EP4554577A1 - Novel use - Google Patents

Novel use

Info

Publication number
EP4554577A1
EP4554577A1 EP23744064.9A EP23744064A EP4554577A1 EP 4554577 A1 EP4554577 A1 EP 4554577A1 EP 23744064 A EP23744064 A EP 23744064A EP 4554577 A1 EP4554577 A1 EP 4554577A1
Authority
EP
European Patent Office
Prior art keywords
human
trpm3
inhibitor
use according
treatment
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP23744064.9A
Other languages
German (de)
French (fr)
Inventor
David Hall
Alexander PRESTON
Colin Macphee
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
GlaxoSmithKline Intellectual Property No 3 Ltd
Original Assignee
GlaxoSmithKline Intellectual Property No 3 Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US17/812,299 external-priority patent/US20230220037A1/en
Application filed by GlaxoSmithKline Intellectual Property No 3 Ltd filed Critical GlaxoSmithKline Intellectual Property No 3 Ltd
Publication of EP4554577A1 publication Critical patent/EP4554577A1/en
Pending legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/06Antimigraine agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/40Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
    • A61K31/403Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
    • A61K31/404Indoles, e.g. pindolol
    • A61K31/4045Indole-alkylamines; Amides thereof, e.g. serotonin, melatonin
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • G01N33/6896Neurological disorders, e.g. Alzheimer's disease
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • G01N2500/10Screening for compounds of potential therapeutic value involving cells
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/28Neurological disorders
    • G01N2800/2807Headache; Migraine

Definitions

  • the present disclosure relates to an inhibitor of human TRPM3 for use in the treatment or prevention of migraine or cluster headache in patients whose migraines/headaches are not responsive to CGRP inhibition or whose migraines/headaches are responsive to triptans.
  • the disclosure relates to an inhibitor of human TRPM3 for use in the treatment of medication overuse headache.
  • An inhibitor of human TRPM3 that inhibits the release of PACAP from trigeminal ganglion neurons, and a method for measuring PACAP release are also disclosed.
  • Migraine headaches are a common cause of disability in the United States, affecting approximately 27 million American adults, or 17.1% of women and 5.6% of men.
  • Chronic migraine which affects 3.2 million Americans (2%), is defined as having migraine symptoms for at least 15 days per month, lasting at least 4 hours, and for longer than 3 months in duration. This is in contrast to episodic migraine, which causes symptoms on fewer than 15 days per month.
  • Current treatment for migraine is divided into acute, abortive agents and medications that will prevent migraine onset.
  • Opioid analgesics and triptans are commonly prescribed for migraine. Whilst these types of drugs provide acute relief, regular use can result in increased headache severity, and progression of headache from an episodic to a chronic state. This form of medication overuse headache is difficult to treat and new treatment options are eagerly awaited.
  • Calcitonin gene-related peptide is a peptide that is released by peripheral neurons, including somatosensory neurons of the dorsal root, vagal and trigeminal ganglia where it is reported to act as a neurotransmitter, a vasodilator and as a local mediator of inflammation. Its short half-life (7 mins) normally results in localised effects.
  • CGRP levels are increased in the cranial circulation during migraine and cluster headache attacks, and intravenous administration of CGRP triggers migraine attacks in migraineurs suggesting that it has a prominent role in migraine.
  • PACAP pituitary adenylate cyclase activating polypeptide
  • PACAP has been implicated in spontaneous headache conditions. For example, elevated PACAP-38 levels have been observed during the attack phase in episodic cluster headache patients. It has also been demonstrated to relieve opioid induced hyperalgesia in animal models. For example, Pradhan and colleagues have demonstrated that PACAP blockade reduced periorbital allodynia in a mouse model of opioid induced hyperalgesia, and that PACAP blockade reduced cephalic allodynia in mice treated with combined morphine and nitroglycerin.
  • a PAC1 receptor monoclonal antibody AMG 301 was observed to offer no benefit over placebo for migraine prevention despite inhibiting nociceptive activity in the trigeminocervical complex to the same extent as sumatriptan in preclinical trials.
  • a monoclonal antibody targeting PACAP-38, ALD1910 remains in clinical development for the treatment of migraine patients.
  • the trigeminal ganglion has been examined to detect neuropeptides including calcitonin gene- related peptide (CGRP) and PACAP.
  • CGRP calcitonin gene- related peptide
  • PACAP-38 is present in the trigeminal ganglion, and plasma PACAP-38-like immunoreactivity is increased after electrical stimulation of the trigeminal ganglion.
  • Substance P is a mediator of the sterile inflammation of the dura, which may be a source of migraine pain. Triptans block this dural neurogenic inflammation dose-dependently in an animal model.
  • Substance P (neurokinin-1 receptor) antagonists are also highly effective in animal models of dural inflammation, but no NK-1 antagonist has yet demonstrated any clinical effect in acute migraine.
  • TRPM3 The human TRPM3 gene is comprised of 30 exons and maps to human chromosome 9q- 21.12.
  • TRPM3 isoforms vary from 1184 to 1744 amino acids in length and possess the characteristic six transmembrane domain of the TRP family. However, unlike some other TRPM family members, TRPM3 does not contain an enzyme domain in the C-terminal cytoplasmic region.
  • TRPM3 does not contain an enzyme domain in the C-terminal cytoplasmic region.
  • Several alternative spliced transcript variants encoding different isoforms have been identified in mice and humans. The isoforms appear to have very different physiological roles given that one mouse isoform, Trpm3al preferentially conducts monovalent cation influx, while another, Trpm3a2 strongly favours divalent ion entry. The mouse Trpm3a2 ⁇ om is the best studied.
  • TRPM3 expression is detectable in kidney, brain, ovary, and pancreas. Northern blotting of mouse tissues resulted in strong signals in brain, whereas in kidney no signal could be detected. Within brain subregions in the mouse, the highest levels of expression were found in the cerebellum, choroid plexus, the locus coeruleus, the posterior hypothalamus, and the substantia nigra, using a Trpm5-specific antisense RNA probe yielded a positive Trpm3 hybridization signal in 82% ⁇ 5% of mouse trigeminal neurons. The most abundant isoform in the human dorsal root ganglion as assessed by RNA expression has the UNIPROT ID: Q9HCF6-2.
  • the invention provides an inhibitor of human TRPM3 for use in the treatment or prevention of migraine in a human subject whose migraines are not responsive to CGRP inhibition.
  • the migraines are not responsive to CGRP therapy and are responsive to therapy with a triptan.
  • migraines that are "not responsive to CGRP inhibition” are migraines that are not adequately treated by CGRP inhibition.
  • Migraines that are "responsive to therapy with a triptan” are migraines that are adequately treated by a triptan.
  • the invention provides an inhibitor of human TRPM3 for use in the treatment or prevention of migraine in a human subject whose migraines are responsive to therapy with a triptan.
  • the invention provides an inhibitor of human TRPM3 for use in the treatment or prevention of cluster headache in a human subject whose headaches are not responsive to CGRP inhibition.
  • the headaches are not responsive to CGRP therapy and are responsive to therapy with a triptan.
  • the invention provides an inhibitor of human TRPM3 for use in the treatment of medication overuse headache in a human subject.
  • the invention provides a method for measuring PACAP in a sample comprising incubating a cell line expressing the PAC1 receptor with the sample and measuring cAMP signalling in the cell line.
  • the invention provides a method for identifying an inhibitor of human TRPM3, comprising measuring release of PACAP from dorsal root ganglia or trigeminal ganglia, or from primary cultures of cells isolated from dorsal root ganglia or trigeminal ganglia, following challenge with an agonist of human TRPM3 in the presence or absence of a test inhibitor, wherein the test inhibitor is identified as an inhibitor for human TRPM3 if PACAP production is reduced in the presence of the test inhibitor compared to PACAP production in the absence of the test inhibitor.
  • PACAP production is measured according to the method of the invention.
  • the invention provides (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5- methylisoxazol-3-yl)propenamide or a salt thereof. DESCRIPTION OF DRAWINGS/FIGURES
  • FIGS. 1A and IB demonstrate that TRPM3 agonists, CIM0216 (0.37-10
  • FIG. 1A and IB demonstrate that TRPM3 agonists, CIM0216 (0.37-10
  • the CIM0216 response was inhibited by TRPM
  • FIGS 3A and 3B also show that CGRP responses were inhibited with isosakuranetin (10 ⁇ M).
  • FIG 4 shows a LocusZoom plot for the association between migraine defined using the 'migraine_diagnosis' classification and genetic variants at the TRPM3 locus.
  • the x-axis displays position on chromosome 9 using GRCh37/hgl9 as the human reference genome build.
  • the y-axis is the - logio(p-value) from a logistic regression testing for an association between migraine case-control status and genotype. Plus symbols (+) denote variants for which genotype was imputed; circle symbols (o) denote variants for which genotype calls were used; x symbols (x) denote imputed coding variants; diamond symbols (0) denote genotyped coding variants.
  • the horizontal line represents the genome-wide significance threshold of 5x10 -8 .
  • the credible set track displays the number and location of variants in the 99% credible set, which is likely to contain the causal variant.
  • the gene track displays genes in the locus with thick bars representing exons and thin lines representing introns.
  • PS and CIM0216 dose-dependent release of CGRP observed in WT neurons was lacking in Trpm3 deficient neurons. Capsaicin evoked CGRP release from Trpm3 deficient neurons.
  • FIG. 10A demonstrates that dural administration of TRPM3 agonists, Pregnenolone sulphate (5mM) and CIM0216 (215 ⁇ M), induce mechanical allodynia in the periorbital region of rats.
  • FIG. 11A demonstrates CIM0216 induces a concentration-dependent release of PACAP from trigeminal ganglia cultures and its inhibition by isosakuranetin.
  • FIG 13 shows the agonist activity of the isomers of CIM0216 in a calcium mobilisation assay.
  • R- CIM0126 is (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3-yl)propenamide
  • S- CIM0216 is (S)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3-yl)propenamide.
  • FIG 14A and 14B demonstrates that the TRPM3 agonists, CIM0216 and pregnenolone sulfate, stimulate release of substance P from trigeminal ganglia (TG) neurons in a concentration dependent manner.
  • FIGS 14A and 14B also show that substance P responses were inhibited with isosakuranetin (10 ⁇ M).
  • FIG. 17A and 17C demonstrates the concentration dependent response of pregnenolone sulfate in the presence of 2.5 ⁇ M /?-CIM0216), and
  • FIG. 17B and 17D demonstrates the concentration dependent response of R- CIM0216 in the presence of 25 ⁇ M pregnenolone sulfate.
  • Example 1 demonstrates that a SNP in the human TRPM3 gene, R1670Q shows a strong genetic association with migraine.
  • Example 3 ( Figure 9) shows that the potency of pregnenolone sulfate is 1.8-fold greater at the R1670Q variant than at canonical form, and the maximal fold change in fluorescence in a calcium mobilisation assay was 26% larger. Thus pregnenolone sulfate is more able to activate the TRPM3 variant associated with increased likelihood of migraine diagnosis than the canonical form of the channel.
  • TRPM3 activation is causative of migraine comes from the five-day rat dural infusion migraine model.
  • Historical data in this model using an inflammatory soup (2 mM histamine, bradykinin, serotonin, 0.2 mM prostaglandin E2) infusion shows mechanical nociception sensitivity (Oshinsky & Gomoncharconsiri, (2007).
  • Episodic dural stimulation in awake rats a model for recurrent headache. Headache: The Journal of Head and Face Pain, 47(7), 1026-1036).
  • This sensitivity is alleviated with sumatriptan and anti-CGRP therapies, current standard of care compounds for migraine, suggesting this model has clinical translation.
  • Example 4 shows that Pregnenolone sulphate and CIM0216 (TRPM3 agonists) also trigger mechanical allodynia in the periorbital region When comparing significant differences in sensitivity, both Pregnenolone sulphate and CIM0216 were effective in increasing sensitivity to periorbital von Frey (VF) stimulation as early as Day 5 (after 4 infusions) when compared to vehicle treated animals. In other words, Example 4 provides further evidence of the link between TRPM3 activation and migraine.
  • TRPM3 agonists TRPM3 agonists
  • Example 2 demonstrates that inhibition of human TRPM3 in sensory ganglion, including the trigeminal ganglion, reduces production of the neuropeptides CGRP, PACAP and substance P.
  • These neuropeptides are implicated in the pathogenesis of migraine and therapies inhibiting CGRP, PACAP and substance P (NK1 receptor antagonists) signalling have been developed although as of the date of filing, only CGRP blocking therapies have been approved as migraine therapies.
  • Trpm3 inhibitors have the ability to treat migraine mediated by CGRP, PACAP or substance P. It is known that there are classes of patients for whom the approved CGRP therapies are ineffective. It is believed trpm3 inhibition may be an effective therapeutic in such patients due to the impact of trpm3 inhibition upon PACAP and substance P.
  • Example 5 shows that this patient group is significant, comprising over 10% of migraine patients, and includes patients with and without mutations in trpm3. It is believed that trpm3 inhibition may be an effective therapeutic in patients that are not responsive to PACAP blockade due to the impact of trpm3 inhibition upon CGRP. Given that triptans may mediate their effects on migraine via PACAP and substance P, it is also plausible that trpm3 inhibition may be an effective therapy in a human subject whose migraines are responsive to therapy with triptans.
  • PACAP receptor antagonism has also been demonstrated to relieve opioid induced hyperalgesia in an animal model. Accordingly, the demonstration in the examples that trpm3 inhibition reduces PACAP shows that trpm3 inhibitors are suitable for the treatment of medication overuse headache, including opioid induced hyperalgesia. ..
  • migraine refers to a condition that satisfies the diagnostic criteria for migraine according to the International Classification of Headache Disorders (ICHD) of the HIS. This definition is periodically updated.
  • IBD International Classification of Headache Disorders
  • cluster headache refers to a condition that satisfies the diagnostic criteria for cluster headache according to the International Classification of Headache Disorders (ICHD) of the HIS. This definition is periodically updated.
  • ICHD International Classification of Headache Disorders
  • medication overuse headache refers to a condition that satisfies the diagnostic criteria for medication overuse headache according to the International Classification of Headache Disorders (ICHD) of the HIS. This definition is periodically updated.
  • ICHD International Classification of Headache Disorders
  • Human TRPM3 refers to a protein product of the TRPM3 gene present on chromosome 9q-21.12. Allelic variants including those encoded by SNPs associated with migraine are included within this definition. In addition, the definition covers all isoforms of human TRPM3 that may be generated from any allelic variant.
  • human TRPM3 refers to the hTRPM3 variant having the amino acid sequence set out in any one of sequences set out as: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO.5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17,
  • SEQ ID NO: 18 SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:
  • SEQ ID NO:31 SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36 and
  • SEQ ID NO: 37 or a processed version of any one of SEQ ID Nos. 1-37 lacking the initial methionine residue.
  • human TRPM3 refers to the TRPM3 variant having the amino acid sequence set out in SEQ ID NO: 2, or a processed version of this variant lacking the initial methionine residue.
  • human TRPM3 is a human TRPM3 having one or more mutations compared with the sequences set out in SEQ ID NO: 1 to SEQ ID NO:37.
  • human TRPM3 has an amino acid substitution at one or more of the following positions R1670, A1645, R1457, D602, K774, S1678, Y378, V990 and P1090 (numbering based on SEQ ID NO:2).
  • human TRPM3 has one or more of the following substitutions R1670Q, A1645V, R1457Q, D602V, K774R, S1678F, Y378C, V990M and P1090Q (numbering based on SEQ ID NO:2).
  • substitutions are described in relation to SEQ ID NO: 2, the substitution could occur in any isoform, and the invention is intended to encompass the corresponding variants with amino acid substitutions in each of SEQ ID NO:1 or SEQ ID NOS: 3-37 (or processed forms of these sequences lacking the initial methionine).
  • human TRPM3 is a human TRPM3 having a gain of function mutation.
  • a gain of function is one that results in constitutive activity (Ze., calcium influx in the absence of a stimulus), or increased sensitivity to stimuli (calcium influx at a lower concentration of agonist, or a larger calcium mobilisation at the same agonist concentration) as determined in a calcium mobilisation assay.
  • the human TRPM3 has one or more of the following amino acid substitutions R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2).
  • the human TRPM3 has the amino acid substitution R1670Q (numbering based on SEQ ID NO: 2).
  • nucleotide sequence of human TRPM3 is set out as SEQ ID NO: 38 to 69.
  • human TRPM3 channel encompasses a channel composed of at least one monomer of human TRPM3 as outlined above. The term therefore encompasses heterotetra meric channels formed from mixtures of human TRPM3 variants and homotetrameric channels formed from a single human TRPM3 variant. In one embodiment, the term human TRPM3 channel refers to a homotetrameric channel.
  • An inhibitor of human TRPM3 has one or more of the following properties:
  • Property 1 may be measured in a calcium mobilisation assay.
  • An inhibitor of human TRPM3 reduces fluorescence emissions in a calcium mobilisation assay compared to the negative control (agonist challenge/no inhibitor). In various embodiments, the fluorescence is reduced by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90%. In one embodiment, an inhibitor of human TRPM3 reduces fluorescence by at least as much as a blocking concentration of isosakuranetin ((2S)-5,7-dihydroxy-2-(4-methoxyphenyl)-2,3- dihydrochromen-4-one).
  • Property 2 may be measured in an electrophysiological assay.
  • An inhibitor of human TRPM3 reduces current increases compared to the negative control (agonist/no inhibitor).
  • An inhibitor of human TRPM3 reduces current increases by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90% compared to the negative control. In one embodiment, an inhibitor of human TRPM3 reduces current increases by at least as much as a blocking concentration of isosakuranetin ((2S)-5,7-dihydroxy-2-(4- methoxyphenyl)-2,3-dihydrochromen-4-one).
  • Property 3 may be measured by the CGRP release assay.
  • An inhibitor of human TRPM3 reduces CGRP levels in the media by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90%.
  • an inhibitor of human TRPM3 reduces CGRP levels by at least as much as a blocking concentration of isosakuranetin ((2S)-5,7- dihydroxy-2-(4-methoxyphenyl)-2,3-dihydrochromen-4-one).
  • Property 4 may be measured by the PACAP release assay.
  • An inhibitor of human TRPM3 reduces PACAP levels in the media by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90%.
  • an inhibitor of human TRPM3 reduces PACAP levels by at least as much as a blocking concentration of isosa kuranetin ((2S)- 5,7-dihydroxy-2-(4-methoxyphenyl)-2,3-dihydrochromen-4-one).
  • Property 5 may be measured by the substance P release assay.
  • An inhibitor of human TRPM3 reduces PACAP levels in the media by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90%.
  • an inhibitor of human TRPM3 reduces substance P levels by at least as much as a blocking concentration of isosakuranetin ((2S)-5,7-dihydroxy-2-(4-methoxyphenyl)-2,3-dihydrochromen-4-one).
  • Property 6 is assessed in a suitable model, for example the five-day rat dural infusion migraine model described by Oshinsky et al., supra, using a TRPM3 agonist in place of inflammatory soup.
  • the level of facial allodynia is lower in the presence of an inhibitor of human TRPM3 compared to that observed in the absence of the inhibitor of human TRPM3.
  • the reduction in facial allodynia is measured using von Frey filaments.
  • an inhibitor of human TRPM3 reduces the von Frey threshold on a particular day following infusion by 0.5 g, 1 g, 1.5 g, or 2 g.
  • the reduction is measured from day 0 to day 14 post the completion of infusion.
  • the reduction is measured on day 0, day 3, day 6, day 9 or day 12.
  • any compound capable of promoting calcium ion influx in a cell line expressing human TRPM3 may be used as the agonist.
  • the calcium ion influx is mediated by human TRPM3.
  • the agonist is used at a concentration causing a response between 50% and 80% of the maximal response (i.e. between EC50 - EC80) for the assays used to assess properties 1 to 5.
  • the agonist is pregnenolone sulfate or CIM0216 (racemate of 2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3-yl)-2-phenylacetamide).
  • the agonist is (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3- yl)propenamide.
  • the agonist is (S)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5- methylisoxazol-3-yl)propenamide.
  • Figure 13 shows that (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5- methylisoxazol-3-yl)propenamide is a more potent agonist than the (S)-isomer. Further details of the conduct of these assays are set out in the section entitled "IDENTIFICATION OF INHIBITORS OF HUMAN TRPM3".
  • the invention provides (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5- methylisoxazol-3-yl)propenamide or a salt thereof.
  • the invention provides (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3-yl)propenamide (free base).
  • the nature of an inhibitor of human TRPM3 is not limited, and could be a chemical compound (i.e. a compound), an oligonucleotide, a peptide, a polypeptide, a protein, an antibody or an alternative antibody format.
  • the inhibitor of human TRPM3 is a compound.
  • antibody is used herein in the broadest sense to refer to molecules with an immunoglobulin-like domain (for example IgG, IgM, IgA, IgD or IgE) and includes monoclonal, recombinant, synthetic, polyclonal, chimeric, human, humanised, multispecific antibodies, including bispecific antibodies, and heteroconjugate antibodies; a single variable domain, antigen binding antibody fragments (e.g. Fab, F(ab')2, Fv, disulphide linked Fv, single chain Fv, disulphide-linked scFv, diabodies, TANDABTM, etc.) and modified versions of any of the foregoing.
  • immunoglobulin-like domain for example IgG, IgM, IgA, IgD or IgE
  • domain refers to a folded protein structure which retains its tertiary structure independent of the rest of the protein. Generally, domains are responsible for discrete functional properties of proteins and in many cases may be added, removed or transferred to other proteins without loss of function of the remainder of the protein and/or of the domain.
  • single variable domain refers to a folded polypeptide domain comprising sequences characteristic of antibody variable domains.
  • a single variable domain that is capable of binding an antigen or epitope independently of a different variable region or domain may be referred to as a "domain antibody” or "dAb(TM)".
  • a single variable domain may be a human single variable domain, but also includes single variable domains from other species such as rodent, nurse shark and Camelid VHH dAbsTM.
  • Camelid VHH are immunoglobulin single variable domain polypeptides that are derived from species including camel, llama, alpaca, dromedary, and guanaco, which produce heavy chain antibodies naturally devoid of light chains. Such VHH domains may be humanised according to standard techniques available in the art, and such domains are considered to be "single variable domains". As used herein VH includes camelid VHH domains.
  • Non-immunoglobulin scaffold may be a derived from the group consisting of CTLA-4, lipocalin, Protein A derived molecules such as Z-domain of Protein A (Affibody, SpA), A-domain (Avimer/Maxibody); heat shock proteins such as GroEl and GroES; transferrin (trans-body); ankyrin repeat protein (DARPin); peptide aptamer; C-type lectin domain (Tetranectin); human y-crystallin and human ubiquitin (affilins); PDZ domains; LDL receptor class A domains; EGF domains; scorpion toxin kunitz type domains of human protease inhibitors; and fibronectin/adnectin.
  • Inhibitors of human TRPM3 are known in the art.
  • Inhibitors of human TRPM3 include those disclosed in WO2022112345 and WO2022112352.
  • an inhibitor of human TRPM3 is a compound of formula (I), or a pharmaceutically acceptable salt thereof: wherein:
  • R 1 is selected from the group consisting of: a 4-6 membered saturated heterocyclylic ring, which 4-6 membered heterocyclic ring is optionally substiiuted by one, two or three groups independently selected from oxo, fluoro, C1- 3fluoroalkyl and C 1-3 alkyl, which C 1-3 alkyl group may optionally by substituted by one hydroxy group; and a group of formula -CR 6 R 7 CONH2, wherein R 6 is optionally H or methyl and R 7 is methyl substituted by one hydroxy group or ethyl substituted by one hyroxy group;
  • R 2 is phenyl or a 5-6 membered nitrogen containing heteroaryl ring, which phenyl or 5-6 membered nitrogen containing heteroaryl ring is optionally substituted by one two or three substituents independently selected from the group consisting of halo, cyclopropyl, cyclopropyloxy, methoxy and C 1-3 alkyl, which C 1-3 alkyl group is optionally substituted by one, two or three substitutents selected from fluoro and cyclopropyl; and
  • R 3 is selected from cycloalkyl and methyl, which methyl group is optionally substituted by one, two or three fluoro groups.
  • R 4 and R 5 are independently selected from H, or methyl, which methyl group is optionally substituted with a group consisting of hydroxy, methoxy and N(CH 3 ) 2 .
  • R 1 is a group of formula -CR 6 R 7 CONH 2 , wherein R 6 is optionally H or methyl and R 7 is methyl substituted by one hydroxy group or ethyl substituted by one hydroxy group.
  • R 1 is a group of formula -CH(CH 2 OH)CONH 2 .
  • R 3 is methyl.
  • R 4 and R 5 are each H. In another embodiment, R 4 is H, and R 5 is methyl, which methyl group is optionally substituted with a group consisting of hydroxy and methoxy.
  • the inhibitor of human TRPM3 is a compound selected from the group consisting of: 2-(difluoromethyl)-N-(3,3-difluoropiperidin-4-yl)-5-((4-methylthiazol-5-yl)methoxy)benzofuran-3- carboxamide;
  • Inhibitors include, for example, primidone (5-ethyldihydro-5-phenyl-4,6(lH,5H)-pyrimidinedione), diclofenac, ononetin, econazole, the calmodulin antagonist W-7, the PPARy agonists rosiglitazone, troglitazone and pioglitazone, the flavonoid derivatives disclosed in Straub et al. (Mol Pharmacol, 2013, 84(5):736-50), the fenamate derivates disclosed in Klose et al.. (Br J Pharmacol., 2011, 162(8): 1757-1769), and the TRPM3-specific polyclonal antibody (TM3E3).
  • T3E3 TRPM3-specific polyclonal antibody
  • the inhibitor of human TRPM3 exhibits selectivity for inhibition of human TRPM3 channels in comparison to other TRP channels.
  • the inhibitor of human TRPM3 exhibits selectivity for inhibition of human TRPM3 over one or more of TRPM1, TRPV1, TRPV4 and TRPM8.
  • selectivity can be assessed in binding assays for example, an assay using a labelled ligand, or where the TRP channel also acts to increase intracellular calcium, in a calcium mobilisation assay.
  • the inhibitor of human TRPM3 may be an inhibitor of a mutated version of human TRPM3, such as those disclosed supra, for example a mutated version of human TRPM3 having a gain of function mutation.
  • an inhibitor of a mutated version of human TRPM3 is an inhibitor of the mutated version, and does not require selectivity over the corresponding wild type variant of TRPM3, although selectivity may be required in particular embodiments.
  • the inhibitor of a mutated version of human TRPM3 having a gain of function mutation is an inhibitor that is selective for the mutated version over the corresponding wild type TRPM3 variant.
  • the inhibitor of human TRPM3 exhibits selectivity for the TRPM3 having the sequence set out in SEQ ID NO: 2 (or a processed version of SEQ ID NO:2 lacking the initial methionine residue) over other TRPM3 variants.
  • selectivity for this isoform can be assessed in binding assays or using a calcium mobilisation assay using channels that are homotetrameric for SEQ ID NO:2 (or a processed version of SEQ ID NO:2 lacking the initial methionine residue) and channels that are homotetrameric for the reference TRPM3 variant.
  • the inhibitor of human TRPM3 selectively inhibits the response to a particular stimulus.
  • human TRPM3 is polymodally activated.
  • inhibition is selective to agonism by pregnenolone sulfate over heat.
  • inhibition is selective to agonism by pregnenolone sulfate over other agonists e.g., nifedipine, D-erythrosphingosine, CIM2016).
  • a functional assay such as a calcium mobilisation assay may be used to assess selectivity to particular stimuli.
  • the Kd for human TRPM3 channels or channels homotetrameric for a particular isoform of human TRPM3 is at least 10 fold lower compared to the reference channel. In a more particular embodiment, the Kd for the human TRPM3 channels or channels homotetrameric for a particular isoform of human TRPM3 is at least 100 fold lower compared to the reference channel. In embodiments above in which selectivity is assessed using a calcium mobilisation assay, the IC50 or Kd derived therefrom for human TRPM3 channels or channels homotetrameric for a particular isoform of human TRPM3 is at least 10 fold lower compared to the reference channel.
  • the IC50 or Kd derived therefrom for human TRPM3 channels or channels homotetrameric for a particular isoform of human TRPM3 is at least 100 fold lower compared to the reference channel.
  • the properties that define an inhibitor are determined experimentally in assays. These assays can be used to identify additional inhibitors of human TRPM3.
  • Property 1 is measured using a calcium mobilisation assay in which changes in intracellular calcium ion levels are detected by changes in calcium indicator compounds.
  • an inhibitor of human TRPM3 can be identified by a method comprising: a) contacting a cell line expressing human TRPM3 which cells contain an intracellular calcium indicator with an agonist of human TRPM3 in the presence and absence of a test inhibitor; and b) measuring a change in intracellular calcium concentrations by measuring a change in the intracellular calcium indicator; wherein the test inhibitor is identified as an inhibitor for human TRPM3 if intracellular calcium concentrations are reduced in the presence of the test inhibitor compared to those achieved in the absence of test inhibitor.
  • the intracellular calcium indicator is a synthetic calcium indicator
  • step a) is preceded by a step of loading the cells with the indicator.
  • synthetic calcium indicator compounds are available commercially, for example, the FLUO calcium indicators (Invitrogen).
  • Synthetic calcium indicators may be loaded into cells using methods known in the art.
  • water soluble salts of synthetic calcium indicators may be loaded into cells by well known methods including microinjection, by addition to patch pipette solutions, or by use of pinocytosis, for example using the INFLUX pinocytotic cell loading reagent.
  • Cell permeant AM esters of calcium indicators may be loaded into cells by addition to the media, typically in the presence of a non-ionic detergent such as PLURONIC F-127, and an anion transport inhibitor such as probenecid or sulfinpyrazone, and incubation at 20-37°C for a suitable period of time e.g., between 15 minutes and 4 hours). Following cell loading, cells may be washed and background fluorescence due to indicator leakage could be quenched by addition of, for example, an anti-fluorescein antibody, although this is not essential. Where cell permeant AM esters were used, incubation for a further 30 minutes after loading permits de-esterification of the intracellular AM esters prior to the assay being conducted.
  • a non-ionic detergent such as PLURONIC F-127
  • an anion transport inhibitor such as probenecid or sulfinpyrazone
  • the intracellular calcium indicator is a genetically encoded calcium indicator.
  • genetically encoded calcium indicators include the GCaMPs, pericams, GECOs, camgaroos. Constructs for transfecting cell lines with these genetically encoded calcium indicators are known in the art, for example, the GCaMP6s-P2A-Bsr construct (commercially available as Addgene plasmid # 40753). Clonal cell lines based upon this construct showed bright, uniform cytoplasmic staining. Transient and stable cell line production using this construct is described in Wu eta/., 2019 (2019, Sci Rep, 9: 12692).
  • DNA encoding the genetically encoded calcium indicator is transfected into a cell line expressing human TRPM3 before step a).
  • the cell line is a cell line stably expressing the genetically encoded calcium indicator.
  • calcium mobilisation assays using cells loaded with calcium indicators are well known in the art.
  • the calcium indicator is an indicator whose fluorescence changes in the presence of calcium ions.
  • calcium mobilisation assays involve measuring levels of fluorescence following excitation with an appropriate wavelength for the calcium indicator following the addition of an agonist and inhibitor.
  • the inhibitor may be added to the cells either before (e.g. 60 minutes before) or at the same time as the agonist. Fluoresence may be measured using a fluorescent imaging plate reader (several are commercially available, for example FLIPR TETRA), or by FACS analysis.
  • negative and positive controls and standards are included in each experiment. Negative controls lack agonist, positive controls lack inhibitor and a standard uses a blocking concentration of a known inhibitor, for example, isosakuranetin.
  • an inhibitor of human TRPM3 is a compound that reduces fluorescence emissions compared to the positive control.
  • the fluorescence is reduced by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90%.
  • an inhibitor is a compound that reduces fluorescence by at least as much as a blocking concentration of isosakuranetin.
  • an inhibitor is a compound that reduces fluorescence by at least as much as a saturating concentration of isosakuranetin (i.e. maximal inhibition with isosakuranetin).
  • Property 2 is measured in an electrophysiological assay such as patch clamp or using an automated electrophysiology platform.
  • electrophysiological assays are well known in the art and several automated electrophysiology platforms are available commercially, for example the IONWORKS platforms, PATCHXPRESS, IONFLUX, QPATCH HT/HTX, PATCHLINER and SYNCHROPATCH platforms.
  • an inhibitor of human TRPM3 can be identified by a method comprising measuring the current increases in a cell line expressing human TRPM3 following challenge with an agonist of human TRPM3 in the presence and absence of a test inhibitor, wherein the test inhibitor is identified as an inhibitor for human TRPM3 if the increase in current is reduced in the presence of the test inhibitor compared to the increase achieved in the absence of the test inhibitor.
  • the change in current is measured at a membrane potential of between +/-80mV.
  • the change in current is measured at a membrane potential of -80mV, - 70mV, -60mV, -50mV, -40mV, -30mV, -20mV, -lOmV, OmV, +10mV, +20mV, +30mV, +40mV, +50mV, +60mV, +70mV or +80mV.
  • the change in current is measured at a membrane potential of -80mV.
  • the change in current is measured at a membrane potential of +80mV.
  • mean changes in current are measured.
  • the assays to assess properties 1 and 2 utilise cell lines expressing human TRPM3.
  • Primary or immortalised cell lines endogenously expressing human TRPM3 may be used.
  • the SHSY-5Y cell line may be used.
  • transient and stable cell lines expressing recombinant human TRPM3 may be prepared by conventional means.
  • the invention provides a cell line stably expressing recombinant human TRPM3.
  • TRPM3 variant i SEQ ID NO: 11
  • WO200526317 Further cell lines expressing TRPM3 variants are disclosed in WO200526317.
  • the assays to assess properties 1 and 2 may be conducted using a cell line expressing a recombinant human TRPM3 variant comprising one or more amino acid substitutions at residues selected from the group consisting of R1670, A1645, R1457, D602, K774, S1678, Y378, V990 and P1090 (numbering based on SEQ ID NO:2).
  • the cell line expresses a recombinant human TRPM3 variant having one, two or three of the following substitutions R1670Q, A1645V, R1457Q, D602V, K774R, S1678F, Y378C, V990M and P1090Q (numbering based on SEQ ID NO:2).
  • the cell line expresses a recombinant human TRPM3 variant comprising the amino acid substitution R1670Q (numbering based on SEQ ID NO:2).
  • the assays to assess properties 1 and 2 may be conducted using a cell line expressing recombinant human TRPM3 variant having the sequence set out in SEQ ID NO: 2, a processed version of SEQ ID NO:2 lacking the initial methionine residue, or a variant of SEQ ID NO: 2 or the processed version of SEQ ID NO: 2 comprising one two or three amino acid substitutions compared to the sequence set out in SEQ ID NO:2.
  • cell line expresses recombinant human TRPM3 variant having the sequence set out in SEQ ID NO: 2, a processed version of SEQ ID NO:2 lacking the initial methionine, or a variant of SEQ ID NO: 2 or the processed version of SEQ ID NO: 2 which has one, two or three amino acid substitutions at residues selected from the group consisting of R1670, A1645, R1457, D602, K774, S1678, Y378, V990 and P1090 (numbering based on SEQ ID NO:2).
  • the cell line expresses recombinant human TRPM3 varianthaving the sequence set out in SEQ ID NO: 2, a processed version of SEQ ID NO:2, or a variant of SEQ ID NO: 2 or the processed version of SEQ ID NO: 2 which has one, two or three of the following substitutions R1670Q, A1645V, R1457Q, D602V, K774R, S1678F, Y378C, V990M and P1090Q (numbering based on SEQ ID NO:2).
  • the cell line is formed by transient transfection of DNA encoding the human TRPM3 varianthaving the sequence set out in SEQ ID NO: 2, a processed version of SEQ ID NO:2 lacking the initial methionine, or a variant of SEQ ID NO:2 or the processed version of SEQ ID NO: 2 comprising the amino acid substitution R1670Q.
  • the cell line is formed by transient transfection of DNA encoding the human TRPM3 variant having the sequence set out in SEQ ID NO: 2.
  • the cell line is formed by transient transfection of DNA encoding the human TRPM3 varianthaving the sequence of SEQ ID NO:2 comprising the amino acid substitution R1670Q.
  • the cell line stably expresses the human TRPM3 varianthaving the sequence set out in SEQ ID NO: 2, a processed version of SEQ ID NO:2 lacking the initial methionine or a variant of SEQ ID NO:2 or the processed version of SEQ ID NO: 2 comprising the amino acid substitution R1670Q.
  • the cell line stably expresses the human TRPM3 varianthaving the sequence set out in SEQ ID NO: 2 or a processed version of SEQ ID NO: 2 lacking the initial methionine.
  • the cell line stably expresses the human TRPM3 variant that has the sequence of SEQ ID NO:2 or the processed form of SEQ ID NO:2 lacking the initial methionine, comprising the amino acid substitution R1670Q.
  • the cell line also stably expresses a genetically encoded calcium indicator.
  • the cell line is a human cell line.
  • the assays described above are conducted in this cell line.
  • the cell lines described herein may be used in the identification of an inhibitor of human TRPM3.
  • Property 3 utilises primary cell cultures derived from freshly extracted dorsal root ganglia or trigeminal ganglia from rats or mice, or samples of the brain stem containing the trigeminal nucleus caudalis itself isolated from rats or mice.
  • CGRP is measured in the incubation fluid.
  • the CGRP content of the incubation fluid may be measured by methods known in the art.
  • a suitable enzyme immunoassay kits with a detection threshold of 5 pg/mL is commercially available (Bertin Pharma) which permits the media to be photometrically analyzed.
  • Example 2 exemplifies a suitable assay.
  • TR-FRET time-resolved fluorescence resonance energy transfer
  • the invention provides a method for identifying an inhibitor of human TRPM3, comprising measuring release of PACAP from dorsal root ganglia, trigeminal ganglia or the trigeminal nucleus caudalis, or from primary cultures of cells isolated from dorsal root ganglia or trigeminal ganglia, following challenge with an agonist of human TRPM3 in the presence or absence of a test inhibitor, wherein the test inhibitor is identified as an inhibitor for human TRPM3 if PACAP production is reduced in the presence of the test inhibitor compared to PACAP production in the absence of the test inhibitor.
  • the method uses primary cultures of cells isolated from dorsal root ganglia or trigeminal ganglia (Ze., cells isolated from dorsal root ganglia or trigeminal ganglia and placed into culture). In one embodiment, the method uses primary cultures of cells isolated from trigeminal ganglia. In one embodiment, the method uses primary cultures of cells in multiwell plates. In another embodiment, the method uses samples of the brain stem containing the trigeminal nucleus caudalis.
  • an inhibitor of human TRPM3 reduces PACAP levels by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90%. In one embodiment, an inhibitor of human TRPM3 reduces PACAP levels by at least as much as a blocking concentration of isosakuranetin.
  • Property 5 utilises primary cell cultures derived from freshly extracted dorsal root ganglia or trigeminal ganglia from rats or mice, or samples of the brain stem containing the trigeminal nucleus caudalis itself isolated from rats or mice.
  • Substance P is measured in the incubation fluid.
  • the substance P content of the incubation fluid may be measured by methods known in the art.
  • a suitable ELISA kit is commercially available from Cayman Chemicals.
  • Example 2 exemplifies a suitable assay.
  • Property 6 may be assessed in a suitable animal model, for example the five-day rat dural infusion migraine model described in Example 4.
  • the level of facial allodynia is lower in the presence of an inhibitor of human TRPM3 compared to that observed in the absence of the inhibitor of human TRPM3.
  • the reduction in facial allodynia is measured using von Frey filaments.
  • an inhibitor of humant TRPM3 reduces the von Frey threshold on a particular day following infusion by 0.5 g, 1 g, 1.5 g, or 2 g.
  • the reduction is measured from day 0 to day 14 post the completion of infusion.
  • the reduction is measured on day 0, day 3, day 6, day 9 or day 12.
  • any compound capable of promoting calcium ion influx in a cell line expressing human TRPM3 may be used as the agonist in the assays described supra.
  • the influx is mediated by human TRPM3.
  • the agonist is pregnenolone sulfate or CIM0216 (racemate of 2- (3,4-dihydroquinolin-l(2H)-yl)-/V-(5-methylisoxazol-3-yl)-2-phenylacetamide).
  • pregnenolone sulfate is used at a concentration in the range from 1 to 300 ⁇ M in the assays measuring properties 1-5.
  • pregnenolone sulfate is used at a concentration of about 100 ⁇ M in the assays measuring properties 1-5.
  • CIM0216 is used at a concentration in the range from 0.1 to 30 ⁇ M, more particularly in the range from 6 to 10 ⁇ M in the assays measuring properties 1-5.
  • CIM0216 or the R or S isomers thereof are used at a concentration of about 6 ⁇ M in the assays measuring properties 1-4.
  • CIM0216 or the R or S isomers thereof are used at a concentration of about 10 ⁇ M in the assays measuring properties 1-5.
  • pregnenolone sulfate is used at 5 mM/rat/day or CIM0216 or the R or S isomers thereof are used at 215 ⁇ M/rat/day. In another embodiment, CIM0216 or the R or S isomers thereof are used at a concentration of 215 ⁇ M/rat/day for dural infusion to measure property 6.
  • the invention provides an inhibitor of human TRPM3 as discussed herein for use in the treatment of migraine in a human subject whose migraines are not responsive to CGRP inhibition.
  • treatment of migraine refers to the symptomatic treatment of acute migraine.
  • Migraines may present with or without aura or visual disturbances.
  • the invention provides an inhibitor of human TRPM3 for use in the treatment of migraine with aura or visual disturbances in a human subject whose migraines are not responsive to CGRP inhibition.
  • the invention provides an inhibitor of human TRPM3 for use in the treatment of migraine without aura or visual disturbances in a human subject whose migraines are not responsive to CGRP inhibition.
  • human subjects whose migraines are not responsive to CGRP inhibition is not limited to human subjects that have previously been prescribed a CGRP inhibitor and found it to lack efficacy, and additionally encompasses individuals that have not previously been prescribed a CGRP inhibitor, but, whose migraines would nonetheless not respond to such treatment options.
  • Example 5 suggests that this includes over 10% of all migraineurs.
  • the invention comprises treating human subjects that have previously failed treatment with an antagonist of CGRP. Such patients can be readily by identified by a review of their clinical history. A suitable questionnaire to identify CGRP non responders is given in Example 5.
  • the invention provides an inhibitor of human TRPM3 as discussed herein for use in the treatment of migraine in a human subject whose migraines are responsive to therapy with a triptan.
  • treatment of migraine refers to the symptomatic treatment of acute migraine.
  • Migraines may present with or without aura or visual disturbances.
  • the invention provides an inhibitor of human TRPM3 for use in the treatment of migraine with aura or visual disturbances in a human subject whose migraines are responsive to therapy with a triptan.
  • the invention provides an inhibitor of human TRPM3 for use in the treatment of migraine without aura or visual disturbances in a human subject whose migraines are responsive to therapy with a triptan.
  • human subjects whose migraines are responsive to a triptan is not limited to human subjects that have previously been prescribed and responded to a triptan, but additionally encompasses individuals that have not previously been prescribed a triptan, but, whose migraines would nonetheless respond to such treatment.
  • the invention comprises treating human subjects that have previously been treated with a triptan and self reported a clinical response. Such patients can be readily by identified by a review of their clinical history.
  • the triptan is a triptan selected from the group consisting of: almotriptan, eletriptan, frovatriptan, naratriptan, rizatriptan, sumatriptan and zolmitriptan. In a more particular embodiment, the triptan is sumatriptan.
  • the invention provides an inhibitor of human TRPM3 as discussed herein for use in the treatment of migraine in a human subject whose migraines are not responsive to CGRP inhibition, but are responsive to therapy with a triptan.
  • a therapeutically effective amount of an inhibitor of human TRPM3 is administered to the human subject.
  • therapeutically effective amount refers to the quantity of the inhibitor of human TRPM3 that is required for symptomatic treatment of acute migraine. It may vary depending on the compound, migraine severity and the age and weight of the subject to be treated.
  • treatment of acute symptomatic migraine refers to the situation where the percentage of patients that are pain free 2 hours after administration of the inhibitor of human TRPM3 is higher for a population of patients receiving the inhibitor of human TRPM3 compared to a population of patients receiving placebo.
  • pain free is a patient reported measure.
  • the percentage of patients that are pain free 2 hours after administration of the inhibitor of human TRPM3 is 10% or higher (compared to placebo).
  • treatment of acute symptomatic migraine refers to the situation where the percentage of patients that have no headache pain 2 hours after administration of the inhibitor of human TRPM3 and have no relapse of headache pain within 24 hours after administration of the inhibitor of human TRPM3 is higher compared to a population of patients receiving placebo. Headache pain is a patient reported measure.
  • the percentage of patients that have no headache pain 2 hours after administration of the inhibitor of human TRPM3 and have no relapse of headache pain within 24 hours after administration of the inhibitor of human TRPM3 is 10% or higher (compared to placebo).
  • treatment of acute symptomatic migraine refers to the situation where the percentage of patients that have no headache pain 2 hours after administration of the inhibitor of human TRPM3 and have no relapse of headache pain within 48 hours in a population of patients receiving the the inhibitor of human TRPM3 is higher compared to a population of patients receiving placebo. Again, headache pain is a patient reported measure.
  • the percentage of patients that have no headache pain 2 hours after administration of the inhibitor of human TRPM3 and have no relapse of headache pain within 48 hours after administration of the inhibitor of human TRPM3 is 10% or higher (compared to placebo).
  • the inhibitor of human TRPM3 is administered in combination with at least one other therapeutic agent selected from: a triptan, an ergot, a non-steroidal anti-inflammatory drug, an acetaminophen containing product, a butalbital containing product, an anti-emetic, caffeine, dexamethasone, ubrogepant, rimegepant and lasmiditan.
  • a triptan an ergot
  • a non-steroidal anti-inflammatory drug an acetaminophen containing product
  • a butalbital containing product an anti-emetic
  • caffeine dexamethasone
  • ubrogepant ubrogepant
  • rimegepant and lasmiditan.
  • the inhibitor of human TRPM3 is administered in combination with a triptan selected from the group consisting of: almotriptan, eletriptan, frovatriptan, naratriptan, rizatriptan, sumatriptan and zolmitriptan.
  • a triptan selected from the group consisting of: almotriptan, eletriptan, frovatriptan, naratriptan, rizatriptan, sumatriptan and zolmitriptan.
  • the inhibitor of human TRPM3 is administered in combination with sumatriptan.
  • the inhibitor of human TRPM3 is administered in combination with oral sumatriptan at a maximum dose of 200 mg/day.
  • the inhibitor of human TRPM3 is administered in combination with a non-steroidal anti-inflammatory drug selected from the group consisting of diclofenac, ibuprofen, naproxen and ketorolac.
  • the inhibitor of human TRPM3 is administered in combination with an anti-emetic selected from the group consisting of: promethazine, prochlorperazine, metoclopramide, trimethobenzamide and ondansetron.
  • an anti-emetic selected from the group consisting of: promethazine, prochlorperazine, metoclopramide, trimethobenzamide and ondansetron.
  • the inhibitor of human TRPM3 and any other therapeutic agent(s) may be administered together or separately and, when administered separately, administration may occur simultaneously or sequentially, in any order.
  • the amounts of inhibitor of human TRPM3 of the present invention and the other therapeutic agent(s) and the relative timings of administration will be selected in order to achieve the desired combined therapeutic effect.
  • Simultaneous administration may be achieved by administration of (1) a unitary pharmaceutical composition including the therapeutic agents; or (2) simultaneous administration of separate pharmaceutical compositions each including one of the therapeutic agents.
  • the combination may be administered separately in a sequential manner wherein one treatment agent is administered first and the other second or vice versa. Such sequential administration may be close in time or remote in time.
  • the amounts of the inhibitor of human TRPM3 of the invention and the other therapeutic agent(s) and the relative timings of administration will be selected in order to achieve the desired combined therapeutic effect.
  • the invention provides a method of treating acute symptomatic migraine in a human subject comprising the steps of: a) identifying a a human subject whose migraines are not responsive to CGRP inhibition; and b) administering a therapeutically effective amount of an inhibitor of human TRPM3 as defined herein to the subject; whereby the acute symptomatic migraine in the subject is treated.
  • the invention provides a method of treating acute symptomatic migraine in a human subject comprising the steps of: a) identifying a a human subject whose migraines are responsive to therapy with a triptan; and b) administering a therapeutically effective amount of an inhibitor of human TRPM3 as defined herein to the subject; whereby the acute symptomatic migraine in the subject is treated.
  • the invention provides a method for decreasing the level of PACAP in cranial blood in a subject comprising the steps of: a) identifying a subject with migraine; and b) administering a therapeutically effective amount of an inhibitor of human TRPM3 as defined herein to the subject; whereby the level of PACAP in the cranial blood of the subject is decreased.
  • the invention provides a method for decreasing the level of PACAP in the systemic circulation of a subject comprising the steps of: a) identifying a subject with migraine; and b) administering a therapeutically effective amount of an inhibitor of human TRPM3 as defined herein to the subject; whereby the level of PACAP in the systemic circulation of the subject is decreased.
  • Certain embodiments of the methods for decreasing PACAP may further comprise the steps of: a) making a first measurement of the level of PACAP in a relevant blood sample; b) making a second measurement of the level of PACAP in a relevant blood sample after administering to the subject a therapeutically effective amount of the inhibitor of human TRPM3; and c) comparing the first measurement and second measurement.
  • the subject is a subject that carries a mutated version of human TRPM3 wherein the mutated verion of human TRPM3 has one or more of the following amino acid substitutions: R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2).
  • Certain embodiments of the methods for decreasing the level of PACAP may further comprise the steps of: determining whether the subject carries a mutated version of human TRPM3 wherein the mutated verion of human TRPM3 has one or more of the following amino acid substitutions: R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2). These steps may take place before step (a) in the above methods.
  • the invention provides an inhibitor of human TRPM3 for use in the prevention of migraine in a human subject whose migraines are not responsive to CGRP inhibition. In one embodiment, the invention provides an inhibitor of human TRPM3 for use in the prevention of chronic migraine in a human subject whose migraines are not responsive to CGRP inhibition.
  • human subjects whose migraines are not responsive to CGRP inhibition is not limited to human subjects that have previously been prescribed a CGRP inhibitor and found it to lack efficacy, and additionally encompasses individuals that have not previously been prescribed a CGRP inhibitor, but, whose migraines would nonetheless not respond to such treatment options.
  • Example 5 suggests that this includes over 10% of all migraineurs.
  • the invention comprises treating human subjects that have previously failed treatment with an antagonist of CGRP. Such patients can be readily by identified by a review of their clinical history. A suitable questionnaire to identify CGRP non responders is given in Example 5.
  • the invention provides an inhibitor of human TRPM3 as discussed herein for use in the prevention of migraine in a human subject whose migraines are responsive to therapy with a triptan. In one embodiment, the invention provides an inhibitor of human TRPM3 for use in the prevention of chronic migraine in a human subject whose migraines are responsive to therapy with a triptan.
  • human subjects whose migraines are responsive to a triptan is not limited to human subjects that have previously been prescribed and responded to a triptan, but additionally encompasses individuals that have not previously been prescribed a triptan, but, whose migraines would nonetheless respond to such treatment.
  • the invention comprises treating human subjects that have previously been treated with a triptan and self reported a clinical response. Such patients can be readily by identified by a review of their clinical history.
  • the triptan is a triptan selected from the group consisting of: almotriptan, eletriptan, frovatriptan, naratriptan, rizatriptan, sumatriptan and zolmitriptan. In a more particular embodiment, the triptan is sumatriptan.
  • the invention provides an inhibitor of human TRPM3 as discussed herein for use in the prevention of migraine in a human subject whose migraines are not responsive to CGRP inhibition, but are responsive to therapy with a triptan.
  • a therapeutically effective amount of an inhibitor of human TRPM3 is administered to the human subject.
  • the term "therapeutically effective amount” refers to the quantity of the inhibitor of human TRPM3 that is required for migraine prevention (e.g. prevention of chronic migraine). It may vary depending on the compound, the mean number of migraine days/month, and the age and weight of the subject to be treated.
  • prevention of migraine refers to the situation where the reduction in mean monthly migraine days is greater for a population of patients receiving the inhibitor of TRPM3 compared to placebo.
  • the reduction in mean monthly migraine days in a population of patients receiving the inhibitor of TRPM3 is at least 1, in a further embodiment, at least 2, in a further embodiment, at least 3 and in a further embodiment, at least 4.
  • prevention of migraine refers to the situation where the 50% responder rate is higher for a population of patients receiving the inhibitor of TRPM3 compared to placebo.
  • the 50% responder rate in patients receiving the inhibitor of TRPM3 is 20% higher for a population of patients receiving the inhibitor of TRPM3 compared to placebo. In a further embodiment, the 50% responder rate in patients receiving the inhibitor of TRPM3 is 25% higher for a population of patients receiving the inhibitor of TRPM3 compared to placebo.
  • the invention provides a method of preventing migraine in a human subject comprising the steps of: c) identifying a a human subject whose migraines are not responsive to CGRP inhibition; and d) administering a therapeutically effective amount of an inhibitor of human TRPM3 as defined herein to the subject; whereby migraine is prevented in the subject.
  • the invention provides a method of preventing migraine in a human subject comprising the steps of: c) identifying a a human subject whose migraines are responsive to therapy with a triptan; and d) administering a therapeutically effective amount of an inhibitor of human TRPM3 as defined herein to the subject; whereby migraine is prevented in the subject.
  • the inhibitor of human TRPM3 is administered in combination with at least one other therapeutic agent selected from: botulinum toxin A, a CGRP inhibitor, an anticonvulsant, a 0- blocker, an antidepressant and a non-steroidal anti-inflammatory drug.
  • the inhibitor of human TRPM3 is administered in combination with at least one other therapeutic agent selected from: valproate, divalproex sodium, amitriptyline, topiramate, venlafaxine, metoprolol, propranolol and timolol.
  • the invention provides a method for identifying whether a human subject that has migraines that are not responsive to CGRP inhibition and/or are responsive to triptans is a candidate for treatment with an inhibitor of human TRPM3, comprising: a) sequencing a human TRPM3 gene in the human subject; b) comparing the sequence with the sequences of the human TRPM3 exons set out in SEQ ID NOs: 38-69 and identifying whether changes would modify the amino acid sequence of any isoform; wherein, if a change in amino acid sequence is identified, the human subject is a candidate for treatment with an inhibitor of human TRPM3.
  • the human subject has migraines that are not responsive to CGRP inhibition.
  • the human subject has migraines that are responsive to a triptan.
  • the human subject has migraines that are not responsive to CGRP inhibition and that are responsive to a triptan.
  • the changes to the amino acid sequence are selected the group consisting of: R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2). In one embodiment, the change to the amino acid sequence is R1670Q (numbering based on SEQ ID NO: 2).
  • the treatment will be acute symptomatic treatment of migraine. In another embodiment, the treatment will be for the prevention of migraine.
  • the invention provides an inhibitor of human TRPM3 for use in the treatment or prevention of migraine in a candidate for treatment with an inhibitor of human TRPM3.
  • the invention also provides use of an inhibitor of human TRPM3 for use in the manufacture of a medicament for use in the treatment or prevention of migraine in a candidate for treatment with an inhibitor of human TRPM3.
  • the invention also provides a method for treating or preventing migraine in a patient in need thereof, comprising administering an inhibitor of human TRPM3 to a human subject that is identified as a candidate for treatment with an inhibitor of human TRPM3.
  • the invention provides a method for migraine prevention, which comprises the following steps: a) sequencing the human TRPM3 gene in a human subject whose migraines are not responsive to CGRP inhibition and/or responsive to triptans to obtain a sequence; b) comparing the sequence with the sequences of the human TRPM3 exons set out in SEQ ID NOs: 38-69 and identifying whether changes would modify the amino acid sequence of any isoform wherein, if a change in amino acid sequence is identified, the human subject is a candidate for treatment with an inhibitor of human TRPM3; c) administering to the human subject that is a candidate for treatment with an inhibitor of human TRPM3 a therapeutically effective amount of an inhibitor of human TRPM3.
  • the human subject has migraines that are not responsive to CGRP inhibition.
  • the human subject has migraines that are responsive to triptans.
  • the changes to the amino acid sequence are selected the group consisting of: R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2). In one embodiment, the change to the amino acid sequence is R1670Q (numbering based on SEQ ID NO: 2).
  • the inhibitor of human TRPM3 and any other therapeutic agent(s) may be administered together or separately and, when administered separately, administration may occur simultaneously or sequentially, in any order.
  • the amounts of inhibitor of human TRPM3 of the present invention and the other therapeutic agent(s) and the relative timings of administration will be selected in order to achieve the desired combined therapeutic effect.
  • Simultaneous administration may be achieved by administration of (1) a unitary pharmaceutical composition including the therapeutic agents; or (2) simultaneous administration of separate pharmaceutical compositions each including one of the therapeutic agents.
  • the combination may be administered separately in a sequential manner wherein one treatment agent is administered first and the other second or vice versa. Such sequential administration may be close in time or remote in time.
  • the amounts of the inhibitor of human TRPM3 of the invention and the other therapeutic agent(s) and the relative timings of administration will be selected in order to achieve the desired combined therapeutic effect.
  • the invention provides an inhibitor of human TRPM3 for use in the treatment or prevention of cluster headache in a human subject whose headaches are not responsive to CGRP inhibition and/or are responsive to therapy with a triptan.
  • human subjects whose headaches are not responsive to CGRP inhibition is not limited to human subjects that have previously been prescribed a CGRP inhibitor and found it to lack efficacy, and additionally encompasses individuals that have not previously been prescribed a CGRP inhibitor, but, whose headaches would nonetheless not respond to such treatment options.
  • the invention comprises treating human subjects that have previously failed treatment with an antagonist of CGRP. Such patients can be readily identified by a review of their clinical history.
  • human subjects whose headaches are responsive to therapy with a triptan is not limited to human subjects that have previously been prescribed and responded to a triptan, but additionally encompasses individuals that have not previously been prescribed a triptan, but, whose headaches would nonetheless respond to such treatment.
  • the invention comprises treating human subjects that have previously been treated with a triptan and self reported a clinical response. Such patients can be readily by identified by a review of their clinical history.
  • the headaches are not responsive to CGRP therapy and are responsive to therapy with a triptan.
  • the triptan is a triptan selected from the group consisting of: almotriptan, eletriptan, frovatriptan, naratriptan, rizatriptan, sumatriptan and zolmitriptan. In a more particular embodiment, the triptan is sumatriptan.
  • the inhibitor of human TRPM3 is for use in the treatment of cluster headache. In another embodiment, the inhibitor of human TRPM3 is for use in the prevention of cluster headache.
  • the human subject has a TRPM3 allele with a gain of function mutation.
  • the mutated version of human TRPM3 has one or more of the following amino acid substitutions is R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2).
  • the invention provides an inhibitor of human TRPM3 for use in the treatment of medication overuse headache in a human subject.
  • the medication overuse headache is opioid induced medication overuse headache. This condition may alternatively be referred to as opioid induced hyperalgesia.
  • the opioid induced medication overuse headache/opioid induced hyperalgesia is induced by opioids acting at the the mu opioid receptor.
  • the medication overuse headache is triptan induced medication overuse headache.
  • the triptan is sumatriptan.
  • the human subject has a TRPM3 allele with a gain of function mutation.
  • the mutated version of human TRPM3 has one or more of the following amino acid substitutions is R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2).
  • an inhibitor of human TRPM3 may be administered by any convenient route.
  • the inhibitor of human TRPM3 may be administered by orally, parenterally, intranasally or by inhalation.
  • the inhibitor of human TRPM3 is administered in a pharmaceutical composition.
  • the inhibitor of human TRPM3 is formulated in a pharmaceutical composition adapted for oral or parenteral administration, or for administration intranasally or by inhalation. Appropriate doses will readily be appreciated by those skilled in the art.
  • the invention provides a pharmaceutical composition comprising an inhibitor of human TRPM3 and a pharmaceutically acceptable excipient. According to another aspect, the invention provides a process for the preparation of a pharmaceutical composition comprising admixing an inhibitor of human TRPM3 with a pharmaceutically acceptable excipient.
  • compositions adapted for oral administration may be presented as discrete units such as capsules or tablets; powders or granules; solutions or suspensions in aqueous or non-aqueous liquids; edible foams or whips; or oil-in-water liquid emulsions or water-in-oil liquid emulsions.
  • compositions adapted for nasal administration can comprise a coarse powder having a particle size for example in the range 20 to 500 microns which is administered in the manner in which snuff is taken, i.e., by rapid inhalation through the nasal passage from a container of the powder held close up to the nose.
  • suitable formulations wherein the carrier is a liquid, for administration as a nasal spray or as nasal drops, include aqueous or oil solutions of the inhibitor of human TRPM3.
  • Pharmaceutical formulations adapted for administration by inhalation include fine particle dusts or mists, which may be generated by means of various types of metered, dose pressurized aerosols, nebulizers or insufflators.
  • compositions adapted for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and nonaqueous sterile suspensions which may include suspending agents and thickening agents.
  • the formulations may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use.
  • Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets.
  • formulations described herein may include other agents conventional in the art having regard to the type of formulation in question, for example those suitable for oral administration may include flavouring agents.
  • the present disclosure also provides unitary pharmaceutical compositions in which the inhibitor of human TRPM3 one or more other therapeutic agent(s) may be administered together.
  • the dose of each therapeutic agent may differ from the dose of that therapeutic agent when used alone.
  • the disclosure provides a pharmaceutical composition
  • a pharmaceutical composition comprising an inhibitor of human TRPM3, at least one other therapeutic agent selected from: a triptan, an ergot, a nonsteroidal anti-inflammatory drug, an acetaminophen containing product, a butalbital containing product, an anti-emetic, caffeine, dexamethasone, ubrogepant and lasmiditan, and a pharmaceutically acceptable excipient.
  • the pharmaceutical composition comprises an inhibitor of human TRPM3, a triptan selected from the group consisting of: almotriptan, eletriptan, frovatriptan, naratriptan, rizatriptan, sumatriptan and zolmitriptan and a pharmaceutically acceptable excipient.
  • the pharmaceutical composition comprises an inhibitor of human TRPM3, sumatriptan and a pharmaceutically acceptable excipient.
  • the pharmaceutical composition comprises an inhibitor of human TRPM3, a non-steroidal anti-inflammatory drug selected from the group consisting of diclofenac, ibuprofen, naproxen and ketorolac and a pharmaceutically acceptable excipient.
  • the pharmaceutical composition comprises an inhibitor of human TRPM3, an anti-emetic selected from the group consisting of: promethazine, prochlorperazine, metoclopramide, trimethobenzamide and ondansetron and a pharmaceutically acceptable excipient.
  • the pharmaceutical composition comprises an inhibitor of human TRPM3, at least one other therapeutic agent selected from: botulinum toxin A, a CGRP inhibitor, an anticonvulsant, a ⁇ -blocker, an antidepressant and a non-steroidal anti-inflammatory drug, and a pharmaceutically acceptable excipient.
  • the pharmaceutical composition comprises an inhibitor of human TRPM3, at least one other therapeutic agent selected from: valproate, divalproex sodium, amitriptyline, topiramate, venlafaxine, metoprolol, propranolol and timolol, and a pharmaceutically acceptable excipient.
  • the pharmaceutical composition comprises an inhibitor of human TRPM3, at least one other therapeutic agent selected from: carbamazepine and oxcarbazepine, and a pharmaceutically acceptable excipient.
  • GWAS Genome wide association study
  • association test results for the genotyped and the imputed SNPs.
  • For tests using imputed data we use the imputed dosages rather than best-guess genotypes.
  • the association test P value was computed using a likelihood ratio test, which in our experience is better behaved than a Wald test on the regression coefficient.
  • Genotyping and SNP Imputation DNA extraction and genotyping were performed on saliva samples by CLIA-certified and CAP- accredited clinical laboratories of Laboratory Corporation of America. Samples were genotyped on one of five genotyping platforms.
  • the VI and V2 platforms were variants of the Illumina HumanHap550 + BeadChip and contained a total of about 560,000 SNPs, including about 25,000 custom SNPs selected by 23andMe.
  • the V3 platform was based on the Illumina OmniExpress + BeadChip and contained a total of about 950,000 SNPs and custom content to improve the overlap with our V2 array.
  • the V4 platform is a fully custom array and includes a lower redundancy subset of V2 and V3 SNPs with additional coverage of lower-frequency coding variation, and about 570,000 SNPs.
  • the V5 platform in current use, is an Illumina Infinium Global Screening Array of about 640,000 SNPs supplemented with about 50,000 SNPs of custom content. Samples that failed to reach 98.5% call rate were re-analyzed. Individuals whose analyses failed repeatedly were re-contacted by 23andMe customer service to provide additional samples, as is done for all 23andMe customers.
  • Variants were imputed using two separate imputation reference panels. One included a larger number of samples, but did not include insertion or deletion variants. The other included a smaller number of individuals, but included insertion and deletion variants.
  • Phased participant data was generated using an internally-developed tool based on Beagle (Browning, S.R. & Browning, B.L., Rapid and accurate Haplotype Phasing and Missing Data Interference for Whole Genome Association Studies Using Localized Haplotype Clustering, Am. J. Hum. Genet., 81: 1084-1097 (2007)) or a new phasing algorithm, Eagle2 (Loh, P.r. et a.
  • Figure 4 is a regional association plot for migraine diagnosis on chromosome 9 where the x- axis shows physical positions on human genome build GRCh37/hgl9 and the y-axes shows the -loglO of the p-value for association with migraine diagnosis. Each point in the depicted plots represents a genetic variant tested for association in the region. The grey horizontal line represents the genome wide significance threshold of 5xl0 -8 . Human genes in the region are depicted on the lower panel. These GWAS data indicate that the locus (genetic region) shown is implicated in susceptibility to migraine diagnosis in humans. In Figure 4, the trait analyzed was "migraine diagnosis” where "the cases” are individuals with a migraine diagnosis and "the controls" are individuals who did not have a migraine diagnosis.
  • a common genetic variant changing the amino acid sequence of the TRPM3 protein was found to be the lead SNP for this locus.
  • This variant rs6560142 (dbSNP build 154 identifier) is located on chromosome 9 at position 73150984 (of the human genome build GRCh37/hgl9) and the observed frequency of the migraine diagnosis risk allele "T” is 0.56 in the research participant population with predominantly European ancestry (the protective allele "C” has a frequency of 0.44).
  • This variant can also be described at the amino acid level in TRPM3, for example: Argl670Gln, (numbering based on SEQ ID NO: 2).
  • the GWAS analysis identified the rs6560142 missense SNP in the TRPM3 coding region as the SNP in this locus with the lowest P value. Consequently, these data imply that TRPM3 has the highest probability of being the gene that is functionally responsible for the association between this locus and migraine diagnosis. Therefore, these novel GWAS data indicates that the TRPM3 protein and its functions contribute to migraine pathophysiology in humans.
  • DRG and TG were then incubated with 1 mg/ml trypsin solution (Sigma-Aldrich) for 30 - 45 min.
  • Digested ganglia were mechanically dissociated by trituration with a 1 ml pipette.
  • Dissociated DRG were centrifuged at 200g for 5 min. The cell pellet was resuspended in L15 culture media and plated onto poly-D Lysine 96 well plates (Greiner bio-one) coated with 10 ⁇ g/ml laminin (Sigma-Aldrich) and cultured at 37 °C, 5% CO2.
  • Dissociated TG were passed through a 70 ⁇ m cell strainer and overlaid onto 4% (w/v) BSA. Cells were collected after centrifugation and plated onto poly-D Lysine-laminin coated 96 well plates and cultured at 37°C, 5% CO 2 .
  • CGRP and PACAP release experiments were conducted after 17-24 h in culture.
  • TRPM3 agonist either CIM0216 or pregnenolone sulfate (PS) for 30 min at 37°C.
  • TRPM3 inhibitor isosa kuranetin for 30 min prior to addition of agonist.
  • conditioned medium was collected for the detection of CGRP, PACAP and substance P.
  • PACAP concentrations in conditioned medium collected from TG and DRG neuron cultures were determined indirectly.
  • Conditioned medium was incubated with Chinese Hamster Ovary cells expressing the pituitary adenylate cyclase-activating polypeptide type I (PAC1) receptor (generated in house).
  • PAC1 receptor pituitary adenylate cyclase-activating polypeptide type I (PAC1) receptor (generated in house).
  • PAC1 receptor pituitary adenylate cyclase-activating polypeptide type I
  • Binding of PACAP to the PAC1 receptor induced cAMP production was measured using a homogeneous time-resolved fluorescence resonance energy transfer (TR-FRET) immunoassay (Perkin Elmer).
  • TR-FRET time-resolved fluorescence resonance energy transfer
  • Substance P concentrations in conditioned media collected from TG neuron cultures were determined using an ELISA (Cayman Chemicals).
  • TRPM3 neuropeptide release
  • CIM0216 induced a concentration dependent release of CGRP from DRG (Fig. 1A and B) and TG (Fig. 3A) neurons.
  • DRG and TG cultures were also responsive to pregnenolone sulfate, resulting in an increased release of CGRP; while a single concentration of PS (100 ⁇ M) was tested in DRG cultures (Fig. 1A), the response was demonstrated to be concentration dependent in TG cultures (Fig. 3B).
  • TRPM3 inhibitor isosakuranetin to antagonise CGRP release induced by CIM0216 and PS was evaluated.
  • Pre-incubation with isosakuranetin inhibited the response to both agonists in DRG (Fig. 1A, B and C), and TG neuron cultures (Fig. 3A, B and C).
  • TRPM3 activation in DRG neurons with either 6 ⁇ M or 10 ⁇ M CIM0216 (Fig. 2A, 2B respectively) was antagonised by isosakuranetin in a concentration dependent manner, resulting in reduced release of CGRP.
  • isosakuranetin 10 ⁇ M, reduced the release of CGRP to basal levels or below in the presence of 6 ⁇ M CIM0216 (Fig 2A) or 100 ⁇ M PS (Fig. 1A) in DRG cultures, or in the presence of CIM0216 ( ⁇ 100 ⁇ M) or PS ( ⁇ 100 ⁇ M) in TG cultures (Fig. 3A and B).
  • FIG. 11A CIM0216 induced a concentration-dependent release of PACAP from rat TG cells
  • FIG. 11B demonstrates concentration-dependent inhibition of the CIM0216 response by TRPM3 antagonist, isosakuranetin.
  • Figure 12 shows activation of TRPM3 results in the release of PACAP from mouse isolated DRG (Fig.l2A, 12B) and TG cells (Fig. 12C, 12D). These responses were absent from Trpm3 knock out (KO) mouse cells and inhibited by the TRPM3 antagonist isosakuranetin (Fig. 12 A-D).
  • Cells derived from Trpm3 knockout (Fig. 12, A-D) animals were still responsive to the TRPV1 agonist, capsaicin, showing that PACAP release to stimuli of other TRP channels is maintained.
  • Calcium mobilisation assays were performed in HEK MSR II cells loaded with the calcium indicator dye Fluo4.
  • the cells were induced to express TRPM3 (SEQ ID NO: 2) or mutants thereof by transducing them with Bacmam virus containing the codon optimised cDNA sequence for the required TRPM3 variant at a multiplicity of infection of approximately 40 for 48 hours prior to the experiment.
  • Cells were incubated in the presence of FLUO4-AM and TRPM3 inhibitors for approx 1.5 hrs prior to transfer to a FLIPR where the cells were treated with TRPM3 agonists to induce calcium mobilisation. Fluo4 fluorescence was monitored for 10 min. As a positive control the cells were then treated with the calcium ionophore ionomycin and the fluorescence monitored for a further 3 min.
  • Figures 5, 6, 7 show results in calcium mobilisation assays using pregnenelone sulfate (Figs 5 and 7) and CIM0216 (Fig 6) as TRPM3 agonists, and isosakuranetin as a TRPM3 inhibitor.
  • Figure 9 shows pregnenolone sulfate induced concentration-dependent increases in FLUO4 fluorescence in cells expressing canonical TRPM3 (SEQ NO: 2) and a variant of SEQID NO: 2 having the R1670Q mutation.
  • SEQ NO: 2 canonical TRPM3
  • SEQID NO: 2 having the R1670Q mutation.
  • the potency of pregnenolone sulfate was 1.8-fold greater at the R1670Q variant than at canonical and the maximal fold change in fluorescence was 26% larger.
  • pregnenolone sulfate is more able to activate the TRPM3 variant associated with increased likelihood of migraine diagnosis than the canonical form of the channel.
  • the five-day rat Dural infusion migraine model is based on repeated inflammatory dural stimulation to mimic the repeated activation of dural afferents believed to occur in patients with recurrent migraine headache.
  • rats are tested in the periorbital region for mechanical allodynia (a pain response to stimuli which are not normally painful) using von Frey fibres, which are small calibrated fibres which deliver a calibrated amount of force.
  • von Frey fibres which are small calibrated fibres which deliver a calibrated amount of force.
  • Historical data in this model shows mechanical nociception sensitivity, which is alleviated with sumatriptan and anti-CGRP therapies, current standard of care compounds, suggesting this model has clinical translation.
  • a custom flange guide cannula (22GA, Plastics One) was inserted into the hole (cut 0.5 mm below pedestal). The cannula was fixed to the bone with small screws and dental cement. A dummy that extended just past the end of the cannula was inserted to prevent scar tissue from forming, and thus clogging the cannula. Animals were allowed 1-2 weeks of recovery before testing and infusions began.
  • Periorbital thresholds were monitored during the recovery period to ensure the thresholds returned to pre-surgery baselines. If animals did not return to baseline, they were excluded from the study. Extra animals were included to account for any post-surgery animal that needed to be excluded.
  • mice were infused supra-durally with treatments according to Table 1 for 5 consecutive days.
  • the animal's nose was place in the nose cone of the anaesthesia machine.
  • the base of the flange cannula was clasped, and the dummy cannula was removed.
  • a custom cannula injector was inserted into the flange cannula.
  • Animals were randomly assigned to a treatment group (A-C) using a software generated randomization scheme. From the first day of sensitization, each animal was tested routinely (every 2- 3 days) for changes in periorbital sensitivity by a blinded investigator.
  • Pre-infusion sensory testing occurred on Day 1 of the testing schedule to provide a point of comparison for subsequent testing.
  • Sensory testing occurred according to the testing schedule established in Table 1, and prior to infusion when applicable.
  • Sensory testing utilized von Frey filaments with reproducible calibrated buckling forces varying from 0.4 - 10g utilizing the Chaplan up and down method. Allodynia was tested by perpendicularly touching the periorbital region causing slight buckling of the filament for approximately 5 seconds. Based on the response pattern and the force of the final filament, the periorbital threshold (g) was calculated (Chaplan et al., 1994, Quantitative assessment of tactile allodynia in the rat paw. Journal of neuroscience methods, 53(1), 55-63).
  • the supra-dural infusions were above the dura in the right brain hemisphere; therefore, the right periorbital threshold data only was recorded.
  • a positive response was characterized by several behavioural criteria: stroking the face with a forepaw, head withdrawal from the stimulus, and head shaking.
  • TRPM3 agonists when administered durally for five days evoked an allodynic response to von Frey filaments in rats.
  • Rats treated with the TRPM3 agonists at lower thresholds than in vehicle treated rats (Figure 10A). This was sustained and did not return to baseline levels for the duration of the experiment (19 days). Animals showed no overt, lasting adverse effects to the agonists and were feeding and grooming normally. This can be seen in Figure 10B as TRPM3 agonist treated groups increase in body weight with the same trend as vehicle treated animals.
  • Sensitivity to non-noxious stimuli is referred to as allodynia and has been shown as a potential clinical correlate in migraine patients.
  • Patients with chronic or transformed migraine exhibit facial allodynia even on days when they do not have a headache (Cooke et al., (2007). Cutaneous allodynia in transformed migraine patients. Headache: The Journal of Head and Face Pain, 47(4), 531-539).
  • Example 4 is evidence that repeated activation by TRPM3 agonists can induce sensitisation in the rodent to a mechanical stimulus, that is similar to a pain assessment used in migraine patients.
  • Example 5 Patient Population (Non-Responders to CGRP Treatment)
  • response was one of the following: 'Slightly', 'moderately', 'very', 'extremely'
  • TRPM3 status Individuals were then stratified by TRPM3 status. The number of 'migraine high-risk' alleles in each individual (corresponding to the coding variant for 1670Gln) was scored as 0, 1 or 2 depending on allele dosage. Data were compiled in a pivot table, with aggregate data of CGRP responders stratified by TRPM3 status.
  • Example 5 is evidence that a population exists that does not respond to CGRP antagonism medication. These individuals could be a target population for a TRPM3 blocker therapy. Of the identified population, 50/58 have at least one migraine high-risk allele, suggesting a higher likelihood of responding to anti-TRPM3 migraine therapy.
  • TNC Trigeminal nucleus caudalis
  • the left and right TNC halves were separated using a scalpel and individual TNC halves were transferred to separate wells of a 48 well tissue culture plate containing 250 ⁇ L of L-15 Medium, GLUTAMAX containing 18 mM NaHCO 3 , 38 mM glucose (L15 assay buffer).
  • TNCs were washed 5 times in L15 assay buffer replacing the assay buffer every 5 min at room temperature, and then a further 5 times in a humidified incubator at 37°C, 5% CO2.
  • each TNC tissue was incubated sequentially with vehicle, and then TRPM3 agonist, either pregnenolone sulfate (PS) or R-CIM0216 (CIM0216*) or both combined, at increasing concentrations each for 10 mins at 37°C.
  • TRPM3 agonist either pregnenolone sulfate (PS) or R-CIM0216 (CIM0216*) or both combined, at increasing concentrations each for 10 mins at 37°C.
  • tissues were incubated with isosakuranetin for 10 mins following vehicle but prior to addition of agonist, and maintained in the presence of increasing agonist concentrations.
  • conditioned medium was collected to a 96 well polypropylene plate containing BSA on ice, such that the final BSA concentration is 1%, and any remaining liquid in the tissue well discarded prior to the next agonists/ antagonist addition.
  • the responsiveness of each tissue was verified by the addition of capsaicin (l ⁇ M) and/or KCI (40mM or 60mM) and measuring the neuropeptides released over 10 mins. In some experiments the treatment periods were 15 mins.
  • CGRP CGRP CGRP ELISA kit
  • Levels of CGRP were quantitated using a rat CGRP ELISA kit (Bertin Bioreagent, Cat. No. #A05482) according to manufacturer's instructions.
  • Levels of Substance P were quantitated using a Substance P ELISA kit (Cayman Chemical, Cat. number #583751). There is 100% sequence identity between rat and mouse CGRP, and between rat and mouse Substance P.
  • TNCs were incubated with TRPM3 agonists pregnenolone sulfate, R-CIM0216 (CIM0216*), or both combined, in the presence and absence of the TRPM3 inhibitor isosakuranetin.
  • Pregnenolone sulfate and CIM0216* in combination induced a concentration-dependent release of CGRP (FIG. 15A-B) and substance P (FIG. 15C-D) from mouse TNC. This concentration-dependent response was inhibited in the presence of the TRPM3 antagonist, isosakuranetin.
  • FIGURE 16 A-B The measured quantities of CGRP and substance P released from TNC over 15mins are shown in FIGURE 16 A-B.
  • KCI responses were observed in both Wild Type and knock out groups.
  • SEQ ID NO: 1 Amino acid sequence of human TRPM3 isoform XI 1
  • SEQ ID NO:2 Amino acid sequence of human TRPM3 isoform k
  • SEQ ID NO:3 Amino acid sequence of human TRPM3 isoform m MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVWCDGSGRASDIL AFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIIL
  • SEQ ID N0:4 Amino acid sequence of human TRPM3 isoform X19
  • SEQ ID NO:5 Amino acid sequence of human TRPM3 isoform q
  • SEQ ID N0:6 Amino acid sequence of human TRPM3 isoform Q9HCF6-6
  • SEQ ID NO:7 Amino acid sequence of human TRPM3 isoform X12
  • SEQ ID N0:8 Amino acid sequence of human TRPM3 isoform Q9HCF6-8
  • SEQ ID NO:9 Amino acid sequence of human TRPM3 isoform s
  • SEQ ID NO: 10 Amino acid sequence of human TRPM3 isoform Q9HCF6-11
  • VGMILRLQDQPFRSD GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQA
  • SEQ ID NO: 38 Nucleotide sequence of exon 1 of the human TRPM3 gene.
  • SEQ ID NO: 39 Nucleotide sequence of exon 2 of the human TRPM3 gene.
  • SEQ ID NO: 40 Nucleotide sequence of exon 3 of the human TRPM3 gene.
  • SEQ ID NO: 41 Nucleotide sequence of exon 4 of the human TRPM3 gene.
  • SEQ ID NO: 42 Nucleotide sequence of exon 5 of the human TRPM3 gene. GTGTTGCTGTGGGCGTCTGATAGGCCAGCATGTTGGCCTCACCCCCAGTATCTCCGTGCTTCAGAATGAAA
  • SEQ ID NO: 43 Nucleotide sequence of exon 6 of the human TRPM3 gene.
  • SEQ ID NO: 44 Nucleotide sequence of exon 7 of the human TRPM3 gene.
  • SEQ ID NO: 45 Nucleotide sequence of exon 8 of the human TRPM3 gene.
  • SEQ ID NO: 46 Nucleotide sequence of exon 9 of the human TRPM3 gene.
  • SEQ ID NO: 47 Nucleotide sequence of exon 10 of the human TRPM3gene.
  • SEQ ID NO: 48 Nucleotide sequence of exon 11 of the human TRPM3gene.
  • SEQ ID NO: 49 Nucleotide sequence of exon 11a of the human TRPM3gene.
  • SEQ ID NO: 50 Nucleotide sequence of exon 12 of the human TRPM3gene.
  • SEQ ID NO: 51 Nucleotide sequence of exon 13 of the human TRPM3gene.
  • SEQ ID NO: 52 Nucleotide sequence of exon 14 of the human TRPM3gene. GTGGGATCTCTGGAGCAAGCCATGTTGGATGCCTTAGTTCTGGACAGAGTGGATTTTGTGAAATTACTCATA GAGAATGGAGTAAGCATGCACCGTTTTCTCACCATCTCCAGACTAGAGGAATTGTACAATACG
  • SEQ ID NO: 53 Nucleotide sequence of exon 15 of the human TRPM3gene.
  • SEQ ID NO: 54 Nucleotide sequence of exon 16 of the human TRPM3gene.
  • SEQ ID NO: 55 Nucleotide sequence of exon 17 of the human TRPM3gene.
  • SEQ ID NO: 56 Nucleotide sequence of exon 18 of the human TRPM3gene.
  • SEQ ID NO: 57 Nucleotide sequence of exon 19 of the human TRPM3gene.
  • SEQ ID NO: 58 Nucleotide sequence of exon 20 of the human TRPM3gene.
  • SEQ ID NO: 59 Nucleotide sequence of exon 21 of the human TRPM3gene.
  • SEQ ID NO: 60 Nucleotide sequence of exon 22 of the human TRPM3gene.
  • SEQ ID NO: 61 Nucleotide sequence of exon 23 of the human TRPM3gene.
  • SEQ ID NO: 62 Nucleotide sequence of exon 24 of the human TRPM3gene.
  • SEQ ID NO: 63 Nucleotide sequence of exon 25 of the human TRPM3gene.
  • SEQ ID NO: 64 Nucleotide sequence of exon 26 of the human TRPM3gene.
  • SEQ ID NO: 65 Nucleotide sequence of exon 27 of the human TRPM3gene.
  • SEQ ID NO: 66 Nucleotide sequence of exon 28 of the human TRPM3gene.
  • SEQ ID NO: 67 Nucleotide sequence of exon 29 of the human TRPM3gene.
  • SEQ ID NO: 68 Nucleotide sequence of exon 29 of the human TRPM3gene where exon 30 is used GGTGGAGAACATGTCTATGCGGCTGGAGGAAGTCAACGAGAGAGCACTCCATGAAGGCTTCACTCCAGA CCGTGGACATCCGGCTGGCGCAGCTGGAAGACCTTATCGGGCGCATGGCCACGGCCCTGGAGCGCCTGACA GGTCTGGAGCGGGCCGAGTCCAACAAAATCCGCTCGAGGACCTCGTCAGACTGCACGGACGCCGCCTACATT GTCCGTCAGAGCAGCTTCAACAGCCAGGAAGGGAACACCTTCAAGCTCCAAGAGAGTATAGACCCTGCAG
  • SEQ ID NO: 69 Nucleotide sequence of exon 30 of the human TRPM3gene.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Neurosurgery (AREA)
  • Hematology (AREA)
  • Immunology (AREA)
  • Neurology (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Pathology (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • Physics & Mathematics (AREA)
  • General Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • Microbiology (AREA)
  • Pain & Pain Management (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

The present disclosure relates to an inhibitor of human TRPM3 for use in the treatment or prevention of migraine or cluster headache in patients whose migraines/headaches are not responsive to CGRP inhibition or whose migraines/headaches are responsive to triptans. In another aspect, the disclosure relates to an inhibitor of human TRPM3 for use in the treatment of medication overuse headache. An inhibitor of human TRPM3 that inhibits the release of PACAP from trigeminal ganglion neurons, and a method for measuring PACAP release are also disclosed.

Description

NOVEL USE
FIELD OF THE INVENTION
The present disclosure relates to an inhibitor of human TRPM3 for use in the treatment or prevention of migraine or cluster headache in patients whose migraines/headaches are not responsive to CGRP inhibition or whose migraines/headaches are responsive to triptans. In another aspect, the disclosure relates to an inhibitor of human TRPM3 for use in the treatment of medication overuse headache. An inhibitor of human TRPM3 that inhibits the release of PACAP from trigeminal ganglion neurons, and a method for measuring PACAP release are also disclosed.
BACKGROUND TO THE INVENTION
Migraine headaches are a common cause of disability in the United States, affecting approximately 27 million American adults, or 17.1% of women and 5.6% of men. Chronic migraine, which affects 3.2 million Americans (2%), is defined as having migraine symptoms for at least 15 days per month, lasting at least 4 hours, and for longer than 3 months in duration. This is in contrast to episodic migraine, which causes symptoms on fewer than 15 days per month. Current treatment for migraine is divided into acute, abortive agents and medications that will prevent migraine onset. Opioid analgesics and triptans are commonly prescribed for migraine. Whilst these types of drugs provide acute relief, regular use can result in increased headache severity, and progression of headache from an episodic to a chronic state. This form of medication overuse headache is difficult to treat and new treatment options are eagerly awaited.
Calcitonin gene-related peptide (CGRP) is a peptide that is released by peripheral neurons, including somatosensory neurons of the dorsal root, vagal and trigeminal ganglia where it is reported to act as a neurotransmitter, a vasodilator and as a local mediator of inflammation. Its short half-life (7 mins) normally results in localised effects. However, CGRP levels are increased in the cranial circulation during migraine and cluster headache attacks, and intravenous administration of CGRP triggers migraine attacks in migraineurs suggesting that it has a prominent role in migraine. Four monoclonal antibody antagonists of CGRP function and two small molecule CGRP receptor antagonists have been approved by the FDA for migraine prevention in addition to an oral CGRP receptor antagonist approved for symptomatic treatment of migraine. Evidence suggests that the increased levels of CGRP during migraine are produced in the trigeminal ganglion.
The prepro-peptide of pituitary adenylate cyclase activating polypeptide (PACAP) is encoded by ADCYAP1 gene and is proteolytically processed into two forms of PACAP containing either 27 or 38 amino acids with PACAP-38 being the more prevalent, representing 90% of PACAP forms in mammalian tissues. Like CGRP, PACAP is a multifunctional vasodilatory peptide that has been implicated in migraine pathogenesis. It has been shown that plasma levels of PACAP are elevated during a migraine attack compared to their interictal levels. Peripheral injection of PACAP in migraineurs resulted in 11 out of 12 subjects experiencing an initial headache, and 7 out of 12 subjects experienced a migraine-like headache that was delayed by 2-11 h. Interestingly, treatment with sumatriptan decreased PACAP-38 levels suggesting that sumatriptan may mediate its effects on migraine via PACAP In addition to its role in migraine pathogenesis, PACAP has been implicated in spontaneous headache conditions. For example, elevated PACAP-38 levels have been observed during the attack phase in episodic cluster headache patients. It has also been demonstrated to relieve opioid induced hyperalgesia in animal models. For example, Pradhan and colleagues have demonstrated that PACAP blockade reduced periorbital allodynia in a mouse model of opioid induced hyperalgesia, and that PACAP blockade reduced cephalic allodynia in mice treated with combined morphine and nitroglycerin.
Currently there is no clinically available PACAP-specific treatment. A PAC1 receptor monoclonal antibody, AMG 301 was observed to offer no benefit over placebo for migraine prevention despite inhibiting nociceptive activity in the trigeminocervical complex to the same extent as sumatriptan in preclinical trials. A monoclonal antibody targeting PACAP-38, ALD1910, however, remains in clinical development for the treatment of migraine patients.
The trigeminal ganglion has been examined to detect neuropeptides including calcitonin gene- related peptide (CGRP) and PACAP. In the human trigeminal ganglion nearly half of the neurons were found to be CGRP immunoreactive. PACAP-38 is present in the trigeminal ganglion, and plasma PACAP-38-like immunoreactivity is increased after electrical stimulation of the trigeminal ganglion.
Substance P is a mediator of the sterile inflammation of the dura, which may be a source of migraine pain. Triptans block this dural neurogenic inflammation dose-dependently in an animal model. Substance P (neurokinin-1 receptor) antagonists are also highly effective in animal models of dural inflammation, but no NK-1 antagonist has yet demonstrated any clinical effect in acute migraine.
The human TRPM3 gene is comprised of 30 exons and maps to human chromosome 9q- 21.12. TRPM3 isoforms vary from 1184 to 1744 amino acids in length and possess the characteristic six transmembrane domain of the TRP family. However, unlike some other TRPM family members, TRPM3 does not contain an enzyme domain in the C-terminal cytoplasmic region. Several alternative spliced transcript variants encoding different isoforms have been identified in mice and humans. The isoforms appear to have very different physiological roles given that one mouse isoform, Trpm3al preferentially conducts monovalent cation influx, while another, Trpm3a2 strongly favours divalent ion entry. The mouse Trpm3a2\om is the best studied. It has been reported to be a calcium-permeable nonselective cation channel that can be activated by several stimuli, including ligands, such as pregnenolone sulfate, nifedipine and CIM0216, and heat.
Human TRPM3 expression is detectable in kidney, brain, ovary, and pancreas. Northern blotting of mouse tissues resulted in strong signals in brain, whereas in kidney no signal could be detected. Within brain subregions in the mouse, the highest levels of expression were found in the cerebellum, choroid plexus, the locus coeruleus, the posterior hypothalamus, and the substantia nigra, using a Trpm5-specific antisense RNA probe yielded a positive Trpm3 hybridization signal in 82% ± 5% of mouse trigeminal neurons. The most abundant isoform in the human dorsal root ganglion as assessed by RNA expression has the UNIPROT ID: Q9HCF6-2.
SUMMARY OF THE INVENTION
In a first aspect, the invention provides an inhibitor of human TRPM3 for use in the treatment or prevention of migraine in a human subject whose migraines are not responsive to CGRP inhibition. In one particular embodiment, the migraines are not responsive to CGRP therapy and are responsive to therapy with a triptan.
In this context, migraines that are "not responsive to CGRP inhibition" are migraines that are not adequately treated by CGRP inhibition. Migraines that are "responsive to therapy with a triptan" are migraines that are adequately treated by a triptan.
In a second aspect, the invention provides an inhibitor of human TRPM3 for use in the treatment or prevention of migraine in a human subject whose migraines are responsive to therapy with a triptan.
In a third aspect, the invention provides an inhibitor of human TRPM3 for use in the treatment or prevention of cluster headache in a human subject whose headaches are not responsive to CGRP inhibition. In one particular embodiment, the headaches are not responsive to CGRP therapy and are responsive to therapy with a triptan.
In a fourth aspect, the invention provides an inhibitor of human TRPM3 for use in the treatment of medication overuse headache in a human subject.
In another aspect, the invention provides a method for measuring PACAP in a sample comprising incubating a cell line expressing the PAC1 receptor with the sample and measuring cAMP signalling in the cell line.
In a further aspect, the invention provides a method for identifying an inhibitor of human TRPM3, comprising measuring release of PACAP from dorsal root ganglia or trigeminal ganglia, or from primary cultures of cells isolated from dorsal root ganglia or trigeminal ganglia, following challenge with an agonist of human TRPM3 in the presence or absence of a test inhibitor, wherein the test inhibitor is identified as an inhibitor for human TRPM3 if PACAP production is reduced in the presence of the test inhibitor compared to PACAP production in the absence of the test inhibitor. In particular embodiments, PACAP production is measured according to the method of the invention.
In yet another aspect, the invention provides (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5- methylisoxazol-3-yl)propenamide or a salt thereof. DESCRIPTION OF DRAWINGS/FIGURES
FIGS. 1A and IB demonstrate that TRPM3 agonists, CIM0216 (0.37-10 |JM) and pregnenolone sulfate (100 μM), induce release of CGRP from dorsal root ganglia neurons. The CIM0216 response was inhibited by TRPM3 blocker isosakuranetin (10 μM) (mean ± SEM; n=3 or mean ± range; n=2).The pregnenolone sulfate response was inhibited with isosakuranetin (10 μM) (mean ± SEM; n=3 or mean ± range; n=2). FIG. 1C is a graph showing that isosakuranetin (10 μM) reduced CIM0216 (10 μM) induced CGRP released from DRG neurons, data from separate experiments (bars represent mean ± SEM, n=2 or 3 wells)
FIG. 2. demonstrates that isosakuranetin inhibits release of CGRP from dorsal root ganglia neurons following activation with 6 μM CIM0216 (A) or 10 μM CIM0216 (B) in a dose dependent manner (mean ± SEM; n=3 or mean ± range; n=2). Isosakuranetin reduced the release of CGRP to below basal levels in the presence of 6 μM CIM0216.
FIGS. 3A and 3B demonstrates that the TRPM3 agonists, CIM0216 and pregnenolone sulfate, stimulate release of CGRP from trigeminal ganglia (TG) neurons in a concentration dependent manner (mean ± SEM; n=2 or 3). FIGS 3A and 3B also show that CGRP responses were inhibited with isosakuranetin (10 μM). FIG. 3C is a graph showing that isosakuranetin (10 μM) reduced CIM0216 (10 μM) induced CGRP release from TG neurons in separate experiments (bars represent mean ± SEM, n=2 or 3 wells).
FIG 4 shows a LocusZoom plot for the association between migraine defined using the 'migraine_diagnosis' classification and genetic variants at the TRPM3 locus. The x-axis displays position on chromosome 9 using GRCh37/hgl9 as the human reference genome build. The y-axis is the - logio(p-value) from a logistic regression testing for an association between migraine case-control status and genotype. Plus symbols (+) denote variants for which genotype was imputed; circle symbols (o) denote variants for which genotype calls were used; x symbols (x) denote imputed coding variants; diamond symbols (0) denote genotyped coding variants. The horizontal line represents the genome-wide significance threshold of 5x10-8. The credible set track displays the number and location of variants in the 99% credible set, which is likely to contain the causal variant. The gene track displays genes in the locus with thick bars representing exons and thin lines representing introns.
FIG 5 demonstrates the effect of isosakuranetin on the pregnenolone sulfate dose response curve in HEK293-TRPM3 cells in a calcium mobilisation assay (mean ± range; n=2). FIG 6 demonstrates the effect of isosakuranetin on the CIM0216 dose response curve in HEK293- TRPM3 cells in a calcium mobilisation assay (mean ± range; n=2).
FIG 7 demonstrates the concentration dependent inhibition of the pregnenolone sulfate response by isosakuranetin in HEK293-TRPM3 cells in a calcium mobilisation assay (mean ± range; n=2).
FIG 8 A-D shows the response of Wild Type (WT) and Trpm3-/- knock out (KO) dorsal root ganglion neurons (FIG 8A and 8B), and trigeminal ganglion neurons (FIG 8C and 8D) to pregnenolone sulfate (PS), CIM0216 and capsaicin in a CGRP release assay (mean ± SEM; n=3 or mean ± range; n=2). The PS and CIM0216 dose-dependent release of CGRP observed in WT neurons was lacking in Trpm3 deficient neurons. Capsaicin evoked CGRP release from Trpm3 deficient neurons.
FIG 9 shows the response of HEK MSR II cells expressing canonical TRPM3(SEQ NO: 2) and a variant of SEQID NO: 2 having the R1670Q mutation to pregnenolone sulfate in a calcium mobilisation assay (mean ± SEM; n=10).
FIG. 10A demonstrates that dural administration of TRPM3 agonists, Pregnenolone sulphate (5mM) and CIM0216 (215 μM), induce mechanical allodynia in the periorbital region of rats. FIG. 10B reveals that at these concentrations the agonists do not cause overt adverse effects, represented by healthy increases in body weight. Data points represent von frey thresholds or percentage change of body weight (mean ± SEM; n=3 or 4), which evoked a response from rats treated with Vehicle Pregnenolone sulphate and CIM0216
FIG. 11A demonstrates CIM0216 induces a concentration-dependent release of PACAP from trigeminal ganglia cultures and its inhibition by isosakuranetin. FIG. 11B shows concentration-dependent inhibition by isosakuranetin (mean ± range; n=2).
FIG 12 A-D shows the response of Wild Type (WT) and Trpm3 knock out (KO) dorsal root ganglion cells (FIG 12A and 12B), and trigeminal ganglion cells (FIG 12C and 12D) to pregnenolone sulfate (PS), CIM0216 and capsaicin and the effect of isosakuranetin on the TRPM3 agonists in a PACAP release assay (mean ± range; n=2).
FIG 13 shows the agonist activity of the isomers of CIM0216 in a calcium mobilisation assay. R- CIM0126 is (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3-yl)propenamide and S- CIM0216 is (S)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3-yl)propenamide. FIG 14A and 14B demonstrates that the TRPM3 agonists, CIM0216 and pregnenolone sulfate, stimulate release of substance P from trigeminal ganglia (TG) neurons in a concentration dependent manner. FIGS 14A and 14B also show that substance P responses were inhibited with isosakuranetin (10 μM).
FIG. 15 A-D shows the neuropeptide release response of isolated Trigeminal nucleus caudalis (TNC) tissue from Wild Type (WT) and Trpm3 knock out (KO) mice to the TRPM3 agonists pregnenolone sulfate (PS) and R-CIM0216 (CIM0216*) and the effect of the TRPM3 inhibitor isosakuranetin on the agonist response (mean ± SD, n=2, stimulation 10 mins). Capsaicin and KCI evoked CGRP and substance P release from both WT and Trpm3 deficient tissue (n=4). Individual datapoints are normalised to their respective KCI response. Data shown are representative of 3 independent experiments.
FIG. 16A-B shows the neuropeptide released from isolated TNC tissue from Wild Type (WT) and Trpm3 knock out (KO) mice in response to the combined application of TRPM3 agonists, 25μM pregnenolone sulfate (PS) and 10μM R-CIM0216 (CIM0216*) (mean ± SD, n=4, stimulation 15mins). **** p < 0.0001, *** p < 0.001, ns = not significant (p>0.05). p-values were derived from an analysis on the log transformed scale using a linear mixed effects model with Bonferroni correction in R (version 4.1.1, lme4 package).
FIG. 17 A-D shows the neuropeptide release response of isolated rat TNC tissue to the TRPM3 agonists pregnenolone sulfate (PS), and R-CIM0216 (CIM0216*) and the effect of the TRPM3 inhibitor isosakuranetin on the agonist response (mean ± SD, n=2, stimulation lOmins). FIG. 17A and 17C demonstrates the concentration dependent response of pregnenolone sulfate in the presence of 2.5μM /?-CIM0216), and FIG. 17B and 17D demonstrates the concentration dependent response of R- CIM0216 in the presence of 25μM pregnenolone sulfate. Capsaicin and KCI evoked CGRP and substance P release from all tissues (n=8). Individual datapoints are normalised to their respective KCI response.
DETAILED DESCRIPTION OF THE INVENTION
STATEMENT OF THE INVENTION
Example 1 demonstrates that a SNP in the human TRPM3 gene, R1670Q shows a strong genetic association with migraine. Example 3 (Figure 9) shows that the potency of pregnenolone sulfate is 1.8-fold greater at the R1670Q variant than at canonical form, and the maximal fold change in fluorescence in a calcium mobilisation assay was 26% larger. Thus pregnenolone sulfate is more able to activate the TRPM3 variant associated with increased likelihood of migraine diagnosis than the canonical form of the channel.
Further evidence that TRPM3 activation is causative of migraine comes from the five-day rat dural infusion migraine model. Historical data in this model using an inflammatory soup (2 mM histamine, bradykinin, serotonin, 0.2 mM prostaglandin E2) infusion shows mechanical nociception sensitivity (Oshinsky & Gomoncharconsiri, (2007). Episodic dural stimulation in awake rats: a model for recurrent headache. Headache: The Journal of Head and Face Pain, 47(7), 1026-1036). This sensitivity is alleviated with sumatriptan and anti-CGRP therapies, current standard of care compounds for migraine, suggesting this model has clinical translation. Example 4 shows that Pregnenolone sulphate and CIM0216 (TRPM3 agonists) also trigger mechanical allodynia in the periorbital region When comparing significant differences in sensitivity, both Pregnenolone sulphate and CIM0216 were effective in increasing sensitivity to periorbital von Frey (VF) stimulation as early as Day 5 (after 4 infusions) when compared to vehicle treated animals. In other words, Example 4 provides further evidence of the link between TRPM3 activation and migraine.
In addition, Example 2 demonstrates that inhibition of human TRPM3 in sensory ganglion, including the trigeminal ganglion, reduces production of the neuropeptides CGRP, PACAP and substance P. These neuropeptides are implicated in the pathogenesis of migraine and therapies inhibiting CGRP, PACAP and substance P (NK1 receptor antagonists) signalling have been developed although as of the date of filing, only CGRP blocking therapies have been approved as migraine therapies. Trpm3 inhibitors have the ability to treat migraine mediated by CGRP, PACAP or substance P. It is known that there are classes of patients for whom the approved CGRP therapies are ineffective. It is believed trpm3 inhibition may be an effective therapeutic in such patients due to the impact of trpm3 inhibition upon PACAP and substance P. Example 5 shows that this patient group is significant, comprising over 10% of migraine patients, and includes patients with and without mutations in trpm3. It is believed that trpm3 inhibition may be an effective therapeutic in patients that are not responsive to PACAP blockade due to the impact of trpm3 inhibition upon CGRP. Given that triptans may mediate their effects on migraine via PACAP and substance P, it is also plausible that trpm3 inhibition may be an effective therapy in a human subject whose migraines are responsive to therapy with triptans.
As discussed in the section entitled Background to the invention, PACAP receptor antagonism has also been demonstrated to relieve opioid induced hyperalgesia in an animal model. Accordingly, the demonstration in the examples that trpm3 inhibition reduces PACAP shows that trpm3 inhibitors are suitable for the treatment of medication overuse headache, including opioid induced hyperalgesia. ..
In the context of this invention, the term migraine refers to a condition that satisfies the diagnostic criteria for migraine according to the International Classification of Headache Disorders (ICHD) of the HIS. This definition is periodically updated.
In the context of this invention, the term cluster headache refers to a condition that satisfies the diagnostic criteria for cluster headache according to the International Classification of Headache Disorders (ICHD) of the HIS. This definition is periodically updated.
In the context of this invention, the term medication overuse headache refers to a condition that satisfies the diagnostic criteria for medication overuse headache according to the International Classification of Headache Disorders (ICHD) of the HIS. This definition is periodically updated.
HUMAN TRPM3
Human TRPM3 refers to a protein product of the TRPM3 gene present on chromosome 9q-21.12. Allelic variants including those encoded by SNPs associated with migraine are included within this definition. In addition, the definition covers all isoforms of human TRPM3 that may be generated from any allelic variant.
In one embodiment, human TRPM3 refers to the hTRPM3 variant having the amino acid sequence set out in any one of sequences set out as: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO.5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17,
SEQ ID NO: 18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID
NO:24, SEQ ID NO: 25, SEQ ID NO:26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO:29, SEQ ID NO:30,
SEQ ID NO:31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36 and
SEQ ID NO: 37 or a processed version of any one of SEQ ID Nos. 1-37 lacking the initial methionine residue.
In one embodiment, human TRPM3 refers to the TRPM3 variant having the amino acid sequence set out in SEQ ID NO: 2, or a processed version of this variant lacking the initial methionine residue. In one embodiment, human TRPM3 is a human TRPM3 having one or more mutations compared with the sequences set out in SEQ ID NO: 1 to SEQ ID NO:37. In one embodiment, human TRPM3 has an amino acid substitution at one or more of the following positions R1670, A1645, R1457, D602, K774, S1678, Y378, V990 and P1090 (numbering based on SEQ ID NO:2). In one embodiment, human TRPM3 has one or more of the following substitutions R1670Q, A1645V, R1457Q, D602V, K774R, S1678F, Y378C, V990M and P1090Q (numbering based on SEQ ID NO:2). The skilled person will appreciate that, although the substitutions are described in relation to SEQ ID NO: 2, the substitution could occur in any isoform, and the invention is intended to encompass the corresponding variants with amino acid substitutions in each of SEQ ID NO:1 or SEQ ID NOS: 3-37 (or processed forms of these sequences lacking the initial methionine).
In one embodiment, human TRPM3 is a human TRPM3 having a gain of function mutation. A gain of function is one that results in constitutive activity (Ze., calcium influx in the absence of a stimulus), or increased sensitivity to stimuli (calcium influx at a lower concentration of agonist, or a larger calcium mobilisation at the same agonist concentration) as determined in a calcium mobilisation assay. In one embodiment, the human TRPM3 has one or more of the following amino acid substitutions R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2). In one embodiment, the human TRPM3 has the amino acid substitution R1670Q (numbering based on SEQ ID NO: 2).
Conventional sequencing techniques can be used to identify changes in the nucleotide sequence of human TRPM3. Changes in nucleotide sequences that give rise to changes in the amino sequence can be readily identified. The nucleotide sequences of the exons of the human TRPM3 are set out as SEQ ID NO: 38 to 69.
The term human TRPM3 channel encompasses a channel composed of at least one monomer of human TRPM3 as outlined above. The term therefore encompasses heterotetra meric channels formed from mixtures of human TRPM3 variants and homotetrameric channels formed from a single human TRPM3 variant. In one embodiment, the term human TRPM3 channel refers to a homotetrameric channel.
INHIBITOR OF HUMAN TRPM3
An inhibitor of human TRPM3 has one or more of the following properties:
1) inhibiting Ca2+ influx in a cell line expressing human TRPM3 channels following challenge with an agonist of a human TRPM3 channel; 2) reducing current increases in a cell line expressing human TRPM3 channels following challenge with an agonist of a human TRPM3 channel;
3) inhibiting release of CGRP from dorsal root ganglia or trigeminal ganglia cells or the trigeminal nucleus caudalis following challenge with an agonist of a human TRPM3 channel;
4) inhibiting release of PACAP from dorsal root gangia or trigeminal ganglia cells or the trigeminal nucleus caudalis following challenge with an agonist of a human TRPM3 channel;
5) inhibiting release of substance P from dorsal root gangia or trigeminal ganglia cells or the trigeminal nucleus caudalis following challenge with an agonist of a human TRPM3 channel;
6) reduces facial allodynia following dural sensitisation with a TRPM3 agonist.
Property 1 may be measured in a calcium mobilisation assay. An inhibitor of human TRPM3 reduces fluorescence emissions in a calcium mobilisation assay compared to the negative control (agonist challenge/no inhibitor). In various embodiments, the fluorescence is reduced by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90%. In one embodiment, an inhibitor of human TRPM3 reduces fluorescence by at least as much as a blocking concentration of isosakuranetin ((2S)-5,7-dihydroxy-2-(4-methoxyphenyl)-2,3- dihydrochromen-4-one).
Property 2 may be measured in an electrophysiological assay. An inhibitor of human TRPM3 reduces current increases compared to the negative control (agonist/no inhibitor).
An inhibitor of human TRPM3 reduces current increases by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90% compared to the negative control. In one embodiment, an inhibitor of human TRPM3 reduces current increases by at least as much as a blocking concentration of isosakuranetin ((2S)-5,7-dihydroxy-2-(4- methoxyphenyl)-2,3-dihydrochromen-4-one).
Property 3 may be measured by the CGRP release assay. An inhibitor of human TRPM3 reduces CGRP levels in the media by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90%. In one embodiment, an inhibitor of human TRPM3 reduces CGRP levels by at least as much as a blocking concentration of isosakuranetin ((2S)-5,7- dihydroxy-2-(4-methoxyphenyl)-2,3-dihydrochromen-4-one).
Property 4 may be measured by the PACAP release assay. An inhibitor of human TRPM3 reduces PACAP levels in the media by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90%. In one embodiment, an inhibitor of human TRPM3 reduces PACAP levels by at least as much as a blocking concentration of isosa kuranetin ((2S)- 5,7-dihydroxy-2-(4-methoxyphenyl)-2,3-dihydrochromen-4-one).
Property 5 may be measured by the substance P release assay. An inhibitor of human TRPM3 reduces PACAP levels in the media by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90%. In one embodiment, an inhibitor of human TRPM3 reduces substance P levels by at least as much as a blocking concentration of isosakuranetin ((2S)-5,7-dihydroxy-2-(4-methoxyphenyl)-2,3-dihydrochromen-4-one).
Property 6 is assessed in a suitable model, for example the five-day rat dural infusion migraine model described by Oshinsky et al., supra, using a TRPM3 agonist in place of inflammatory soup. The level of facial allodynia is lower in the presence of an inhibitor of human TRPM3 compared to that observed in the absence of the inhibitor of human TRPM3. In a particular embodiment, the reduction in facial allodynia is measured using von Frey filaments. In particular embodiments, an inhibitor of human TRPM3 reduces the von Frey threshold on a particular day following infusion by 0.5 g, 1 g, 1.5 g, or 2 g. In certain embodiment, the reduction is measured from day 0 to day 14 post the completion of infusion. In particular embodiments, the reduction is measured on day 0, day 3, day 6, day 9 or day 12.
In the assays used to assess these properties, any compound capable of promoting calcium ion influx in a cell line expressing human TRPM3 may be used as the agonist. In one embodiment, the calcium ion influx is mediated by human TRPM3. Typically, the agonist is used at a concentration causing a response between 50% and 80% of the maximal response (i.e. between EC50 - EC80) for the assays used to assess properties 1 to 5. In one embodiment, the agonist is pregnenolone sulfate or CIM0216 (racemate of 2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3-yl)-2-phenylacetamide). In one embodiment, the agonist is (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3- yl)propenamide. In another embodiment, the agonist is (S)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5- methylisoxazol-3-yl)propenamide. Figure 13 shows that (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5- methylisoxazol-3-yl)propenamide is a more potent agonist than the (S)-isomer. Further details of the conduct of these assays are set out in the section entitled "IDENTIFICATION OF INHIBITORS OF HUMAN TRPM3".
Accordingly, in one embodiment, the invention provides (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5- methylisoxazol-3-yl)propenamide or a salt thereof. In a more particular embodiment, the invention provides (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3-yl)propenamide (free base). The nature of an inhibitor of human TRPM3 is not limited, and could be a chemical compound (i.e. a compound), an oligonucleotide, a peptide, a polypeptide, a protein, an antibody or an alternative antibody format. In one embodiment, the inhibitor of human TRPM3 is a compound.
The term "antibody" is used herein in the broadest sense to refer to molecules with an immunoglobulin-like domain (for example IgG, IgM, IgA, IgD or IgE) and includes monoclonal, recombinant, synthetic, polyclonal, chimeric, human, humanised, multispecific antibodies, including bispecific antibodies, and heteroconjugate antibodies; a single variable domain, antigen binding antibody fragments (e.g. Fab, F(ab')2, Fv, disulphide linked Fv, single chain Fv, disulphide-linked scFv, diabodies, TANDAB™, etc.) and modified versions of any of the foregoing.
The term "domain" refers to a folded protein structure which retains its tertiary structure independent of the rest of the protein. Generally, domains are responsible for discrete functional properties of proteins and in many cases may be added, removed or transferred to other proteins without loss of function of the remainder of the protein and/or of the domain. The term "single variable domain" refers to a folded polypeptide domain comprising sequences characteristic of antibody variable domains. It therefore includes complete antibody variable domains such as VH, VHH and VL and modified antibody variable domains, for example, in which one or more loops have been replaced by sequences which are not characteristic of antibody variable domains, or antibody variable domains which have been truncated or comprise N- or C-terminal extensions, as well as folded fragments of variable domains which retain at least the binding activity and specificity of the full-length domain. A single variable domain that is capable of binding an antigen or epitope independently of a different variable region or domain may be referred to as a "domain antibody" or "dAb(™)". A single variable domain may be a human single variable domain, but also includes single variable domains from other species such as rodent, nurse shark and Camelid VHH dAbs™. Camelid VHH are immunoglobulin single variable domain polypeptides that are derived from species including camel, llama, alpaca, dromedary, and guanaco, which produce heavy chain antibodies naturally devoid of light chains. Such VHH domains may be humanised according to standard techniques available in the art, and such domains are considered to be "single variable domains". As used herein VH includes camelid VHH domains.
Alternative antibody formats are those where the CDRs are arranged onto a suitable nonimmunoglobulin protein scaffold or skeleton. The non-immunoglobulin scaffold may be a derived from the group consisting of CTLA-4, lipocalin, Protein A derived molecules such as Z-domain of Protein A (Affibody, SpA), A-domain (Avimer/Maxibody); heat shock proteins such as GroEl and GroES; transferrin (trans-body); ankyrin repeat protein (DARPin); peptide aptamer; C-type lectin domain (Tetranectin); human y-crystallin and human ubiquitin (affilins); PDZ domains; LDL receptor class A domains; EGF domains; scorpion toxin kunitz type domains of human protease inhibitors; and fibronectin/adnectin. Inhibitors of human TRPM3 are known in the art.
Inhibitors of human TRPM3 include those disclosed in WO2022112345 and WO2022112352. In one embodiment, an inhibitor of human TRPM3 is a compound of formula (I), or a pharmaceutically acceptable salt thereof: wherein:
R1 is selected from the group consisting of: a 4-6 membered saturated heterocyclylic ring, which 4-6 membered heterocyclic ring is optionally substiiuted by one, two or three groups independently selected from oxo, fluoro, C1- 3fluoroalkyl and C1-3 alkyl, which C1-3alkyl group may optionally by substituted by one hydroxy group; and a group of formula -CR6R7CONH2, wherein R6 is optionally H or methyl and R7 is methyl substituted by one hydroxy group or ethyl substituted by one hyroxy group;
R2 is phenyl or a 5-6 membered nitrogen containing heteroaryl ring, which phenyl or 5-6 membered nitrogen containing heteroaryl ring is optionally substituted by one two or three substituents independently selected from the group consisting of halo, cyclopropyl, cyclopropyloxy, methoxy and C1-3alkyl, which C1-3alkyl group is optionally substituted by one, two or three substitutents selected from fluoro and cyclopropyl; and
R3 is selected from cycloalkyl and methyl, which methyl group is optionally substituted by one, two or three fluoro groups.
R4 and R5 are independently selected from H, or methyl, which methyl group is optionally substituted with a group consisting of hydroxy, methoxy and N(CH3)2.
In one embodiment, R1 is a group of formula -CR6R7CONH2, wherein R6 is optionally H or methyl and R7 is methyl substituted by one hydroxy group or ethyl substituted by one hydroxy group. In a more particular embodiment, R1 is a group of formula -CH(CH2OH)CONH2. In one embodiment, R3 is methyl.
In one embodiment, R4 and R5 are each H. In another embodiment, R4 is H, and R5 is methyl, which methyl group is optionally substituted with a group consisting of hydroxy and methoxy.
Compounds of formula (I) can be made as described in WO2022112352 or WO2022112345. It will be appreciated that certain compounds of formula (I) may exist in alternative tautomeric forms. For the avoidance of doubt, all tautomers of a compound of formula (I) are encompassed.
In one embodiment, the inhibitor of human TRPM3 is a compound selected from the group consisting of: 2-(difluoromethyl)-N-(3,3-difluoropiperidin-4-yl)-5-((4-methylthiazol-5-yl)methoxy)benzofuran-3- carboxamide;
N-(3,3-difluoropiperidin-4-yl)-2-methyl-5-((4-methylthiazol-5-yl)methoxy)benzofuran-3-carboxamide;
(S)-N-(l-amino-3-hydroxy-l-oxopropan-2-yl)-2-(difluoromethyl)-5-((4-methylthiazol-5- yl)methoxy)benzofuran-3-carboxamide;
(S)-N-(l-amino-3-hydroxy-l-oxopropan-2-yl)-2-cyclopropyl-5-((4-methylthiazol-5- yl)methoxy)benzofuran-3-carboxamide;
(S)-5-(benzyloxy)-2-methyl-N-(pyrrolidin-3-yl)benzofuran-3-carboxamide;
(S)-5-((2-fluorobenzyl)oxy)-2-methyl-N-(pyrrolidin-3-yl)benzofuran-3-carboxamide;
5-(benzyloxy)-N-(3,3-difluoropiperidin-4-yl)-2-methylbenzofuran-3-carboxamide;
N-(3,3-difluoropiperidin-4-yl)-5-((2-fluorobenzyl)oxy)-2-methylbenzofuran-3-carboxamide;
(S)-N-(l-amino-l-oxobutan-2-yl)-2-methyl-5-((4-methylthiazol-5-yl)methoxy)benzofuran-3- carboxamide;
(S)-N-(l-amino-l-oxobutan-2-yl)-5-(benzyloxy)-2-methylbenzofuran-3-carboxamide;
(S)-N-(l-amino-l-oxobutan-2-yl)-5-((2-fluorobenzyl)oxy)-2-methylbenzofuran-3-carboxamide; (S)-2-methyl-5-((4-methylthiazol-5-yl)methoxy)-N-(pyrrolidin-3-yl)benzofuran-3-carboxamide; 5-(benzyloxy)-2-(difluoromethyl)-N-(3,3-difluoropiperidin-4-yl)benzofuran-3-carboxamide;
2-(difluoromethyl)-N-(3,3-difluoropiperidin-4-yl)-5-((2-fluorobenzyl)oxy)benzofuran-3-carboxamide;
(S)-N-(l-amino-3-hydroxy-l-oxopropan-2-yl)-5-(benzyloxy)-2-(difluoromethyl)benzofuran-3- carboxamide;
(S)-N-(l-amino-3-hydroxy-l-oxopropan-2-yl)-2-(difluoromethyl)-5-((2-fluorobenzyl)oxy)benzofuran-
3-carboxamide;
(S)-2-(difluoromethyl)-5-((4-methylthiazol-5-yl)methoxy)-N-(pyrrolidin-3-yl)benzofuran-3- carboxamide;
(S)-5-(benzyloxy)-2-(difluoromethyl)-N-(pyrrolidin-3-yl)benzofuran-3-carboxamide; (S)-2-(difluoromethyl)-5-((2-fluorobenzyl)oxy)-N-(pyrrolidin-3-yl)benzofuran-3-carboxamide; (S)-2-cyclopropyl-5-((4-methylthiazol-5-yl)methoxy)-N-(pyrrolidin-3-yl)benzofuran-3-carboxamide; (S)-5-(benzyloxy)-2-cyclopropyl-N-(pyrrolidin-3-yl)benzofuran-3-carboxamide;
(S)-2-cyclopropyl-5-((2-fluorobenzyl)oxy)-N-(pyrrolidin-3-yl)benzofuran-3-carboxamide; (S)-N-(l-amino-3-hydroxy-l-oxopropan-2-yl)-5-(benzyloxy)-2-cyclopropylbenzofuran-3- carboxamide;
(S)-N-(l-amino-3-hydroxy-l-oxopropan-2-yl)-2-cyclopropyl-5-((2-fluorobenzyl)oxy)benzofuran-3- carboxamide;
2-cyclopropyl-N-(3,3-difluoropiperidin-4-yl)-5-((4-methylthiazol-5-yl)methoxy)benzofuran-3- carboxamide;
5-(benzyloxy)-2-cyclopropyl-N-(3,3-difluoropiperidin-4-yl)benzofuran-3-carboxamide; and 2-cyclopropyl-N-(3,3-difluoropiperidin-4-yl)-5-((2-fluorobenzyl)oxy)benzofuran-3-carboxamide; or a pharmaceutically acceptable salt thereof.
Additional inhibitors of human TRPM3 are reviewed in Held et al., (2015, Temperature 2: 201-13). Inhibitors include, for example, primidone (5-ethyldihydro-5-phenyl-4,6(lH,5H)-pyrimidinedione), diclofenac, ononetin, econazole, the calmodulin antagonist W-7, the PPARy agonists rosiglitazone, troglitazone and pioglitazone, the flavonoid derivatives disclosed in Straub et al. (Mol Pharmacol, 2013, 84(5):736-50), the fenamate derivates disclosed in Klose et al.. (Br J Pharmacol., 2011, 162(8): 1757-1769), and the TRPM3-specific polyclonal antibody (TM3E3).
The properties that define an inhibitor of human TRPM3 are determined experimentally. The skilled person will appreciate that this permits the identification of additional inhibitors of human TRPM3. This is discussed in the section entitled "IDENTIFICATION OF INHIBITORS OF HUMAN TRPM3".
In particular embodiments, the inhibitor of human TRPM3 exhibits selectivity for inhibition of human TRPM3 channels in comparison to other TRP channels. In particular, the inhibitor of human TRPM3 exhibits selectivity for inhibition of human TRPM3 over one or more of TRPM1, TRPV1, TRPV4 and TRPM8. The skilled person will readily understand that selectivity can be assessed in binding assays for example, an assay using a labelled ligand, or where the TRP channel also acts to increase intracellular calcium, in a calcium mobilisation assay.
The inhibitor of human TRPM3 may be an inhibitor of a mutated version of human TRPM3, such as those disclosed supra, for example a mutated version of human TRPM3 having a gain of function mutation. For the avoidance of doubt, an inhibitor of a mutated version of human TRPM3 is an inhibitor of the mutated version, and does not require selectivity over the corresponding wild type variant of TRPM3, although selectivity may be required in particular embodiments. For example, in one embodiment, the inhibitor of a mutated version of human TRPM3 having a gain of function mutation is an inhibitor that is selective for the mutated version over the corresponding wild type TRPM3 variant.
In one embodiment, the inhibitor of human TRPM3 exhibits selectivity for the TRPM3 having the sequence set out in SEQ ID NO: 2 (or a processed version of SEQ ID NO:2 lacking the initial methionine residue) over other TRPM3 variants. Similarly to the above, the skilled person would understand that selectivity for this isoform can be assessed in binding assays or using a calcium mobilisation assay using channels that are homotetrameric for SEQ ID NO:2 (or a processed version of SEQ ID NO:2 lacking the initial methionine residue) and channels that are homotetrameric for the reference TRPM3 variant.
In a further embodiment, the inhibitor of human TRPM3 selectively inhibits the response to a particular stimulus. As explained in the Background, human TRPM3 is polymodally activated. In one embodiment, inhibition is selective to agonism by pregnenolone sulfate over heat. In another embodiment, inhibition is selective to agonism by pregnenolone sulfate over other agonists e.g., nifedipine, D-erythrosphingosine, CIM2016). A functional assay such as a calcium mobilisation assay may be used to assess selectivity to particular stimuli.
In the above embodiments in which selectivity is assessed using a binding assay, the Kd for human TRPM3 channels or channels homotetrameric for a particular isoform of human TRPM3 is at least 10 fold lower compared to the reference channel. In a more particular embodiment, the Kd for the human TRPM3 channels or channels homotetrameric for a particular isoform of human TRPM3 is at least 100 fold lower compared to the reference channel. In embodiments above in which selectivity is assessed using a calcium mobilisation assay, the IC50 or Kd derived therefrom for human TRPM3 channels or channels homotetrameric for a particular isoform of human TRPM3 is at least 10 fold lower compared to the reference channel. In a particular embodiment above in which selectivity is assessed using a calcium mobilisation assay, the IC50 or Kd derived therefrom for human TRPM3 channels or channels homotetrameric for a particular isoform of human TRPM3 is at least 100 fold lower compared to the reference channel.
IDENTIFICATION OF INHIBITORS OF HUMAN TRPM3
As discussed supra, the properties that define an inhibitor are determined experimentally in assays. These assays can be used to identify additional inhibitors of human TRPM3. Property 1 is measured using a calcium mobilisation assay in which changes in intracellular calcium ion levels are detected by changes in calcium indicator compounds. Currently, over one hundred chemically synthesized and genetically encoded calcium indicators are available.
Accordingly, an inhibitor of human TRPM3 can be identified by a method comprising: a) contacting a cell line expressing human TRPM3 which cells contain an intracellular calcium indicator with an agonist of human TRPM3 in the presence and absence of a test inhibitor; and b) measuring a change in intracellular calcium concentrations by measuring a change in the intracellular calcium indicator; wherein the test inhibitor is identified as an inhibitor for human TRPM3 if intracellular calcium concentrations are reduced in the presence of the test inhibitor compared to those achieved in the absence of test inhibitor.
In one embodiment, the intracellular calcium indicator is a synthetic calcium indicator, and step a) is preceded by a step of loading the cells with the indicator. Several synthetic calcium indicator compounds are available commercially, for example, the FLUO calcium indicators (Invitrogen). Synthetic calcium indicators may be loaded into cells using methods known in the art. For example, water soluble salts of synthetic calcium indicators may be loaded into cells by well known methods including microinjection, by addition to patch pipette solutions, or by use of pinocytosis, for example using the INFLUX pinocytotic cell loading reagent. Cell permeant AM esters of calcium indicators may be loaded into cells by addition to the media, typically in the presence of a non-ionic detergent such as PLURONIC F-127, and an anion transport inhibitor such as probenecid or sulfinpyrazone, and incubation at 20-37°C for a suitable period of time e.g., between 15 minutes and 4 hours). Following cell loading, cells may be washed and background fluorescence due to indicator leakage could be quenched by addition of, for example, an anti-fluorescein antibody, although this is not essential. Where cell permeant AM esters were used, incubation for a further 30 minutes after loading permits de-esterification of the intracellular AM esters prior to the assay being conducted.
In an alternative embodiment, the intracellular calcium indicator is a genetically encoded calcium indicator. Several genetically encoded calcium indicators are known in the art, including the GCaMPs, pericams, GECOs, camgaroos. Constructs for transfecting cell lines with these genetically encoded calcium indicators are known in the art, for example, the GCaMP6s-P2A-Bsr construct (commercially available as Addgene plasmid # 40753). Clonal cell lines based upon this construct showed bright, uniform cytoplasmic staining. Transient and stable cell line production using this construct is described in Wu eta/., 2019 (2019, Sci Rep, 9: 12692). In one embodiment, DNA encoding the genetically encoded calcium indicator is transfected into a cell line expressing human TRPM3 before step a). In an alternative embodiment, the cell line is a cell line stably expressing the genetically encoded calcium indicator.
Calcium mobilisation assays using cells loaded with calcium indicators are well known in the art. In one embodiment, the calcium indicator is an indicator whose fluorescence changes in the presence of calcium ions. In such embodiments, calcium mobilisation assays involve measuring levels of fluorescence following excitation with an appropriate wavelength for the calcium indicator following the addition of an agonist and inhibitor. The inhibitor may be added to the cells either before (e.g. 60 minutes before) or at the same time as the agonist. Fluoresence may be measured using a fluorescent imaging plate reader (several are commercially available, for example FLIPR TETRA), or by FACS analysis. Typically, negative and positive controls and standards are included in each experiment. Negative controls lack agonist, positive controls lack inhibitor and a standard uses a blocking concentration of a known inhibitor, for example, isosakuranetin.
A suitable calcium mobilisation assay in 96 well plates has been described by Zhao and colleagues, (eLife 2020;9:e55634).
In a calcium mobilisation assay, an inhibitor of human TRPM3 is a compound that reduces fluorescence emissions compared to the positive control. In various embodiments, the fluorescence is reduced by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90%. In one embodiment, an inhibitor is a compound that reduces fluorescence by at least as much as a blocking concentration of isosakuranetin. In one embodiment, an inhibitor is a compound that reduces fluorescence by at least as much as a saturating concentration of isosakuranetin (i.e. maximal inhibition with isosakuranetin).
Property 2 is measured in an electrophysiological assay such as patch clamp or using an automated electrophysiology platform. These assays are well known in the art and several automated electrophysiology platforms are available commercially, for example the IONWORKS platforms, PATCHXPRESS, IONFLUX, QPATCH HT/HTX, PATCHLINER and SYNCHROPATCH platforms.
Accordingly, an inhibitor of human TRPM3 can be identified by a method comprising measuring the current increases in a cell line expressing human TRPM3 following challenge with an agonist of human TRPM3 in the presence and absence of a test inhibitor, wherein the test inhibitor is identified as an inhibitor for human TRPM3 if the increase in current is reduced in the presence of the test inhibitor compared to the increase achieved in the absence of the test inhibitor. In one embodiment, the change in current is measured at a membrane potential of between +/-80mV. In particular embodiments, the change in current is measured at a membrane potential of -80mV, - 70mV, -60mV, -50mV, -40mV, -30mV, -20mV, -lOmV, OmV, +10mV, +20mV, +30mV, +40mV, +50mV, +60mV, +70mV or +80mV. In one embodiment, the change in current is measured at a membrane potential of -80mV. In an alternative ambodiment, the change in current is measured at a membrane potential of +80mV. In certain embodiments, mean changes in current are measured.
The assays to assess properties 1 and 2 utilise cell lines expressing human TRPM3. Primary or immortalised cell lines endogenously expressing human TRPM3 may be used. In one embodiment, the SHSY-5Y cell line may be used. In another embodiment, transient and stable cell lines expressing recombinant human TRPM3 may be prepared by conventional means. In one embodiment, the invention provides a cell line stably expressing recombinant human TRPM3.
The production of a HEK293 cell line expressing the human TRPM3 variant i (SEQ ID NO: 11) is described in by Zhao and colleagues supra.. Further cell lines expressing TRPM3 variants are disclosed in WO200526317.
The assays to assess properties 1 and 2 may be conducted using a cell line expressing a recombinant human TRPM3 variant comprising one or more amino acid substitutions at residues selected from the group consisting of R1670, A1645, R1457, D602, K774, S1678, Y378, V990 and P1090 (numbering based on SEQ ID NO:2). In one embodiment, the cell line expresses a recombinant human TRPM3 variant having one, two or three of the following substitutions R1670Q, A1645V, R1457Q, D602V, K774R, S1678F, Y378C, V990M and P1090Q (numbering based on SEQ ID NO:2). In one embodiment, the cell line expresses a recombinant human TRPM3 variant comprising the amino acid substitution R1670Q (numbering based on SEQ ID NO:2).
The assays to assess properties 1 and 2 may be conducted using a cell line expressing recombinant human TRPM3 variant having the sequence set out in SEQ ID NO: 2, a processed version of SEQ ID NO:2 lacking the initial methionine residue, or a variant of SEQ ID NO: 2 or the processed version of SEQ ID NO: 2 comprising one two or three amino acid substitutions compared to the sequence set out in SEQ ID NO:2. In one embodiment, cell line expresses recombinant human TRPM3 variant having the sequence set out in SEQ ID NO: 2, a processed version of SEQ ID NO:2 lacking the initial methionine, or a variant of SEQ ID NO: 2 or the processed version of SEQ ID NO: 2 which has one, two or three amino acid substitutions at residues selected from the group consisting of R1670, A1645, R1457, D602, K774, S1678, Y378, V990 and P1090 (numbering based on SEQ ID NO:2). In one embodiment, the cell line expresses recombinant human TRPM3 varianthaving the sequence set out in SEQ ID NO: 2, a processed version of SEQ ID NO:2, or a variant of SEQ ID NO: 2 or the processed version of SEQ ID NO: 2 which has one, two or three of the following substitutions R1670Q, A1645V, R1457Q, D602V, K774R, S1678F, Y378C, V990M and P1090Q (numbering based on SEQ ID NO:2). In a more particular embodiment, the cell line is formed by transient transfection of DNA encoding the human TRPM3 varianthaving the sequence set out in SEQ ID NO: 2, a processed version of SEQ ID NO:2 lacking the initial methionine, or a variant of SEQ ID NO:2 or the processed version of SEQ ID NO: 2 comprising the amino acid substitution R1670Q. In one embodiment, the cell line is formed by transient transfection of DNA encoding the human TRPM3 variant having the sequence set out in SEQ ID NO: 2. In another embodiment, the cell line is formed by transient transfection of DNA encoding the human TRPM3 varianthaving the sequence of SEQ ID NO:2 comprising the amino acid substitution R1670Q. In another embodiment, the cell line stably expresses the human TRPM3 varianthaving the sequence set out in SEQ ID NO: 2, a processed version of SEQ ID NO:2 lacking the initial methionine or a variant of SEQ ID NO:2 or the processed version of SEQ ID NO: 2 comprising the amino acid substitution R1670Q. In one embodiment, the cell line stably expresses the human TRPM3 varianthaving the sequence set out in SEQ ID NO: 2 or a processed version of SEQ ID NO: 2 lacking the initial methionine. In one embodiment, the cell line stably expresses the human TRPM3 variant that has the sequence of SEQ ID NO:2 or the processed form of SEQ ID NO:2 lacking the initial methionine, comprising the amino acid substitution R1670Q.
In further embodiments of the above cell lines, the cell line also stably expresses a genetically encoded calcium indicator. In one embodiment, the cell line is a human cell line. In one embodiment, the assays described above are conducted in this cell line. The cell lines described herein may be used in the identification of an inhibitor of human TRPM3.
Property 3) utilises primary cell cultures derived from freshly extracted dorsal root ganglia or trigeminal ganglia from rats or mice, or samples of the brain stem containing the trigeminal nucleus caudalis itself isolated from rats or mice. CGRP is measured in the incubation fluid. The CGRP content of the incubation fluid may be measured by methods known in the art. A suitable enzyme immunoassay kits with a detection threshold of 5 pg/mL is commercially available (Bertin Pharma) which permits the media to be photometrically analyzed. Example 2 exemplifies a suitable assay.
Property 4) utilises primary cell cultures derived from freshly extracted dorsal root ganglia or trigeminal ganglia from rats or mice, or samples of the brain stem containing the trigeminal nucleus caudalis itself isolated from rats or mice. PACAP is measured in the incubation fluid. The PACAP content of the incubation fluid is measured indirectly. The conditioned media is incubated with PACl-receptor expressing CHO cells, binding of PACAP to PAC1 receptor induces concentration dependent cAMP production that may be measured using a homogeneous time-resolved fluorescence resonance energy transfer (TR-FRET) immunoassay. A suitable TR-FRET cAMP assay is commercially available from (Perkin Elmer). Example 2 exemplifies a suitable assay.
In one aspect, the invention provides a method for identifying an inhibitor of human TRPM3, comprising measuring release of PACAP from dorsal root ganglia, trigeminal ganglia or the trigeminal nucleus caudalis, or from primary cultures of cells isolated from dorsal root ganglia or trigeminal ganglia, following challenge with an agonist of human TRPM3 in the presence or absence of a test inhibitor, wherein the test inhibitor is identified as an inhibitor for human TRPM3 if PACAP production is reduced in the presence of the test inhibitor compared to PACAP production in the absence of the test inhibitor.
In one embodiment, the method uses primary cultures of cells isolated from dorsal root ganglia or trigeminal ganglia (Ze., cells isolated from dorsal root ganglia or trigeminal ganglia and placed into culture). In one embodiment, the method uses primary cultures of cells isolated from trigeminal ganglia. In one embodiment, the method uses primary cultures of cells in multiwell plates. In another embodiment, the method uses samples of the brain stem containing the trigeminal nucleus caudalis.
In one embodiment, an inhibitor of human TRPM3 reduces PACAP levels by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90%. In one embodiment, an inhibitor of human TRPM3 reduces PACAP levels by at least as much as a blocking concentration of isosakuranetin.
Property 5) utilises primary cell cultures derived from freshly extracted dorsal root ganglia or trigeminal ganglia from rats or mice, or samples of the brain stem containing the trigeminal nucleus caudalis itself isolated from rats or mice. Substance P is measured in the incubation fluid. The substance P content of the incubation fluid may be measured by methods known in the art. A suitable ELISA kit is commercially available from Cayman Chemicals. Example 2 exemplifies a suitable assay.
Property 6) may be assessed in a suitable animal model, for example the five-day rat dural infusion migraine model described in Example 4. The level of facial allodynia is lower in the presence of an inhibitor of human TRPM3 compared to that observed in the absence of the inhibitor of human TRPM3. In a particular embodiment, the reduction in facial allodynia is measured using von Frey filaments. In particular embodiments, an inhibitor of humant TRPM3 reduces the von Frey threshold on a particular day following infusion by 0.5 g, 1 g, 1.5 g, or 2 g. In certain embodiment, the reduction is measured from day 0 to day 14 post the completion of infusion. In particular embodiments, the reduction is measured on day 0, day 3, day 6, day 9 or day 12.
Any compound capable of promoting calcium ion influx in a cell line expressing human TRPM3 may be used as the agonist in the assays described supra. In one embodiment, the influx is mediated by human TRPM3. In one embodiment, the agonist is pregnenolone sulfate or CIM0216 (racemate of 2- (3,4-dihydroquinolin-l(2H)-yl)-/V-(5-methylisoxazol-3-yl)-2-phenylacetamide). In a particular embodiment, pregnenolone sulfate is used at a concentration in the range from 1 to 300 μM in the assays measuring properties 1-5. In a particular embodiment, pregnenolone sulfate is used at a concentration of about 100 μM in the assays measuring properties 1-5. In another embodiment, CIM0216 is used at a concentration in the range from 0.1 to 30 μM, more particularly in the range from 6 to 10 μM in the assays measuring properties 1-5. In one embodiment, CIM0216 or the R or S isomers thereof are used at a concentration of about 6 μM in the assays measuring properties 1-4. In another embodiment, CIM0216 or the R or S isomers thereof are used at a concentration of about 10 μM in the assays measuring properties 1-5. For dural infusion to measure property 6, pregnenolone sulfate is used at 5 mM/rat/day or CIM0216 or the R or S isomers thereof are used at 215μM/rat/day. In another embodiment, CIM0216 or the R or S isomers thereof are used at a concentration of 215μM/rat/day for dural infusion to measure property 6.
THERAPEUTIC USE
In one embodiment, the invention provides an inhibitor of human TRPM3 as discussed herein for use in the treatment of migraine in a human subject whose migraines are not responsive to CGRP inhibition. In this context, treatment of migraine refers to the symptomatic treatment of acute migraine. Migraines may present with or without aura or visual disturbances. In one embodiment, the invention provides an inhibitor of human TRPM3 for use in the treatment of migraine with aura or visual disturbances in a human subject whose migraines are not responsive to CGRP inhibition. In an alternative embodiment, the invention provides an inhibitor of human TRPM3 for use in the treatment of migraine without aura or visual disturbances in a human subject whose migraines are not responsive to CGRP inhibition.
For the avoidance of doubt, human subjects whose migraines are not responsive to CGRP inhibition is not limited to human subjects that have previously been prescribed a CGRP inhibitor and found it to lack efficacy, and additionally encompasses individuals that have not previously been prescribed a CGRP inhibitor, but, whose migraines would nonetheless not respond to such treatment options. Example 5 suggests that this includes over 10% of all migraineurs. However, in one embodiment, the invention comprises treating human subjects that have previously failed treatment with an antagonist of CGRP. Such patients can be readily by identified by a review of their clinical history. A suitable questionnaire to identify CGRP non responders is given in Example 5.
In one embodiment, the invention provides an inhibitor of human TRPM3 as discussed herein for use in the treatment of migraine in a human subject whose migraines are responsive to therapy with a triptan. In this context, treatment of migraine refers to the symptomatic treatment of acute migraine. Migraines may present with or without aura or visual disturbances. In one embodiment, the invention provides an inhibitor of human TRPM3 for use in the treatment of migraine with aura or visual disturbances in a human subject whose migraines are responsive to therapy with a triptan. In an alternative embodiment, the invention provides an inhibitor of human TRPM3 for use in the treatment of migraine without aura or visual disturbances in a human subject whose migraines are responsive to therapy with a triptan.
For the avoidance of doubt, human subjects whose migraines are responsive to a triptan is not limited to human subjects that have previously been prescribed and responded to a triptan, but additionally encompasses individuals that have not previously been prescribed a triptan, but, whose migraines would nonetheless respond to such treatment. However, in one embodiment, the invention comprises treating human subjects that have previously been treated with a triptan and self reported a clinical response. Such patients can be readily by identified by a review of their clinical history.
In one embodiment, the triptan is a triptan selected from the group consisting of: almotriptan, eletriptan, frovatriptan, naratriptan, rizatriptan, sumatriptan and zolmitriptan. In a more particular embodiment, the triptan is sumatriptan.
In particular embodiments, the invention provides an inhibitor of human TRPM3 as discussed herein for use in the treatment of migraine in a human subject whose migraines are not responsive to CGRP inhibition, but are responsive to therapy with a triptan.
In one embodiment, a therapeutically effective amount of an inhibitor of human TRPM3 is administered to the human subject. In this context, the term "therapeutically effective amount" refers to the quantity of the inhibitor of human TRPM3 that is required for symptomatic treatment of acute migraine. It may vary depending on the compound, migraine severity and the age and weight of the subject to be treated.
In one embodiment, treatment of acute symptomatic migraine refers to the situation where the percentage of patients that are pain free 2 hours after administration of the inhibitor of human TRPM3 is higher for a population of patients receiving the inhibitor of human TRPM3 compared to a population of patients receiving placebo. In this context, "pain free" is a patient reported measure.
In one embodiment, the percentage of patients that are pain free 2 hours after administration of the inhibitor of human TRPM3 is 10% or higher (compared to placebo).
In another embodiment, treatment of acute symptomatic migraine refers to the situation where the percentage of patients that have no headache pain 2 hours after administration of the inhibitor of human TRPM3 and have no relapse of headache pain within 24 hours after administration of the inhibitor of human TRPM3 is higher compared to a population of patients receiving placebo. Headache pain is a patient reported measure.
In one embodiment, the percentage of patients that have no headache pain 2 hours after administration of the inhibitor of human TRPM3 and have no relapse of headache pain within 24 hours after administration of the inhibitor of human TRPM3 is 10% or higher (compared to placebo).
In another embodiment, treatment of acute symptomatic migraine refers to the situation where the percentage of patients that have no headache pain 2 hours after administration of the inhibitor of human TRPM3 and have no relapse of headache pain within 48 hours in a population of patients receiving the the inhibitor of human TRPM3 is higher compared to a population of patients receiving placebo. Again, headache pain is a patient reported measure.
In one embodiment, the percentage of patients that have no headache pain 2 hours after administration of the inhibitor of human TRPM3 and have no relapse of headache pain within 48 hours after administration of the inhibitor of human TRPM3 is 10% or higher (compared to placebo).
In one embodiment, the inhibitor of human TRPM3 is administered in combination with at least one other therapeutic agent selected from: a triptan, an ergot, a non-steroidal anti-inflammatory drug, an acetaminophen containing product, a butalbital containing product, an anti-emetic, caffeine, dexamethasone, ubrogepant, rimegepant and lasmiditan.
In one embodiment, the inhibitor of human TRPM3 is administered in combination with a triptan selected from the group consisting of: almotriptan, eletriptan, frovatriptan, naratriptan, rizatriptan, sumatriptan and zolmitriptan. In a more particular embodiment, the inhibitor of human TRPM3 is administered in combination with sumatriptan. In a more particular embodiment, the inhibitor of human TRPM3 is administered in combination with oral sumatriptan at a maximum dose of 200 mg/day.
In one embodiment, the inhibitor of human TRPM3 is administered in combination with a non-steroidal anti-inflammatory drug selected from the group consisting of diclofenac, ibuprofen, naproxen and ketorolac.
In one embodiment, the inhibitor of human TRPM3 is administered in combination with an anti-emetic selected from the group consisting of: promethazine, prochlorperazine, metoclopramide, trimethobenzamide and ondansetron.
The inhibitor of human TRPM3 and any other therapeutic agent(s) may be administered together or separately and, when administered separately, administration may occur simultaneously or sequentially, in any order. The amounts of inhibitor of human TRPM3 of the present invention and the other therapeutic agent(s) and the relative timings of administration will be selected in order to achieve the desired combined therapeutic effect. Simultaneous administration may be achieved by administration of (1) a unitary pharmaceutical composition including the therapeutic agents; or (2) simultaneous administration of separate pharmaceutical compositions each including one of the therapeutic agents. Alternatively, the combination may be administered separately in a sequential manner wherein one treatment agent is administered first and the other second or vice versa. Such sequential administration may be close in time or remote in time. The amounts of the inhibitor of human TRPM3 of the invention and the other therapeutic agent(s) and the relative timings of administration will be selected in order to achieve the desired combined therapeutic effect.
In one embodiment, the invention provides a method of treating acute symptomatic migraine in a human subject comprising the steps of: a) identifying a a human subject whose migraines are not responsive to CGRP inhibition; and b) administering a therapeutically effective amount of an inhibitor of human TRPM3 as defined herein to the subject; whereby the acute symptomatic migraine in the subject is treated.
In one embodiment, the invention provides a method of treating acute symptomatic migraine in a human subject comprising the steps of: a) identifying a a human subject whose migraines are responsive to therapy with a triptan; and b) administering a therapeutically effective amount of an inhibitor of human TRPM3 as defined herein to the subject; whereby the acute symptomatic migraine in the subject is treated.
In one embodiment, the invention provides a method for decreasing the level of PACAP in cranial blood in a subject comprising the steps of: a) identifying a subject with migraine; and b) administering a therapeutically effective amount of an inhibitor of human TRPM3 as defined herein to the subject; whereby the level of PACAP in the cranial blood of the subject is decreased.
In another embodiment, the invention provides a method for decreasing the level of PACAP in the systemic circulation of a subject comprising the steps of: a) identifying a subject with migraine; and b) administering a therapeutically effective amount of an inhibitor of human TRPM3 as defined herein to the subject; whereby the level of PACAP in the systemic circulation of the subject is decreased.
Certain embodiments of the methods for decreasing PACAP may further comprise the steps of: a) making a first measurement of the level of PACAP in a relevant blood sample; b) making a second measurement of the level of PACAP in a relevant blood sample after administering to the subject a therapeutically effective amount of the inhibitor of human TRPM3; and c) comparing the first measurement and second measurement.
In certain embodiments of the methods for decreasing the level of PACAP, the subject is a subject that carries a mutated version of human TRPM3 wherein the mutated verion of human TRPM3 has one or more of the following amino acid substitutions: R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2).
Certain embodiments of the methods for decreasing the level of PACAP may further comprise the steps of: determining whether the subject carries a mutated version of human TRPM3 wherein the mutated verion of human TRPM3 has one or more of the following amino acid substitutions: R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2). These steps may take place before step (a) in the above methods.
PROPHYLACTIC USE In one aspect of the invention, the invention provides an inhibitor of human TRPM3 for use in the prevention of migraine in a human subject whose migraines are not responsive to CGRP inhibition. In one embodiment, the invention provides an inhibitor of human TRPM3 for use in the prevention of chronic migraine in a human subject whose migraines are not responsive to CGRP inhibition.
For the avoidance of doubt, human subjects whose migraines are not responsive to CGRP inhibition is not limited to human subjects that have previously been prescribed a CGRP inhibitor and found it to lack efficacy, and additionally encompasses individuals that have not previously been prescribed a CGRP inhibitor, but, whose migraines would nonetheless not respond to such treatment options. Example 5 suggests that this includes over 10% of all migraineurs. However, in one embodiment, the invention comprises treating human subjects that have previously failed treatment with an antagonist of CGRP. Such patients can be readily by identified by a review of their clinical history. A suitable questionnaire to identify CGRP non responders is given in Example 5.
In one embodiment, the invention provides an inhibitor of human TRPM3 as discussed herein for use in the prevention of migraine in a human subject whose migraines are responsive to therapy with a triptan. In one embodiment, the invention provides an inhibitor of human TRPM3 for use in the prevention of chronic migraine in a human subject whose migraines are responsive to therapy with a triptan.
For the avoidance of doubt, human subjects whose migraines are responsive to a triptan is not limited to human subjects that have previously been prescribed and responded to a triptan, but additionally encompasses individuals that have not previously been prescribed a triptan, but, whose migraines would nonetheless respond to such treatment. However, in one embodiment, the invention comprises treating human subjects that have previously been treated with a triptan and self reported a clinical response. Such patients can be readily by identified by a review of their clinical history.
In one embodiment, the triptan is a triptan selected from the group consisting of: almotriptan, eletriptan, frovatriptan, naratriptan, rizatriptan, sumatriptan and zolmitriptan. In a more particular embodiment, the triptan is sumatriptan.
In particular embodiments, the invention provides an inhibitor of human TRPM3 as discussed herein for use in the prevention of migraine in a human subject whose migraines are not responsive to CGRP inhibition, but are responsive to therapy with a triptan.
In one embodiment, a therapeutically effective amount of an inhibitor of human TRPM3 is administered to the human subject. In this context, the term "therapeutically effective amount" refers to the quantity of the inhibitor of human TRPM3 that is required for migraine prevention (e.g. prevention of chronic migraine). It may vary depending on the compound, the mean number of migraine days/month, and the age and weight of the subject to be treated.
In one embodiment, prevention of migraine refers to the situation where the reduction in mean monthly migraine days is greater for a population of patients receiving the inhibitor of TRPM3 compared to placebo.
In one embodiment, the reduction in mean monthly migraine days in a population of patients receiving the inhibitor of TRPM3 is at least 1, in a further embodiment, at least 2, in a further embodiment, at least 3 and in a further embodiment, at least 4.
In one embodiment, prevention of migraine refers to the situation where the 50% responder rate is higher for a population of patients receiving the inhibitor of TRPM3 compared to placebo.
In one embodiment, the 50% responder rate in patients receiving the inhibitor of TRPM3 is 20% higher for a population of patients receiving the inhibitor of TRPM3 compared to placebo. In a further embodiment, the 50% responder rate in patients receiving the inhibitor of TRPM3 is 25% higher for a population of patients receiving the inhibitor of TRPM3 compared to placebo.
In one embodiment, the invention provides a method of preventing migraine in a human subject comprising the steps of: c) identifying a a human subject whose migraines are not responsive to CGRP inhibition; and d) administering a therapeutically effective amount of an inhibitor of human TRPM3 as defined herein to the subject; whereby migraine is prevented in the subject.
In one embodiment, the invention provides a method of preventing migraine in a human subject comprising the steps of: c) identifying a a human subject whose migraines are responsive to therapy with a triptan; and d) administering a therapeutically effective amount of an inhibitor of human TRPM3 as defined herein to the subject; whereby migraine is prevented in the subject.
In one embodiment, the inhibitor of human TRPM3 is administered in combination with at least one other therapeutic agent selected from: botulinum toxin A, a CGRP inhibitor, an anticonvulsant, a 0- blocker, an antidepressant and a non-steroidal anti-inflammatory drug. In one embodiment, the inhibitor of human TRPM3 is administered in combination with at least one other therapeutic agent selected from: valproate, divalproex sodium, amitriptyline, topiramate, venlafaxine, metoprolol, propranolol and timolol.
IDENTIFICATION OF PATIENTS FOR PROPHYLACTIC OR THERAPEUTIC TREATMENT
In one aspect, the invention provides a method for identifying whether a human subject that has migraines that are not responsive to CGRP inhibition and/or are responsive to triptans is a candidate for treatment with an inhibitor of human TRPM3, comprising: a) sequencing a human TRPM3 gene in the human subject; b) comparing the sequence with the sequences of the human TRPM3 exons set out in SEQ ID NOs: 38-69 and identifying whether changes would modify the amino acid sequence of any isoform; wherein, if a change in amino acid sequence is identified, the human subject is a candidate for treatment with an inhibitor of human TRPM3.
In one embodiment, the human subject has migraines that are not responsive to CGRP inhibition.
In one embodiment, the human subject has migraines that are responsive to a triptan.
In one embodiment, the human subject has migraines that are not responsive to CGRP inhibition and that are responsive to a triptan.
In one embodiment, the changes to the amino acid sequence are selected the group consisting of: R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2). In one embodiment, the change to the amino acid sequence is R1670Q (numbering based on SEQ ID NO: 2).
In particular embodiments, the treatment will be acute symptomatic treatment of migraine. In another embodiment, the treatment will be for the prevention of migraine.
In related aspects, the invention provides an inhibitor of human TRPM3 for use in the treatment or prevention of migraine in a candidate for treatment with an inhibitor of human TRPM3. The invention also provides use of an inhibitor of human TRPM3 for use in the manufacture of a medicament for use in the treatment or prevention of migraine in a candidate for treatment with an inhibitor of human TRPM3. The invention also provides a method for treating or preventing migraine in a patient in need thereof, comprising administering an inhibitor of human TRPM3 to a human subject that is identified as a candidate for treatment with an inhibitor of human TRPM3.
Accordingly, the invention provides a method for migraine prevention, which comprises the following steps: a) sequencing the human TRPM3 gene in a human subject whose migraines are not responsive to CGRP inhibition and/or responsive to triptans to obtain a sequence; b) comparing the sequence with the sequences of the human TRPM3 exons set out in SEQ ID NOs: 38-69 and identifying whether changes would modify the amino acid sequence of any isoform wherein, if a change in amino acid sequence is identified, the human subject is a candidate for treatment with an inhibitor of human TRPM3; c) administering to the human subject that is a candidate for treatment with an inhibitor of human TRPM3 a therapeutically effective amount of an inhibitor of human TRPM3.
In one embodiment, the human subject has migraines that are not responsive to CGRP inhibition.
In one embodiment, the human subject has migraines that are responsive to triptans.
In one embodiment, the changes to the amino acid sequence are selected the group consisting of: R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2). In one embodiment, the change to the amino acid sequence is R1670Q (numbering based on SEQ ID NO: 2).
COMBINATION THERAPY
The inhibitor of human TRPM3 and any other therapeutic agent(s) may be administered together or separately and, when administered separately, administration may occur simultaneously or sequentially, in any order. The amounts of inhibitor of human TRPM3 of the present invention and the other therapeutic agent(s) and the relative timings of administration will be selected in order to achieve the desired combined therapeutic effect. Simultaneous administration may be achieved by administration of (1) a unitary pharmaceutical composition including the therapeutic agents; or (2) simultaneous administration of separate pharmaceutical compositions each including one of the therapeutic agents. Alternatively, the combination may be administered separately in a sequential manner wherein one treatment agent is administered first and the other second or vice versa. Such sequential administration may be close in time or remote in time. The amounts of the inhibitor of human TRPM3 of the invention and the other therapeutic agent(s) and the relative timings of administration will be selected in order to achieve the desired combined therapeutic effect.
CLUSTER HEADACHE
In one aspect, the invention provides an inhibitor of human TRPM3 for use in the treatment or prevention of cluster headache in a human subject whose headaches are not responsive to CGRP inhibition and/or are responsive to therapy with a triptan..
For the avoidance of doubt, human subjects whose headaches are not responsive to CGRP inhibition is not limited to human subjects that have previously been prescribed a CGRP inhibitor and found it to lack efficacy, and additionally encompasses individuals that have not previously been prescribed a CGRP inhibitor, but, whose headaches would nonetheless not respond to such treatment options. However, in one embodiment, the invention comprises treating human subjects that have previously failed treatment with an antagonist of CGRP. Such patients can be readily identified by a review of their clinical history.
For the avoidance of doubt, human subjects whose headaches are responsive to therapy with a triptan is not limited to human subjects that have previously been prescribed and responded to a triptan, but additionally encompasses individuals that have not previously been prescribed a triptan, but, whose headaches would nonetheless respond to such treatment. However, in one embodiment, the invention comprises treating human subjects that have previously been treated with a triptan and self reported a clinical response. Such patients can be readily by identified by a review of their clinical history.
In one particular embodiment, the headaches are not responsive to CGRP therapy and are responsive to therapy with a triptan.
In one embodiment, the triptan is a triptan selected from the group consisting of: almotriptan, eletriptan, frovatriptan, naratriptan, rizatriptan, sumatriptan and zolmitriptan. In a more particular embodiment, the triptan is sumatriptan.
In one embodiment, the inhibitor of human TRPM3 is for use in the treatment of cluster headache. In another embodiment, the inhibitor of human TRPM3 is for use in the prevention of cluster headache.
In one embodiment, the human subject has a TRPM3 allele with a gain of function mutation. In a more particular embodiment, the mutated version of human TRPM3 has one or more of the following amino acid substitutions is R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2).
MEDICATION OVERUSE HEADACHE In one aspect, the invention provides an inhibitor of human TRPM3 for use in the treatment of medication overuse headache in a human subject. In a particular embodiment, the medication overuse headache is opioid induced medication overuse headache. This condition may alternatively be referred to as opioid induced hyperalgesia. In a more particular embodiment, the opioid induced medication overuse headache/opioid induced hyperalgesia is induced by opioids acting at the the mu opioid receptor. In another embodiment, the medication overuse headache is triptan induced medication overuse headache. In a more particular embodiment, the triptan is sumatriptan.
In one embodiment, the human subject has a TRPM3 allele with a gain of function mutation. In a more particular embodiment, the mutated version of human TRPM3 has one or more of the following amino acid substitutions is R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2).
PHARMACEUTICAL COMPOSITIONS/ROUTES OF ADMINISTRATION/DOSAGES
An inhibitor of human TRPM3 may be administered by any convenient route. In particular embodiments, the inhibitor of human TRPM3 may be administered by orally, parenterally, intranasally or by inhalation. In one embodiment, the inhibitor of human TRPM3 is administered in a pharmaceutical composition. In one embodiment, the inhibitor of human TRPM3 is formulated in a pharmaceutical composition adapted for oral or parenteral administration, or for administration intranasally or by inhalation. Appropriate doses will readily be appreciated by those skilled in the art.
According to one aspect, the invention provides a pharmaceutical composition comprising an inhibitor of human TRPM3 and a pharmaceutically acceptable excipient. According to another aspect, the invention provides a process for the preparation of a pharmaceutical composition comprising admixing an inhibitor of human TRPM3 with a pharmaceutically acceptable excipient.
Pharmaceutical formulations adapted for oral administration may be presented as discrete units such as capsules or tablets; powders or granules; solutions or suspensions in aqueous or non-aqueous liquids; edible foams or whips; or oil-in-water liquid emulsions or water-in-oil liquid emulsions.
Pharmaceutical formulations adapted for nasal administration can comprise a coarse powder having a particle size for example in the range 20 to 500 microns which is administered in the manner in which snuff is taken, i.e., by rapid inhalation through the nasal passage from a container of the powder held close up to the nose. Suitable formulations wherein the carrier is a liquid, for administration as a nasal spray or as nasal drops, include aqueous or oil solutions of the inhibitor of human TRPM3. Pharmaceutical formulations adapted for administration by inhalation include fine particle dusts or mists, which may be generated by means of various types of metered, dose pressurized aerosols, nebulizers or insufflators.
Pharmaceutical formulations adapted for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and nonaqueous sterile suspensions which may include suspending agents and thickening agents. The formulations may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets.
It should be understood that in addition to the ingredients particularly mentioned above, the formulations described herein may include other agents conventional in the art having regard to the type of formulation in question, for example those suitable for oral administration may include flavouring agents.
The present disclosure also provides unitary pharmaceutical compositions in which the inhibitor of human TRPM3 one or more other therapeutic agent(s) may be administered together. When an inhibitor of human TRPM3 is used in combination with a second therapeutic agent, the dose of each therapeutic agent may differ from the dose of that therapeutic agent when used alone.
In one embodiment, the disclosure provides a pharmaceutical composition comprising an inhibitor of human TRPM3, at least one other therapeutic agent selected from: a triptan, an ergot, a nonsteroidal anti-inflammatory drug, an acetaminophen containing product, a butalbital containing product, an anti-emetic, caffeine, dexamethasone, ubrogepant and lasmiditan, and a pharmaceutically acceptable excipient. In a more particular embodiment, the pharmaceutical composition comprises an inhibitor of human TRPM3, a triptan selected from the group consisting of: almotriptan, eletriptan, frovatriptan, naratriptan, rizatriptan, sumatriptan and zolmitriptan and a pharmaceutically acceptable excipient. In a more particular embodiment, the pharmaceutical composition comprises an inhibitor of human TRPM3, sumatriptan and a pharmaceutically acceptable excipient.
In another embodiment, the pharmaceutical composition comprises an inhibitor of human TRPM3, a non-steroidal anti-inflammatory drug selected from the group consisting of diclofenac, ibuprofen, naproxen and ketorolac and a pharmaceutically acceptable excipient. In a further embodiment, the pharmaceutical composition comprises an inhibitor of human TRPM3, an anti-emetic selected from the group consisting of: promethazine, prochlorperazine, metoclopramide, trimethobenzamide and ondansetron and a pharmaceutically acceptable excipient.
In one embodiment, the pharmaceutical composition comprises an inhibitor of human TRPM3, at least one other therapeutic agent selected from: botulinum toxin A, a CGRP inhibitor, an anticonvulsant, a β-blocker, an antidepressant and a non-steroidal anti-inflammatory drug, and a pharmaceutically acceptable excipient.
In one embodiment the pharmaceutical composition comprises an inhibitor of human TRPM3, at least one other therapeutic agent selected from: valproate, divalproex sodium, amitriptyline, topiramate, venlafaxine, metoprolol, propranolol and timolol, and a pharmaceutically acceptable excipient.
In one embodiment, the pharmaceutical composition comprises an inhibitor of human TRPM3, at least one other therapeutic agent selected from: carbamazepine and oxcarbazepine, and a pharmaceutically acceptable excipient.
EXAMPLES
Example 1: Genome Wide Association Study in Individuals with Migraine
Genome wide association study (GWAS) of individuals diagnosed with migraine identified a genetic region in the TRPM3 locus reaching the accepted genome-wide statistical threshold of p < 5xl0-8 on human chromosome 9.
GWAS Analysis
We computed association test results for the genotyped and the imputed SNPs. We performed association testing using logistic regression, assuming additive allelic effects. For tests using imputed data, we use the imputed dosages rather than best-guess genotypes. We included covariates for age, sex, and the top five principal components to account for residual population structure. The association test P value was computed using a likelihood ratio test, which in our experience is better behaved than a Wald test on the regression coefficient.
All individuals included in the analyses provided informed consent and answered surveys online according to our human subject protocol, which was reviewed and approved by Ethical & Independent Review Services, a private institutional review board (http://www.eandireview.com).
Genotyping and SNP Imputation DNA extraction and genotyping were performed on saliva samples by CLIA-certified and CAP- accredited clinical laboratories of Laboratory Corporation of America. Samples were genotyped on one of five genotyping platforms. The VI and V2 platforms were variants of the Illumina HumanHap550 + BeadChip and contained a total of about 560,000 SNPs, including about 25,000 custom SNPs selected by 23andMe. The V3 platform was based on the Illumina OmniExpress + BeadChip and contained a total of about 950,000 SNPs and custom content to improve the overlap with our V2 array. The V4 platform is a fully custom array and includes a lower redundancy subset of V2 and V3 SNPs with additional coverage of lower-frequency coding variation, and about 570,000 SNPs. The V5 platform, in current use, is an Illumina Infinium Global Screening Array of about 640,000 SNPs supplemented with about 50,000 SNPs of custom content. Samples that failed to reach 98.5% call rate were re-analyzed. Individuals whose analyses failed repeatedly were re-contacted by 23andMe customer service to provide additional samples, as is done for all 23andMe customers.
Variants were imputed using two separate imputation reference panels. One included a larger number of samples, but did not include insertion or deletion variants. The other included a smaller number of individuals, but included insertion and deletion variants. Phased participant data was generated using an internally-developed tool based on Beagle (Browning, S.R. & Browning, B.L., Rapid and accurate Haplotype Phasing and Missing Data Interference for Whole Genome Association Studies Using Localized Haplotype Clustering, Am. J. Hum. Genet., 81: 1084-1097 (2007)) or a new phasing algorithm, Eagle2 (Loh, P.r. et a. I, Fast and accurate Long-Range Phasing ina UK Biobank Cohort, Nature Genetics, 48: 811-6 (2016)). We imputed phased participant data against both reference panels using Minimac3 (Das, S. et al., Next-generation genotype Imputation Service and Methods, Nat. Genet., 48: 1284-1287 (2016)) and then built a merged imputation dataset by combining the two sets of imputed data. A simple merging rule was applied: if a variant was imputed in the larger panel, the imputed results from the larger panel were included in the merged imputed dataset. For the remaining variants not present in the larger panel, the imputed results from the smaller panel were added to the merged dataset.
Results
We identified an independent association between migraine diagnosis and several SNPs near the TRPM3 C-terminus coding sequence. The sentinel SNP for migraine associations is the missense SNP rs6560142 (P = 5.9x10-10, OR = 1.020).
Figure 4 is a regional association plot for migraine diagnosis on chromosome 9 where the x- axis shows physical positions on human genome build GRCh37/hgl9 and the y-axes shows the -loglO of the p-value for association with migraine diagnosis. Each point in the depicted plots represents a genetic variant tested for association in the region. The grey horizontal line represents the genome wide significance threshold of 5xl0-8. Human genes in the region are depicted on the lower panel. These GWAS data indicate that the locus (genetic region) shown is implicated in susceptibility to migraine diagnosis in humans. In Figure 4, the trait analyzed was "migraine diagnosis" where "the cases" are individuals with a migraine diagnosis and "the controls" are individuals who did not have a migraine diagnosis.
A common genetic variant changing the amino acid sequence of the TRPM3 protein was found to be the lead SNP for this locus. This variant rs6560142 (dbSNP build 154 identifier) is located on chromosome 9 at position 73150984 (of the human genome build GRCh37/hgl9) and the observed frequency of the migraine diagnosis risk allele "T" is 0.56 in the research participant population with predominantly European ancestry (the protective allele "C" has a frequency of 0.44). This variant can also be described at the amino acid level in TRPM3, for example: Argl670Gln, (numbering based on SEQ ID NO: 2). The GWAS analysis identified the rs6560142 missense SNP in the TRPM3 coding region as the SNP in this locus with the lowest P value. Consequently, these data imply that TRPM3 has the highest probability of being the gene that is functionally responsible for the association between this locus and migraine diagnosis. Therefore, these novel GWAS data indicates that the TRPM3 protein and its functions contribute to migraine pathophysiology in humans.
Example 2 - Neuropeptide release from sensory ganglia
Dorsal root and trigeminal ganglion neuron cultures
Cultures were prepared from 8-13 week Trpm3 +I+ (Wild type), Trpm3-/- (knockout) C57BL/6NJ mice and Sprague Dawley rats. Following cervical dislocation and cardiac cessation, trigeminal ganglia (TG) and dorsal root ganglia (DRG) were removed and collected in ice cold dissociation media containing LEBOVITZ L-15 Medium, GLUTAMAX (Gibco). DRG and TG were incubated with 1 mg/ml type 1A collagenase (Sigma-Aldrich) for 15-30 min at 37°C. DRG and TG were then incubated with 1 mg/ml trypsin solution (Sigma-Aldrich) for 30 - 45 min. Digested ganglia were mechanically dissociated by trituration with a 1 ml pipette. Dissociated DRG were centrifuged at 200g for 5 min. The cell pellet was resuspended in L15 culture media and plated onto poly-D Lysine 96 well plates (Greiner bio-one) coated with 10 μg/ml laminin (Sigma-Aldrich) and cultured at 37 °C, 5% CO2. Dissociated TG were passed through a 70 μm cell strainer and overlaid onto 4% (w/v) BSA. Cells were collected after centrifugation and plated onto poly-D Lysine-laminin coated 96 well plates and cultured at 37°C, 5% CO2. CGRP and PACAP release experiments were conducted after 17-24 h in culture.
Neuropeptide release assay
To stimulate neuropeptide release, cells were incubated with TRPM3 agonist, either CIM0216 or pregnenolone sulfate (PS) for 30 min at 37°C. For inhibitor studies, cells were pre-incubated with TRPM3 inhibitor, isosa kuranetin for 30 min prior to addition of agonist. At the end of the incubation period, conditioned medium was collected for the detection of CGRP, PACAP and substance P.
Measurement of CGRP CGRP concentrations in conditioned media collected from TG and DRG neuron cultures were determined using an ELISA (Bertin bioreagent).
Measurement of PACAP
PACAP concentrations in conditioned medium collected from TG and DRG neuron cultures were determined indirectly. Conditioned medium was incubated with Chinese Hamster Ovary cells expressing the pituitary adenylate cyclase-activating polypeptide type I (PAC1) receptor (generated in house). Binding of PACAP to the PAC1 receptor induced cAMP production that was measured using a homogeneous time-resolved fluorescence resonance energy transfer (TR-FRET) immunoassay (Perkin Elmer). The TR-FRET signal was calibrated against a PACAP-38 standard curve.
Measurement of Substance P
Substance P concentrations in conditioned media collected from TG neuron cultures were determined using an ELISA (Cayman Chemicals).
Results - CGRP and PACAP release from DRG and TG cultures is modulated by TRPM3 ligands
To test whether activation of TRPM3 leads to neuropeptide release, cultured DRG and TG neurons were incubated with TRPM3 agonists CIM0216 or pregnenolone sulfate.
CIM0216 induced a concentration dependent release of CGRP from DRG (Fig. 1A and B) and TG (Fig. 3A) neurons. DRG and TG cultures were also responsive to pregnenolone sulfate, resulting in an increased release of CGRP; while a single concentration of PS (100 μM) was tested in DRG cultures (Fig. 1A), the response was demonstrated to be concentration dependent in TG cultures (Fig. 3B).
The ability of TRPM3 inhibitor isosakuranetin to antagonise CGRP release induced by CIM0216 and PS was evaluated. Pre-incubation with isosakuranetin inhibited the response to both agonists in DRG (Fig. 1A, B and C), and TG neuron cultures (Fig. 3A, B and C). TRPM3 activation in DRG neurons with either 6 μM or 10 μM CIM0216 (Fig. 2A, 2B respectively) was antagonised by isosakuranetin in a concentration dependent manner, resulting in reduced release of CGRP. In addition, isosakuranetin, 10 μM, reduced the release of CGRP to basal levels or below in the presence of 6 μM CIM0216 (Fig 2A) or 100 μM PS (Fig. 1A) in DRG cultures, or in the presence of CIM0216 (≤100 μM) or PS (≤100 μM) in TG cultures (Fig. 3A and B). These results demonstrate that activation of TRPM3 in DRG and TG neurons with synthetic ligand CIM0216 or neurosteroid pregnenolone sulfate leads to release of CGRP. The dose-dependent release of CGRP observed in wild type sensory neurons in response to pregnenolone sulfate and CIM0216 was absent from neurons derived from TRPM3 deficient animals (Fig 8 A-D). CGRP release from these neurons could be induced by capsaicin, a TRPV1 agonist, showing that CGRP release to stimuli of other TRP channels is maintained. These data demonstrate that CGRP release induced by PS and CIM0216 is dependent on TRPM3.
CIM0216 induced a concentration-dependent release of PACAP from rat TG cells (Fig. 11A). Figure 11B demonstrates concentration-dependent inhibition of the CIM0216 response by TRPM3 antagonist, isosakuranetin. Figure 12 shows activation of TRPM3 results in the release of PACAP from mouse isolated DRG (Fig.l2A, 12B) and TG cells (Fig. 12C, 12D). These responses were absent from Trpm3 knock out (KO) mouse cells and inhibited by the TRPM3 antagonist isosakuranetin (Fig. 12 A-D). Cells derived from Trpm3 knockout (Fig. 12, A-D) animals were still responsive to the TRPV1 agonist, capsaicin, showing that PACAP release to stimuli of other TRP channels is maintained.
These data demonstrate that PACAP release induced by pregnenolone sulfate and CIM0216 is dependent on TRPM3.
Concentration dependent release of substance P was observed in rat TG neuron cultures in response to CIM0216 (FIG 14A) and pregnenolone sulfate (Fig 14B). These responses were inhibited by isosakuranetin. These data show that in addition to CGRP and PACAP, Substance P is released in response to TRPM3 agonists.
Example 3 - Calcium mobilisation assay and cell lines
Calcium mobilisation assays were performed in HEK MSR II cells loaded with the calcium indicator dye Fluo4. The cells were induced to express TRPM3 (SEQ ID NO: 2) or mutants thereof by transducing them with Bacmam virus containing the codon optimised cDNA sequence for the required TRPM3 variant at a multiplicity of infection of approximately 40 for 48 hours prior to the experiment. Cells were incubated in the presence of FLUO4-AM and TRPM3 inhibitors for approx 1.5 hrs prior to transfer to a FLIPR where the cells were treated with TRPM3 agonists to induce calcium mobilisation. Fluo4 fluorescence was monitored for 10 min. As a positive control the cells were then treated with the calcium ionophore ionomycin and the fluorescence monitored for a further 3 min.
Figures 5, 6, 7 show results in calcium mobilisation assays using pregnenelone sulfate (Figs 5 and 7) and CIM0216 (Fig 6) as TRPM3 agonists, and isosakuranetin as a TRPM3 inhibitor.
Figure 9 shows pregnenolone sulfate induced concentration-dependent increases in FLUO4 fluorescence in cells expressing canonical TRPM3 (SEQ NO: 2) and a variant of SEQID NO: 2 having the R1670Q mutation. When transduced with equal multiplicities of infection of the relevant Bacmam viruses, the potency of pregnenolone sulfate was 1.8-fold greater at the R1670Q variant than at canonical and the maximal fold change in fluorescence was 26% larger. Thus pregnenolone sulfate is more able to activate the TRPM3 variant associated with increased likelihood of migraine diagnosis than the canonical form of the channel.
Figure 13 shows the agonist effect of the isomers of CIM0216 in a calcium mobilisation assay. The results show that the R-isomer ((R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3- yl)propenamide ) is a more potent agonist compared to the S-isomer ((S)-2-(3,4-dihydroquinolin- l(2H)-yl)-N-(5-methylisoxazol-3-yl)propenamide).
Example 4 - 5 Day Rat Dural Infusion Migraine Model
The five-day rat Dural infusion migraine model is based on repeated inflammatory dural stimulation to mimic the repeated activation of dural afferents believed to occur in patients with recurrent migraine headache. In this model, rats are tested in the periorbital region for mechanical allodynia (a pain response to stimuli which are not normally painful) using von Frey fibres, which are small calibrated fibres which deliver a calibrated amount of force. Historical data in this model shows mechanical nociception sensitivity, which is alleviated with sumatriptan and anti-CGRP therapies, current standard of care compounds, suggesting this model has clinical translation.
The surgery, infusion, and testing followed the modification of the method of Oshinsky & Gomoncharconsiri, 2007, supra. Briefly, rats were habituated and trained for 1-2 weeks and then fitted with a stainless-steel cannula (22GA, Plastics One) under isoflurane anaesthesia. A craniotomy was performed using lambda as a reference (the junction of the superior sagittal sinus and transverse sinus) by advancing 1.5mm right of lambda and 1mm anterior towards bregma via a 1 mm hole that was made in the skull to expose the dura. Special attention was given not to disturb the dura. A custom flange guide cannula (22GA, Plastics One) was inserted into the hole (cut 0.5 mm below pedestal). The cannula was fixed to the bone with small screws and dental cement. A dummy that extended just past the end of the cannula was inserted to prevent scar tissue from forming, and thus clogging the cannula. Animals were allowed 1-2 weeks of recovery before testing and infusions began.
Periorbital thresholds were monitored during the recovery period to ensure the thresholds returned to pre-surgery baselines. If animals did not return to baseline, they were excluded from the study. Extra animals were included to account for any post-surgery animal that needed to be excluded.
After recovering from surgery, animals were infused supra-durally with treatments according to Table 1 for 5 consecutive days. Under isoflurane, the animal's nose was place in the nose cone of the anaesthesia machine. Using a haemostat, the base of the flange cannula was clasped, and the dummy cannula was removed. A custom cannula injector was inserted into the flange cannula. With a Hamilton syringe and infusion pump at a rate of 1.759pl/min 15μ I of formulations was delivered supra-durally.
Animals were randomly assigned to a treatment group (A-C) using a software generated randomization scheme. From the first day of sensitization, each animal was tested routinely (every 2- 3 days) for changes in periorbital sensitivity by a blinded investigator.
Pre-infusion sensory testing occurred on Day 1 of the testing schedule to provide a point of comparison for subsequent testing. Sensory testing occurred according to the testing schedule established in Table 1, and prior to infusion when applicable. Sensory testing utilized von Frey filaments with reproducible calibrated buckling forces varying from 0.4 - 10g utilizing the Chaplan up and down method. Allodynia was tested by perpendicularly touching the periorbital region causing slight buckling of the filament for approximately 5 seconds. Based on the response pattern and the force of the final filament, the periorbital threshold (g) was calculated (Chaplan et al., 1994, Quantitative assessment of tactile allodynia in the rat paw. Journal of neuroscience methods, 53(1), 55-63). The supra-dural infusions were above the dura in the right brain hemisphere; therefore, the right periorbital threshold data only was recorded. A positive response was characterized by several behavioural criteria: stroking the face with a forepaw, head withdrawal from the stimulus, and head shaking.
*one animal was omitted due to cannula loss post-surgery.
Rats that received dural infusions of the vehicle for five days, maintained sensitivity to von Frey thresholds similar to the pre infusion baseline apart from an approximate 18% reduction on day five. This was a transient occurrence and sensitivity quickly returned to baseline levels by day 10.
TRPM3 agonists when administered durally for five days evoked an allodynic response to von Frey filaments in rats. Rats treated with the TRPM3 agonists at lower thresholds than in vehicle treated rats (Figure 10A). This was sustained and did not return to baseline levels for the duration of the experiment (19 days). Animals showed no overt, lasting adverse effects to the agonists and were feeding and grooming normally. This can be seen in Figure 10B as TRPM3 agonist treated groups increase in body weight with the same trend as vehicle treated animals.
Sensitivity to non-noxious stimuli is referred to as allodynia and has been shown as a potential clinical correlate in migraine patients. Patients with chronic or transformed migraine exhibit facial allodynia even on days when they do not have a headache (Cooke et al., (2007). Cutaneous allodynia in transformed migraine patients. Headache: The Journal of Head and Face Pain, 47(4), 531-539). Example 4 is evidence that repeated activation by TRPM3 agonists can induce sensitisation in the rodent to a mechanical stimulus, that is similar to a pain assessment used in migraine patients.
Example 5 - Patient Population (Non-Responders to CGRP Treatment)
Methods: data collection. CGRP-resoonder status bv TRPM3 genotype
23andMe customers, who are genotyped using SNP arrays such that their TRPM3 genetic status at amino acid 1670 is known, were invited by email to complete a Headache and Migraine survey. 23andMe's "Headache and Migraine" survey asks questions on self-reported calcitonin gene-related peptide (CGRP) medication efficacy as follows- A single, check-box question that reads: "Have you ever taken any of the following calcitonin gene-related peptide (CGRP) medications to relieve or prevent your headache or migraine pain? Please check all that apply. "
[ ] Aimovig® or erenumab
[ ] Emgality® or galcanezumab
[ ] Ajovy® or fremanezumab
[ ] Nurtec® or rimegepant
[ ] Vyepti® or eptinezumab
[ ] Ubrelvy® or ubrogepant
[ ] Qulipta® or atogepant
[ ] Other
[ ] None of the above
[ ] Not sure
- For each of the 8 medications (7 listed by name in addition to 'Other') listed in the previous question, the survey respondent would see an efficacy question that reads: "How effective was <medication X>_ in helping to relieve or prevent your headache or migraine pain?"
• Not at all
• Slightly
• Moderately
• Very
• Extremely
In order to assess CGRP medication efficacy, data were pulled from only the baseline instance of the "Headache and Migraine" survey. Analysis was limited to individuals who answered at least one of the 8 CGRP medication efficacy questions, have measured SNP dosage data (i.e. TRPM3 status is known), and have consented to participate in 23andMe research. Those who answered more than one CGRP medication efficacy question were assigned an overall efficacy level equal to their maximum response (extremely' > 'very' > 'moderately' > 'slightly' > 'not at all').
CGRP medication efficacy responses were binarized into "responder(+)" and "never- responder(-)". "NEVER respond to anti-CGRP medication" individuals were defined as follows:
- Responder(+): response was one of the following: 'Slightly', 'moderately', 'very', 'extremely'
- Non-responder(-): response was 'Not at all'
Individuals were then stratified by TRPM3 status. The number of 'migraine high-risk' alleles in each individual (corresponding to the coding variant for 1670Gln) was scored as 0, 1 or 2 depending on allele dosage. Data were compiled in a pivot table, with aggregate data of CGRP responders stratified by TRPM3 status.
Results:
Example 5 is evidence that a population exists that does not respond to CGRP antagonism medication. These individuals could be a target population for a TRPM3 blocker therapy. Of the identified population, 50/58 have at least one migraine high-risk allele, suggesting a higher likelihood of responding to anti-TRPM3 migraine therapy.
Example 6 - Neuropeptide release from the trigeminal nucleus caudalis
Methods
Isolation of mouse and rat trigeminal nucleus caudalis
Trigeminal nucleus caudalis (TNC) were dissected from 8-13 week C57BL/6NJ (TRPM3 +/+ Wild type, TRPM3 knock out) mice or Sprague Dawley rats following the method of Rasmussen et al, 2022. Following CO2 termination and cardiac cessation, the TNC-containing parts of the brain stem were removed and collected in ice cold culture media containing LEBOVITZ L-15 Medium, GLUTAMAX (Gibco). The left and right TNC halves were separated using a scalpel and individual TNC halves were transferred to separate wells of a 48 well tissue culture plate containing 250 μL of L-15 Medium, GLUTAMAX containing 18 mM NaHCO3, 38 mM glucose (L15 assay buffer).
TNCs were washed 5 times in L15 assay buffer replacing the assay buffer every 5 min at room temperature, and then a further 5 times in a humidified incubator at 37°C, 5% CO2.
Neuropeptide release
To stimulate neuropeptide release, each TNC tissue was incubated sequentially with vehicle, and then TRPM3 agonist, either pregnenolone sulfate (PS) or R-CIM0216 (CIM0216*) or both combined, at increasing concentrations each for 10 mins at 37°C. For inhibitor studies, tissues were incubated with isosakuranetin for 10 mins following vehicle but prior to addition of agonist, and maintained in the presence of increasing agonist concentrations. At the end of each 10 minutes incubation period, conditioned medium was collected to a 96 well polypropylene plate containing BSA on ice, such that the final BSA concentration is 1%, and any remaining liquid in the tissue well discarded prior to the next agonists/ antagonist addition. At the end of the agonist/antagonist treatments, the responsiveness of each tissue was verified by the addition of capsaicin (lμM) and/or KCI (40mM or 60mM) and measuring the neuropeptides released over 10 mins. In some experiments the treatment periods were 15 mins.
Levels of CGRP were quantitated using a rat CGRP ELISA kit (Bertin Bioreagent, Cat. No. #A05482) according to manufacturer's instructions. Levels of Substance P were quantitated using a Substance P ELISA kit (Cayman Chemical, Cat. number #583751). There is 100% sequence identity between rat and mouse CGRP, and between rat and mouse Substance P.
Results - CGRP and substance P release from TNC is modulated by TRPM3 ligands
To test the effect of TRPM3 activation on neuropeptide release, TNCs were incubated with TRPM3 agonists pregnenolone sulfate, R-CIM0216 (CIM0216*), or both combined, in the presence and absence of the TRPM3 inhibitor isosakuranetin. Pregnenolone sulfate and CIM0216* in combination induced a concentration-dependent release of CGRP (FIG. 15A-B) and substance P (FIG. 15C-D) from mouse TNC. This concentration-dependent response was inhibited in the presence of the TRPM3 antagonist, isosakuranetin. Both the stimulation of CGRP and substance P release in response to TRPM3 agonists and the inhibitory effect of isosakuranetin were observed only in the TNC from Wild Type (WT) animals, but not in the TNC from Trpm3 knock outs (KO). The responses to the TRPV1 agonist, capsaicin (1μM ), and to KCI (40 or 60mM) were maintained in the Trpm3 knock out tissue (FIG. 15 A-D) showing that neuropeptide release to stimuli of other TRP channels and to a non-specific depolarisation agent was still present. Data are represented as %KCI to normalise for donor variations in tissue weight and size. The measured quantities of CGRP and substance P released from TNC over 15mins are shown in FIGURE 16 A-B. A significant increase in the release of neuropeptides was observed to the combined application of 25μM pregnenolone sulfate and 10μM R-CIM0216 in the tissue from Wild Type (WT) animals (p <0.0001, n=4) but not those from Trpm3 knock outs (KO) which remained at basal vehicle levels. KCI responses were observed in both Wild Type and knock out groups.
In TNC tissue isolated from the rat, pregnenolone sulfate and R-CIM0216 also induced a concentration-dependent release of CGRP (FIG. 17A-B) and substance P (FIG. 17C-D). As with mouse TNC, this response was inhibited in the presence of the TRPM3 inhibitor 10μM isosakuranetin. These data together demonstrate that in both mouse and rat, CGRP and substance P release can be induced from the TNC by pregnenolone sulfate and /?-CIM0216, and that this is dependent on TRPM3.
SEQUENCE LISTING
SEQ ID NO: 1: Amino acid sequence of human TRPM3 isoform XI 1
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD FiNGTTGKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPWALIVEGGPNVISI VLEYLRDTPPVPWVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKK ELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLD RVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCN YTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKR QKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAM KLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDD MPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPI VKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTD LIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLWLMS FGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACY LLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDP DERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQ TVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETM SPTSPTLMPRMRSHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSC IDIYVSAMDELHCDIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDY THLPECQNPWDSEPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCID TRCVNAPQAIADRAAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNI TVPKIERANSYSAEEPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFE SKHN
SEQ ID NO:2: Amino acid sequence of human TRPM3 isoform k
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVWCDGSGRASDIL AFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLK GANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEE LYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLG MEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKL CKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHR DFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTK EKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKME RWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVI YCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYM
PYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSIS NQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQ CIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTG LERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSVNMKDK GGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNSVNIL GLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPMYHTIERSK SSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFPGGLGDKV EDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAPYAHTRK SFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO:3: Amino acid sequence of human TRPM3 isoform m MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVWCDGSGRASDIL AFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLK GANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEE LYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLF GPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEE AMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNAT CLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQ EKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYL MLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRL QDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEE PSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAV FNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDD ELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIG RMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRS HSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHC DIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDS EPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADR AAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAE EPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID N0:4: Amino acid sequence of human TRPM3 isoform X19
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVWCDGSGRASDIL AFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLK GANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEE LYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRG RKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASE NDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQM LLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELT AM LGRN NG ESSRKKDEEEVQSKHRLIPLG RKIYEFYN APIVKFWFYTLAYIGYLMLFN YIVLVKM ERWPSTQEWI VISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYI RLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVF ADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQ LIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDR FNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSR TSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSVNMKDKGGIEKLESIFKE RSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNSVNILGLGEPSFSTPVP STAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPMYHTIERSKSSRYLATTPFLL EEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFPGGLGDKVEDLTCCHPEREA
ELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAPYAHTRKSFSISDKLDRQR NTASLRN PFQRSKSSKPEGRGDSLSM RRLSRTSAFQSFESKH N
SEQ ID NO:5: Amino acid sequence of human TRPM3 isoform q
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE
CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG
HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVWCDGSGRASDIL AFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLK GANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEE LYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLF G PKRDDIPLRRG RKTTKKREEEVDIDLDDPEIN HFPFPFH ELMVWAVLM KRQKMALFFWQHG EEAM AKALVAC KLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAK HRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKP TKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVK MERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDG RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLWLMSFGVARQAILFPNEEPSWKLAKNIF YMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKS ISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEE QCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLT GLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSVNMK DKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNSVN ILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPMYHTIER SKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFPGGLGD KVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAPYAHT RKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID N0:6: Amino acid sequence of human TRPM3 isoform Q9HCF6-6
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVWCDGSGRASDIL AFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLK GANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEE LYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLG MEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKL CKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHR DFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTK EKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKME RWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVI YCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYM
PYWMIYGEVFADQIDRKQVYDSHTPKSAPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIA VFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITD DELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLI GRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMR SHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHC DIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDS EPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADR AAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAE EPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO:7: Amino acid sequence of human TRPM3 isoform X12
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE
CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG
HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG
VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD
NGTTGKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPWALIVEGGPNVISIV
LEYLRDTPPVPVWCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKE
LITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDR VDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNY
TRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQH GEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWS NATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEI HLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYI GYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMI
LRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLWLMSFGVARQAILFP NEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNL LIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFI TDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLE DLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMP
RMRSHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMD ELHCDIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNP WDSEPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQA lADRAAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANS YSAEEPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID N0:8: Amino acid sequence of human TRPM3 isoform Q9HCF6-8
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVWCDGSGRASDIL AFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLK GANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGRHGPSNTLYHLVR DVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDD PEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSR DFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKN SGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDE EEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILM SEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVM MIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETRED GKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIF SHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERV ENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSS FNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAK EPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTD RPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPS RSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAK GRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSS
KPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO:9: Amino acid sequence of human TRPM3 isoform s
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVWCDGSGRASDIL AFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLK GANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEE LYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLG MEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKL
CKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHR DFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTK EKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKME RWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVI YCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYM PYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSIS NQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQ CIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTG LERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAEHPLYSV
SEQ ID NO: 10: Amino acid sequence of human TRPM3 isoform Q9HCF6-11
MGKKWRDAAEMERGCSDREDNAESRRRSRSASRGRFAESWKRLSSKQGSTKRSGLPSQQTPAQKSWIERAFY KRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQG GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFT GGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFIL ADNGTTGKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPWALIVEGGPNVIS IVLEYLRDTPPVPVWCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKK KELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVL DRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRC NYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMK RQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLA MKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKD DMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAP IVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVT DLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLM SFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMAC YLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESD PDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASL QTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEET MSPTSPTLMPRMRSHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSS CIDIYVSAMDELHCDIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSD YTHLPECQNPWDSEPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCI DTRCVNAPQAIADRAAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNN ITVPKIERANSYSAEEPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSF ESKHN
SEQ ID NO: 11 Amino acid sequence of human TRPM3 isoform i
MGKKWRDAAEMERGCSDREDNAESRRRSRSASRGRFAESWKRLSSKQGSTKRSGLPSQQTPAQKSWIERAFY KRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQG GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFT GGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFIL ADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPWALIVEGGPNVISIVLEYLRDTPPVPWVCDGSGRASD ILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALL KGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLE ELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLL
GMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACK LCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKH RDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPT KEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKM ERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGR VIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLWLMSFGVARQAILFPNEEPSWKLAKNIFY MPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSI
SNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEE QCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLT GLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSVNMK DKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNSVN ILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPMYHTIER SKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFPGGLGD KVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAPYAHT RKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO: 12 Amino acid sequence of human TRPM3 isoform j
MGKKWRDAAEMERGCSDREDNAESRRRSRSASRGRFAESWKRLSSKQGSTKRSGLPSQQTPAQKSWIERAFY KRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQG GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFT GGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFIL ADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPWALIVEGGPNVISIVLEYLRDTPPVPWVCDGSGRASD ILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALL KGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLE ELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNL FGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGE EAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNA TCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHL QEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGY LMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILR LQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLWLMSFGVARQAILFPNE
EPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIA VFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITD DELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLI GRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAEHPLYSV
SEQ ID NO: 13 Amino acid sequence of human TRPM3 isoform w
MGKKWRDAAEMERGCSDREDNAESRRRSRSASRGRFAESWKRLSSKQGSTKRSGLPSQQTPAQKSWIERAFY KRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQG GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFT GGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFIL ADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPWALIVEGGPNVISIVLEYLRDTPPVPWVCDGSGRASD ILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALL KGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLE ELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLL GMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACK LCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKH RDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPT KEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKM ERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGR VIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLWLMSFGVARQAILFPNEEPSWKLAKNIFY MPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSI SNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEE QCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLT
GLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAEHPLYSV
SEQ ID NO: 14 Amino acid sequence of human TRPM3 isoform n
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVWCDGSGRASDIL AFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLK GANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEE LYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLF GPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEE AMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNAT
CLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQ EKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYL MLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRL QDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEE PSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAV FNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDD ELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIG RMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAEHPLYSV
SEQ ID NO: 15 Amino acid sequence of human TRPM3 isoform o
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPWALIVEGGPNVISIV LEYLRDTPPVPVWCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKE LITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDR VDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIE YLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHE
LMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQ SYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPS ILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLG RKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKV WLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMM YFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKT GAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHL CCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEV NEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFK LQESIDPAGEETMSPTSPTLMPRMRSHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANT
LAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDI TSMDTRSFSSDYTHLPECQNPWDSEPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPV KTAEYTSITDCIDTRCVNAPQAIADRAAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQE GDNSERTLSNNITVPKIERANSYSAEEPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSM RRLSRTSAFQSFESKHN
SEQ ID NO: 16 Amino acid sequence of human TRPM3 isoform p
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPWALIVEGGPNVISIV LEYLRDTPPVPVWCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKE LITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDR VDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIE YLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMK RQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLA MKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKD DMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAP
IVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVT DLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLM SFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMAC YLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESD PDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASL QTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAEHPL YSV
SEQ ID NO: 17 Amino acid sequence of human TRPM3 isoform r
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVWCDGSGRASDIL AFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLK GANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEE LYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRG RKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASE NDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQM LLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELT AM LGRN NG ESSRKKDEEEVQSKHRLIPLG RKIYEFYN APIVKFWFYTLAYIGYLMLFN YIVLVKM ERWPSTQEWI
VISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYI RLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVF ADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQ LIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDR FNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSR TSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAEHPLYSV SEQ ID NO: 18 Amino acid sequence of human TRPM3 isoform t
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG
HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPWALIVEGGPNVISIV LEYLRDTPPVPVWCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKE
LITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDR VDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIE YLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHE LMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQ SYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPS ILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLG
RKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKV WLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMM YFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKT GAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHL CCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEV NEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFK
LQESIDPAEHPLYSV
SEQ ID NO: 19 Amino acid sequence of human TRPM3 isoform v
MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVI RHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGK YGAEVKLRRQLEKHISLQKINTRIGQGVPWALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYS EEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP DQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHG PSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKA
LKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALV ACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVA AKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEP EKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIV LVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFR SDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLWLMSFGVARQAILFPNEEPSWKLA
KNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFF EVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVH DFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATAL ERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAEHPLYSV
SEQ ID NO: 20 Amino acid sequence of human TRPM3 isoform a
MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVI RHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGK YGAEVKLRRQLEKHISLQKINTRIGQGVPWALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYS EEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP DQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHG PSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPL RRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHE ASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTC
SQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEED MELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST
QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVNII YWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMI YGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWK
FQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFR EKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAES
NKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSVNMKDKGGIEKL ESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNSVNILGLGEPS FSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPMYHTIERSKSSRYLA TTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFPGGLGDKVEDLTCC HPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAPYAHTRKSFSISDK LDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO: 21 Amino acid sequence of human TRPM3 isoform b
MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVI RHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGK YGAEVKLRRQLEKHISLQKINTRIGQGVPWALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYS EEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP DQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHG PSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKA
LKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALV ACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVA AKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEP EKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIV LVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFR SDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLWLMSFGVARQAILFPNEEPSWKLA
KNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFF EVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVH DFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATAL ERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSV NMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLD NSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPMY
HTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFPG GLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAP YAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO: 22 Amino acid sequence of human TRPM3 isoform d
MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVI RHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGK YGAEVKLRRQLEKHISLQKINTRIGQGVPWALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYS EEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP DQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHG PSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKR EEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDI SQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMW MGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRN NGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTL GIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFG VNKYLGPYVMMIGKMMIDMMYFVIIMLWLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDP PCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFH ERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSN DERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDC TDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSVNMKDKGGIEKLESIFKERSLSL HRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNSVNILGLGEPSFSTPVPSTAPS SSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPMYHTIERSKSSRYLATTPFLLEEAPI VKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFPGGLGDKVEDLTCCHPEREAELSH PSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAPYAHTRKSFSISDKLDRQRNTAS LRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO: 23 Amino acid sequence of human TRPM3 isoform e
MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVI RHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGK YGAEVKLRRQLEKHISLQKINTRIGQGVPWALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYS EEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP DQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHG PSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDI PLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMA HEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAH TCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEE DMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPS TQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVN IIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWM IYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVW KFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYF REKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAE SNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSVNMKDKGGIEK LESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNSVNILGLGEP
SFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPMYHTIERSKSSRYL ATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFPGGLGDKVEDLTC CHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAPYAHTRKSFSISD KLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO: 24 Amino acid sequence of human TRPM3 isoform f
MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVI RHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGK YGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPVVALIVEGGPNVISIVLEYLRDT PPVPVWCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRM
GSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLL IENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRT
LYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFF
WQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELK NWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQ
AQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYT LAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFS
VGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQA
ILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILL
VNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGL
KLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLA
QLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTL MPRMRSHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSA
MDELHCDIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPEC
QNPWDSEPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNA PQAIADRAAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIER ANSYSAEEPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO:25 Amino acid sequence of human TRPM3 isoform g
MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVI
RHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGK
YGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPWALIVEGGPNVISIVLEYLRDT
PPVPVWCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRM
GSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLL IENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRT
LYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMA
KALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQ
LAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKE
AEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLF
NYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQD
QPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLWLMSFGVARQAILFPNEEPS
WKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFN
NTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDEL
KKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGR
MATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSH
SFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDI
DPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEP PMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAA FPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEP SAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO: 26 Amino acid sequence of human TRPM3 isoform X18
MGKKWRDAAEMERGCSDREDNAESRRRSRSASRGRFAESWKRLSSKQGSTKRSGLPSQQTPAQKSWIERAFY
KRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQG GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFT GGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFIL ADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPWALIVEGGPNVISIVLEYLRDTPPVPWVCDGSGRASD ILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALL KGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLE ELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRR GRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEAS ENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQ MLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMEL TAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEW IVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWY IRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEV FADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRY
QLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDD RFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRS RTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSVNMKDKGGIEKLESIFK ERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNSVNILGLGEPSFSTPV PSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPMYHTIERSKSSRYLATTPFL LEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFPGGLGDKVEDLTCCHPERE AELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAPYAHTRKSFSISDKLDRQ RNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO: 27 Amino acid sequence of human TRPM3 isoform X15
MGKKWRDAAEMERGCSDREDNAESRRRSRSASRGRFAESWKRLSSKQGSTKRSGLPSQQTPAQKSWIERAFY KRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQG GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFT GGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFIL ADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPWALIVEGGPNVISIVLEYLRDTPPVPWVCDGSGRASD ILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALL KGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLE ELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNL FGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVA CKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAA KHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPE KPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVL
VKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRS DGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAK NIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFE VKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHD FEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALE RLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSVN MKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNS VNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPMYHTI ERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFPGGLG DKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAPYAH TRKSFSISDKLDRQRNTASLRN PFQRSKSSKPEG RG DSLSM RRLSRTSAFQSFESKH N
SEQ ID NO: 28 Amino acid sequence of human TRPM3 isoform X13
MGKKWRDAAEMERGCSDREDNAESRRRSRSASRGRFAESWKRLSSKQGSTKRSGLPSQQTPAQKSWIERAFY KRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQG GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFT GGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFIL ADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPWVCDGSGRASD ILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALL KGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLE ELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNL FGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGE EAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNA TCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHL QEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGY LMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILR LQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLWLMSFGVARQAILFPNE EPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIA VFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITD DELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLI
GRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMR SHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHC DIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDS EPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADR AAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAE EPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO: 29 Amino acid sequence of human TRPM3 isoform X10
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFYKRE CVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGG HSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGG VNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDWRPYQTMSNPMSKLTVLNSMHSHFILAD NGTTGKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPWALIVEGGPNVISIV LEYLRDTPPVPVWCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKE LITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDR VDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIE YLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMK RQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLA MKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKD DMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAP IVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVT DLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLM SFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMAC YLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESD PDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASL QTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEET MSPTSPTLMPRMRSHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSS CIDIYVSAMDELHCDIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSD YTHLPECQNPWDSEPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCI DTRCVNAPQAIADRAAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNN ITVPKIERANSYSAEEPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSF ESKHN
SEQ ID NO: 30 Amino acid sequence of human TRPM3 isoform X4
MGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVK LLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRF RTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEA MAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATC LQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQE KEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLM LFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQ DQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLWLMSFGVARQAILFPNEEP SWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVF NNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDE LKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGR MATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSH SFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDI DPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEP
PMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAA FPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEP SAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO: 31 Amino acid sequence of human TRPM3 isoform X7
MGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVK LLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRF
RTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALF FWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYEL KNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMS QAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWF YTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILL FSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVAR QAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVAN ILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDY GLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIR LAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAEHPLYSV
SEQ ID NO: 32 Amino acid sequence of human TRPM3 isoform X3
MGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVK LLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRF RTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALF FWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYEL KNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMS QAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWF YTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILL FSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVAR QAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVAN ILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDY GLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIR LAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSP TLMPRMRSHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYV
SAMDELHCDIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLP ECQNPWDSEPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCV NAPQAIADRAAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKI ERANSYSAEEPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO: 33 Amino acid sequence of human TRPM3 isoform X6
MGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVK LLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGG AYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMA LFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTY ELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYM SQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFW FYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAIL LFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVA RQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVA NILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERD YGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDI
RLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAEHPLYSV
SEQ ID NO: 34 Amino acid sequence of human TRPM3 isoform X2
MGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVK LLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGG AYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMA LFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTY ELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYM SQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFW FYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAIL LFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVA RQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVA NILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERD YGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDI
RLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTS PTLMPRMRSHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIY VSAMDELHCDIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHL PECQNPWDSEPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRC VNAPQAIADRAAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVP KIERAN SYSAEEPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESK HN
SEQ ID NO: 35 Amino acid sequence of human TRPM3 isoform X5
MGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVK LLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGG AYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWA VLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD EQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEF KNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYE FYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEY WNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIML WLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPA IMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRK HESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHS MKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDP AEHPLYSV
SEQ ID NO: 36 Amino acid sequence of human TRPM3 isoform XI
MGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVK LLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGG AYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWA VLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD EQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEF KNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYE FYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEY WNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIML WLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPA IMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRK HESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHS MKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDP AGEETMSPTSPTLMPRMRSHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDS RRPSSCIDIYVSAMDELHCDIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTR SFSSDYTHLPECQNPWDSEPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTS ITDCIDTRCVNAPQAIADRAAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSER TLSNNITVPKIERANSYSAEEPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTS AFQSFESKHN
SEQ ID NO: 37 Amino acid sequence of human TRPM3 isoform A2A3F3
MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVI RHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGK YGAEVKLRRQLEKHISLQKINTRIGQGVPWALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYS EEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP DQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHG
PSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPL
RRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHE
ASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTC
SQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEED
MELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST
QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVNII
YWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMI
YGEVFADQIDRKQVYDSHTPKSAPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTF
FEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKV
HDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMAT
ALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFY
SVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPL
DNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPM
YHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFP GGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSA PYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN
SEQ ID NO: 38 Nucleotide sequence of exon 1 of the human TRPM3 gene.
GGCAAAGGCAGCGCCAACCGAGAGCCGCGCGCAGGCTGGAGGGAGACCCGCGGCGAGGAGCCAGCGAGAG
CGCTCGGCGCTGGGCTGTTTCCCGGCCGAGGGAGGCGAACTTCTCATGGGGAAGAAGTGGAGGGATGCGGC
GGAAATGGAGCGGGGCTGCTCCGACCGCGAGGACAACGCGGAGAGCCGCAGACGCAGCCGGAGCGCCAGCC
GGGGCAGGTTTGCCGAGTCGTGGAAAAGGTTAAGTTCCAAGCAGGGGTCCACCAAACGCTCGGGACTCCCG TCGCAGCAGACGCCG
SEQ ID NO: 39 Nucleotide sequence of exon 2 of the human TRPM3 gene.
ATTCTGGAGCAGGCTGCTTTGACTCCGACCACAGGCTGTTTTGTGCAGGCTGTCCCTCTTCTTCAAAATCGT
GCATCCCCTCCCCGAAGCAGCAGGCAGTGTGCCTCCATTCAGCCACATTTGGTATGCATGAGCACGGCTGCA
GAGAGAGGGGAGGTGGCTGTTTTAAGAAGGTTCAGGGGCTCAGGCAAGGCTACTTGACTAGTCTTCCAAGT
TCCAGGAAGCCTCTGCCCTAATGGAATTTGCAGGTGTGGAGATGACCATGGGATGCCAGAGCCGTGGGGGA
CCGTTTATTTTCTAGGCATTGCTCAGGTTTTCAGTTTCTTGTTTTCCTGGTGGAATTTGGAAGGGGTCATGA
ATCAGGCTGATGCTCCTCGACCCCTAAACTGGACCATCCGGAAGCTGTGCCACGCAGCCTTTCTTCCATCTGT CAGACTTCTGAAG
SEQ ID NO: 40 Nucleotide sequence of exon 3 of the human TRPM3 gene.
AGCAAAATGAAAGCAACAGGAGCTGCTCCGGGGACTGCTTTTGCCAGTACCCAGAATCAGTGCTCAG
SEQ ID NO: 41 Nucleotide sequence of exon 4 of the human TRPM3 gene.
GCTCAGAAATCCTGGATAGAAAGAGCATTTTATAAAAGAGAATGTGTCCACATCATACCCAGCACCAAAGACC
CCCATAG
SEQ ID NO: 42 Nucleotide sequence of exon 5 of the human TRPM3 gene. GTGTTGCTGTGGGCGTCTGATAGGCCAGCATGTTGGCCTCACCCCCAGTATCTCCGTGCTTCAGAATGAGAA
AAATGAAAGTCGCCTCTCCCGAAATGACATCCAGTCTGAAAAGTGGTCCATCAGCAAACACACTCAACTCAGC
CCTACGGATGCTTTTGGGACCATTGAGTTCCAAGGAGGTGGCCATTCCAACAAAGCCATG
SEQ ID NO: 43 Nucleotide sequence of exon 6 of the human TRPM3 gene.
TATGTGCGAGTATCTTTTGATACAAAACCTGATCTCCTCTTACACCTGATGACCAAGGAATGGCAGTTGGAG
CTTCCCAAGCTTCTCATCTCTGTCCATGGGGGCCTGCAGAACTTTGAACTCCAGCCAAAACTCAAGCAAGTCT
TTGGGAAAGGGCTCATCAAAGCAGCAATGACAACTGGAGCGTGGATATTCACTGGAGGGGTTAACACAG
SEQ ID NO: 44 Nucleotide sequence of exon 7 of the human TRPM3 gene.
GTGTTATTCGTCATGTTGGCGATGCCTTGAAGGATCATGCCTCTAAGTCTCGAGGAAAGATATGCACCATAG
GTATTGCCCCCTGGGGAATTGTGGAAAACCAGGAGGACCTCATTGGAAGAGAT
SEQ ID NO: 45 Nucleotide sequence of exon 8 of the human TRPM3 gene.
GTTGTCCGGCCATACCAGACCATGTCCAATCCCATGAGCAAGCTCACTGTTCTCAACAGCATGCATTCCCACT
TCATTCTGGCTGACAACGGGACCACTGGAAAATATGGAGCAGAGGTGAAACTTCGAAGACAACTGGAAAAGC ATATTTCACTCCAGAAGATAAACACAA
SEQ ID NO: 46 Nucleotide sequence of exon 9 of the human TRPM3 gene.
GATGCCTGCCGTTTTTCTCTCTTGACTCCCGCTTGTTTTATTCATTTTGGGGTAGTTGCCAGTTAGACTCAGT TG
SEQ ID NO: 47 Nucleotide sequence of exon 10 of the human TRPM3gene.
GAATCGGTCAAGGTGTTCCTGTGGTGGCACTCATAGTGGAAGGAGGACCCAATGTGATCTCGATTGTTTTGG
AGTACCTTCGAGACACCCCTCCCGTGCCAGTGGTTGTCTGTGATGGGAGTGGACGGGCATCGGACATCCTG
GCCTTTGGGCATAAATACTCAGAAGAAGGCGG
SEQ ID NO: 48 Nucleotide sequence of exon 11 of the human TRPM3gene.
ACTGATAAATGAATCTTTGAGGGACCAGCTGTTGGTGACTATACAGAAGACTTTCACATACACTCGAACCCAA
GCTCAGCATCTGTTCATCATCCTCATGGAGTGCATGAAGAAGAAGGAATTG
SEQ ID NO: 49 Nucleotide sequence of exon 11a of the human TRPM3gene.
GCAGAATCTCACCAGGCCTGCCTAAACTACCCATCCCTGGCTGACCTCAGTGCCCCCTAGTCTCTCCATTCCA
GTTGAAACAGGACAGCTGGATGACTCCCATTAAGGAGCAACTCTCATAATGTAACCTCCCACCCAATCGGAAA
CCCACATTACCCTCGCTGTGCTTCCCAAG
SEQ ID NO: 50 Nucleotide sequence of exon 12 of the human TRPM3gene.
ATTACGGTATTTCGGATGGGATCAGAAGGACACCAGGACATTGATTTGGCTATCCTGACAGCTTTACTCAAA G
SEQ ID NO: 51 Nucleotide sequence of exon 13 of the human TRPM3gene.
GAGCCAATGCCTCGGCCCCAGACCAACTGAGCTTAGCTTTAGCCTGGAACAGAGTCGACATCGCTCGCAGCC
AGATCTTTATTTACGGGCAACAGTGGCCG
SEQ ID NO: 52 Nucleotide sequence of exon 14 of the human TRPM3gene. GTGGGATCTCTGGAGCAAGCCATGTTGGATGCCTTAGTTCTGGACAGAGTGGATTTTGTGAAATTACTCATA GAGAATGGAGTAAGCATGCACCGTTTTCTCACCATCTCCAGACTAGAGGAATTGTACAATACG
SEQ ID NO: 53 Nucleotide sequence of exon 15 of the human TRPM3gene.
AGACATGGGCCCTCAAATACATTGTACCACTTGGTCAGGGATGTCAAAAAG
SEQ ID NO: 54 Nucleotide sequence of exon 16 of the human TRPM3gene.
CGAGAGTATCCAGGTTTCGGTTGGATCTATTTTAAG
SEQ ID NO: 55 Nucleotide sequence of exon 17 of the human TRPM3gene.
GGGAACCTGCCCCCAGACTACAGAATCAGCCTGATTGACATCGGCCTGGTGATCGAGTACCTGATGGGCGG
GGCTTATCGCTGCAACTACACGCGCAAGCGCTTCCGGACCCTCTACCACAACCTCTTCGGCCCCAAGAGG
SEQ ID NO: 56 Nucleotide sequence of exon 18 of the human TRPM3gene.
CCCAAAGCCTTGAAACTGCTGGGAATGGAG
SEQ ID NO: 57 Nucleotide sequence of exon 19 of the human TRPM3gene.
GATGATATTCCCTTGAGGCGAGGAAGAAAGACAACCAAGAAACGTGAAGAAGAGGTGGACATTGACTTGGAT
GATCCTGAGATCAACCACTTCCCCTTCCCTTTCCATGAGCTCATGGTGTGGGCTGTTCTCATGAAGCGGCAG AAGATGGCCCTGTTCTTCTGGCAGCACGGTGAGGAGGCCATGGCCAAGGCCCTGGTGGCCTGCAAGCTCTG CAAAGCCATGGCTCATGAGGCCTCTGAGAACGACATGGTTGACGACATTTCCCAGGAGCTGAATCACAATTC
CAG
SEQ ID NO: 58 Nucleotide sequence of exon 20 of the human TRPM3gene.
AGACTTTGGCCAGCTGGCTGTGGAGCTCCTGGACCAGTCCTACAAGCAGGACGAACAGCTGGCCATGAAACT GCTGACGTATGAGCTGAAGAACTGGAGCAACGCCACGTGCCTGCAGCTTGCCGTGGCTGCCAAACACCGCGA CTTCATCGCGCACACGTGCAGCCAGATGCTGCTCACCGACATGTGGATGGGCCGGCTCCGCATGCGCAAGAA
CTCAGGCCTCAAG
SEQ ID NO: 59 Nucleotide sequence of exon 21 of the human TRPM3gene.
GTAATTCTGGGAATTCTACTTCCTCCTTCAATTCTCAGCTTGGAGTTCAAGAACAAAGACGACATGCCCTATA
TGTCTCAGGCCCAGGAAATCCACCTCCAAGAGAAGGAGGCAGAAGAACCAGAGAAGCCCACAAAGGAAAAAG AGGAAGAGGACATGGAGCTCACA
SEQ ID NO: 60 Nucleotide sequence of exon 22 of the human TRPM3gene.
GCAATGTTGGGACGAAACAACGGGGAGTCCTCCAGGAAGAAGGATGAAGAGGAAGTTCAGAGCAAGCACCG
GTTAATCCCCCTCGGCAGAAAAATCTATGAATTCTACAATGCACCCATCGTGAAGTTCTGGTTCTACACA
SEQ ID NO: 61 Nucleotide sequence of exon 23 of the human TRPM3gene.
CTGGCGTATATCGGATACCTGATGCTCTTCAACTATATCGTGTTAGTGAAGATGGAACGCTGGCCGTCCACC
CAGGAATGGATCGTAATCTCCTATATTTTCACCCTGGGAATAGAAAAGATGAGAGAG
SEQ ID NO: 62 Nucleotide sequence of exon 24 of the human TRPM3gene.
ATTCTGATGTCAGAGCCAGGGAAGTTGCTACAGAAAGTGAAGGTATGGCTGCAGGAGTACTGGAATGTCAC
GGACCTCATCGCCATCCTTCTGTTTTCTGTCGGAATGATCCTTCGTCTCCAAGACCAGCCCTTCAGGAGTGAC GGGAGGGTCATCTACTGCGTGAACATCATTTACTGGTATATCCGTCTCCTAGACATCTTCGGCGTGAACAAG TATTTGGGCCCGTATGTAATGATGATTGGAAAAATG
SEQ ID NO: 63 Nucleotide sequence of exon 25 of the human TRPM3gene.
ATGATAGACATGATGTACTTTGTCATCATTATGCTGGTGGTTCTGATGAGCTTTGGGGTCGCCAGGCAAGCC
ATCCTTTTTCCCAATGAGGAGCCATCATGGAAACTGGCCAAGAACATCTTCTACATGCCCTATTGGATGATTT ATGGGGAAGTGTTTGCGGACCAGATAGACC
SEQ ID NO: 64 Nucleotide sequence of exon 26 of the human TRPM3gene.
CTCCCTGTGGACAGAATGAGACCCGAGAGGATGGTAAAATAATCCAGCTGCCTCCCTGCAAGACAGGAGCTT
GGATCGTGCCGGCCATCATGGCCTGCTACCTCTTAGTGGCAAACATCTTGCTGGTCAACCTCCTCATTGCTG TCTTTAA
SEQ ID NO: 65 Nucleotide sequence of exon 27 of the human TRPM3gene.
CAATACATTTTTTGAAGTAAAATCGATATCCAACCAAGTCTGGAAGTTTCAGAGGTATCAGCTCATCATGACT
TTCCATGAAAGGCCAGTTCTGCCCCCACCACTGATCATCTTCAGCCACATGACCATGATATTCCAGCACCTGT GCTGCCGATGGAGGAAACACGAGAGCGACCCGGATGAAAGGGACTACGGCCTGA
SEQ ID NO: 66 Nucleotide sequence of exon 28 of the human TRPM3gene.
AACTCTTCATAACCGATGATGAGCTCAAGAAAGTACATGACTTTGAAGAGCAATGCATAGAAGAATACTTCAG
AGAAAAGGATGATCGGTTCAACTCATCTAATGATGAGAGGATACGGGTGACTTCAGAAAG
SEQ ID NO: 67 Nucleotide sequence of exon 29 of the human TRPM3gene.
GGTGGAGAACATGTCTATGCGGCTGGAGGAAGTCAACGAGAGAGAGCACTCCATGAAGGCTTCACTCCAGA
CCGTGGACATCCGGCTGGCGCAGCTGGAAGACCTTATCGGGCGCATGGCCACGGCCCTGGAGCGCCTGACA
GGTCTGGAGCGGGCCGAGTCCAACAAAATCCGCTCGAGGACCTCGTCAGACTGCACGGACGCCGCCTACATT
GTCCGTCAGAGCAGCTTCAACAGCCAGGAAGGGAACACCTTCAAGCTCCAAGAGAGTATAGACCCTGCAGGT
GAGGAGACCATGTCCCCAACTTCTCCAACCTTAATGCCCCGTATGCGAAGCCATTCTTTCTATTCGGTCAATA
TGAAAGACAAAGGTGGTATAGAAAAGTTGGAAAGTATTTTTAAAGAAAGGTCCCTGAGCCTACACCGGGCTA
CTAGTTCCCACTCTGTAGCAAAAGAACCCAAAGCTCCTGCAGCCCCTGCCAACACCTTGGCCATTGTTCCTGA
TTCCAGAAGACCATCATCGTGTATAGACATCTATGTCTCTGCTATGGATGAGCTCCACTGTGATATAGACCCT
CTGGACAATTCCGTGAACATCCTTGGGCTGGGCGAGCCAAGCTTTTCAACTCCAGTACCTTCCACAGCCCCTT
CAAGTAGTGCCTATGCAACACTTGCACCCACAGACAGACCTCCAAGCCGGAGCATTGATTTTGAGGACATCA
CCTCCATGGACACTAGATCTTTTTCTTCAGACTACACCCACCTCCCAGAATGCCAAAACCCCTGGGACTCAGA
GCCTCCGATGTACCACACCATTGAGCGTTCCAAAAGTAGCCGCTACCTAGCCACCACACCCTTTCTTCTAGAA
GAGGCTCCCATTGTGAAATCTCATAGCTTTATGTTTTCCCCCTCAAGGAGCTATTATGCCAACTTTGGGGTGC
CTGTAAAAACAGCAGAATACACAAGTATTACAGACTGTATTGACACAAGGTGTGTCAATGCCCCTCAAGCAAT
TGCGGACAGAGCTGCCTTCCCTGGAGGTCTTGGAGACAAAGTGGAGGACnTAACTTGCTGCCATCCAGAGCG
AGAAGCAGAACTGAGTCACCCCAGCTCTGACAGTGAGGAGAATGAGGCCAAAGGCCGCAGAGCCACCATTGC
AATATCCTCCCAGGAGGGTGATAACTCAGAGAGAACCCTGTCCAACAACATCACTGTTCCCAAGATAGAGCG
CGCCAACAGCTACTCGGCAGAGGAGCCAAGTGCGCCATATGCACACACCAGGAAGAGCnTCTCCATCAGTGA
CAAACTCGACAGGCAGCGGAACACAGCAAGCCTGCGAAATCCCTTCCAGAGAAGCAAGTCCTCCAAGCCGGA
GGGCCGAGGGGACAGCCTGTCCATGAGGAGACTGTCCAGAACATCGGCTTTCCAAAGCTTTGAAAGCAAGCA
CAACTAAACCTTCTTAATATCCGCCACAGAAGGCTCAAGAATCCAGCCCTAAAATTCTCTCCAACTCCAGTTT
TTCCCCTTTCCTTGAATCATACCTGCTTTATTCTTAGCTGAGCAAAACAAGCAATGCTTTGGGAGGTGTTAAC TCAAAGGTGACTTCTGGGCCACAGATCAAGAAAGCATTTGATCTGACCCAGTGCCAGACACAGGGGATTTAA
GGCATGTTCACACTTGCTGGGCAGGGAGGGGGAAGAGAGGGAGAAGGAAGGGTTAGAGATGAATGTGTATC
CGCAGTCACAGCAGAAAGCCATGAGAGCAGGGGAAACAAGGGGCTTCGAGCACGCTCCATGCCAGGAGGCA
TCTGTTGATTTCTGACCATTATCAAGAGTTGTAGGATGCAGGGCTAAATTGCAAAATAAAATAAAATAGCCAG
CGTACACAATGAGATATTCTAAACTTCCATTCTGTTTTCTTTTCACATTGGCTCCATCACTGGTGACTGATGA
AGAGCATCCTCTTTATTCAGTATAAGCCGGCAGCAAGCAGTTCTACCTAACGTCCCACATCCTTCTCATGCCA
ACACTTCTGTAATTGATCATTATAAAGAAAAAACAAGGTAACAGTCATAGTTCACCTGTCTCTTATCTATTCA
C rCTGGTGCCACAACTGTTTATCCTTTTTTGAAGAAAATAAGGGAACAGAAATGCCTTTTTGTATTGCAATC
GAAATGAAAGAAGAGTTGATGTTAAAAAAACAAAAGTCAAGTGATTTATTATATACAGTGGGCGTTCAAGTC
TAGTCGAGCAAGCTCAGGAGAATGTAATTAAATAATTTTATATTTTTTAATTTATTTTGTATCTCACCTGTCA
TGGATGAATTCATTCACTGAATATGTAATATTGAACTTAAAAAAAAAAAAAAAAAAACAGTGGACAGAACTAG
CCTGAAATTGCCATGTGGGATGTTCTGTTCTCACCGTTCATGTCGTGTGTTGTGCTGCTGTGTGACCGTCAT
CATTTGCATGGCTCCACCACGTCCTCCTGAACACCTCCAAGACGTAACTGCCAATTTTTCACACCACTCATCA
CATGACCATTTTGTATATGAATATATGGTTATATGTGGATATTTTCATACCTAGAGTTTTGCCATCTAATCTG
AGCTCAGCATAAATTTAATTGGAGTTTTTCAAGGGCTGGTATCTTTTCTATGGAAATGTTCCAAAGTACTTTT
TAAGGAAGTTTCAAAACTATAAATAACCTTAGATTTGACTGGGAGTTTGGTATCAACCCAAAGCCATCAGTTG
CAAGCATACCATGAATATTTTTCTTATAGACAGAGCTATAAAAAAAGATACAGTAGACCAAAATAGAAAGCAA
ATAAACCATATAAAGAGTTCTATAGTATATGCCACTTATACACATGTATATGCATTTATGCAGAGACACATAT
TTATATATAAAATAAATGGACATAAAGAGCTTTCTTAAGAGGCTTGGACTTTTCTATCACCTTGAAGTATAAT
CAAGATTTTTTTTAATATACAAGAAGTTCCATTGAAAGAGTTCATTATACTATTAGACCAAATGTTGAAATTA
TGAATTTTTTAAATTCCTATGACTTTTCCTCATATCAAACTAGAGTTGTCAAAATGACTCACTGCTCGCCTTCT
GCCCTTTTTTGTCTGAAATCACTCACTATCAGGACATCTCATTTAGTCTCGCTTTTCCTAAACAAAGTTTTTAC
ACCACGTACAATCTGAATAGACACGCAACTTTAAACCAGCTAGTGTTACAGACTCTAAAGTAGAGGCATAATC
TTCTAGATCAGAATCTGGATTGGAAGTGGGATAAAGAAATCTTGACCCCAAATCTTTGGATTCCTATTTGGCT
CATTAACGTTTAAAAAAGAATAAAGCCnTTAAGGAAAACAATCTATTGTTCCTGGCCTGAGATACTACCTGGT
TCTTTTGTTTAATTATAATTGAAAACACCAAGTTTTACTTTATTTTGTGAAATCAAGTAAATACATGGCCTTTA
AATATAAGATAAAAAACAAAATAAAAACTCTTCTGAATAAGCATTTCAGGTATAAAAATTGTGATGAGGTCAC
ATATGTAAAGAATTAAACAATTCCTTTTTCACTCCTTGGCATTTAGGTGAATTGCTAACAAACACCCAGACTC
CCTTATTTACAGCTGTTCTAGAAACACnTAACATTTTATTGGGCCCCACGCTGGCTATTTCCCTCTCAGCAAA
CATGCACTGGGTCTGAGAATAAATCAGTCGTTCTTAAACTTCCTTGAGTCATGAATCCCTACGAGGCTCTACG
ATAACTCTAGGCTCTCTCTCCAGAAAGAAAAAAAAAATGTACATAATGCAAAGTTGCAATATAACTTGAAAGG
GTTCATGAGCCCCTGGTTCTATATTGATTATGAGGGAAAGGAACCATGTTTGCTCGTAGTTAATGCAGTTGT
AATAGGCACTTTACATTTGAGACCATCTCTCTGTGATTCTCAGGAAGGCCAAATCTCAGCACCAGAGTTTGAA
CAAAGATTTTGTTATTTTTGTTCTTTAAATTAGATGTTGCCAATTTAATGCACTTACATCCTAACATGTTGAT
GATTTTAAGTATCAAGCACAATCACAATGCTGAAGTCTCCCTGAAGGGTCTATAGAGGAATCCAAGAAGGAG
GTGAAAACATTATTCATTGACATCAAACACCTCCAAGGCCTCATTCTGGGCCAGATTGGAAGTGAGGGAAAG
AAATTTTCAGCTCAAGTGTTTCCATTCATCGTGATTTCAGAGAGAAAAGGATAGGAACTGGGAAACGAAATA
CTCAACAGTCCTGATCTTGCAATTACCTGATTCTTTTGTTGTGCATGAAAATTAAGTTCTAACGTCTGTGAAA
CGTGTGAAATATATAAGCCAAACTTAAATGACTGTAGACACAAACTGTGTAACTTCCATGAGCCATTTCCTTC
CTGTGCACATGTATGTGTGTTATTTTTCAGTCCATTTCCTTCCATTTCTGGGTTCTCTGTGCAGCAATGTGGC
ATTGATTCTGTGGCCTTGTGCAGTCAGCTTATGCTCAGCCCATTGATTCCACCACATCCCTGATCGAGGGGA
CGTTAATTACCTGTCTTTGTGAATTAAGCAGTTTATGAGCAGCAAGTTACTGAGGACCGTAAATAAAGTCATA
GAGAGCTCAAGGAAGTAATAGCTTCGGTTTAATCATCTGCTTCAAAGGTGCCAATTTTTACATACTACTATAT
GTAATGATTTGTTCTAAATTGCTTGTTCCTTTTGAAAAAAATTTAAGGATGTTTTATGAAAATGACCATGGAG
GTCTCCTGCTTAACCAATATACTTTATATTTATAGTTAGAGGGCCCCTCCTTGATAGATTTGAATGAGGAGCT GGAAAGCTTGGGTACAATTTTCATGACTAGTTTGTATTATCTCTGCAAGCCAAAAGGTGTATTAGCAGTCAG
AATACAGCACTTTACAGAACTGGATTTTTTAAATGTATAAGTTTCCAGGTCTAGGATATTATTTAGCACTTTG
AAAGTTCCCCTTTTAAAATATATATATAAGAATAATCAAACGAGAAAAATGTACTCATAAAAACACAAAATGT
GTTTCTTCTGAATGTTTCAAATGTATTCTAAAATATGGTTTCTATAGATAATATTATGGTAGATAACTGGATA
GTACTTTTTTACTTTCTGAGTCTGTACAGTCTAATTCCTGAATGTTTGGGCTGTTTAATTTCTTTAAAGAT
GATAAATATTACCCGGTCATCCATCATGCTCTATCTATAGGCTATACCATTCATATGTTGGGCAATGCTGTAT
TATAAAACACATGTAAACATGTATGTAACCCATGTTTAACCCAGCGTAGTTGTAGCATGTGGTTGTATTAATG
AACGTTACAGGAGAGCTTTATAATCATTTATAAATCTGTAACATTCAATAAAGAAACACATGTTGCAATGATT
AATTATGTTCCCAATTCCATGTTATTTAGCATCTTTGTGAACCGGGCATTTTTGTTCCTGATCTGCTTGATGC
TTTTCATGTTCCTTTGGACCACTGTAAAATATGTGTGTAAGCTGATGTATATCCTCTAATGAGTCCTGCGAGC
TGTGGTAGGCAAGTTGTGATTTTGTGAAAGATGAACTGGCATGTTATGCAAAAGACTATATGACAAATGAAC
TTAAAATGATATTTTAAACTCCAGTTGAATTAGCTGTTTACATCTGCCAACCCCATGCAGAAGCAGTGTACAG
TATTTTATAAATATGTTCATTTAGTAACACTATGTTGTTTCTAGATAAAGTGATACTAGTGTGTAGGTGGTTA
TATATTTGGCCTAGATATTGCATTATAACTCACTATCCTTGAACAATAACAATGTGACTGAAATGAAGTAATC
TCTCTCCAAACCTGGTCrrTAATTTTGTGTCAACAAAATGCATGCACTGCTTTTATGCATTTCTTTTGACTTTTCT
AAGGCACTTAACATTTTACTATTGCCTGCTGTGACGCTTAAGCCAGTTAAGAATTCACTCAAACAGTTGGGCT
TGTTACTATGGGGATTATGTTCAGTTTTGAAAAATTAAAAACAAAAAAAAAGTAACCAAGGGATTTTTAAATC
TTTTTTTTAAGCACTGAACAAATAATATGAAATAAAGTATTAACTGCAGGTTGTATAGCCATGGGACCCAGAG
GTGGCAAGCCAACACCTCTTGGGTCTGCCAAGGTCTAGGTGTTGTGCATCTGTGATATATGCAAGACACATT
TCTGATTCTTCAGAGCTACTGGGTGCAAATTGCTAAGCCGGAGATGAGAGCGAAAAGTCCATTTGTGATAGT
GCAGAAGTGCGCAGATCGCTGTGAATGTGTGATCCAATGATATGACAAGAGACCTCCCTCCTTGTCTTGTGG
CTTCTTCACCTTGGGGGTGGGAGGCGTGTGTTTGGGTGTCTGATGAAGCACTGGGTGGTTCTAAAGAGTTT
ACTCTTTTAGAAAATCATCATTACTAGAAGCCATTCAACATCTGTTAAAGAGAGGAGCCAATTTGCACAGTTT
TGAAAATGACTGCTCCTAAAATGAGTAGACAAAACTTTCCTCTCAGCCTGCATTGACCTAAGCTTTCTCTTCT
TTTTACAAGTTGGATATTCTGTCTCTCAGATTGGAGTCAACCAAAAGAAAGGCTGGTTCCAATTAAGGAAAAG
CAATTTTTTTCTrTTAATTCCTCTCAGAAGGTAGTTGTGTTACCTTTTCTCTGATGATTTCCTTGCACTCATCA
CTGCTAATGAAAGCAACGTGACTGTTTCTACAGGTCATCTAAGAGAGGATTTTGGTGACCAGGTAATCCAGA
TGGCAATAAGAATGAGGTGAATTTTCCCTTCCTTACCTTACCTAGTCTACCAGCCTCCTTAAACCTGCAGGCC
CTTGTGCGTTTGCACAATGTTTGTGTGCTGGAAACTGAAAAGACATGTGTATGGCTAGAAGTCCATAGGCTT
TGTAAAGAGTGTCAGTGCCAATCAGGACCCATGCCTTCCTCTGGAGGAGACAGGTGGCTGAGGCCTATGGG
GCAAAGGGGGAAATTCAGCCTTGTGCCTGGATGTGCGGCTTTCTTTCTCCCCTCnTCTTGCTTCTCTTCTCTT
AGTCTAAGACTAGCTGCTTTTTCACCAGACCAACAGACCCnTGCCCACATTACCTTTATACCTTGTTGACCCT
CGCACAGTAAGCTGAAACAGCGGCCGCTTGGAAAAAGGCAAACATTTAGACTTTGTCCCAGGCCTGATCTTC
CCACCAACTTAGCCTCCTCCTGCCTCTACCCCGGCTGCTGTTCACATTGACCTCGTCCAATTTTTGCCTCTCT
AAATCTCAAGAGTCCTACACATCTTCACCGCAGCTTCCCACACATCATTAAAACCAGCCATCTGCACATAGAC
TGAGAGGCTGCAAATTCAAACACATGGAGGGGCCGGATCCAGAAAACACAAATGTGTGAACTGGACTGGTGA
AAGTCAACAGAAGTAGGGTTTGTAAGTAAGGCATGACAGAATACACATCCCACCACAAACACCTTCAAATTCA
GCTTTCCAAACACTGTCCTAGCCAAACAAACATGTCTGCCAGCAGCATTCAGTCCCAAAGGCAATAGTTTGGG
ACCTCTGATTTAGAGCCAACAGGATCAGATTCTTGATAGTGACTTGGTGAGTGTACACACAAAATACACTGA
GAACCGAGAGGGGGGAAAAGAAACTCGCCTTATTCAGAGTTACTCTTGTTCTGAATGATATATGCATGTATA
TTTGTTAGCCACATAATTCTAAACTTGAACACAGAGTCTTTGTGAGAGAGATTCAGAAGAAGAGTACCATAGC
ATGGTATGAAGACTTACCTGCTTCCTGTCACTACTGCGTCTGACCTGAGTTTATATTGCTGCTACCGCTGTGT
AAAAACAGTACGTGCAGTATACTGTACTCATAGCCATTTCATAATATAGGACCTAGACTCTCATTTGTAAACG
TTCTAACCCTAGTTTATAATGGGGGAAATTATTCAGATATCATTTTTAAATGAATTCCTACAAATACAATGGT
TTTAAAATTGGGTTTGCTGAATATATATACATCTTTTCCTTCTTTGTGTATGGATGGACCACGGTATGCATAT CTATCGACACTATAAATATATATAAATCCTTAGAAGAATTGTTCTTTTTTAAAGGTCTATTATTGGATTCACAA
TGCACTTTGAGTTTGATTGTTTAGATATACAATTCAGAGCAGAAGTTGGCAGATACCACGGGAAAAACTTTCT
GAAATTTCTGTAACAAATGTTTTGCAATAAAAAAAAAAACTCAGTAGTTTAAAACA
SEQ ID NO: 68 Nucleotide sequence of exon 29 of the human TRPM3gene where exon 30 is used GGTGGAGAACATGTCTATGCGGCTGGAGGAAGTCAACGAGAGAGAGCACTCCATGAAGGCTTCACTCCAGA CCGTGGACATCCGGCTGGCGCAGCTGGAAGACCTTATCGGGCGCATGGCCACGGCCCTGGAGCGCCTGACA GGTCTGGAGCGGGCCGAGTCCAACAAAATCCGCTCGAGGACCTCGTCAGACTGCACGGACGCCGCCTACATT GTCCGTCAGAGCAGCTTCAACAGCCAGGAAGGGAACACCTTCAAGCTCCAAGAGAGTATAGACCCTGCAG
SEQ ID NO: 69 Nucleotide sequence of exon 30 of the human TRPM3gene.
AGCATCCTCTTTATTCAGTATAAGCCGGCAGCAAGCAGTTCTACCTAACGTCCCACATCCTTCTCATGCCAAC
ACTTCTGTAATTGATCATTATAAAGAAAAAACAAGGTAACAGTCATAGTTCACCTGTCTCTTATCTATTCACTT CTGGTGCCACAACTGTTTATCCTTTTTTGAAGAAAATAAGGGAACAGAAATGCCTTTTTGTATTGCAATCGAA ATGAAAGAAGAGTTGATGTTAAAAAAACAAAAGTCAAGTGATTTATTATATACAGTGGGCGTTCAAGTCTAGT CGAGCAAGCTCAGGAGAATGTAATTAAATAATTTTATATTTTTTAATTTATTTTGTATCTCACCTGTCATGGA TGAATTCATTCACTGAATATGTAATATTGAACTTAAAAAAAAAAAAAAAAAAACAGTGGACAGAACTAGCCTG
AAATTGCCATGTGGGATGTTCTGTTCTCACCGTTCATGTCGTGTGTTGTGCTGCTGTGTGACCGTCATCATT TGCATGGCTCCACCACGTCCTCCTGAACACCTCCAAGACGTAACTGCCAATTTTTCACACCACTCATCACATG ACCATTTTGTATATGAATATATGGTTATATGTGGATATTTTCATACCTAGAGTTTTGCCATCTAATCTGAGCT CAGCATAAATTTAATTGGAGTTTTTCAAGGGCTGGTATCTTTTCTATGGAAATGTTCCAAAGTACTTTTTAAG GAAGTTTCAAAACTATAAATAACCTTAGATTTGACTGGGAGTTTGGTATCAACCCAAAGCCATCAGTTGCAAG CATACCATGAATATTTTTCTTATAGACAGAGCTATAAAAAAAGATACAGTAGACCAAAATAGAAAGCAAATAA ACCATATAAAGAGTTCTATAGTATATGCCACTTATACACATGTATATGCATTTATGCAGAGACACATATTTAT ATATAAAATAAATGGACATAAAGAGCTTTCTTAAGAGGCTTGGACTTTTCTATCACCTTGAAGTATAATCAAG ATTTTTTTTAATATACAAGAAGTTCCATTGAAAGAGTTCATTATACTATTAGACCAAATGTTGAAATTATGAAT
TTTTTAAATTCCTATGACTTTCCTCATATCAAACTAGAGTTGTCAAAATGACTCACTGCTCGCCTTCTGCCCT TTTTTGTCTGAAATCACTCACTATCAGGACATCTCATTTAGTCTCGCTTTTCCTAAACAAAGTTTTTACACCAC GTACAATCTGAATAGACACGCAACTTTAAACCAGCTAGTGTTACAGACTCTAAAGTAGAGGCATAATCTTCTA GATCAGAATCTGGATTGGAAGTGGGATAAAGAAATCTTGACCCCAAATCTTTGGATTCCTATTTGGCTCATTA ACGTTTAAAAAAGAATAAAGCCTTTAAGGAAAACAATCTATTGTTCCTGGCCTGAGATACTACCTGGTTCTTT TGTTTAATTATAATTGAAAACACCAAGTTTTACTTTATTTTGTGAAATCAAGTAAATACATGGCCTTTAAATAT AAGATAAAAAACAAAATAAAAACTCTTCTGAATAAGCATTTCAGGTATAAAAATTGTGATGAGGTCACATATG TAAAGAATTAAACAATTCCTTTTTCACTCCTTGGCATTTAGGTGAATTGCTAACAAACACCCAGACTCCCTTA TTTACAGCTGTTCTAGAAACACTTAACATTTTATTGGGCCCCACGCTGGCTATTTCCCTCTCAGCAAACATGC ACTGGGTCTGAGAATAAATCAGTCGTTCTTAAACTTCCTTGAGTCATGAATCCCTACGAGGCTCTACGATAAC TCTAGGCTCTCTCTCCAGAAAGAAAAAAAAAATGTACATAATGCAAAGTTGCAATATAACTTGAAAGGGTTCA TGAGCCCCTGGTTCTATATTGATTATGAGGGAAAGGAACCATGTTTGCTCGTAGTTAATGCAGTTGTAATAG GCACTTTACATTTGAGACCATCTCTCTGTGATTCTCAGGAAGGCCAAATCTCAGCACCAGAGTTTGAACAAAG ATTTTGTTATTTTTGTTCTTTAAATTAGATGTTGCCAATTTAATGCACTTACATCCTAACATGTTGATGATTTT AAGTATCAAGCACAATCACAATGCTGAAGTCTCCCTGAAGGGTCTATAGAGGAATCCAAGAAGGAGGTGAAA
ACATTATTCATTGACATCAAACACCTCCAAGGCCTCATTCTGGGCCAGATTGGAAGTGAGGGAAAGAAATTTT CAGCTCAAGTGTTTCCATTCATCGTGATTTCAGAGAGAAAAGGATAGGAACTGGGAAACGAAATACTCAACA GTCCTGATCTTGCAATTACCTGATTCTTTTGTTGTGCATGAAAATTAAGTTCTAACGTCTGTGAAACGTGTGA AATATATAAGCCAAACTTAAATGACTGTAGACACAAACTGTGTAACTTCCATGAGCCATTTCCTTCCTGTGCA CATGTATGTGTGTTATTTTTCAGTCCATTTCCTTCCATTTCTGGGTTCTCTGTGCAGCAATGTGGCATTGATT
CTGTGGCCTTGTGCAGTCAGCTTATGCTCAGCCCATTGATTCCACCACATCCCTGATCGAGGGGACGTTAAT
TACCTGTCTTTGTGAATTAAGCAGTTTATGAGCAGCAAGTTACTGAGGACCGTAAATAAAGTCATAGAGAGC
TCAAGGAAGTAATAGCTTCGGTTTAATCATCTGCTTCAAAGGTGCCAATTTTTACATACTACTATATGTAATG
ATTTGTTCTAAATTGCTTGTTCCTTTTGAAAAAAATTTAAGGATGTTTTATGAAAATGACCATGGAGGTCTCC
TGCTTAACCAATATACTTTATATTTATAGTTAGAGGGCCCCTCCTTGATAGATTTGAATGAGGAGCTGGAAAG
CTTGGGTACAATTTTCATGACTAGTTTGTATTATCTCTGCAAGCCAAAAGGTGTATTAGCAGTCAGAATACAG
CACTTTACAGAACTGGATTTTTTAAATGTATAAGTTTCCAGGTCTAGGATATTATTTAGCACTTTGAAAGTTC
CCCTTTTAAAATATATATATAAGAATAATCAAACGAGAAAAATGTACTCATAAAAACACAAAATGTGTTTCTTC
TGAATGTTTCAAATGTATTCTAAAATATGGTTTCTATAGATAATATTATGGTAGATAACTGGATAGTACTTTT
TTACTTTCTGAGTCTGTACAGTCTAATCTTCCTGAATGTTTGGGCTGTTTAATTTCnTTAAAGATGATAAATA
TTACCCGGTCATCCATCATGCTCTATCTATAGGCTATACCATTCATATGTTGGGCAATGCTGTATTATAAAAC
ACATGTAAACATGTATGTAACCCATGTTTAACCCAGCGTAGTTGTAGCATGTGGTTGTATTAATGAACGTTAC
AGGAGAGCTTTATAATCATTTATAAATCTGTAACATTCAATAAAGAAACACATGTTGCAATGATTAATTATGT
TCCCAATTCCATGTTATTTAGCATCTTTGTGAACCGGGCATTTTTGTTCCTGATCTGCTTGATGCTTTTCATG
TTCCTTTGGACCACTGTAAAATATGTGTGTAAGCTGATGTATATCCTCTAATGAGTCCTGCGAGCTGTGGTA
GGCAAGTTGTGATTTTGTGAAAGATGAACTGGCATGTTATGCAAAAGACTATATGACAAATGAACTTAAAAT
GATATTTTAAACTCCAGTTGAATTAGCTGTTTACATCTGCCAACCCCATGCAGAAGCAGTGTACAGTATTTTA
TAAATATGTTCATTTAGTAACACTATGTTGTTTCTAGATAAAGTGATACTAGTGTGTAGGTGGTTATATATTT
GGCCTAGATATTGCATTATAACTCACTATCCTTGAACAATAACAATGTGACTGAAATGAAGTAATCTCTCTCC
AAACCTGGTCTrTAATTTTGTGTCAACAAAATGCATGCACTGCTTTATGCATTTCTTTTGACTTTTCTAAGGCA
CTTAACATTTTACTATTGCCTGCTGTGACGCTTAAGCCAGTTAAGAATTCACTCAAACAGTTGGGCTTCTTAC
TATGGGGATTATGTTCAGTTTTGAAAAATTAAAAACAAAAAAAAAGTAACCAAGGGATTTTTAAATCTTTTTT
TTAAGCACTGAACAAATAATATGAAATAAAGTATTAACTGCAGGTTGTATAGCCATGGGACCCAGAGGTGGC
AAGCCAACACCTCTTGGGTCTGCCAAGGTCTAGGTGTTGTGCATCTGTGATATATGCAAGACACATTTCTGA
TTCTTCAGAGCTACTGGGTGCAAATTGCTAAGCCGGAGATGAGAGCGAAAAGTCCATTTGTGATAGTGCAGA
AGTGCGCAGATCGCTGTGAATGTGTGATCCAATGATATGACAAGAGACCTCCCTCCTTGTCTTGTGGCTTCT
TCACCTTGGGGGTGGGAGGCGTGTGTTTGGGTGTCTGATGAAGCACTGGGTGGTTCTAAAGAGTTTACTCT
TTTAGAAAATCATCATTACTAGAAGCCATTCAACATCTGTTAAAGAGAGGAGCCAATTTGCACAGTTTTGAAA
ATGACTGCTCCTAAAATGAGTAGACAAAACTTTCCTCTCAGCCTGCATTGACCTAAGCTTTCTCTTCTTTTTA
CAAGTTGGATATTCTGTCTCTCAGATTGGAGTCAACCAAAAGAAAGGCTGGTTCCAATTAAGGAAAAGCAAT
TTTTTTCTTTTAATTCCTCTCAGAAGGTAGTTGTGTTACCTTTTCTCTGATGATTTCCTTGCACTCATCACTGC
TAATGAAAGCAACGTGACTGTTTCTACAGGTCATCTAAGAGAGGATTTTGGTGACCAGGTAATCCAGATGGC
AATAAGAATGAGGTGAATTTTCCCTTCCTTACCTTACCTAGTCTACCAGCCTCCTTAAACCTGCAGGCCCTTG
TGCGTTTGCACAATGTTTGTGTGCTGGAAACTGAAAAGACATGTGTATGGCTAGAAGTCCATAGGCTTTGTA
AAGAGTGTCAGTGCCAATCAGGACCCATGCCTTCCTCTGGAGGAGACAGGTGGCTGAGGCCTATGGGGCAA
AGGGGGAAATTCAGCCTTGTGCCTGGATGTGCGGCTTCTTTCTCCCCTCTTCTTGCTTCTCTTCTCTTAGTC
TAAGACTAGCTGCTTTTTCACCAGACCAACAGACCCTTGCCCACATTACCTTTATACCTTGTTGACCCTCGCA
CAGTAAGCTGAAACAGCGGCCGCTTGGAAAAAGGCAAACATTTAGACTTTGTCCCAGGCCTGATCTTCCCAC
CAACTTAGCCTCCTCCTGCCTCTACCCCGGCTGGTGTTCACATTGACCTCGTCCAATTTTTGCCTCTCTAAAT
CTCAAGAGTCCTACACATCTTCACCGCAGCTTCCCACACATCATTAAAACCAGCCATCTGCACATAGACTGAG
AGGCTGCAAATTCAAACACATGGAGGGGCCGGATCCAGAAAACACAAATGTGTGAACTGGACTGGTGAAAGT
CAACAGAAGTAGGGTTTGTAAGTAAGGCATGACAGAATACACATCCCACCACAAACACCTTCAAATTCAGCTT
TCCAAACACTGTCCTAGCCAAACAAACATGTCTGCCAGCAGCATTCAGTCCCAAAGGCAATAGTTTGGGACCT
CTGATTTAGAGCCAACAGGATCAGATTCTTGATAGTGACTTGGTGAGTGTACACACAAAATACACTGAGAAC CGAGAGGGGGGAAAAGAAACTCGCCTTATTCAGAGTTACTCTTGTTCTGAATGATATATGCATGTATATTTG
TTAGCCACATAATTCTAAACTTGAACACAGAGTCTTTGTGAGAGAGATTCAGAAGAAGAGTACCATAGCATG
GTATGAAGACTTACCTGCTTCCTGTCACTACTGCGTCTGACCTGAGTTTATATTGCTGCTACCGCTGTGTAAA
AACAGTACGTGCAGTATACTGTACTCATAGCCATTTCATAATATAGGACCTAGACTCTCATTTGTAAACGTTC TAACCCTAGTTTATAATGGGGGAAATTATTCAGATATCATTTTTAAATGAATTCCTACAAATACAATGGTTTT
AAAATTGGGTTTGCTGAATATATATACATCTTTTCCTTCTTTGTGTATGGATGGACCACGGTATGCATATCTA
TCGACACTATAAATATATATAAATCCTTAGAAGAATTGTTCTTTTTTAAAGGTCTATTATTGGATTCACAATGC
ACTTTGAGTTTGATTGTTTAGATATACAATTCAGAGCAGAAGTTGGCAGATACCACGGGAAAAACTTTCTGAA
ATTTCTGTAACAAATGTTTTGCAATAAAAAAAAAAACTCAGTAGTTTAAAACATGA

Claims

1. An inhibitor of human TRPM3 for use in the treatment or prevention of migraine in a human subject whose migraines are not responsive to CGRP inhibition.
2. Use of an inhibitor of human TRPM3 in the manufacture of a medicament for the treatment or prevention of migraine in a human subject whose migraines are not responsive to CGRP inhibition.
3. A method of treatment, or prevention, of migraine in a human subject whose migraines are not responsive to CGRP inhibition, which comprises administering a subject in need thereof a therapeutically effective amount of an inhibitor of human TRPM3.
4. An inhibitor of human TRPM3 for use according to claim 1, use according to claim 2 or a method according to claim 3, wherein the human subject has failed treatment with an antagonist of CGRP.
5. An inhibitor of human TRPM3 for use according to claim 1 or claim 4, use according to claim 2 or claim 4, or a method according to claim 3 or claim 4, wherein the human subject has migraines that are responsive to therapy with a triptan.
6. An inhibitor of human TRPM3 for use according to claim 5, use according to claim 5 or a method according to claim 5, wherein the human subject has migraines that have previously responded to treatment with a triptan.
7. An inhibitor of human TRPM3 for use in the treatment or prevention of migraine in a human subject whose migraines are responsive to therapy with a triptan.
8. Use of an inhibitor of human TRPM3 in the manufacture of a medicament for the treatment or prevention of migraine in a human subject whose migraines are responsive to therapy with a triptan.
9. A method of treatment or prevention of migraine in a human subject whose migraines are responsive to therapy with a triptan, which comprises administering a subject in need thereof a therapeutically acceptable amount of an inhibitor of human TRPM3.
10. An inhibitor of human TRPM3 for use according to claim 7, use according to claim 8 or a method according to claim 9, wherein the human subject has migraines that have previously responded to treatment with a triptan.
11. An inhibitor of human TRPM3 for use according to claim 6 or claim 10, use according to claim 6 or claim 10 or a method according to claim 6 or claim 10, wherein the triptan is selected from the group consisting of: almotriptan, eletriptan, frovatriptan, naratriptan, rizatriptan, sumatriptan and zolmitriptan.
12. An inhibitor of human TRPM3 for use according to any one of claims 1, 4, 5, 6, 7, 10 and 11, use according to any one of claims 2, 4, 5, 6, 8, 10 and 11 or a method according to any one of claims 3, 4, 5, 9, 10 and 11, wherein the human subject has a TRPM3 allele with a gain of function mutation.
13. An inhibitor of human TRPM3 for use according to claim 12, use according to claim 12 or a method according to claim 12, wherein the mutated version of human TRPM3 has one or more of the following amino acid substitutions is R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2).
14. An inhibitor of human TRPM3 for use according to any one of claims 1, 4, 5, 6, 7, 10, 11, 12 and 13 , use according to any one of claims 2, 4, 5, 6, 8,10,11, 12 and 13 or a method according to any one of claims 3, 4, 5, 6, 9, 10, 11, 12 and 13, wherein the use is the treatment of migraine.
15. An inhibitor of human TRPM3 for use according to claim 14, use according to claim 14, or a method according to claim 14, wherein the percentage of patients that are pain free 2 hours after administration of the inhibitor of human TRPM3 is higher for a population of patients receiving the inhibitor of human TRPM3 compared to a population of patients receiving placebo.
16. An inhibitor of human TRPM3 for use according to claim 14, use according to claim 14 or a method according to claim 14, wherein, following administration to a population of patients, the percentage of patients that are pain free 2 hours after administration of the inhibitor of human TRPM3 and do not use rescue medication or relapse within 24 hours after administration of the inhibitor of human TRPM3 is higher compared to a population of patients receiving placebo.
17. An inhibitor of human TRPM3 for use according to any one of claims 1, 4, 5, 6, 7, 10, 11, 12 and 13 , use according to any one of claims 2, 4, 5, 6, 8,10,11, 12 and 13 or a method according to any one of claims 3, 4, 5, 6, 9, 10, 11, 12 and 13, wherein the use is the prevention of migraine.
18. An inhibitor of human TRPM3 for use according to claim 17, use according to claim 17, or a method according to claim 17, wherein, following administration to a population of patients, the reduction in mean monthly migraine days is greater for a population of patients receiving the inhibitor of TRPM3 compared to placebo.
19. An inhibitor of human TRPM3 for use according to claim 17, use according to claim 17, or a method according to claim 17, wherein the 50% responder rate is higher for a population of patients receiving the inhibitor of TRPM3 compared to placebo.
20. An inhibitor of human TRPM3 for use in the treatment or prevention of cluster headache in a human subject whose headaches are not responsive to CGRP inhibition.
21. Use of an inhibitor of human TRPM3 in the manufacture of a medicament for the treatment or prevention of cluster headache in a human subject whose headaches are not responsive to CGRP inhibition.
22. A method of treatment or prevention of cluster headache in a human subject whose headaches are not responsive to CGRP inhibition, which comprises administering a subject in need thereof a therapeutically acceptable amount of an inhibitor of human TRPM3.
23. An inhibitor of human TRPM3 for use according to claim 20, use according to claim 21 or a method according to claim 23, wherein the human subject has failed treatment with an antagonist of CGRP.
24. An inhibitor of human TRPM3 for use according to claim 20 or claim 23, use according to claim 21 or claim 23, or a method according to claim 22 or claim 23, wherein the human subject has headaches that are responsive to therapy with a triptan.
25. An inhibitor of human TRPM3 for use according to claim 24, use according to claim 24 or a method according to claim 24, wherein the human subject has headaches that have previously responded to treatment with a triptan.
26. An inhibitor of human TRPM3 for use according to claim 25, use according to claim 25 or a method according to claim 25, wherein the triptan is selected from the group consisting of: almotriptan, eletriptan, frovatriptan, naratriptan, rizatriptan, sumatriptan and zolmitriptan.
27. An inhibitor of human TRPM3 for use according to any one of claims 20 or 23-26, use according to any one of claims 21 or 23-26, or a method according to any one of claims 22- 26, wherein the human subject has a TRPM3 allele with a gain of function mutation.
28. An inhibitor of human TRPM3 for use according to claim 27 , use according to claim 27 or a method according to claim 27 , wherein the mutated version of human TRPM3 has one or more of the following amino acid substitutions is R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2).
29. An inhibitor of human TRPM3 for use in the treatment of medication overuse headache in a human subject.
30. Use of an inhibitor of human TRPM3 in the manufacture of a medicament for the treatment of medication overuse headache in a human subject.
31. A method of treatment of medication overuse headache in a human subject, which comprises administering a subject in need thereof a therapeutically acceptable amount of an inhibitor of human TRPM3.
32. An inhibitor of human TRPM3 for use according to claim 29, use according to claim 30 or a method according to claim 31, wherein the human subject has a TRPM3 allele with a gain of function mutation,.
33. An inhibitor of human TRPM3 for use according to claim 32, use according to claim 32 or a method according to claim 32, wherein the mutated version of human TRPM3 has one or more of the following amino acid substitutions is R1670Q, A1645V, V990M and P1090Q (numbering based on SEQ ID NO: 2).
34. A method for measuring PACAP in a sample comprising incubating a cell line expressing the PAC1 receptor with the sample and measuring cAMP signalling in the cell line.
35. A method for identifying an inhibitor of human TRPM3, comprising measuring release of PACAP from dorsal root ganglia or trigeminal ganglia, or from primary cultures of cells isolated from dorsal root ganglia or trigeminal ganglia, following challenge with an agonist of human
TRPM3 in the presence or absence of a test inhibitor, wherein the test inhibitor is identified as an inhibitor for human TRPM3 if PACAP production is reduced in the presence of the test inhibitor compared to PACAP production in the absence of the test inhibitor, and wherein PACAP production is measured according to the method defined in claim 34.
36. A method according to claim 35, wherein the agonist of human TRPM3 is pregnenolone sulfate, a racemate of 2-(3,4-dihydroquinolin-l(2H)-yl)-/V-(5-methylisoxazol-3-yl)-2- phenylacetamide, (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3- yl)propenamide or (S)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3- yl)propenamide.
37. (R)-2-(3,4-dihydroquinolin-l(2H)-yl)-N-(5-methylisoxazol-3-yl)propenamide or a salt thereof.
EP23744064.9A 2022-07-13 2023-07-10 Novel use Pending EP4554577A1 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US202263388720P 2022-07-13 2022-07-13
US17/812,299 US20230220037A1 (en) 2022-01-12 2022-07-13 Novel use
PCT/EP2023/068967 WO2024013052A1 (en) 2022-07-13 2023-07-10 Novel use

Publications (1)

Publication Number Publication Date
EP4554577A1 true EP4554577A1 (en) 2025-05-21

Family

ID=87418957

Family Applications (1)

Application Number Title Priority Date Filing Date
EP23744064.9A Pending EP4554577A1 (en) 2022-07-13 2023-07-10 Novel use

Country Status (2)

Country Link
EP (1) EP4554577A1 (en)
WO (1) WO2024013052A1 (en)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025224601A1 (en) * 2024-04-21 2025-10-30 Biohaven Therapeutics Ltd. Trpm3 antagonists for the treatment of migraine and pain

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7344882B2 (en) 2003-05-12 2008-03-18 Bristol-Myers Squibb Company Polynucleotides encoding variants of the TRP channel family member, LTRPC3
JP7836102B2 (en) 2020-11-24 2026-03-26 カトリーケ・ユニフェルシテイト・ルーヴァン Heterocyclic derivatives for treating TRPM3-mediated disorders
US20230391739A1 (en) 2020-11-24 2023-12-07 Katholieke Universiteit Leuven Aryl derivatives for treating trpm3 mediated disorders
EP4277609A1 (en) * 2021-01-14 2023-11-22 Glaxosmithkline Intellectual Property (N0.3) Limited Inhibitors of trpm3 and their uses

Also Published As

Publication number Publication date
WO2024013052A1 (en) 2024-01-18

Similar Documents

Publication Publication Date Title
EP3027225B1 (en) Compositions and methods for modulating thermogenesis using transforming growth factor alpha
US20180110837A1 (en) Methods and assays relating to macrophage differentiation
US20150125442A1 (en) Methods for treating muscle specific receptor kinase myasthenia gravis
US20240173290A1 (en) Novel use
US20130333059A1 (en) Hox compositions and methods
US20090105281A1 (en) Methods of treating inflammation
US20150335739A1 (en) Methods for treating inflammation
WO2024013052A1 (en) Novel use
US20230220037A1 (en) Novel use
AU2011291450B2 (en) TAM receptors and TAM receptor ligands in detection and modulation of neuropathological disease
JP7676323B2 (en) GPCR heteromeric inhibitors and uses thereof
EP2705364B1 (en) Screening method for analgesic agents
TW200831898A (en) Treatment of insulin resistance
US20090239884A1 (en) Methods of Treating Inflammation
US20230305023A1 (en) Methods of treatment and diagnostic of pathological conditions associated with intense stress
US20170360888A1 (en) Methods for treating inflammatory arthritis
Takeuchi et al. Repair of mucosal damage induced by ethanol in the rat stomach: effects of concentration, exposure period and prostaglandins
US20250154236A1 (en) Prevention and treatment of headaches
EP4179333B1 (en) Use of gdf11 to diagnose and treat anxiety and depression
EP1705256A1 (en) Methods for the treatment of insulin resistance and disease states characterized by insulin resistance
Berezin Opioid Bioavailability in the Retina Modulates Sleep/Wake Behavior
US20230056994A1 (en) Necroptosis modulators, screening methods and pharmaceutical compositions
Bretz The Role of NFAT Family Transcription Factors in Diabetic Retinopathy

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20250114

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)