapy is desirable and/or intended.
- the administration is not local to the tissue.
- the administration can be systemic or subcutaneous.
- the cancer is acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adrenocortical carcinoma, anal cancer, appendix cancer, astrocytoma, basal cell carcinoma, brain tumor, bile duct cancer, bladder cancer, bone cancer, breast cancer, bronchial tumor, Burkitt Lymphoma, carcinoma of unknown primary origin, cardiac tumor, cervical cancer, chordoma, chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), chronic myeloproliferative neoplasm, colon cancer, colorectal cancer, craniopharyngioma, cutaneous T- cell lymphoma, ductal carcinoma, embryonal tumor, endometrial cancer, ependymoma, esophageal cancer, esthesioneuroblastoma, fibrous histiocytoma, Ewing sarcoma, eye cancer, germ cell tumor, gallbladder cancer, gas
- the IFN proproteins can be used to enhance an immune response elicited by another agent.
- an IFN proprotein (e.g., an IFN receptor agonist) of the disclosure is administered as an adjunct therapy with an immunogenic agent.
- the immunogenic agent is an adjuvanted or unadjuvanted vaccine.
- the IFN proproteins (e.g., IFN receptor agonists) can thus enhance an antigen-specific immune response elicited by the vaccine.
- the vaccine is a prophylactic or therapeutic cancer vaccine or a prophylactic or therapeutic vaccine against an infectious agent, e.g., a virus, bacteria, or parasite.
- the targeting moiety preferably binds to a mammalian target molecule
- the IFN moiety is preferably derived from a mammalian IFN
- the Fc domains are preferably derived from a mammalian antibody
- the subjects are preferably mammals. More preferably, the mammal is human.
- a Type I interferon (IFN) proprotein comprising
- a second Fc domain associated with the first Fc domain to form an Fc region; wherein at least two of the first linker, second linker, third linker and fourth linker are protease-cleavable linkers (PCLs), optionally wherein the IFN moieties in the IFN proprotein are sterically hindered from binding to an IFN receptor by the Fc domains.
- PCLs protease-cleavable linkers
- the IFN proprotein of embodiment 1 wherein the first and second IFN moieties each comprise an amino acid sequence having at least about 90% sequence identity to (a) full length mature human IFNcd , IFNa2b, IFN
- the IFN proprotein of embodiment 1 wherein the first and second IFN moieties each comprise an amino acid sequence having about 95% sequence identity to (a) full length mature human IFNal , IFNo2b, I FNp, IFNco, I FNE or IFNK or (b) a mature human IFNal, IFNa2b, IFNp, IFNco, IFNE or I FNK having up to a 15-amino acid truncation at its N-terminus and/or its C-terminus.
- the IFN proprotein of embodiment 1 wherein the first and second IFN moieties each comprise an amino acid sequence having about 98% sequence identity to (a) full length mature human IFNal , IFNa2b, I FNp, IFNco, I FNE or IFNK or (b) a mature human IFNal, IFNa2b, IFNp, IFNco, IFNE or I FNK having up to a 15-amino acid truncation at its N-terminus and/or its C-terminus.
- PCLs protease-cleavable linkers
- PCLs protease-cleavable linkers
- NCLs non-cleavable linkers
- the IFN proprotein of any one of embodiments 1 to 37 which further comprises one or more targeting moieties that bind to one or more target molecules.
- the IFN proprotein of embodiment 38 which comprises a first targeting moiety and a second targeting moiety.
- the IFN proprotein of embodiment 40 wherein the first targeting moiety and second targeting moiety are Fabs.
- the IFN proprotein of embodiment 40, wherein the first immunoglobulin constant domain is a CH3 domain.
- the IFN proprotein of embodiment 40, wherein the first immunoglobulin constant domain is a CH1 domain. 50.
- the IFN proprotein of embodiment 50 which comprises the first polypeptide chain, the second polypeptide chain, a third polypeptide chain and a fourth polypeptide chain, wherein:
- the first polypeptide chain comprises:
- a third Fc domain comprising a hinge domain, a CH2 domain and a CH3 domain, wherein the CH3 domain is the first immunoglobulin constant domain;
- a fourth Fc domain comprising a hinge domain, a CH2 domain and a CH3 domain, wherein the CH3 domain is the second immunoglobulin constant domain;
- the third polypeptide chain comprises:
- the IFN proprotein of embodiment 51 wherein the first and third linkers are non- cleavable linkers (NCLs) and the second and fourth linkers are protease-cleavable linkers (PCLs).
- NCLs non- cleavable linkers
- PCLs protease-cleavable linkers
- IFN proprotein of any one of embodiments 1 to 49 which is configured as illustrated in FIG. 1 B, FIG. 2B or FIG. 2E.
- the first polypeptide chain comprises:
- the third polypeptide chain comprises:
- the fourth polypeptide chain comprises:
- the IFN proprotein of embodiment 56 wherein the first and third linkers are non- cleavable linkers (NCLs) and the second and fourth linkers are protease-cleavable linkers (PCLs).
- NCLs non- cleavable linkers
- PCLs protease-cleavable linkers
- the IFN proprotein of embodiment 56 wherein the first and third linkers are protease-cleavable linkers (PCLs) and the second and fourth linkers are non-cleavable linkers (NCLs).
- PCLs protease-cleavable linkers
- NCLs non-cleavable linkers
- the IFN proprotein of embodiment 60 which comprises the first polypeptide chain, the second polypeptide chain, a third polypeptide chain and a fourth polypeptide chain, wherein:
- the first polypeptide chain comprises:
- the third polypeptide chain comprises:
- the fourth polypeptide chain comprises:
- first polypeptide chain is associated with the third polypeptide chain such that the first VH, CH1 , VL and CL form the first targeting moiety and wherein the second polypeptide chain is associated with the fourth polypeptide chain such that the second VH, CH1, VL and CL form the second targeting moiety.
- PCLs protease-cleavable linkers
- the IFN proprotein of embodiment 61 wherein the first and third linkers are non- cleavable linkers (NCLs) and the second and fourth linkers are protease-cleavable linkers (PCLs).
- NCLs non- cleavable linkers
- PCLs protease-cleavable linkers
- the IFN proprotein of any one of embodiments 38 to 61, herein the first targeting moiety and/or second targeting moiety is capable of binding to an extracellular matrix (ECM) antigen, a tumor reactive lymphocyte antigen, a cell surface molecule of tumor or viral lymphocytes, a T-cell antigen (TCA), a checkpoint inhibitor, a tumor-associated antigen (TAA), a dendritic cell (DC) or other antigen-presenting cell (APC) antigen, or a natural killer (NK) cell antigen.
- ECM extracellular matrix
- TAA T-cell antigen
- AAC antigen-presenting cell
- NK natural killer
- the IFN proprotein of any one of embodiments 38 to 66, wherein the first targeting moiety and/or second targeting moiety (a) comprises the (i) CDR or (ii) VH and VL sequences of antibody set forth in Table F or (b) competes with the antibody set forth in Table F for binding to the target molecule. 68.
- ECM antigen which is optionally selected from syndecan, heparanase, integrins, osteopontin, link, cadherins, laminin, laminin type EGF, lectin, fibronectin, notch, nectin (e.g., nectin-4), tenascin, collagen (e.g., collagen type X) and matrixin.
- the IFN proprotein of embodiment 71 wherein the antigen is a T-cell costimulatory protein.
- the IFN proprotein of embodiment 72, wherein the T-cell co-stimulatory protein is CD27, CD28, 4-1 BB (CD137), 0X40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, or B7-H3.
- T-cell co-stimulatory protein is CD27, CD28, 4-1 BB (CD137), 0X40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, or B7-H3.
- IFN proprotein of embodiment 73, wherein the T-cell co-stimulatory protein is B7-H3.
- TAA tumor-associated antigen
- the IFN proprotein of embodiment 80 wherein the first targeting moiety and/or second targeting moiety is capable of binding to AFP, ALK, a BAGE protein, BIRC5 (survivin), BIRC7, p-catenin, brc-abl, BRCA1 , BORIS, CA9, carbonic anhydrase IX, caspase-8, CALR, CEACAM5 (also known as carcinoembryonic antigen or CEA), CCR5, CD19, CD20 (MS4A1), CD22, CD30, CD40, CDK4, CEA, CTLA4, cyclin-B1 , CYP1B1, EGFR, EGFRvlll, ErbB2/Her2, ErbB3, ErbB4, ETV6-AML, EpCAM, EphA2, Fra-1 , FOLR1 , a GAGE protein (e.g., GAGE-1 or - 2), GD2, GD3, GloboH, glypican-3, GM3, g
- IFN proprotein of embodiment 81 wherein the TAA is CEACAM5.
- DC dendritic cell
- the IFN proprotein of embodiment 87, wherein the dendritic cell antigen is DEC- 205.
- NK natural killer
- IFN proprotein of any one of embodiments 1 to 37 which further comprises one or more targeting moieties each comprising means for binding to one or more target molecules.
- the IFN proprotein of embodiment 92 which comprises a first targeting moiety and a second targeting moiety, each comprising means for binding to a target molecule.
- the IFN proprotein of embodiment 93, wherein the first targeting moiety and second targeting moiety are antibodies or antigen-binding fragments thereof.
- the IFN proprotein of embodiment 101 wherein the first immunoglobulin constant domain is a CH3 domain.
- the IFN proprotein of embodiment 101 wherein the first immunoglobulin constant domain is a CH 1 domain.
- the IFN proprotein of embodiment 104 which comprises the first polypeptide chain, the second polypeptide chain, a third polypeptide chain and a fourth polypeptide chain, wherein:
- the first polypeptide chain comprises:
- the third polypeptide chain comprises:
- the fourth polypeptide chain comprises:
- the IFN proprotein of embodiment 105 wherein the first, second, third and fourth linkers are protease-cleavable linkers (PCLs).
- PCLs protease-cleavable linkers
- 107 The IFN proprotein of embodiment 105, wherein the first and third linkers are non-cleavable linkers (NCLs) and the second and fourth linkers are protease-cleavable linkers (PCLs).
- the IFN proprotein of embodiment 105 wherein the first and third linkers are protease-cleavable linkers (PCLs) and the second and fourth linkers are non-cleavable linkers (NCLs).
- PCLs protease-cleavable linkers
- NCLs non-cleavable linkers
- the first polypeptide chain comprises:
- the third polypeptide chain comprises:
- the IFN proprotein of embodiment 110 wherein the first, second, third and fourth linkers are protease-cleavable linkers (PCLs).
- PCLs protease-cleavable linkers
- the IFN proprotein of embodiment 110 wherein the first and third linkers are non-cleavable linkers (NCLs) and the second and fourth linkers are protease-cleavable linkers (PCLs).
- NCLs non-cleavable linkers
- PCLs protease-cleavable linkers
- the IFN proprotein of embodiment 110 wherein the first and third linkers are protease-cleavable linkers (PCLs) and the second and fourth linkers are non-cleavable linkers (NCLs).
- PCLs protease-cleavable linkers
- NCLs non-cleavable linkers
- the IFN proprotein of embodiment 114 which comprises the first polypeptide chain, the second polypeptide chain, a third polypeptide chain and a fourth polypeptide chain, wherein:
- the first polypeptide chain comprises:
- the third polypeptide chain comprises:
- the fourth polypeptide chain comprises:
- the IFN proprotein of embodiment 115 wherein the first, second, third and fourth linkers are protease-cleavable linkers (PCLs).
- PCLs protease-cleavable linkers
- ECM extracellular matrix
- TAA T-cell antigen
- TAA tumor-associated antigen
- DC dendritic cell
- APC antigen-presenting cell
- NK natural killer
- ECM antigen is optionally selected from syndecan, heparanase, integrins, osteopontin, link, cadherins, laminin, laminin type EGF, lectin, fibronectin, notch, nectin (e.g., nectin-4), tenascin, collagen (e.g., collagen type X) and matrixin.
- the IFN proprotein of embodiment 121 wherein the first targeting moiety and/or second targeting moiety comprises means for binding to a nectin, e.g., nectin 4.
- the IFN proprotein of embodiment 121 wherein the first targeting moiety and/or second targeting moiety comprises means for binding to a collagen, e.g., collagen X.
- the T-cell co-stimulatory protein is CD27, CD28, 4-1 BB (CD137), 0X40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, or B7-H3.
- TAA tumor- associated antigen
- the IFN proprotein of embodiment 133 wherein the TAA is AFP, ALK, a BAGE protein, BIRC5 (survivin), BIRC7, -catenin, brc-abl, BRCA1 , BORIS, CA9, carbonic anhydrase IX, caspase-8, CALR, CEACAM5 (also known as carcinoembryonic antigen or CEA), CCR5, CD19, CD20 (MS4A1), CD22, CD30, CD40, CDK4, CEA, CTLA4, cyclin-B1 , CYP1 B1, EGFR, EGFRvlll, ErbB2/Her2, ErbB3, ErbB4, ETV6-AML, EpCAM, EphA2, Fra-1 , FOLR1 , a GAGE protein (e.g., GAGE-1 or -2), GD2, GD3, GloboH, glypican-3, GM3, gp100, Her2, HLA/B-raf, H
- IFN proprotein of embodiment 134 wherein the TAA is EPCAM.
- DC dendritic cell
- the IFN proprotein of embodiment 140, wherein the dendritic cell antigen is DEC-205.
- NK natural killer
- a pharmaceutical composition comprising the IFN proprotein of any one of embodiments 1 to 146 and an excipient.
- a method of treating cancer comprising administering to a subject in need thereof the IFN proprotein of any one of embodiments 1 to 146 or the pharmaceutical composition of embodiment 150.
- the IFN proprotein comprises at least one targeting moiety that is capable of binding to a target molecule.
- the IFN proprotein comprises at least one means for binding a target molecule.
- an activated IFN protein comprising the IFN moiety is produced by cleavage of one or more protease-cleavable linkers in the IFN proprotein by one or more proteases expressed by the cancer tissue.
- the IFN protein is selectively activated in the cancer tissue.
- the IFN proprotein comprises one or more targeting moieties that recognize a target molecule expressed by the tissue.
- the IFN proprotein comprises two targeting moieties that each recognize a target molecule expressed by the tissue.
- the IFN proprotein comprises one or more means for binding a target molecule expressed by the tissue.
- the target molecule expressed by the tissue is an extracellular matrix (ECM) antigen, a tumor reactive lymphocyte antigen, a cell surface molecule of tumor or viral lymphocytes, a T-cell antigen (TCA), a checkpoint inhibitor, a tumor-associated antigen (TAA), a dendritic cell (DC) or other antigen-presenting cell (APC) antigen, or a natural killer (NK) cell antigen.
- ECM extracellular matrix
- TAA T-cell antigen
- AAC antigen-presenting cell
- NK natural killer
- an activated IFN protein comprising the IFN moiety is produced by cleavage of one or more protease-cleavable linkers in the IFN proprotein by one or more proteases in the tissue.
- a method of treating cancer with an IFN protein that is selectively activated in cancer tissue comprising administering to a subject in need thereof an IFN proprotein according to any one of embodiments 1 to 146 (or a pharmaceutical composition comprising the IFN proprotein and an excipient) which has one or more protease-cleavable linkers, each comprising one or more substrates for one or more proteases expressed by cancer tissue to which the IFN protein is targeted.
- the IFN proprotein comprises one or more targeting moieties that recognize a target molecule expressed by the cancer tissue or associated immune cells.
- the IFN proprotein comprises two targeting moieties that each recognize a target molecule expressed by the cancer tissue or associated immune cells.
- the IFN proprotein comprises one or more means for binding a target molecule expressed by the cancer tissue or associated immune cells.
- the IFN proprotein comprises two means for binding a target molecule expressed by the cancer tissue or associated immune cells.
- the target molecule expressed by the cancer tissue or associated immune cells is an extracellular matrix (ECM) antigen, a tumor reactive lymphocyte antigen, a cell surface molecule of tumor or viral lymphocytes, a T-cell antigen (TCA), a checkpoint inhibitor, a tumor-associated antigen (TAA), a dendritic cell (DC) or other antigen-presenting cell (APC) antigen, or a natural killer (NK) cell antigen.
- ECM extracellular matrix
- TAA T-cell antigen
- APC antigen-presenting cell
- NK natural killer
- a method of administering to the subject IFN therapy with reduced systemic exposure and/or reduced systemic toxicity comprising administering to a subject the IFN therapy in the form of an IFN proprotein according to any one of embodiments 1 to 146 (or a pharmaceutical composition comprising the IFN proprotein and an excipient) which has one or more protease-cleavable linkers, each comprising one or more substrates for one or more proteases expressed by a tissue for which IFN therapy is desirable and/or intended.
- the IFN proprotein comprises one or more targeting moieties that recognize a target molecule expressed by the tissue.
- the IFN proprotein comprises two targeting moieties that each recognize a target molecule expressed by the tissue.
- the IFN proprotein comprises one or more means for binding a target molecule expressed by the tissue.
- the target molecule expressed by the tissue is an extracellular matrix (ECM) antigen, a tumor reactive lymphocyte antigen, a cell surface molecule of tumor or viral lymphocytes, a T-cell antigen (TCA), a checkpoint inhibitor, a tumor-associated antigen (TAA), a dendritic cell (DC) or other antigen-presenting cell (APC) antigen, or a natural killer (NK) cell antigen.
- ECM extracellular matrix
- TAA tumor reactive lymphocyte antigen
- DC dendritic cell
- APC antigen-presenting cell
- NK natural killer
- the IFN proprotein comprises one or more targeting moieties that recognize a target molecule expressed by the cancer tissue or associated immune cells.
- the IFN proprotein comprises two targeting moieties that each recognize a target molecule expressed by the cancer tissue or associated immune cells.
- the IFN proprotein comprises one or more means for binding a target molecule expressed by the cancer tissue or associated immune cells.
- a method of targeted delivery of an activated IFN protein to cancer tissue comprising administering to a subject an IFN proprotein according to any one of embodiments 1 to 146 (or a pharmaceutical composition comprising the IFN proprotein and an excipient), wherein the IFN proprotein:
- the target molecule expressed by the cancer tissue or associated immune cells is an extracellular matrix (ECM) antigen, a tumor reactive lymphocyte antigen, a cell surface molecule of tumor or viral lymphocytes, a T- cell antigen (TCA), a checkpoint inhibitor, a tumor-associated antigen (TAA), a dendritic cell (DC) or other antigen-presenting cell (APC) antigen, or a natural killer (NK) cell antigen.
- ECM extracellular matrix
- TAA T- cell antigen
- TAA tumor-associated antigen
- DC dendritic cell
- APC antigen-presenting cell
- NK natural killer
- an activated IFN protein comprising the IFN moiety is produced by cleavage of one or more protease-cleavable linkers in the IFN proprotein by one or more proteases in the cancer tissue.
- a method of locally inducing an immune response in a target tissue comprising administering to a subject an IFN proprotein according to any one of embodiments 1 to 146 (or a pharmaceutical composition comprising the IFN proprotein and an excipient) which has (i) one or more targeting moieties capable of binding a target molecule expressed in the target tissue or (ii) one or more means for binding a target molecule expressed in the target tissue and one or more protease-cleavable linkers, each protease-cleavable linker comprising one or more substrates for one or more proteases expressed in the target tissue.
- an IFN proprotein according to any one of embodiments 1 to 146 (or a pharmaceutical composition comprising the IFN proprotein and an excipient) which has (i) one or more targeting moieties capable of binding a target molecule expressed in the target tissue or (ii) one or more means for binding a target molecule expressed in the target tissue and one or more protease-cleavable linkers, each protea
- the IFN proprotein comprises (i) two targeting moieties that each recognize a target molecule expressed in the target tissue or associated immune cells or (ii) two means for binding a target molecule expressed in the target tissue or associated immune cells.
- the target molecule expressed in the target tissue or associated immune cells is an extracellular matrix (ECM) antigen, a tumor reactive lymphocyte antigen, a cell surface molecule of tumor or viral lymphocytes, a T-cell antigen (TCA), a checkpoint inhibitor, a tumor-associated antigen (TAA), a dendritic cell (DC) or other antigen-presenting cell (APC) antigen, or a natural killer (NK) cell antigen.
- ECM extracellular matrix
- TAA T-cell antigen
- TAA tumor-associated antigen
- DC dendritic cell
- APC antigen-presenting cell
- NK natural killer
- a method of enhancing an immune response against an antigen comprising administering to a subject an immunogenic agent that elicits an immune response against the antigen together with an IFN proprotein (e.g., an IFN receptor agonist) according to any one of claims 1 to 146 (or a pharmaceutical composition comprising the IFN receptor agonist and an excipient) or a nucleic acid encoding such IFN proprotein (e.g., IFN receptor agonist), e.g., as described in Section 6.10.1).
- an IFN proprotein e.g., an IFN receptor agonist
- Table 3 below provides sequences of IFN proprotein and control constructs utilized in the studies described herein.
- Constructs encoding antibody and sterically attenuated IFN fusion proteins were generated in standard mammalian protein expression DNA vectors (pcDNA3.4 or similar) suitable for high yield protein production and containing standard elements such as promoter sequence, polyA sequence, regulatory elements, and resistance genes. Where applicable, sequences were codon-optimized.
- a 29-amino acid signal sequence from murine inactive tyrosine-protein kinase transmembrane receptor ROR1 (mR0R1) was added to the N-termini of the constructs to serve as a signal for secretion. All IFN fusion proteins were expressed as preproteins containing the signal sequence which is cleaved by intracellular processing to produce a mature protein.
- the constructs were expressed in Expi293FTM cells by transient transfection (Thermo Fisher Scientific). Proteins in Expi293F supernatant were purified using the ProteinMaker system (Protein BioSolutions, Gaithersburg, MD) with either HiTrapTM Protein G HP or MabSelect SuRe pcc columns (Cytiva). After single step elution, the proteins were neutralized, dialyzed into a final buffer of phosphate buffered saline (PBS) with 5% glycerol, aliquoted and stored at -80 °C. Samples were further analyzed by SE-UPLC to determine the presence of high or low molecular weight species relative to the species of interest.
- PBS phosphate buffered saline
- protease-cleavable linkers were cleaved enzymatically either by incubating the proprotein constructs with uPA or MMP enzymes.
- uPA cleaved enzymatically either by incubating the proprotein constructs with uPA or MMP enzymes.
- 8 pg of protein constructs were incubated with 100 ng of uPA enzyme in 200 pL volume of uPA buffer (50mM Tris pH8.5, 0.01% (v/v) Tween20) for 20 hours at 37°C.
- MMP buffer 50mM Tris pH7.5,150mM NaCI, 10mMCaCl2, 0.05% Brij35
- the promyeloblast macrophage cell line KG-1 a was transduced with an ISRE-driven luciferase reporter construct and maintained in Iscove’s modified Dulbecco’s medium supplemented with 2mM L-Glutamine/Penicillin/Streptomycin + 20% FBS + 1 pg/ml_ puromycin.
- RPMI1640 media supplemented with 2mM L-Glutamine/Penicillin/Streptomycin + 10% FBS was used as assay medium to prepare cell suspensions and fusion protein dilutions.
- SE-UPLC was conducted to assess the IFN molecules that are linked to Fc domains either on the C-terminus or on the N-terminus.
- the main peak percent area of Fc-IFNa1 was calculated to be 37.43, whereas these percentage values were larger for the Fc-IFNa2b and IFNa2b-Fc, which were calculated to be 57.66 and 56.4, respectively.
- ISRE Interferon-Stimulated Response Element
- Fc-IFNa2b and Fc-IFNa1 were compared to the activity of three IFN variants, IFNa2b, IFNcd , and IFNfB (FIG. 5C).
- IFNa2b the highest level of activity was observed with I FNp and IFNa2b, whereas the activity of IFNcH was relatively weaker.
- Recombinant proteins with Fc fusions displayed an attenuated level of activity compared to the IFN variants. In conclusion, Fc fusion leads to attenuation of interferon signaling relative to free interferon.
- SE-UPLC was conducted to assess mutant IFN molecules that are linked to Fc domains on the C-terminus.
- FIG. 8 illustrates the profiles of three exemplary IFN proprotein constructs: a single hinge IFN construct (FIG. 8A), a double hinge IFN construct (FIG. 8B), and an IFN construct with two Fc domains (FIG. 8C). Whereas the single and double hinge constructs displayed discrete main peaks, the SEC profile of the IFN construct with two Fc domains was less clear. Therefore, subsequent analyses were conducted with single and double hinge IFN constructs and excluded the IFN constructs with two Fc domains.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Cell Biology (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
Abstract
Description
Claims
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202263399040P | 2022-08-18 | 2022-08-18 | |
| US202263383804P | 2022-11-15 | 2022-11-15 | |
| US202363481303P | 2023-01-24 | 2023-01-24 | |
| PCT/US2023/072512 WO2024040247A1 (en) | 2022-08-18 | 2023-08-18 | Interferon proproteins and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP4573110A1 true EP4573110A1 (en) | 2025-06-25 |
Family
ID=87971867
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP23772061.0A Pending EP4573110A1 (en) | 2022-08-18 | 2023-08-18 | Interferon proproteins and uses thereof |
Country Status (7)
| Country | Link |
|---|---|
| EP (1) | EP4573110A1 (en) |
| JP (1) | JP2025529805A (en) |
| KR (1) | KR20250048583A (en) |
| CN (1) | CN120051483A (en) |
| AU (1) | AU2023325400A1 (en) |
| CA (1) | CA3264973A1 (en) |
| WO (1) | WO2024040247A1 (en) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025255508A1 (en) * | 2024-06-07 | 2025-12-11 | Regeneron Pharmaceuticals, Inc. | Engineered alpha klotho polypeptides and uses thereof |
| GB2641580A (en) | 2024-06-07 | 2025-12-10 | T Therapeutics Ltd | Tumour-transforming multispecific proteins |
Family Cites Families (40)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
| US5582996A (en) | 1990-12-04 | 1996-12-10 | The Wistar Institute Of Anatomy & Biology | Bifunctional antibodies and method of preparing same |
| US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
| ES2102007T3 (en) | 1992-01-23 | 1997-07-16 | Merck Patent Gmbh | MONOMER AND DIMER ANTIBODY FRAGMENT FUSION PROTEINS. |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| GB9625640D0 (en) | 1996-12-10 | 1997-01-29 | Celltech Therapeutics Ltd | Biological products |
| US20020062010A1 (en) | 1997-05-02 | 2002-05-23 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| GB9720054D0 (en) | 1997-09-19 | 1997-11-19 | Celltech Therapeutics Ltd | Biological products |
| US6833441B2 (en) | 2001-08-01 | 2004-12-21 | Abmaxis, Inc. | Compositions and methods for generating chimeric heteromultimers |
| GB0315450D0 (en) | 2003-07-01 | 2003-08-06 | Celltech R&D Ltd | Biological products |
| GB0315457D0 (en) | 2003-07-01 | 2003-08-06 | Celltech R&D Ltd | Biological products |
| HUE026278T2 (en) | 2003-07-01 | 2016-05-30 | Ucb Biopharma Sprl | Modified antibody fab fragments |
| US20060024272A1 (en) | 2004-07-29 | 2006-02-02 | Large Scale Biology Corporation | C-terminally truncated interferon |
| CA2577082A1 (en) | 2004-09-02 | 2006-03-16 | Genentech, Inc. | Heteromultimeric molecules |
| CN101198698B (en) | 2005-03-31 | 2014-03-19 | 中外制药株式会社 | Process for production of polypeptide by regulation of assembly |
| JP5208733B2 (en) | 2005-06-29 | 2013-06-12 | イエダ リサーチ アンド デベロップメント カンパニー リミテッド | Recombinant interferon α2 (IFNα2) mutant |
| US11535673B2 (en) | 2007-04-05 | 2022-12-27 | President and Fellows of Harvard CoHege | Chimeric activators: quantitatively designed protein therapeutics and uses thereof |
| CN101868246A (en) | 2007-09-21 | 2010-10-20 | 加利福尼亚大学董事会 | Targeted interferons exhibit potent apoptotic and antitumor activity |
| US9266967B2 (en) | 2007-12-21 | 2016-02-23 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
| EP3663318A1 (en) | 2008-01-07 | 2020-06-10 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2010030671A1 (en) | 2008-09-09 | 2010-03-18 | University Of Medicine And Dentistry Of New Jersey | Type i interferon antagonists |
| LT2975051T (en) | 2009-06-26 | 2021-07-12 | Regeneron Pharmaceuticals, Inc. | EASY-RELEASED BIS-SPECIFIC ANTIBODIES TO NATIVE IMMUNOGLOBULIN |
| US9796788B2 (en) | 2010-02-08 | 2017-10-24 | Regeneron Pharmaceuticals, Inc. | Mice expressing a limited immunoglobulin light chain repertoire |
| WO2013059885A2 (en) | 2011-10-28 | 2013-05-02 | Cephalon Australia Pty Ltd | Polypeptide constructs and uses thereof |
| AU2013211059B8 (en) | 2012-01-20 | 2017-12-21 | Centre Hospitalier Regional Universitaire De Montpellier | Targeted mutant alpha-helical bundle cytokines |
| MX385344B (en) | 2012-11-28 | 2025-03-18 | Zymeworks Bc Inc | GENETICALLY MODIFIED IMMUNOGLOBULIN HEAVY CHAIN-LIGHT CHAIN PAIRS AND THEIR USES. |
| TWI682941B (en) | 2013-02-01 | 2020-01-21 | 美商再生元醫藥公司 | Antibodies comprising chimeric constant domains |
| ES2821753T3 (en) | 2013-03-15 | 2021-04-27 | Lilly Co Eli | Fab and bispecific antibody production procedures |
| US9732135B2 (en) | 2013-07-19 | 2017-08-15 | Vib Vzw | Targeting of human interferon antagonists |
| TWI681969B (en) | 2014-01-23 | 2020-01-11 | 美商再生元醫藥公司 | Human antibodies to pd-1 |
| WO2016161010A2 (en) | 2015-03-30 | 2016-10-06 | Regeneron Pharmaceuticals, Inc. | Heavy chain constant regions with reduced binding to fc gamma receptors |
| AU2016333517B2 (en) | 2015-10-02 | 2023-09-07 | Les Laboratoires Servier | Anti-PD-1 antibodies and compositions |
| ES3034233T3 (en) | 2016-01-22 | 2025-08-14 | MabQuest SA | Non-blocking pd1 specific antibodies |
| US11390676B2 (en) | 2016-10-13 | 2022-07-19 | Symphogen A/S | Anti-LAG-3 antibodies and compositions |
| CN110573172A (en) | 2017-02-06 | 2019-12-13 | 奥里尼斯生物科学有限公司 | Targeted engineered interferon and uses thereof |
| WO2019222294A1 (en) * | 2018-05-14 | 2019-11-21 | Werewolf Therapeutics, Inc. | Activatable cytokine polypeptides and methods of use thereof |
| EP3856229A1 (en) * | 2018-09-28 | 2021-08-04 | Pierre Fabre Medicament | New immunocytokines for the treatment of cancer |
| CN111499718B (en) | 2019-01-30 | 2022-06-14 | 复旦大学 | Human alpha interferon receptor binding related site mutant and application thereof |
| AR117715A1 (en) | 2019-12-17 | 2021-08-25 | Univ Nacional Del Litoral Unl | HYPERGLYCOSILATED INTERFERON WITH REDUCED IMMUNOGENICITY |
| US20230226203A1 (en) * | 2020-06-18 | 2023-07-20 | Proviva Therapeutics (Hong Kong) Limited | Activatable procytokines |
-
2023
- 2023-08-18 WO PCT/US2023/072512 patent/WO2024040247A1/en not_active Ceased
- 2023-08-18 CA CA3264973A patent/CA3264973A1/en active Pending
- 2023-08-18 EP EP23772061.0A patent/EP4573110A1/en active Pending
- 2023-08-18 JP JP2025508865A patent/JP2025529805A/en active Pending
- 2023-08-18 CN CN202380073299.0A patent/CN120051483A/en active Pending
- 2023-08-18 AU AU2023325400A patent/AU2023325400A1/en active Pending
- 2023-08-18 KR KR1020257008494A patent/KR20250048583A/en active Pending
Also Published As
| Publication number | Publication date |
|---|---|
| AU2023325400A1 (en) | 2025-02-27 |
| WO2024040247A1 (en) | 2024-02-22 |
| KR20250048583A (en) | 2025-04-09 |
| CN120051483A (en) | 2025-05-27 |
| CA3264973A1 (en) | 2024-02-22 |
| JP2025529805A (en) | 2025-09-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12522638B2 (en) | IL12 receptor agonists and methods of use thereof | |
| AU2023325402A1 (en) | Interferon receptor agonists and uses thereof | |
| AU2023325400A1 (en) | Interferon proproteins and uses thereof | |
| CA3191454A1 (en) | Fusion protein comprising il-12 and anti-fap antibody, and use thereof | |
| US20250340668A1 (en) | Multispecific binding molecule proproteins and uses thereof | |
| US20230391844A1 (en) | Interleukin-2 proproteins and uses thereof | |
| US20230382969A1 (en) | Interleukin-2 proproteins and uses thereof | |
| HK40126891A (en) | Interferon proproteins and uses thereof | |
| US20240270836A1 (en) | Il12 receptor agonists and methods of use thereof | |
| HK40126890A (en) | Interferon receptor agonists and uses thereof | |
| HK40123893A (en) | Interleukin-2 proproteins and uses thereof | |
| HK40121930A (en) | Interleukin-2 proproteins and uses thereof | |
| HK40116914A (en) | Multispecific binding molecule proproteins and uses thereof | |
| WO2025106469A1 (en) | Engineered heavy chain variable domains and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20250311 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) | ||
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 40128635 Country of ref document: HK |