EP4543920A1 - Combinations involving epidermal growth factor receptor tyrosine kinase inhibitors for the treatment of cancer - Google Patents
Combinations involving epidermal growth factor receptor tyrosine kinase inhibitors for the treatment of cancerInfo
- Publication number
- EP4543920A1 EP4543920A1 EP23736622.4A EP23736622A EP4543920A1 EP 4543920 A1 EP4543920 A1 EP 4543920A1 EP 23736622 A EP23736622 A EP 23736622A EP 4543920 A1 EP4543920 A1 EP 4543920A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- egfr
- amino acid
- seq
- acid sequence
- cmet
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/50—Pyridazines; Hydrogenated pyridazines
- A61K31/501—Pyridazines; Hydrogenated pyridazines not condensed and containing further heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/506—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/517—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with carbocyclic ring systems, e.g. quinazoline, perimidine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/535—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines
- A61K31/5375—1,4-Oxazines, e.g. morpholine
- A61K31/5377—1,4-Oxazines, e.g. morpholine not condensed and containing further heterocyclic rings, e.g. timolol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68037—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a camptothecin [CPT] or derivatives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
Definitions
- the specification relates to an Epidermal Growth Factor Receptor (EGFR) Tyrosine Kinase Inhibitor (TKI) for use in the treatment of cancer (for example, non-small cell lung cancer [NSCLC]), wherein the EGFR TKI is for use in combination with anti-EGFR/cMET antibody molecule.
- EGFR Epidermal Growth Factor Receptor
- TKI Tyrosine Kinase Inhibitor
- EGFR epidermal growth factor receptor
- two first generation erlotinib & gefitinib
- two second generation afatinib & dacomitinib
- a third generation osimertinib tyrosine kinase inhibitors (TKIs)
- NSCLC non-small cell lung cancer
- cMET the gene product of the proto -oncogene MET, is a receptor tyrosine kinase expressed primarily on the surface of epithelial cells.
- Aberrant expression and dysregulation of the cMET pathway has been reported for a wide variety of human cancers, including non-small cell lung, colorectal, gastrointestinal, head and neck, pancreatic, renal, and hepatocellular cancers, among many others (Organ, 2011; Birchmeier, 2003; Mo, 2017; Sierra, 2011).
- ADCs Antibody drug conjugates
- ABT-414 depatuxizumab mafodotin
- ABT-414 was in Phase III clinical development by AbbVie for glioblastoma (Phillips, 2016).
- ABT-414 was previously tested in Phase II trials for multiple additional solid tumor indications (ClinicalTrials.gov: NCT01741727).
- the ADC showed limited efficacy at tolerated doses in these indications, and concerning ocular toxicides were frequently observed in treated patients (Tolcher, 2014).
- a second generation EGFR ADC ABBV-221 was in clinical development but was discontinued due to safety concerns (Phillips, 2018; Calvo, 2017).
- There is one cMET targeted ADC Telisotuzumab Vedotin (ABBV-399), which is entering Phase II clinical development for non-small cell lung cancer (NSCLC) patients whose tumors express high levels of cMET, both as monotherapy and in combination with the EGFR inhibitor, erlotinib (Angevin, 2017; Wang, 2017).
- NSCLC non-small cell lung cancer
- erlotinib erlotinib
- the cMET ADC + EGFR TKI combination has shown clinical activity in Phase I trials in this selected patient population, with peripheral neuropathy and skin rash as the most frequent treatment related adverse events (Angevin, 2017; Calvo, 2017).
- a bispecific antibody targeting EGFR and cMET has also been developed and is being clinically investigated in the treatment of patients with advanced NSCLC as a monotherapy and in combination with third generation EGFR TKIs (ClinicalTrials.gov: NCT02609776).
- bispecific antibodies allows for fine tuning of the interactions between each target to impact the overall properties of the molecule, which could produce an ADC with an acceptable therapeutic window (Comer, 2018).
- This concept has been tested for EGFR and cMET in vitro, but investigators have yet to demonstrate proof of concept in vivo of an improvement in safety or efficacy compared to the EGFR and cMET ADC’s noted above (Sellmann, 2016).
- the inventors recognised that developing a developing anti-EGFR/cMET antibody molecules that bind EGFR with a low affinity e.g. that binds to human EGFR with a dissociation constant (Kd) that is equal to or higher than 10 nM
- Kd dissociation constant
- an anti-EGFR/cMET antibody molecule comprising such a low affinity EGFR binding domain conjugated to a drug (an antibody drug conjugate (“ADC”)) displayed reduced on-target toxicity in normal tissues such as skin toxicity and therefore were demonstrated to exhibit an improved safety profile compared to conjugates comprising an EGFR antigen-binding domain that binds human EGFR with a higher affinity.
- ADC antibody drug conjugate
- an ADC comprising this low affinity EGFR binding domain used in combination with the third generation TKI osimertinib was demonstrated to effectively treat a range of EGFR mutant cancer models, including cancer models that had developed resistance to osimertinib.
- the combination of the antibody molecules disclosed herein and EGFR TKIs may provide a safe and effective therapy against EGFR-associated cancer, e.g. in patients that have developed resistance to EGFR TKIs.
- an EGFR TKI for use in the treatment of cancer in a human patient, wherein the EGFR TKI is administered in combination with an anti-EGFR/cMET antibody molecule, wherein the anti-EGFR/cMET antibody molecule comprises an EGFR binding domain and a cMET binding domain, wherein the EGFR binding domain comprises: a. a heavy chain variable (VH) region comprising the following complementarity determining regions (CDRs): i. HCDR1 having the amino acid sequence of SEQ ID NO: 1 ii. HCDR2 having the amino acid sequence of SEQ ID NO: 2 iii. HCDR3 having the amino acid sequence of SEQ ID NO: 3, or a variant thereof in which one or two or three amino acids in one or more of HCDR1,
- VH heavy chain variable
- HCDR2, or HCDR3 are substituted with another amino acid; and b. a light chain variable (VL) region comprising the following CDRs: i. LCDR1 having the amino acid sequence of SEQ ID NO: 4 ii. LCDR2 having the amino acid sequence of SEQ ID NO: 5 iii. LCDR3 having the amino acid sequence of SEQ ID NO: 6, or a variant thereof in which one or two or three amino acids in one or more of HCDR1,
- an anti-EGFR/cMET antibody molecule for use in the treatment of cancer in a human patient, wherein the anti-EGFR/cMET antibody molecule is administered in combination with an EGFR TKI, wherein the anti-EGFR/cMET antibody molecule comprises an EGFR binding domain and a cMET binding domain, wherein the EGFR binding domain comprises: a. a heavy chain variable (VH) region comprising the following complementarity determining regions (CDRs): i. HCDR1 having the amino acid sequence of SEQ ID NO: 1 ii. HCDR2 having the amino acid sequence of SEQ ID NO: 2 iii.
- VH heavy chain variable
- HCDR3 having the amino acid sequence of SEQ ID NO: 3, or a variant thereof in which one or two or three amino acids in one or more of HCDR1, HCDR2, or HCDR3 are substituted with another amino acid
- a light chain variable (VL) region comprising the following CDRs: i. LCDR1 having the amino acid sequence of SEQ ID NO: 4 ii. LCDR2 having the amino acid sequence of SEQ ID NO: 5 iii. LCDR3 having the amino acid sequence of SEQ ID NO: 6, or a variant thereof in which one or two or three amino acids in one or more of HCDR1, HCDR2, or HCDR3 are substituted with another amino acid.
- HCDR3 having the amino acid sequence of SEQ ID NO: 3, or a variant thereof in which one or two or three amino acids in one or more of HCDR1, HCDR2, or HCDR3 are substituted with another amino acid
- a light chain variable (VL) region comprising the following CDRs: i. LCDR1 having the amino acid sequence of SEQ ID NO: 4 ii. LCDR2 having the amino acid sequence of SEQ ID NO: 5 iii. LCDR3 having the amino acid sequence of SEQ ID NO: 6, or a variant thereof in which one or two or three amino acids in one or more of HCDR1, HCDR2, or HCDR3 are substituted with another amino acid.
- a pharmaceutical combination of an EGFR/cMET antibody molecule and an EGFR TKI wherein the anti-EGFR/cMET antibody molecule comprises an EGFR binding domain and a cMET binding domain, wherein the EGFR binding domain comprises: a. a heavy chain variable (VH) region comprising the following complementarity determining regions (CDRs): i. HCDR1 having the amino acid sequence of SEQ ID NO: 1 ii. HCDR2 having the amino acid sequence of SEQ ID NO: 2 iii.
- VH heavy chain variable
- HCDR3 having the amino acid sequence of SEQ ID NO: 3, or a variant thereof in which one or two or three amino acids in one or more of HCDR1, HCDR2, or HCDR3 are substituted with another amino acid
- a light chain variable (VL) region comprising the following CDRs: i. LCDR1 having the amino acid sequence of SEQ ID NO: 4 ii. LCDR2 having the amino acid sequence of SEQ ID NO: 5 iii. LCDR3 having the amino acid sequence of SEQ ID NO: 6, or a variant thereof in which one or two or three amino acids in one or more of LCDR1, LCDR2, or LCDR3 are substituted with another amino acid.
- administration of the EGFR TKI and the anti-EGFR/cMET antibody molecule is separate, sequential, or simultaneous.
- the anti-EGFR binding domain comprises HCDR1 having the amino acid sequence of SEQ ID NO: 1, HCDR2 having the amino acid sequence of SEQ ID NO: 2, HCDR3 having the amino acid sequence of SEQ ID NO: 3, LCDR1 having the amino acid sequence of SEQ ID NO: 4, LCDR2 having the amino acid sequence of SEQ ID NO: 5, and LCDR3 having the amino acid sequence of SEQ ID NO: 6.
- the anti-EGFR binding domain comprises a VH region comprising an amino acid sequence having at least 70%, at least 80%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 16; and a VL region comprising an amino acid sequence having at least 70%, at least 80%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 20.
- the anti-cMET binding domain comprises: a. a heavy chain variable (VH) region comprising the following complementarity determining regions (CDRs): i. HCDR1 having the amino acid sequence of SEQ ID NO: 24 ii. HCDR2 having the amino acid sequence of SEQ ID NO: 25 iii.
- HCDR3 having the amino acid sequence of SEQ ID NO: 26, or a variant thereof in which one or two or three amino acids in one or more of HCDR1, HCDR2, or HCDR3 are substituted with another amino acid; and b. a light chain variable (VL) region comprising the following CDRs: i. LCDR1 having the amino acid sequence of SEQ ID NO: 27 ii. LCDR2 having the amino acid sequence of SEQ ID NO: 28 iii. LCDR3 having the amino acid sequence of SEQ ID NO: 29, or a variant thereof in which one or two or three amino acids in one or more of HCDR1, HCDR2, or HCDR3 are substituted with another amino acid.
- VL light chain variable
- the anti-cMET binding domain comprises HCDR1 having the amino acid sequence of SEQ ID NO: 24, HCDR2 having the amino acid sequence of SEQ ID NO: 25, HCDR3 having the amino acid sequence of SEQ ID NO: 26, LCDR1 having the amino acid sequence of SEQ ID NO: 27, LCDR2 having the amino acid sequence of SEQ ID NO: 28, and LCDR3 having the amino acid sequence of SEQ ID NO: 29.
- the anti-cMET binding domain comprises a VH region comprising an amino acid sequence having at least 70%, at least 80%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 38; and a VL region comprising an amino acid sequence having at least 70%, at least 80%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 40.
- FIG 1A Graphical depiction of RAA22/B09-57 DuetMab. Shown are the Fabs of anti-EGFR RAA22, Fab of anti-cMET B09-57 and Hole and Knob heavy chains. The structural rendering is a composite of individual domain structures.
- FIG 11C Luciferase imaging of the orthotopic MEDI-PANC-08 LUC (luciferase expressing) PDX model. Mice were imaged weekly using the IVIS Spectrum In vivo Imaging system. The images are normalized across all groups and timepoints with the radiance scale (Avg Radiance [p/s/cm2/sr]) set between the max signal (Day 21 Control Gp) and background.
- radiance scale Avg Radiance [p/s/cm2/sr]
- FIG 11D In vivo efficacy of the Low Affinity RAA2/B09 ADC in the subcutaneous MEDI-PANC- 08 PDX model. • - Untreated, ⁇ - Gemcitabine (75 mg/kg - Q3/4Dx5), A R347-AZ1508 (3 mg/kg - QlWx4), ⁇ - RAA2/B09-1508 (2 mg/kg - QlWx4) and • - RAA2/B09-1508 (3 mg/kg - QlWx4). Treatment days are indicated by the arrows, tumor volumes were measured twice a week.
- the data displayed in FIGs 11 A and B are the group mean tumor volume (mm 3 ) ⁇ SEM, in FIG 1 ID group mean Radiance [p/s/cm 2 /sr] ⁇ SEM.
- FIG 12A Mean concentrations-time profiles and mean NCA PK parameters for RAA22/B09-57- AZ15O8 in Mice.
- the target compound concentration and the total antibody concentration were measured with an immuno capture LC-MS/MS assay.
- FIG 12B Mean concentrations-time profiles and mean NCA PK parameters for QD6/B09-57- AZ15O8 in Mice.
- the target compound concentration and the total antibody concentration were measured with an immuno capture LC-MS/MS assay.
- FIG 13A Mean concentrations-time profiles and mean NCA PK parameters for RAA22/B09-57- AZ15O8 and in Monkeys.
- FIG 13B Mean concentrations-time profiles and mean NCA PK parameters for QD6/B09-57-AZ1508 and in Monkeys.
- PK profiles and NCA PK parameters for QD6/B09-57-AZ1508 at 3 mg/kg in 20067312 was based on PK data following second dose.
- FIG 13C is a table summarizing the PK parameters of the molecules
- FIG 14 EGFR-cMET Maia Topoi ADC was evaluated in patient derived xenograft (PDX) models representing multiple types of human cancer in immunodeficient mice as a PDX trial. Compound was tested at a dose level of 10 mg/kg in a single mouse for each PDX model representing a unique human tumor.
- PDX patient derived xenograft
- %T/C Percent tumor growth relative to untreated control tumors
- Percent Tumor Regression (TXfinal avg - TXinitial avg)/(TXinitial avg) x 100).
- Percent Tumor Regression (TXfinal avg - TXinitial avg)/(TXinitial avg) x 100).
- FIG 16B Two different EGFR-cMET ADCs with different IgG Fc formats (Maia and TM) were evaluated for comparability in the PDX model Panc-08.
- the ADCs were tested at 3 dose levels: 2.5, 5, and 10 mg/kg and tumor growth was compared against untreated control animals. A total of 10 animals were treated per treatment and control group.
- FIG 17 depicts the results of the non-small cell lung cancer NSCLC PDX models from FIG 14 above, highlighting the EGFR mutation status and histology, where known.
- FIG 18 The pharmacokinetic profiles of EGFR-cMET bispecific antibodies INT-009 (RAA22/B09- Maia naked mAb) and INT-009-SG3932 DAR8 ADC (“MAIA ADC”) were compared to B09/RAA2- IgGl-TM mirror mAb (INT-017) and TM-mirror-SG3932 DAR6 ADC (“TM ADC”) in NOD-SCID mice at therapeutic doses of 5 mg/kg.
- FIG 19A depicts results of ADC efficacy in EGFR mutant PDX model ‘LUN487’ containing the L858R EGFR mutation.
- FIG 19B depicts results of ADC efficacy in combination with the 3 rd gen TKI osimertinib (‘Osi’) in EGFR mutant PDX model ‘LUN487’ containing the L858R EGFR mutation.
- FIG 19C depicts results of ADC efficacy in EGFR mutant PDX model ‘LUN439’ containing the L858R EGFR mutation.
- FIG 19D depicts results of ADC efficacy in combination with the 3 rd gen TKI osimertinib (‘Osi’) in EGFR mutant PDX model ‘LUN439’ containing the L858R EGFR mutation.
- the binding domain that binds cMET comprises a VH region according to (15) below:
- a VH region comprising the CDRs according to (15) and the FRs according to (16).
- binding domain that binds cMET comprises a VH region according to (18) below:
- VH region comprising an amino acid sequence having at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of SEQ ID NO: 38.
- VL region comprising the following CDRs:
- LCDR1 having the amino acid sequence of SEQ ID NO: 27
- LCDR2 having the amino acid sequence of SEQ ID NO: 28
- LCDR3 having the amino acid sequence of SEQ ID NO: 29, or a variant thereof in which one or two or three amino acids in one or more of LCDR1 , LCDR2, or LCDR3 are substituted with another amino acid.
- the binding domain that binds cMET comprises a VL region according to (19) above, wherein the VL region additionally comprises the FRs according to (20) below:
- LFR4 having the amino acid sequence of SEQ ID NO: 37, or a variant thereof in which one or two or three amino acids in one or more of LFR1, LFR2, LFR3, or LFR4 are substituted with another amino acid.
- binding domain that binds cMET comprises a VL region according to (21) below:
- binding domain that binds cMET comprises a VL region according to (22) below:
- VL region comprising an amino acid sequence having at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of SEQ ID NO: 40.
- the binding domain that binds cMET comprises a VH region according to any one of (15) to (18) above, and a VL region according to any one of (19) to (22) above.
- one or more amino acids are substituted with another amino acid.
- Naturally occurring residues may be divided into classes based on common side chain properties: 1) nonpolar, aliphatic: glycine (G), methionine (M), alanine (A), valine (V), leucine (L), isoleucine (I);
- H histidine
- K lysine
- R arginine
- the amino acid substitution may be a conservative amino acid substitution.
- Conservative amino acid substitutions may involve exchange of a member of one of these classes with another member of the same class.
- a conservative amino acid substitution may be a substitution of the acidic amino acid glutamic acid (E) for the acidic amino acid aspartic acid (D).
- the antibody molecule described herein comprises an immunoglobulin heavy chain constant (CH) region.
- CH immunoglobulin heavy chain constant
- the CH is, or is derived from, the heavy chain constant sequence of an IgG (e.g. IgGl, IgG2, IgG3, IgG4), IgA (e.g. IgAl, IgA2), IgD, IgE or IgM.
- the CH region is human immunoglobulin G1 constant (IGHG1; UniProt: P01857-1, vl; SEQ ID NO: 42) or a fragment thereof.
- the CH region comprises an amino acid sequence having at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of SEQ ID NO: 42, 43, 44, 45, 46, 63 or 64.
- the CH region comprises an amino acid sequence having at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of SEQ ID NO: 63 or 64.
- the antibody molecule comprises a heavy chain that comprises or consists of a VH region as described herein and a CH region as described herein.
- the antibody molecule described herein comprises an immunoglobulin light chain constant (CL) region or a fragment thereof.
- the CL region is, or is derived from a kappa CL region set forth in SEQ ID NO: 47 or SEQ ID NO: 48.
- the CL region is, or is derived from a lambda CL region set forth in SEQ ID NO: 49 or SEQ ID NO: 65.
- the antibody molecule comprises: a first CL region that is, or is derived from, a kappa CL region set forth in SEQ ID NO: 47 or 48; and a second CL region that is, or is derived from, a lambda CL region set forth in SEQ ID NO: 49 or 65.
- the antibody molecule described herein comprises: a first heavy chain, wherein the first heavy chain comprises the VH region of the anti-EGFR binding domain, and a first heavy chain constant (CH) region or a fragment thereof; a first light chain, wherein the first light chain comprises the VL region of the anti-EGFR binding domain, and a first light chain constant (CL) region or a fragment thereof; a second heavy chain, wherein the second heavy chain comprises the VH region of the s anti- cMET binding domain, and a second heavy chain constant (CH) region or a fragment thereof; and a second light chain, wherein the second light chain comprises the VL region of the anti-cMET binding domain, and a second light chain constant (CL) region or a fragment thereof.
- a first heavy chain wherein the first heavy chain comprises the VH region of the anti-EGFR binding domain, and a first heavy chain constant (CH) region or a fragment thereof
- a first light chain wherein the first light chain comprises the VL region of the anti-EGFR binding domain
- the first and second CH region may be identical or different.
- the first and second CH region may form a homodimer or heterodimer.
- asymmetrical bispecific antibody molecules have different first and second CH regions, as described in more detail below.
- the first and second CL regions may be identical or different.
- the first CL region is, or is derived from, a kappa CL region set forth in SEQ ID NO: 47 or 48; and a second CL region that is, or is derived from, a lambda CL region set forth in SEQ ID NO: 49 or 65.
- an antibody molecule comprises a first VH region and a first CH region, that these regions together form a first heavy chain of the antibody molecule, that is that the first VH and first CH regions are connected to each other.
- a second VH region and a second CH region forms a second heavy chain of the antibody molecule;
- a first VL region and a first CL region form a first light chain of the antibody molecule;
- a second VL region and a second CL region form a second light chain of the antibody molecule.
- the antibody molecule comprises a heavy chain having an amino acid sequence which has at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the B-09-GL heavy chain set forth in SEQ ID NO: 50, the QD6 heavy chain set forth in SEQ ID NO: 53, the RAA22 heavy chain set forth in SEQ ID NO: 56, the heavy chain set forth in SEQ ID NO: 59, or the heavy chain set forth in SEQ ID NO: 60.
- the antibody molecule comprises a first and second heavy chain, wherein
- the first heavy chain comprises an amino acid sequence which has at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the B-09-GL heavy chain set forth in SEQ ID NO: 56; and
- the second heavy chain comprises an amino acid sequence which has at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the RAA22 heavy chain set forth in SEQ ID NO: 50.
- the antibody molecule comprises a first and second heavy chain, wherein
- the first heavy chain comprises an amino acid sequence which has at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the heavy chain set forth in SEQ ID NO: 59; and
- the second heavy chain comprises an amino acid sequence which has at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the heavy chain set forth in SEQ ID NO: 60.
- the antibody molecule described herein comprises a light chain that comprises or consists of a VL region as described herein and a CL region as described herein.
- the antibody molecule described herein comprises a light chain having an amino acid sequence which has at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the B-09-GL light chain set forth in SEQ ID NO: 52, the QD6 light chain set forth in SEQ ID NO: 55, the RAA22 light chain set forth in SEQ ID NO: 58, the light chain set forth in SEQ ID NO: 61, or the light chain set forth in SEQ ID NO: 62.
- the antibody molecule described herein comprises a first and second light chain, wherein
- the first light chain comprises an amino acid sequence which has at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the RAA22 light chain set forth in SEQ ID NO: 58; and
- the second light chain comprises an amino acid sequence which has at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the B-09-GL light chain set forth in SEQ ID NO: 52
- the antibody molecule described herein comprises a first and second light chain, wherein
- the first light chain comprises an amino acid sequence which has at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the light chain set forth in SEQ ID NO: 61; and
- the second light chain comprises an amino acid sequence which has at least 70% sequence identity, such as at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the light chain set forth in SEQ ID NO: 62.
- the CH, CL, heavy chain and/or light chain of the antibody molecules described herein may comprise one or more modifications, for example to abrogate or reduce Fc effector functions, promote formation of a heterodimeric antibody molecule, to increase the efficacy of cognate heavy and light chain pairing, and/or to assist with conjugate formation as described in more detail below.
- a CH, CL, heavy chain and light chain that has been modified may be referred to as a modified CH, CL, heavy chain and light chain, respectively.
- the antibody molecule may comprise a mutation in the CH region(s) of the heavy chain(s) to reduce or abrogate binding of the antibody molecule to one or more Fey receptors, such as FcyRI, FcyRIIa, FcyRIIb, FcyRIII and/or to complement. Such mutations abrogate or reduce Fc effector functions. Mutations for reduce or abrogate binding of antibody molecule to one or more Fey receptors and complement are known and include the “triple mutation” or “TM” of L234F/L235E/P331S described for example in Organesyan, 2008. Other mutations that are known to modulate antibody effector function are described for example in Wang, 2018.
- the first and/or second heavy chain comprise phenylalanine (F) at position 234, glutamic acid (E) at position 235, and serine (S) at position 331, wherein the numbering is as per the EU index.
- one or both of the first and second heavy chains may comprise a CH region having an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95% sequence identity to the sequence set forth in SEQ ID NO: 42 and comprise a phenylalanine (F) at position 234, glutamic acid (E) at position 235, and serine (S) at position 331, wherein the numbering is as per the EU index.
- including the TM in the heavy chain was demonstrated to improve pharmacokinetic properties of the exemplified antibody molecules and ADCs.
- CH regions comprising the triple mutation are SEQ ID NOs: 63 and 64.
- one of the first and second heavy chains comprises a CH region having an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95%, or 100% sequence identity to the sequence set forth in SEQ ID NO: 63 and the other heavy chain comprises a CH region having an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95%, or 100% sequence identity to the sequence set forth in SEQ ID NO: 64, wherein one or both of the CH regions comprise a phenylalanine at position 234, glutamic acid at position 235, and serine at position 331, wherein the numbering is as per the EU index.
- heavy chains comprising a CH region containing the triple mutation are SEQ ID NOs: 59 and 60.
- one of the first and second heavy chains has an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95%, or 100% sequence identity to the sequence set forth in SEQ ID NO: 59 and the other heavy chain has an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95%, or 100% sequence identity to the sequence set forth in SEQ ID NO: 60, wherein one or both of the have chains comprise a phenylalanine at position 234, glutamic acid at position 235, and serine at position 331, wherein the numbering is as per the EU index.
- amino acid residue positions in the constant domain including the position of amino acid sequences, substitutions, deletions and insertions as described herein, are numbered according to EU numbering (Edelman, 2007).
- Bispecific antibody molecules may be provided in any suitable format. Suitable formats for a bispecific antibody molecule described herein, and methods for producing the same, are described in Kontermann, MAbs 2012, 4(2):182-197 and Kontermann and Brinkmann 2015, 20(7): 838-847, both of which are herein incorporated by reference in their entirety. See in particular FIG 2 of Kontermann MAbs 2012, 4(2): 182-19. Bispecific antibody molecules can also be generated from existing antibodies by chemical conjugation. For example, two IgG molecules or two Fab' fragments can be coupled using homo- or heterobifunctional coupling reagents, e.g. as described in Graziano and Guptill, Methods Mol Biol. 2004; 283:71-85.
- Symmetrical IgG-like bispecific antibody molecules generally contain an antigen -binding domain that is fused to the N- or C-terminus of the heavy of light chain of an IgG molecule, e.g. in the form of a scFv fragment or a variable single domain.
- a characteristic property of these symmetrical IgG-like bispecific antibody molecules is that they contain a two identical heavy chains.
- symmetrical IgG-like bispecific antibody molecules are typically bivalent for each epitope. Valency as used herein refers to the number of antigen-binding regions in the antibody molecule that are able to bind a single epitope.
- a monoclonal monospecific IgG antibody molecule is bivalent for a single epitope - it contains two antigen-binding domains, each of which are able to bind an epitope on a single target molecule.
- a symmetrical IgG-like bispecific antibody molecule is bivalent for each epitope - it typically contains four antigen-binding domains, two of which are able to bind a first epitope on a target molecule and two of which are able to bind to a second epitope on a target molecule.
- symmetrical IgG-like bispecific antibody molecules include DVD-IgG, IgG-scFv, scFv- IgG, scFv4-Ig, IgG-scFab, scFab-IgG, IgG-sVD, sVD-IgG, 2 in 1-IgG, mAb 2 , tandemab common LC. These can be formed by methods known in the art, for example chemical crosslinking, somatic hybridisation or the redox method.
- Asymmetrical IgG-like bispecific antibody molecules in contrast, are typically monovalent for each target.
- the concept of monovalent bispecific IgG is thought to have a unique therapeutic niche in that they (i) do not cause receptor homodimerization, (ii) potentially have reduced toxicity on non-target tissues due to loss of avidity for each antigen, and (iii) have better selectivity when both antigens are either selectively restricted or abundantly expressed on target cells.
- the antibody molecule is an asymmetrical IgG-like bispecific antibody molecule.
- Asymmetrical IgG-like bispecific antibody molecules involve heterodimerization of two distrinct heavy chain and correct pairing of the cognate light chain and heavy chain.
- Heterodimerization of the heavy chains can be addressed by several techniques, such as knobs-into-holes, electrostatic steering of CH3, CH3 strand exchanged engineered domains and leucine zippers.
- the pairing of the correct light and heavy chain can be ensured by using one of these heavy chain heterodimerization techniques along with the use of a common light chain, domain cross-over between CHI and CL, coupling of the heavy and light chains with a linker, in vitro assembly of heavy chain-light chain dimers from two separate monoclonals, interface engineering of an entire Fab domain, or disulfide engineering of the CHI /CL interface.
- the antibody molecules comprise one or more modifications in one or more of the CHI, CH2 and CH3 domains that promotes formation of a heterodimeric antibody molecule.
- the DuetMab antibody molecule described above may additionally comprise one or more modifications in one or more of the CHI, CH2 and CH3 domains that promotes formation of a heterodimeric antibody molecule. This may involve a Knobs into Holes (KiH) strategy based on single amino acid substitutions in the CH3 domains that promote heavy chain heterodimerization is described in Ridgway, 1996. The knob variant heavy chain CH3 has a small amino acid has been replaced with a larger one, and the hole variant has a large amino acid has replaced with a smaller one. Additional modifications may also introduced to stabilise the association between the heavy chains.
- the antibody molecule comprises a first and second heavy chain that form a heterodimer, wherein one of the first and second heavy chains comprises a cysteine (C) residue at position 354 and a tryptophan (W) residue at position 366 and the other heavy chain comprises a cysteine (C) residue at position 349, a valine (V) residue at position 407, a serine (S) at position 366 and an alanine (A) at position 368, wherein the numbering of the constant region is as per the EU index.
- the antibody molecule comprises:
- a second heavy chain comprising a second modified CH3 region, wherein the second modified CH3 region comprises a cysteine (C) residue at position 349, a valine (V) residue at position 407, a serine (S) at position 366 and an alanine (A) at position 368, wherein the numbering of the constant region is as per the EU index.
- C cysteine
- V valine
- S serine
- A alanine
- DuetMab antibody molecules uses KIH technology for heterodimerization of 2 distinct heavy chains and increases the efficacy of cognate heavy and light chain pairing by replacing the native disulphide bond in one of the CHI -CL interfaces with an engineered disulphide bond. Disclosure related to DuetMab can found e.g., in U.S. Pat. No. 9,527,927 and Mazor, 2015, which are herein incorporated by reference in their entirety.
- the antibody molecule comprises:
- modified CL comprises a substitution of a native non-cysteine amino acid to a cysteine amino acid, wherein either:
- the first heavy chain comprises the modified CH region and the first light chain comprises the modified corresponding CL region;
- the second heavy chain comprises the modified CH region and the second light chain comprises the modified corresponding CL region.
- the substituted cysteine of the modified CH region, resulting from the substitution of the native non-cysteine amino acid to the cysteine amino acid, and the substituted cysteine of the modified corresponding CL region, resulting from the substitution of the native non-cysteine amino acid to the cysteine amino acid can form a disulphide bond.
- the modified CH region comprises a substitution of a native non-cysteine amino acid to a cysteine amino acid at position 126; and the modified corresponding CL region comprises a substitution of a native non-cysteine amino acid to a cysteine at position 121, wherein the numbering of the constant region is as per the EU index.
- the modified CH region comprises a substitution of a native non-cysteine amino acid to a cysteine amino acid at position 126 and a substitution of a native cysteine amino acid to a non-cysteine amino acid at position 219, for example to a valine; and the modified corresponding CL region comprises a substitution of a native non-cysteine amino acid to a cysteine at position 121 and a substitution of a native cysteine amino acid to a non-cysteine amino acid at position 214, for example to a valine, where the numbering of the constant region is as per the EU index.
- the antibody molecule comprises a second CH region and a second corresponding light chain, wherein the second CH region and second corresponding CL do not comprise a substitution of a native non-cysteine amino acid to a cysteine amino acid and do not comprise a substitution of a native cysteine to a non-cysteine amino acid.
- the antibody molecule may be conjugated to a drug.
- the antibody molecule may be referred to as a “conjugate” or an “antibody drug conjugate”.
- conjugates find application in the treatment and/or diagnosis of diseases as described herein.
- the drug may be referred to as a “payload” or “warhead”.
- the drug comprises a cytotoxin, a radioisotope, an immunomodulator, a cytokine, a lymphokine, a chemokine, a growth factor, a tumor necrosis factor, a hormone, a hormone antagonist, an enzyme, an oligonucleotide, a DNA, an RNA, an siRNA, an RNAi, a microRNA, a photoactive therapeutic agent, an anti-angiogenic agent, a pro-apoptotic agent, a peptide, a lipid, a carbohydrate, a chelating agent, or combinations thereof.
- a cytotoxin is a compound that is able to include death of the cell that is being targeted.
- a cytotoxin is delivered to a cell targeted by the antibody molecule, where it is released into the cell and induces cell death.
- the use of cytotoxins in antibody drug conjugates is described, for example, in Chalouni and Doll 2018 J Exp Clin Cancer Res. 37(l):20.
- cytotoxin is a tubulysin, an auristatin, a maytansinoid, a topoisomerase inhibitor or a pyrrolobenzodiazepine (PBD).
- the cytotoxin is or comprises a tubulysin.
- Tubulysins are a class of cytostatic tetrapeptides which contain isoleucine and three other complex unnatural amino acids Mep (R — N- Mepipecolic acid), Tuv (tubuvaline) and Tut (tubulyrosine) or Tup (tubuphenylalanine).
- Mep R — N- Mepipecolic acid
- Tuv tubuvaline
- Tut tubulyrosine
- Tup tubuphenylalanine
- Tubulysins are extremely potent cytotoxic molecules and are potent against multidrug resistant cell lines (Domling, 2005). These compounds show high cytotoxicity tested against a panel of cancer cell lines with IC50 values in the low picomolar range; thus, they are of interest as anticancer therapeutics. See, e.g., W02012019123.
- Tubulysin conjugates are disclosed, e.g., in U.S.
- tubulysin is tubulysin 1508, also referred to as “AZ1508” and described in more detail in WO 2015157594.
- Tubulysin 1508 has the following chemical structure:
- the cytotoxin is or comprises a topoisomerase inhibitor.
- topoisomerase inhibitor refers to a cytotoxic agent that inhibits the activity of one or more of the topoisomerase enzymes (topoisomerase I and II), which are enzymes that play an important role in DNA replication and transcription by regulating DNA supercoiling.
- Antibody drug conjugates comprising a topoisomerase inhibitor as a cytotoxin are therefore expected to interfere with normal processes involving DNA, therefore leading to cell death.
- topoisomerase I inhibitors include, but are not limited to, camptothecins and its analogues topotecan, irinotecan, belotecan, exatecan, lurotecan and sinotecan.
- topoisomerase I inhibitor A general example of a suitable topoisomerase I inhibitor is represented by the following compound:
- linkers to be used in conjugates is known in the art and is described for example in Beck, 2017.
- the linker used herein may be any of the linkers described in Beck, 2017.
- topoisomerase I inhibitor is represented by the following compound, with the formula “I”: and salts and solvates thereof, wherein R L is a linker for connection to an antibody molecule described herein , wherein said linker is optionally selected from:
- G L is a linker for connecting to an antibody or antigen binding fragment thereof described herein (e.g. the Ligand Unit or Cell Binding Agent); or
- agent(s) e.g. topoisomerase I inhibitor
- e.g. topoisomerase I inhibitor may be conjugated to the antibody molecule.
- L - (D L ) P (IV) or a pharmaceutically acceptable salt or solvate thereof wherein L is an antibody molecule described herein (e.g. the Ligand Unit or CBA), D L is drug having a linker (e.g. a Drug Linker Unit), and p is a integer of from 1 to 20.
- L is an antibody molecule described herein (e.g. the Ligand Unit or CBA)
- D L is drug having a linker (e.g. a Drug Linker Unit)
- p is a integer of from 1 to 20.
- D L is a topoisomerase I inhibitor having a linker that is of formula III:
- R LL is a linker connected to an antibody molecule described herein (e.g. the Ligand Unit), wherein the linker is optionally selected from
- the drug loading is represented by p, the number of topoisomerase I inhibitor(s) (e.g. Drug units) per antibody molecule (e.g. Ligand Unit). Drug loading may range from 1 to 20 Drug units (D) per Ligand unit.
- p represents the average drug loading of the conjugates in the composition, and p ranges from 1 to 20.
- the p range is selected from 2 to 8, optionally 4 to 8, such as 5 to 7, or 5.5 to 6.5.
- an ADC comprising topoisomerase I inhibitor SG3932 was produced with an average DAR of 6 +/- 6%.
- the disclosure embraces a conjugate comprising an antibody molecule described herein (e.g. the Ligand Unit or CBA) covalently linked to at least one topoisomerase I inhibitor (e.g. Drug unit, such as A* illustrated above).
- Said inhibitor is optionally linked to the antibody molecule by a linker (e.g. Linker unit), such as a linker described above as R L and/or R LL .
- linker e.g. Linker unit
- the disclosure embraces an antibody molecule described herein (e.g. the Ligand Unit or CBA) with one or more topoisomerase I inhibitors attached, optionally via a linker (e.g. Drug-Linker units).
- the antibody molecule (representing a Ligand unit or CBA), described more fully above, is a targeting agent that binds to a target moiety. More particularly, this antibody molecule can, for example, specifically binds to a EGFR and cMET on a target cell, to which the Drug unit is thus delivered. Accordingly, the present disclosure also provides methods for the treatment of, for example, various cancers and other disorders with an ADC (e.g. cancers/ disorders which are associated with the presence of cells, such as cancerous cells, which express EGFR and cMET). Such methods are described in more detail below
- Q is an amino acid residue.
- the amino acid may be a natural amino acid or a nonnatural amino acid.
- Q may be selected from: Phe, Lys, Vai, Ala, Cit, Leu, He, Arg, and Trp, where Cit is citrulline.
- Q comprises a dipeptide residue.
- the amino acids in the dipeptide may be any combination of natural amino acids and non-natural amino acids.
- the dipeptide comprises natural amino acids.
- the linker is a cathepsin labile linker
- the dipeptide is the site of action for cathepsin-mediated cleavage. The dipeptide then is a recognition site for cathepsin.
- Q is selected from:
- Q is selected from:
- dipeptide combinations may be used, including those described by Dubowchik et al., Bioconjugate Chemistry, 2002, 13,855-869, which is incorporated herein by reference.
- Q is a tripeptide residue.
- the amino acids in the tripeptide may be any combination of natural amino acids and non-natural amino acids.
- the tripeptide comprises natural amino acids.
- the linker is a cathepsin labile linker
- the tripeptide is the site of action for cathepsin-mediated cleavage. The tripeptide then is a recognition site for cathepsin.
- Tripeptide linkers of particular interest are:
- the tetrapeptide is:
- NH -Gly-Gly-Phe-Gly c o .
- NH - represents the N-terminus
- - c ° represents the C-terminus of the residue.
- the C-terminus binds to the NH of A*.
- Glu represents the residue of glutamic acid, i.e.: aGlu represents the residue of glutamic acid when bound via the a-chain, i.e.:
- the amino acid side chain is chemically protected, where appropriate.
- the side chain protecting group may be a group as discussed above.
- Protected amino acid sequences are cleavable by enzymes. For example, a dipeptide sequence comprising a Boc side chain-protected Lys residue is cleavable by cathepsin.
- G L is selected from G L1 1 and G L1-2 . In some of these instances, G L is G L1 1 .
- G LL may be selected from: where Ar represents a C5-6 arylene group, e.g. phenylene and X’ represents CM alkyl.
- CBA represents the Cell Binding Agent or Ligand Unit.
- G LL is selected from G LL1-1 and G LL1-2 . In some of these instances, G LL is G LL1 1 .
- a may be 0, 1, 2, 3, 4 or 5.
- a is 0 to 3.
- a is 0 or 1.
- bl may be 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16.
- bl is 0 to 12.
- bl is 0 to 8, and may be 0, 2, 3, 4, 5 or 8.
- b2 may be 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16. In some instances, b2 is 0 to 12. In some of these instances, b2 is 0 to 8, and may be 0, 2, 3, 4, 5 or 8. In some instances, only one of bl and b2 may not be 0. cl may be 0 or 1. c2 may be 0 or 1. In some instances, only one of cl and c2 may not be 0. d may be 0, 1, 2, 3, 4 or 5. In some instances, d is 0 to 3. In some of these instances, d is 1 or 2. In further instances, d is 2. In further instances, d is 5.
- a is 0, bl is 0, cl is 1, c2 is 0 and d is 2, and b2 may be from 0 to 8. In some of these instances, b2 is 0, 2, 3, 4, 5 or 8. In some instances of X, a is 1, b2 is 0, cl is 0, c2 is 0 and d is 0, and bl may be from 0 to 8. In some of these instances, bl is 0, 2, 3, 4, 5 or 8. In some instances of X, a is 0, bl is 0, cl is 0, c2 is 0 and d is 1, and b2 may be from 0 to 8. In some of these instances, b2 is 0, 2, 3, 4, 5 or 8. In some instances of X, a is 0, bl is 0, cl is 0, c2 is 0 and d is 1, and b2 may be from 0 to 8. In some of these instances, b2 is 0, 2, 3, 4, 5 or 8.
- bl is 0, b2 is 0, cl is 0, c2 is 0 and one of a and d is 0.
- the other of a and d is from 1 to 5. In some of these instances, the other of a and d is 1. In other of these instances, the other of a and d is 5.
- a is 1, b2 is 0, cl is 0, c2 is 1, d is 2, and bl may be from 0 to 8. In some of these instances, b2 is 0, 2, 3, 4, 5 or 8.
- R L is of formula lb. In some instances, R LL is is formula lb’.
- R L1 and R L2 may be independently selected from H and methyl, or together with the carbon atom to which they are bound form a cyclopropylene or cyclobutylene group. In some instances, both R L1 and R L2 are H. In some instances, R L1 is H and R L2 is methyl. In some instances, both R L1 and R L2 are methyl.
- R L1 and R L2 together with the carbon atom to which they are bound form a cyclopropylene group. In some instances, R L1 and R L2 together with the carbon atom to which they are bound form a cyclobutylene group.
- e is 0. In other instances, e is 1 and the nitro group may be in any available position of the ring. In some of these instances, it is in the ortho position. In others of these instances, it is in the para position.
- the enantiomerically enriched form has an enantiomeric ratio greater than 60:40, 70:30; 80:20 or 90:10. In further instances, the enantiomeric ratio is greater than 95:5, 97:3 or 99:1.
- R LL is a group derived from the R L groups above.
- the compound of formula I is of the formula I p : and salts and solvates thereof, wherein R LP is a linker for connection to an antibody or antigen binding fragment thereof described herein, wherein said linker is selected from:
- Q xp is such that Q p is an amino-acid residue, a dipeptide residue or a tripeptide residue
- G L is a linker for connecting to an antibody or antigen binding fragment thereof described herein (e.g. Ligand Unit);
- R L1 and R L2 are independently selected from H and methyl, or together with the carbon atom to which they are bound form a cyclopropylene or cyclobutylene group; and e is 0 or 1.
- aP may be 0, 1, 2, 3, 4 or 5. In some instances, aP is 0 to 3. In some of these instances, aP is 0 or 1. In further instances, aP is 0.
- bP may be 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16. In some instances, b is 0 to 12. In some of these instances, bP is 0 to 8, and may be 0, 2, 4 or 8.
- cP may be 0 or 1.
- dP may be 0, 1, 2, 3, 4 or 5. In some instances, dP is 0 to 3. In some of these instances, dP is 1 or 2.
- dP is 2.
- aP is 0, cP is 1 and dP is 2, and bP may be from 0 to 8. In some of these instances, bP is 0, 4 or 8.
- the conjugate of formula IV is of the formula IV P :
- R LLP is a linker connected to the antibody or antigen binding fragment thereof (e.g. Ligand unit), wherein said linker is selected from
- the compound of formula I is of the formula I P2 : and salts and solvates thereof, wherein R LP2 is a linker for connection to an antibody or antigen binding fragment thereof described herein, wherein said linker is selected from:
- Q x is such that Q is an amino-acid residue, a dipeptide residue, a tripeptide residue or a tetrapeptide residue;
- G L is a linker for connecting to an antibody or antigen binding fragment thereof described herein (e.g. Ligand Unit);
- R L1 and R L2 are independently selected from H and methyl, or together with the carbon atom to which they are bound form a cyclopropylene or cyclobutylene group; and e is 0 or 1.
- aP2 may be 0, 1, 2, 3, 4 or 5. In some instances, aP2 is 0 to 3. In some of these instances, aP2 is 0 or 1. In further instances, aP2 is 0.
- blP2 may be 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16. In some instances, blP2 is 0 to 12. In some of these instances, blP2 is 0 to 8, and may be 0, 2, 3, 4, 5 or 8.
- b2P2 may be 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16. In some instances, b2P2 is 0 to 12. In some of these instances, b2P2 is 0 to 8, and may be 0, 2, 3, 4, 5 or 8. In some instances, only one of blP2 and b2P2 may not be 0. cP2 may be 0 or 1. dP2 may be 0, 1, 2, 3, 4 or 5. In some instances, dP2 is 0 to 3. In some of these instances, dP2 is 1 or 2. In further instances, dP2 is 2. In further instances, dP2 is 5.
- aP2 is 0, blP2 is 0, cP2 is 1 and dP2 is 2, and b2P2 may be from 0 to 8. In some of these instances, b2P2 is 0, 2, 3, 4, 5 or 8. In some instances of X P2 , aP2 is 1, b2P2 is 0, cP2 is 0 and dP2 is 0, and blP2 may be from 0 to 8. In some of these instances, blP2 is 0, 2, 3, 4, 5 or 8. In some instances of X P2 , aP2 is 0, blP2 is 0, cP2 is 0 and dP2 is 1, and b2P2 may be from 0 to 8.
- b2P2 is 0, 2, 3, 4, 5 or 8.
- blP2 is 0, b2P2 is 0, cP2 is 0 and one of aP2 and dP2 is 0.
- the other of aP2 and d is from 1 to 5. In some of these instances, the other of aP2 and d is 1. In other of these instances, the other of aP2 and dP2 is 5.
- the conjugate of formula IV is of the formula IV P2 :
- R LLP2 is a linker connected to the antibody or antigen binding fragment thereof (e.g. Ligand unit), wherein said linker is selected from
- topoisomerase I inhibitors include those having the following formulas:
- an antibody molecule described herein is conjugated to a topoisomerase I inhibitor having the following formula (e.g. SG3932):
- Any antibody or antigen binding fragment thereof described herein may be conjugated to one or more of said topoisomerase I inhibitor(s).
- Such a reaction may be carried out under amide coupling conditions.
- Compounds of Formula 2 may be synthesised by the deprotection of a compound of Formula 4: where R L * prot is -Q-Prot N , where Prot N is an amine protecting group.
- Compounds of Formula 4 may be synthesised by the coupling of a compound of Formula 5 : with the compound A3 using the Friedlander reaction.
- Compounds of Formula 5 may be synthesised from compounds of Formula 6: by removal of the trifluoroacetamide protecting group.
- Amine protecting groups are well-known to those skilled in the art. Particular reference is made to the disclosure of suitable protecting groups in Greene’s Protecting Groups in Organic Synthesis, Fourth Edition, John Wiley & Sons, 2007 (ISBN 978-0-471-69754-1), pages 696-871.
- the drug loading (p) is the average number of drugs (e.g. tubulysin or topoisomerase inhibitor) per antibody molecule.
- drug loading ranges from 1 to 20 drugs (D) per antibody molecule.
- drug loading may range from 1 to 10 drugs (D) per antibody molecule, i.e. where 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 drugs are covalently attached to the antibody molecule.
- Compositions of conjugates include collections of antibody molecules, conjugated with a range of drugs, from 1 to 10. Where the compounds of the disclosure are bound to lysines, drug loading may range from 1 to 80 drugs (D) per antibody molecule, although an upper limit of 40, 20, 10 or 8 may be preferred.
- Compositions of conjugates include collections of antibody molecules, conjugated with a range of drugs, from 1 to 80, 1 to 40, 1 to 20, 1 to 10 or 1 to 8.
- the average number of drugs per antibody in preparations of conjugates from conjugation reactions may be characterized by conventional means such as UV, reverse phase HPLC, HIC, mass spectroscopy, ELISA assay, and electrophoresis.
- the quantitative distribution of conjugates in terms of p may also be determined.
- ELISA the averaged value of p in a particular preparation of conjuages may be determined (Hamblett, 2004; Sanderson, 2005).
- the distribution of p (drug) values is not discernible by the antibody-antigen binding and detection limitation of ELISA.
- ELISA assay for detection of conjugates does not determine where the drug moieties are attached to the antibody molecule, such as the heavy chain or light chain fragments, or the particular amino acid residues.
- separation, purification, and characterization of homogeneous conjuatges where p is a certain value from conjugates with other drug loadings may be achieved by means such as reverse phase HPLC or electrophoresis. Such techniques are also applicable to other types of conjugates.
- p may be limited by the number of attachment sites on the antibody molecule.
- an antibody molecule may have only one or several cysteine thiol groups, or may have only one or several sufficiently reactive thiol groups through which a linker may be attached.
- an antibody molecule may contain, for example, many lysine residues that do not react with the linker (L). Only the most reactive lysine groups may react with an amine -reactive linker reagent. Also, only the most reactive cysteine thiol groups may react with a thiol -reactive linker reagent. Generally, antibody molecules do not contain many, if any, free and reactive cysteine thiol groups which may be linked to a drug moiety.
- cysteine thiol residues in the antibody molecules of the conjugates exist as disulfide bridges and must be reduced with a reducing agent such as dithiothreitol (DTT) or TCEP, under partial or total reducing conditions.
- DTT dithiothreitol
- TCEP TCEP
- the loading (drug/antibody ratio) of a conjugate may be controlled in several different manners, including: (i) limiting the molar excess of Drug Linker relative to antibody, (ii) limiting the conjugation reaction time or temperature, and (iii) partial or limiting reductive conditions for cysteine thiol modification.
- Certain antibody molecules have reducible interchain disulfides, i.e. cysteine bridges.
- Antibody molecules may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (dithiothreitol).
- DTT dithiothreitol
- Each cysteine bridge will thus form, theoretically, two reactive thiol nucleophiles.
- This process is also referred to as “classical conjugation” and is distinguished from methods such as where conjugation takes place at a cysteine that has been engineered into a specific site in the antibody molecule.
- Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2-iminothiolane (Traut’s reagent) resulting in conversion of an amine into a thiol.
- ADCs with drugs randomly conjugated to native cysteine residues are prepared by classical conjugation by partial reduction of the antibody followed by reaction with desired linker -drug.
- the antibody at a concentration of 5 mg/mL may be partially reduced by addition of about 3 molar equivalents of DTT at pH 8.0, followed by incubation at about 37 °C for about 2 hours.
- the reduction reaction may then be chilled in ice and the excess DTT removed, for example, via diafiltration.
- the linker-drug can then be added at a linker-drug/thiol molar ratio of about 1:10.
- the conjugation reaction may be carried out in the presence of -10% v/v of DMSO.
- excess free cysteine (about 2 fold molar ratio over linker-drug) can be added to quench unreacted linker-drug to produce the cysteine -linker-drug adduct.
- the reaction mixture can then purified (e.g., by hydrophobic interaction chromatography), and subjected to buffer -exchange into PBS.
- Drug load distribution can be determined using standard methods, such as hydrophobic interaction chromatography and reduced reverse phase chromatography, as described elsewhere.
- site-specific conjugation a method in which drug load and site of conjugation is controlled. This can be achieved by, for example, engineering cysteines at specific residues, replacement of residues with unnatural amino acids with bio -orthogonal reactivity or enzyme ligation approaches.
- site-specific conjugation is described in Dimasi, 2017, which is herein incorporated by reference in its entirety and involves inserting cysteines into antibody molecules at particular positions.
- Cysteine amino acids may be engineered at reactive sites in an antibody molecule and which do not form intrachain or intermolecular disulfide linkages (Junutula, 2008; Dornan, 2009; US 7521541; US 7723485; W02009/052249).
- the engineered cysteine thiols may react with linkers or the drug-linker described herein which have thiol-reactive, electrophilic groups such as maleimide or alpha-halo amides to form conjugates with cysteine engineered antibody molecules and the drug.
- the location of the drug can thus be designed, controlled, and known.
- the drug loading can be controlled since the engineered cysteine thiol groups typically react with thiol-reactive linker reagents or drug-linker reagents in high yield.
- Engineering an IgG antibody to introduce a cysteine amino acid by substitution at a single site on the heavy or light chain gives two new cysteines on the symmetrical antibody. If required, a drug loading near 2 can be achieved with near homogeneity of the conjugation product.
- the antibody molecule of the conjugate of the disclosure comprises a CH region and the drug is chemically conjugated at a cysteine amino acid inserted between positions 239 and 240 of the CH region, wherein the numbering of the constant region is as per the EU index.
- the connection between the antibody molecule and the drug may therefore be through this inserted cysteine amino acid and a terminal maleimide group on the linker.
- CH regions that comprise a cysteine amino acid inserted between positions 239 and 240 of the CH region are SEQ ID NO: 43 and SEQ ID NO: 45.
- Examples of heavy chains comprising a CH region that comprises a cysteine amino acid inserted between positions 239 and 240 of the CH region are SEQ ID NOs: 50, 53 and 56.
- the antibody molecule of the conjugate does not comprise any amino acid residues inserted into the CH region.
- the antibody molecule of the conjugate does not comprise a cysteine amino acid inserted into the CH region (e.g. between positions 239 and 240, wherein the numbering of the constant region is as per the EU index).
- the inserted cysteine is not necessary.
- CH regions that do not comprise any amino acid residues inserted into the CH region are SEQ ID NO: 44, 46, 63 and 64.
- Examples of heavy chains comprising a CH region that do not comprise any amino acid residues inserted into the CH region are SEQ ID NOs: 51, 54, 57, 59 and 60.
- nucleophilic or electrophilic group of the antibody molecule reacts with a druglinker intermediate, or linker reagent followed by drug reagent
- the resulting product is a mixture of conjugate compounds with a distribution of drug attached to an antibody, e.g. 1, 2, 3, etc.
- Liquid chromatography methods such as polymeric reverse phase (PLRP) and hydrophobic interaction (HIC) may separate compounds in the mixture by drug loading value.
- Preparations of conjugate with a single drug loading value (p) may be isolated, however, these single loading value conjugates may still be heterogeneous mixtures because the drug may be attached, via the linker, at different sites on the antibody molecule.
- conjugate compositions of the disclosure include mixtures of antibody-drug conjugate compounds where the antibody has one or more drug moieties (e.g. tubulysin or topoisomerase inhibitor) and where the drug moieties may be attached to the antibody molecule at various amino acid residues.
- drug moieties e.g. tubulysin or topoisomerase inhibitor
- the average number of tubulysin drug moieties per antibody molecule is in the range 1 to 8. In some instances the range is selected from 1 to 6, 1 to 4, 1 to 3, optionally 1 to 2, 1.5 to 2, 1.8 to 2, such as 1.9 to 2.
- the antibody molecule of the ADC may comprise one or more mutations in the CH region(s) of the heavy chain(s) to reduce or abrogate binding of the antibody molecule to one or more Fey receptors.
- the first and/or second heavy chain of the ADCs described herein may comprise phenylalanine (F) at position 234, glutamic acid (E) at position 235, and serine (S) at position 331, wherein the numbering is as per the EU index.
- the antibody molecules and conjugates described herein may be characterised by reference to certain functional properties.
- the antibody molecules and conjugates described herein may be characterised by the antigen-binding domain that binds EGFR having a particular affinity for EGFR and/or the antigen-binding domain that binds c-Met having a particular affinity for c-Met.
- the binding affinity of an antibody molecule to a cognate antigen, such as human, mouse or cynomolgus EGFR or c-Met can be determined by surface plasmon resonance (SPR), using Biacore, for example.
- SPR surface plasmon resonance
- the binding affinity can be determined using an antibody molecule, for example as part of a bispecific antibody molecule that comprises a first antigen-binding domain that binds EGFR and a second antigen-binding domain that binds c-Met.
- the binding affinity can be determined using an antibody molecule that is monospecific for EGFR or c-Met.
- the binding affinity is determined using BIACore as described in Example 2.1.
- Binding affinity is typically measured by Kd (the equilibrium dissociation constant between the antigen-binding domain and its antigen). As is well understood, the lower the Kd value, the higher the binding affinity of the antigen-binding domain. For example, an antigen-binding domain that binds to a target with a Kd of 10 nM would be considered to be binding said target with a higher affinity than an antigen-binding domain that binds to the same target with a Kd of 100 nM.
- Reference to human EGFR may refer to a polypeptide comprising the extracellular domain of EGFR, such as one having the amino acid sequence set forth in SEQ ID NO: 68.
- Reference to mouse EGFR may refer to a polypeptide produced from the molecule available from SinoBiological with catalogue # 51091-M08H.
- Reference to cynomolgus EGFR may refer to the amino acid sequence set forth in SEQ ID NOs: 69.
- Reference to human c-Met may refer to a polypeptide having the amino acid sequence set forth in SEQ ID NO: 70.
- mouse c-Met may refer to a polypeptide having the amino acid sequence set forth in SEQ ID NO: 90 or to the polypeptide produced from the molecule available from SinoB iologic al with catalogue # 50622-M08H.
- Reference to cynomolgus c-Met may refer to the amino acid sequence set forth in SEQ ID NO: 71.
- Antibody molecules and conjugates described herein may comprise a binding domain that binds to EGFR with a low affinity.
- EGFR is known to be expressed at low levels in normal tissues, e.g. the skin e.g. the skin.
- Antibody molecules and conjugates that bind to EGFR with a low-affinity are advantageously expected to display reduced on-target toxicity in normal tissues whilst still being able to target tumors expressing high levels of EGFR, resulting in an improved safety profile.
- conjugates comprising this low affinity EGFR binding domain are more efficacious at treating cancer compared to conjugates comprising a higher affinity EGFR binding domain.
- the binding domain that binds to EGFR may bind to human EGFR with an affinity having a Kd equal to or higher than 10 nM, 15 nM, 20 nM, 25 nM, 30 nM, 35 nM, or 40 nM.
- binding domain that binds to EGFR may bind to human EGFR with a Kd of between 10 and 100 nM, between 20 and 100 nM, between 30 and 100 nM, between 40 and 100 nM, between 10 and 80 nM, between 20 and 80 nM, between 30 and 80 nM, between 40 and 80 nM, between, between 10 and 70 nM, between 20 and 70 nM, between 30 and 70 nM, between 40 and 70 nM, between 10 and 60 nM, between 20 and 60 nM, between 30 and 60 nM, between 40 and 60 nM, between 10 and 50 nM, between 20 and 50 nM, between 30 and 50 nM, or between 40 and 50 nM.
- the binding domain that binds to EGFR may bind to human EGFR with an affinity that is lower than the affinity that a binding domain comprising the heavy chain sequence and light chain sequence of antibody molecule QD6 set forth in SEQ ID NOs: 53 and 55, respectively.
- the binding domain that binds to EGFR may bind to human EGFR with an affinity having a Kd that is at least 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, or 7-fold higher than the Kd that a binding domain comprising the heavy chain sequence and light chain sequence of antibody molecule QD6 set forth in SEQ ID NOs: 53 and 55, respectively, binds human EGFR.
- the binding domain that binds to EGFR may bind to human EGFR with an affinity having a Kd that is between 2- and 10- fold higher, between 3- and 10-fold higher, between 4- and 10-fold higher, between 5- and 10-fold higher, between 6- and 10-fold higher, between 7- and 10-fold higher, between 2- and 9-fold higher, between 3- and 9-fold higher, between 4- and 9-fold higher, between 5- and 9-fold higher, between 6- and 9-fold higher, between 7- and 9-fold higher, between 2- and 8-fold higher, between 3- and 8-fold higher, between 4- and 8-fold higher, between 5- and 8-fold higher, between 6- and 8-fold higher, between 7- and 8-fold higher than the Kd that a binding domain comprising the heavy chain sequence and light chain sequence of antibody QD6 set forth in SEQ ID NOs: 53 and 55, respectively, binds human EGFR.
- the binding domain that binds to EGFR may bind to human EGFR with an affinity that is similar to the affinity that a binding domain comprising the variable heavy region sequence and variable light region sequence of antibody molecule RAA22 set forth in SEQ ID NOs: 16 and 20, respectively binds human EGFR.
- the binding domain that binds to EGFR may bind to human EGFR with an affinity having a Kd that is less than 5 -fold different, less than 4-fold different, less than 3 -fold different, less than 2-fold different, less than 1-fold different or less than 0.5-fold different than an binding domain comprising the variable heavy region sequence and variable light region sequence of antibody molecule RAA22 set forth in SEQ ID NOs: 16 and 20, respectively, binds human EGFR.
- the binding domain that binds to EGFR may also bind to cynomolgus EGFR.
- the binding domain that binds to EGFR may bind to cynomolgus EGFR with an affinity having a Kd that is less than 700 nM, less than 600 nM, less than 500 nM, less than 400 nM, less than 300 nM, or less than 250 nM.
- the antigen-binding domain that binds to EGFR may bind to cynomolgus EGFR with an affinity having a Kd of between 100 and 700 nM, between 100 and 600 nM, between 100 and 500 nM, between 100 and 400 nM, between 100 and 300 nM, between 150 and 250 nM, between 100 and 200 nM.
- the antigen-binding domain that binds to EGFR may bind to cynomolgus EGFR with a Kd that is less than or equal 10-, 9-, 8-, 7-, 6-, 5-, 4-, 3-fold higher Kd than the binding domain binds to human EGFR.
- the binding domain that binds to EGFR may also bind to mouse EGFR.
- the binding domain that binds to EGFR may bind to mouse EGFR with an affinity having a Kd that is less than 1 pM, less than 900 nM, less than 800 nM, less than 700 nM, less than 600 nM or less than 650 nM.
- the binding domain that binds to EGFR may bind to mouse EGFR with a Kd of between 100 nM and 1 pM, between 200 and 900 nM, between 300 and 800 nM, between 400 and 700 nM, between 400 and 600 nM, or between 450 and 550 nM.
- the binding domain that binds to EGFR is capable of binding human EGFR and cynomolgus EGFR. This cross-reactivity is advantageous, as it allows dosing and safety testing of the antibody molecules and conjugates to be performed in cynomolgus monkeys during preclinical development.
- the binding domain that binds to EGFR is capable of binding human EGFR, cynomolgus EGFR and mouse EGFR.
- the binding domain that binds EGFR may be capable of binding human EGFR, cynomolgus EGFR and mouse EGFR with the Kd values set out above (e.g.
- the binding domain that binds to cMET may bind to human cMET with an affinity having a Kd of lower than 20 nM, 15 nM, 12 nM, 11 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM or 2.5 nM.
- antigen-binding domain that binds to cMET may bind to human c-Met with an affinity having a Kd of between 1 and 20 nM, between 1 and 15 nM, between 1 and 10 nM, between 1 and 9 nM, between 1 and 8 nM, between 1 and 7 nM, between 1 and 6 nM, between 1 and 5 nM, between 1 and 4 nM, between 1 and 3 nM, between 1 and 2.5 nM, or between 2 and 2.5 nM.
- the binding domain that binds to cMET may bind to cynomolgus cMET.
- the binding domain that binds to cMET may bind to cynomolgus cMET with an affinity having a Kd that is lower than 30 nM, 25 nM, 20 nM, 15 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, or 2.5 nM.
- the binding domain that binds to cMET may bind to cynomolgus cMET with an affinity having a Kd of between 1 and 20 nM, between 1 and 15 nM, between 1 and 10 nM, between 1 and 9 nM, between 1 and 8 nM, between 1 and 7 nM, between 1 and 6 nM, between 1 and 5 nM, between 1 and 4 nM, between 1 and 3 nM, between 1 and 2.5 nM, or between 2 and 2.5 nM.
- the binding domain that binds to cMET may bind to cynomolgus cMET with an affinity having a Kd that is less than or equal 10-, 9-, 8-, 7-, 6-, 5-, 4-, 3-, 2-, 1-fold higher Kd than the antigen-binding domain binds to human c-Met.
- the binding domain that binds to cMET is capable of binding human cMET and cynomolgus cMET.
- This cross-reactivity is advantageous, as it allows dosing and safety testing of the antibody molecules to be performed in cynomolgus monkeys during preclinical development.
- the binding domain that binds cMET may be capable of binding human cMET and cynomolgus cMET with the Kd values set out above (e.g. human cMET with a Kd of between 1 and 20 nM and cynomolgus cMET with a Kd of between 1 and 20 nM).
- the binding domains described herein may specifically bind their respective targets (i.e. EGFR and cMET).
- the term “specific” may refer to the situation in which the antigen-binding domain will not show any significant binding to molecules other than its specific binding partner(s), here EGFR or cMET. Such molecules are referred to as “non-target molecules”.
- the term “specific” is also applicable where the antibody molecule is specific for particular epitopes, such as epitopes on EGFR or cMET, that are carried by a number of antigens in which case the antibody molecule will be able to bind to the various antigens carrying the epitope.
- an antibody molecule is considered to not show any significant binding to a nontarget molecule if the extent of binding to a non-target molecule is less than about 10% of the binding of the antibody to the target as measured, e.g., by ELISA, SPR, Bio-Layer Interferometry (BLI), MicroScale Thermophoresis (MST), or by a radioimmunoassay (RIA).
- the binding specificity may be reflected in terms of binding affinity, where the antibody molecule described herein binds to EGFR and/or c-Met with an affinity that is at least 0.1 order of magnitude greater than the affinity towards another, non-target molecule.
- the antibody molecule of the present disclosure binds to EGFR and/or cMET with an affinity that is one of at least 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.5, or 2.0 orders of magnitude greater than the affinity towards another, non-target molecule.
- EGFR is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR, HER2, HER3 and HER4.
- the RAA22 antigen-binding domain showed no binding to HER2, HER3 and HER4, demonstrating that this antigen-binding domain binds EGFR specifically.
- the antigen-binding domain that binds EGFR does not bind, or does not show any significant binding, to HER2, HER3 or HER4.
- cMET is a member of the subfamily of receptor tyrosine kinases that includes Ron and Serna 4a.
- the B09-GL antigen-binding domain showed no binding to Ron and Serna 4a, demonstrating that this antigen-binding domain binds cMET specifically.
- the binding domain that binds cMET does not bind, or does not show any significant binding, to Ron, Serna 4a.
- the antibody molecules and conjugates described herein may be characterised by the ability of both the binding domains to concurrently engage their respective EGFR and cMET targets.
- Antibody molecules and conjugates with the ability to concurrently engage EGFR and cMET are expected to be advantageous, as numerous tumours are known to co-express both EGFR and c-Met and therefore can be targeted by antibody molecules of the disclosure.
- the antibody molecule is able to concurrently engage EGFR and cMET.
- Concurrent engagement can be determined for example by an in vitro cytotoxicity assay using a cell line expresses roughly equal amounts of EGFR and cMET and a conjugate comprising the antibody molecules with EGFR and cMET antigen-binding domains. If the individual antigen-binding domains in the conjugate function independently to deliver the drug, blocking either target in this cell line would be expected to only modestly reduce the activity of the conjugate, shifting the IC50 by 2-fold or less, since the targets are present at similar levels.
- the EGFR and cMET targets can be blocked in this assay by using, for example, a monospecific antibody molecule that binds the same region on either EGFR or cMET, but lacks a drug that is able to induce cytotoxicity.
- the monospecific antibody molecule may contain the same antigen-binding domain that binds EGFR, or the same antigen-binding domain that binds c-Met, as the conjugate being tested. If, on the other hand, the conjugate requires concurrent engagement to effectively deliver the conjugate into cells, blocking either target would be likely to have a greater impact on the activity of the conjugate. That is, the antibody molecule is considered to be able to engage both targets concurrently if there is a shift in IC50 by at least 2-fold, at least 5 -fold, or at least 10-fold after blocking either target when using this assay.
- An additional method to determine concurrent engagement is to compare the activity of the bispecific EGFR- cMET conjugate to monovalent, monospecific control conjugates in an in vitro cytotoxicity assay.
- the control conjugates comprise one antigen-binding domain to either EGFR or c-Met and one non-binding isotype antibody control antigen-binding domain. If each antigen-binding domain in the bispecific conjugate functions independently, the expected result would be that each monospecific control conjugate would only be modestly less potent than the bispecific conjugate, and the difference would be additive. Alternatively, if the two antigen-binding domains of the bispecific conjugate function synergistically by concurrent binding, one would expect larger differences in activity of the bispecific conjugate compared to the monospecific control antibodies. That is, the antibody molecule is considered to be able to engage both targets concurrently if the bispecific conjugate results in a shift in IC50 that is greater than the sum of the shifts in IC50 observed using the monospecific control conjugates.
- the antibody molecules and conjugates described herein may be characterised by their ability to mediate efficient internalisation. This is particularly useful for conjugates, as it ensures the conjugate is internalised into the cell and delivered to lysosomes, where the antibody molecule is subsequently degraded and drug released into the cell, where it exerts its cellular effects, e.g. cytotoxicity.
- Internalisation of an antibody molecule by cells can be analysed by contacting live cells with the antibody molecule, and detecting the antibody molecule after sufficient period of time for internalisation. Internalisation can be determined by detection of the localisation of the antibody molecule. Where the antibody molecule remains on the surface of the cell (e.g. is detected on the cell surface, and/or is not detected inside the cell), the antibody molecule is determined not to have been internalised. Where the antibody molecule is detected inside the cell (e.g. localised to the cytoplasm or a cellular organelle), the antibody molecule is determined to have been internalised.
- An exemplary method for visualising whether the antibody molecule is able to mediate efficient internalisation involves labelling the antibody molecule with pH sensitive dyes that exhibit fluorescent at an acidic pH and adding these labelled antibody molecules to cells. Internalisation into the cell can be detected by monitoring fluorescence. The antibody molecule is considered able to mediate internalisation and delivery to lysosomes if the fluorescence observed is greater than that of a labelled non-binding control antibody molecule over a certain time period, for example 48 hours. Further details of this method to visualise antibody internalisation can be found in the examples.
- the antibody molecules described herein may be characterised by their ability to mediate more efficient internalisation when compared to the EGFR or cMET monospecific controls. Antibody molecules and conjugates that exhibit this properties are expected to be advantageous, as they are expected to display greater selectivity to tumour cells co -expressing both targets and could minimise the impact of the antibody molecule in normal tissues that do not display significant levels of co- expression.
- the antibody molecules described herein may be characterised by their cytotoxic activity, i.e. their ability to kill cells. Cytotoxic activity can be measured using an in vitro cell viability assay, such as the CellTiter-Glo ® (Promega) assay, for example. In some instances, the cells are cells that expression both EGFR and cMET.
- IC50 is the median inhibitory concentration of an antibody molecule. In functional assays, IC50 is the concentration that reduces a biological response by 50% of its maximum. IC50 can be calculated by any number of means known in the art.
- the antibody molecules described herein having cytotoxic activity have an IC50 of less than less than 4000 pM, less than 3500 pM, less than 3000 pM, less than 2500 pM, less than 2000 pM, less than 1500 pM, less than 1000 pM, less than 500 pM, less than 400 pM, less than 300 pM, less than 250 pM, less than 200 pM, less than 150 pM, or less than 100 pM when measured using an in vitro cell viability assay.
- the antibody molecules described herein may have an IC50 of between 60 and 500 pM.
- the antibody molecules described herein are capable of increased killing of cells, e.g. tumor cells, that express significant amounts of both EGFR and cMET compared to cells that express low levels of one or the other of EGFR and cMET.
- Cells expressing significant amounts of both EGFR and cMET may be determined by measuring relative receptor density at the cell surface. For example, cells expressing EGFR and cMET at a relative receptor density at the cell surface of greater than 15,000 may be considered cells that express significant amounts of both EGFR and cMET and cells that express one of EGFR and c-Met at a low relative receptor density at the cell surface of 15,000 or less.
- Relative EGFR and cMET density can be measured, for example, using the Quantum MESF quantitative FACS assay kit as described in the examples.
- Examples of cells that express significant amounts of both EGFR and cMET may include NCI H596, HCC 827 GR Pool, A549, NCI H1792, NCI H1975, NCI H292 and NCI H358 cell lines. Examples of cells that express one of EGFR and cMET at a low relative receptor density may include A427, NCI H23 and NCI H661 (Ag negative) cell lines. These cell lines are available through ATCC.
- EGFR TKIs can be characterised as either first-, second- or third-generation EGFR TKIs, as set out below.
- First-generation EGFR TKIs are reversible inhibitors of EGFR bearing activating mutations that do not significantly inhibit EGFR bearing the T790M mutation.
- Examples of first-generation TKIs include gefitinib and erlotinib.
- Second-generation EGFR TKIs are irreversible inhibitors of EGFR bearing activating mutations that do not significantly inhibit EGFR bearing the T790M mutation.
- Examples of second-generation TKIs include afatinib and dacomitinib.
- Third-generation EGFR TKIs are inhibitors of EGFR bearing activating mutations that also significantly inhibit EGFR bearing the T790M mutation and do not significantly inhibit wild-type EGFR.
- Examples of third-generation TKIs include compounds of Formula (V), osimertinib, AZD3759 (zorifertinib), lazertinib, fasciartinib (EGF816), CO1686 (rociletinib), HM61713, ASP8273 (naquotinib), PF-06747775 (mavelertinib), avitinib (abivertinib), alflutinib (AST2818) and CX-101 (olafertinib; RX-518), almonertinib (HS-10296; aumolertinib) and BPI-7711 (rezivertinib).
- the EGFR TKI is a first-generation EGFR TKI.
- the first-generation EGFR TKI is selected from the group consisting of gefitinib or a pharmaceutically acceptable salt thereof, icotinib or a pharmaceutically acceptable salt thereof, and erlotinib or a pharmaceutically acceptable salt thereof.
- the EGFR TKI is a second-generation EGFR TKI.
- the second- generation EGFR TKI is selected from dacomitinib, or a pharmaceutically acceptable salt thereof, and afatinib or a pharmaceutically acceptable salt thereof.
- the EGFR TKI is a third-generation EGFR TKI.
- the third-generation EGFR TKI is a compound of Formula (V), as defined below.
- the third-generation EGFR TKI is selected from the group consisting of osimertinib or a pharmaceutically acceptable salt thereof, AZD3759 or a pharmaceutically acceptable salt thereof, lazertinib or a pharmaceutically acceptable salt thereof, abivertinib or a pharmaceutically acceptable salt thereof, alflutinib or a pharmaceutically acceptable salt thereof, CX-101 or a pharmaceutically acceptable salt thereof, HS- 10296 or a pharmaceutically acceptable salt thereof and BPI-7711 or a pharmaceutically acceptable salt thereof.
- the third generation EGFR TKI is osimertinib or a pharmaceutically acceptable salt thereof.
- G is selected from 4,5,6,7-tetrahydropyrazolo[l,5-a]pyridin-3-yl, indol-3-yl, indazol-l-yl, 3,4- dihydro-lH-[l,4]oxazino[4,3-a]indol-10-yl, 6,7,8,9-tetrahydropyrido[l,2-a]indol-10-yl, 5,6-dihydro- 4H-pyrrolo[3,2,l-ij]quinolin-l-yl, pyrrolo[3,2-b]pyridin-3-yl and pyrazolo[l,5-a]pyridin-3-yl;
- R 3 is selected from (3R)-3-(dimethylamino)pyrrolidin-l-yl, (35)-3-(dimethyl-amino)pyrrolidin-l-yl, 3-(dimethylamino)azetidin-l-yl, [2-(dimethylamino)ethyl]-(methyl)amino, [2-
- R 5 is independently selected from methyl, ethyl, propyl, 2,2-difluoroethyl, 2,2,2-trifluoroethyl, fluoro, chloro and cyclopropyl;
- X is CH or N; and n is 0, 1 or 2; or a pharmaceutically acceptable salt thereof.
- G is selected from indol-3-yl and indazol-l-yl;
- R 1 is selected from hydrogen, fluoro, chloro, methyl and cyano;
- R 2 is selected from methoxy and 2,2,2-trifluoroethoxy;
- R 3 is selected from[2- (dimethylamino)ethyl]-(methyl)amino, [2-(methylamino)ethyl](methyl)amino, 2-
- R 4 is hydrogen
- R 5 is selected from methyl, 2,2,2-trifluoroethyl and cyclopropyl
- X is CH or N
- n is 0 or 1; or a pharmaceutically acceptable salt thereof.
- Examples of compounds of Formula (V) include those described in WO 2013/014448, WO 2015/175632, WO 2016/054987, WO 2016/015453, WO 2016/094821, WO 2016/070816 and WO 2016/173438.
- Osimertinib has the following chemical structure:
- osimertinib The free base of osimertinib is known by the chemical name: /V-(2- ⁇ 2-dimethylamino ethyl - methylamino ⁇ -4-methoxy-5- ⁇ [4-(l-methylindol-3-yl)pyrimidin-2-yl]amino ⁇ phenyl) prop-2-enamide.
- Osimertinib is described in WO 2013/014448.
- Osimertinib is also known as AZD9291.
- Osimertinib may be found in the form of the mesylate salt: A / -(2- ⁇ 2-dimelhylamino ethylmethylamino ⁇ -4-methoxy-5- ⁇ [4-(l-methylindol-3-yl)pyrimidin-2-yl]amino ⁇ phenyl) prop-2-enamide mesylate salt.
- Osimertinib mesylate is also known as TAGRISSOTM.
- Osimertinib mesylate is currently approved as an oral once daily tablet formulation, at a dose of 80 mg (expressed as free base, equivalent to 95.4 mg osimertinib mesylate), for the treatment of metastatic EGFR T790M mutation positive NSCLC patients.
- a 40 mg oral once daily tablet formulation (expressed as free base, equivalent to 47.7 mg osimertinib mesylate) is available should dose modification be required.
- the tablet core comprises pharmaceutical diluents (such as mannitol and microcrystalline cellulose), disintegrants (such as low-substituted hydroxypropyl cellulose) and lubricants (such as sodium stearyl fumarate).
- the tablet formulation is described in WO 2015/101791.
- osimertinib is in the form of the mesylate salt, i.e. A-(2- ⁇ 2-dimethylamino ethyl-methylamino ⁇ -4-methoxy-5- ⁇ [4-(l-methylindol-3- yl)pyrimidin-2-yl] amino ⁇ phenyl) prop-2-enamide mesylate salt.
- osimertinib or a pharmaceutically acceptable salt thereof, is administered once -daily.
- osimertinib mesylate is administered once-daily.
- the total daily dose of osimertinib is about 80 mg. In a further aspect, the total daily dose of osimertinib mesylate is about 95.4 mg.
- the total daily dose of osimertinib is about 40 mg. In a further aspect, the total daily dose of osimertinib mesylate is about 47.7 mg.
- osimertinib or a pharmaceutically acceptable salt thereof, is in tablet form.
- osimertinib is administered in the form of a pharmaceutical composition
- a pharmaceutical composition comprising one or more pharmaceutically acceptable excipients (for example a diluent or carrier).
- the composition comprises one or more pharmaceutical diluents (such as mannitol and microcrystalline cellulose), one or more pharmaceutical disintegrants (such as low-substituted hydroxypropyl cellulose) or one or more pharmaceutical lubricants (such as sodium stearyl fumarate).
- AZD3759 has the following chemical structure:
- AZD3759 The free base of AZD3759 is known by the chemical name: 4-[(3-chloro-2-fluorophenyl)amino]-7- methoxy-6-quinazolinyl (2/?)-2,4-dimelhyl-l -piperazinecarboxylate.
- AZD3759 is described in WO 2014/135876.
- AZD3759 is administered twice-daily. In a further aspect, AZD3759 is administered twice-daily.
- the total daily dose of AZD3759 is about 400 mg. In a further aspect, about 200 mg of AZD3759 is administered twice a day.
- Lazertinib has the following chemical structure:
- the total daily dose of lazertinib is about 240 mg.
- Avitinib has the following chemical structure:
- avitinib The free base of avitinib is known by the chemical name: N-(3-((2-((3-fluoro-4-(4-methylpiperazin-l- yl)phenyl)amino)-7H-pyrrolo(2,3-d)pyrimidin-4-yl)oxy)phenyl)prop-2-enamide.
- Avitinib is disclosed in US2014038940.
- Avitinib is also known as abivertinib.
- avitinib or a pharmaceutically acceptable salt thereof is administered twice daily.
- avitinib maleate is administered twice daily.
- the total daily dose of avitinib maleate is about 600 mg.
- Alflutinib has the following chemical structure:
- alflutinib The free base of alflutinib is known by the chemical name: N- ⁇ 2- ⁇ [2- (dimethylamino)ethyl] (methyl)amino ⁇ -6-(2,2,2-trifluoroethoxyl)-5- ⁇ [4-( 1 -methyl- 1 H -indol-3- yl)pyrimidin-2-yl]amino ⁇ pyridin-3-yl ⁇ acrylamide.
- Alflutinib is disclosed in WO 2016/15453. Alflutinib is also known as AST2818.
- alflutinib or a pharmaceutically acceptable salt thereof is administered once daily.
- alflutinib mesylate is administered once daily.
- the total daily dose of alflutinib mesylate is about 80 mg.
- the total daily dose of alflutinib mesylate is about 40 mg.
- Afatinib has the following chemical structure:
- afatinib The free base of afatinib is known by the chemical name: A-[4-(3-chloro-4-fluoroanilino)-7-[(3 )- oxolan-3-yl] oxyquinazolin-6-yl]-4-(dimethylamino)but-2-enamide.
- Afatinib is disclosed in WO 02/50043.
- Afatinib is also known as Gilotrif.
- afatinib or a pharmaceutically acceptable salt thereof is administered once daily.
- afatinib dimaleate is administered once daily.
- the total daily dose of afatinib dimaleate is about 40 mg.
- the total daily dose of afatinib dimaleate is about 30 mg.
- CX-101 (olafertinib: RX-518)
- CX-101 has the following chemical structure:
- CX-101 The free base of CX-101 is known by the chemical name: N-(3-(2-((2,3-difluoro-4-(4-(2- hydroxyethyl)piperazin-l-yl)phenyl)amino)quinazolin-8-yl)phenyl)acrylamide.
- CX-101 is disclosed in WO 2015/027222.
- CX-101 is also known as RX-518.
- HS-10296 (almonertinib; aumolertinib) has the following chemical structure:
- the free base of HS-10296 is known by the chemical name: N-[5-[[4-(l-cyclopropylindol-3- yl)pyrimidin-2-yl] amino] -2- [2-(dimethylamino)ethyl-methyl-amino] -4-methoxy-phenyl]prop-2- enamide.
- HS-10296 is disclosed in WO 2016/054987.
- the total daily dose of HS-10296 is about 110 mg.
- BPI- 7711 ( rezivertinib ) BPI-7711 has the following chemical structure:
- BPI-7711 The free base of BPI-7711 is known by the chemical name: N-[2-[2-(dimethylamino)ethoxy]-4- methoxy-5-[[4-(l-methylindol-3-yl)pyrimidin-2-yl]amino]phenyl]prop-2-enamide.
- BPI-7711 is disclosed in WO 2016/94821.
- the total daily dose of B PI-7711 is about 180 mg.
- Dacomitinib has the following chemical structure:
- dacomitinib The free form of dacomitinib is known by the chemical name: (2£0-A / - ⁇ 4-[(3-chloro-4- fluorophenyl)amino] -7 -methoxy quinazolin-6-yl ⁇ -4-(piperidin- 1 -yl)but-2-enamide. Dacomitinib is described in WO 2005/107758. Dacomitinib is also known by the name PF-00299804.
- Dacomitinib may be found in the form of dacomitinib monohydrate, i.e. (2E)-N- ⁇ 4-[(3-chloro-4- fluorophenyl)amino] -7 -methoxy quinazolin-6-yl ⁇ -4-(piperidin- 1 -yl)but-2-enamide monohydrate.
- dacomitinib or a pharmaceutically acceptable salt thereof, is administered once-daily.
- dacomitinib monohydrate is administered once-daily.
- the total daily dose of dacomitinib monohydrate is about 45 mg.
- dacomitinib or a pharmaceutically acceptable salt thereof, is in tablet form.
- dacomitinib is administered in the form of a pharmaceutical composition comprising one or more pharmaceutically acceptable excipients.
- the one or more pharmaceutically acceptable excipients comprise lactose monohydrate, microcrystalline cellulose, sodium starch glycolate and magnesium stearate.
- Icotinib has the following chemical structure:
- icotinib The free base of icotinib is known by the chemical name: A-(3-ethynylphenyl)-2,5,8,ll-tetraoxa- 15,17-diazatricyclo[10.8.0.0 14 19 ]icosa-l(12),13,15,17,19-pentaen-18-amine.
- Icotinib is disclosed in WO20 13064128. Icotinib is also known as Conmana.
- icotinib or a pharmaceutically acceptable salt thereof, is administered three times daily.
- icotinib hydrochloride is administered three times daily.
- the total daily dose of icotinib hydrochloride is about 375 mg.
- Gefitinib has the following chemical structure:
- gefitinib The free base of gefitinib is known by the chemical name: N-(3-chloro-4-fluorophenyl)-7-methoxy-6- (3-morpholin-4-ylpropoxy)quinazolin-4-amine.
- Gefitinib is disclosed in WO 1996/033980.
- Gefitinib is also known as IRESSATM.
- gefitinib or a pharmaceutically acceptable salt thereof, is administered once-daily. In further instances, gefitinib is administered once-daily.
- the total daily dose of gefitinib is about 250 mg.
- Erlotinib has the following chemical structure:
- erlotinib The free base of erlotinib is known by the chemical name: N-(3-ethynylphenyl)-6,7-bis(2- methoxy ethoxy) quinazolin-4-amine. Erlotinib is disclosed in WO 1996/030347. Erlotinib is also known as TARCEVATM.
- erlotinib or a pharmaceutically acceptable salt thereof, is administered once-daily. In further instances, erlotinib is administered once-daily.
- the total daily dose of erlotinib is about 150 mg.
- the total daily dose of erlotinib is about 100 mg.
- EGFR TKI and antibody molecule as described herein are thus expected to be useful for therapeutic applications, in particular in the treatment of cancer.
- An EGFR TKI and/or antibody molecule as described herein may be used in a method of treatment of the human or animal body.
- Related aspects of the disclosure provide;
- an EGFR TKI described herein for use in a method of treatment of a cancer, wherein in the method the EGFR TKI is administered in combination with an antibody molecule described herein,
- an antibody molecule described herein for use in a method of treatment of a cancer, wherein in the method the antibody molecule is administered in combination with an EGFR TKI described herein,
- a method of treating a cancer in an individual comprises administering to the individual a first amount of an EGFR TKI, and a second amount of an anti-EGFR/cMET antibody molecule, where the first amount and the second amount together comprise a therapeutically effective amount.
- a pharmaceutical combination refers to a composition comprising a therapeutically effective amount of an EGFR/cMET antibody molecule described herein and a therapeutically effective amount of an EGFR TKI described herein and one or more pharmaceutically acceptable carriers, where each active ingredient is intended to be given to the patient in combination.
- a “combination treatment” refers to the administration of both i) an antibody molecule described herein (which, as described herein may be conjugated to a drug); and ii) a EGFR TKI described herein to an individual.
- the individual may be a patient.
- the patient is a human patient.
- Treatment may be any treatment or therapy in which some desired therapeutic effect is achieved, for example, the inhibition or delay of the progress of the condition, and includes a reduction in the rate of progress, a halt in the rate of progress, amelioration of the condition, cure or remission (whether partial or total) of the condition, preventing, ameliorating, delaying, abating or arresting one or more symptoms and/or signs of the condition or prolonging survival of an individual or patient beyond that expected in the absence of treatment.
- the antibody molecules, conjugates and EGFR TKIs will usually be administered in the form of a pharmaceutical composition, which may comprise at least one component in addition to the active agent.
- compositions may comprise, in addition to the antibody molecule, conjugate or EGFR TKI, a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials well known to those skilled in the art.
- pharmaceutically acceptable as used herein pertains to compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgement, suitable for use in contact with the tissues of a subject (e.g., human) without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- Each carrier, excipient, etc. must also be “acceptable” in the sense of being compatible with the other ingredients of the formulation.
- the precise nature of the carrier or other material will depend on the route of administration, which may be by infusion, injection or any other suitable route, as discussed below.
- Administration may be in a "therapeutically effective amount", this being sufficient to show benefit to an individual.
- the actual amount administered, and rate and time -course of administration will depend on the nature and severity of what is being treated, the particular individual being treated, the clinical condition of the individual, the cause of the disorder, the site of delivery of the composition, the type of antibody molecule, the method of administration, the scheduling of administration and other factors known to medical practitioners. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, and may depend on the severity of the symptoms and/or progression of a disease being treated.
- Appropriate doses of EGFR TKIs are known in the art, which exemplary doses described above in the section on EGFR TKIs.
- Appropriate doses of antibody molecules are well known in the art (Ledermann, 1991; and Bagshawe, 1991). Specific dosages indicated herein, or in the Physician's Desk Reference (2003) as appropriate for an antibody molecule being administered, may be used.
- a therapeutically effective amount or suitable dose of an antibody molecule can be determined by comparing in vitro activity and in vivo activity in an animal model. Methods for extrapolation of effective dosages in mice and other test animals to humans are known. The precise dose will depend upon a number of factors, including whether the size and location of the area to be treated, and the precise nature of the antibody molecule.
- the antibody molecule may be for example administered daily, once a week, once every two weeks or once every month.
- the EGFR TKI is administered as a first amount and the anti-EGFR/cMET antibody molecule administered as a second amount, where the first amount and second amount together comprise a therapeutically effective amount.
- the EGFR TKI may be administered to the individual concurrently with, sequentially to, or separately from the administration of the antibody molecule. Where the EGFR TKI is administered concurrently with the antibody molecule, the antibody molecule and EGFR TKI may be administered to the individual as a combined preparation.
- the combination treatment i.e. antibody molecule and EGFR TKI
- the third treatment may comprise chemotherapy, radiotherapy, another (different) antibody molecule, or another (different) EGFR TKI.
- the cancer to be treated using the combination treatment as described herein may be selected from the group consisting of: lung cancer (such as Non-Small Cell Lung Cancer (NSCLC)), pancreatic cancer, breast cancer, colorectal cancer, kidney cancer, gastric cancer, head and neck cancer, ovarian cancer or glioblastoma.
- lung cancer such as Non-Small Cell Lung Cancer (NSCLC)
- pancreatic cancer breast cancer, colorectal cancer, kidney cancer, gastric cancer, head and neck cancer, ovarian cancer or glioblastoma.
- the cancer may be a cancer that expresses both EGFR and cMET.
- Cells of the cancer may express EGFR and cMET at the cell surface.
- the tumour may have been determined to coexpress EGFR and cMET.
- Methods for determining the expression of a target are known in the art and include, for example, immunohistochemistry.
- the cancer to be treated using the combination treatment described herein is selected from the group consisting of: lung cancer (such as Non-Small Cell Lung Cancer (NSCLC)), pancreatic cancer, colon cancer, colorectal cancer and squamous cell carcinoma of head and neck (SCCHN or SQHN).
- lung cancer such as Non-Small Cell Lung Cancer (NSCLC)
- pancreatic cancer colon cancer
- colorectal cancer colorectal cancer
- SCCHN or SQHN squamous cell carcinoma of head and neck
- SCCHN non-small cell lung cancer
- SCCHN squamous cell carcinoma of head and neck
- the cancer is a wild-type EGFR cancer, an EGFR mutant cancer, a wild-type cMET cancer, or a cMET mutant cancer.
- Methods of detecting EGFR and cMET mutant cancers are well known.
- the cancer to be treated is an EGFR mutant cancer (also termed “EGFR mutationpositive”), for example an EGFR mutant NSCLC.
- EGFR mutations such as EGFR activating mutations, that may be associated with cancer include point mutations, deletion mutations, insertion mutations, inversions or gene amplifications that lead to an increase in at least one biological activity of EGFR, such as elevated tyrosine kinase activity, formation of receptor homodimers and heterodimers, enhanced ligand binding etc.
- Mutations can be located in any portion of an EGFR gene or regulatory region associated with an EGFR gene and include mutations in exon 18, 19, 20 or 21.
- the EGFR mutant cancer is a cancer with a L858R mutation, one or more deletions in exon 19, or one or more insertions in exon 20, a T790M mutation or a combination thereof in the EGFR gene.
- NSCLC NSCLC specific mutations in the EGFR gene are associated with high response rates to EGFR TKIs.
- the single point mutation leucine-858 to arginine (L858R) in exon 21 and variable deletions of at least three amino acid residues in exon 19 are together often referred to as ‘classical’ EGFR activating mutations and represent the vast majority (85-90%) of all observed EGFR kinase domain mutations in NSCLC (Vyse and Huang, 2019).
- Examples of reported EGFR exon 19 deletions include delE746-A750, delE746-T751, delL747-E749, delL747-P753, delL747-T751.
- the EGFR mutant cancer is a cancer (e.g. an EGFR mutationpositive NSCLC) with a L858R mutation and/or one or more deletions in exon 19 in the EGFR gene. In some instances, the EGFR mutant cancer is a cancer (e.g. an EGFR mutation-positive NSCLC) with one or more deletions in exon 19 and/or a L858R mutation in the EGFR gene. In some instances, the EGFR mutant cancer is a cancer (e.g. an EGFR mutation-positive NSCLC) with a L858R mutation and one or more deletions in exon 19 in the EGFR gene. In some instances, the EGFR mutant cancer is a cancer (e.g. an EGFR mutation-positive NSCLC) with a L858R mutation and one or more deletions in exon 19 in the EGFR gene. In some instances, the EGFR mutant cancer is a cancer (e.g.
- the EGFR mutant cancer is a cancer (e.g. an EGFR mutation-positive NSCLC) with a L858R mutation in the EGFR gene.
- T790M A secondary point mutation that substitutes methionine for threonine at amino acid position 790 is a molecular mechanism that produces a drug-resistant variant of the targeted kinase.
- the T790M mutation is present in about half of the lung cancer patients with acquired resistance to first- and second-generation EGFR TKIs, and reported to act by increasing the affinity of the receptor to adenosine triphosphate, relative to its affinity to TKIs (Suda, 2009).
- Examples of reported EGFR exon 20 insertions include D761-E762 insX, A764-Y764 insX, Y764-V765 insX, V765-M766 insX, A767-S768 insX, S768-V769 insX, V769-D770 insX, D770-N771 insX, N771- P772 insX, P772-H773 insX, H773-V774 insX, V774-C775 insX, wherein insX indicates an in-frame insertion of between 1-7 amino acids.
- a combination treatment involving the anti-EGFR/cMET conjugate described herein and osimertinib showed effective tumour inhibition across a range of different mutant EGFR cancer models, including those containing the L858R mutation, an exon 20 insertion, and an exon 19 deletion with a T790M mutation.
- the combination treatment described herein will be effective at treating a range of different EGFR mutant cancers in humans.
- the patient being treated has previously been treated with a prior anti-cancer therapy, such as a prior EGFR TKI.
- the human patient’s disease has progressed during or after previous EGFR TKI treatment, i.e.
- the patient has acquired resistance or is resistant to treatment to the previous EGFR TKI treatment.
- the patient being treated is resistant to or has acquired resistance to treatment with erlotinib, gefitinib, lapatinib, vandetanib, afatinib, osimertinib, poziotinib, criotinib, cabozantinib, capmatinib, axitinib, lenvatinib, nintedanib, regorafenib, pazopanib, sorafenib and/or sunitinib.
- human patient’s disease has progressed during or after previous treatment with a different EGFR TKI, e.g. the cancer being treated is classed as an osimertinib resistant cancer.
- mutations associated with EGFR TKI resistance include the T790M mutation and insertions in exon 20.
- the patient being treated is an EGFR TKI-naive human patient (i.e. they haven’t previously been treated with an EGFR TKI).
- treatment may include inhibiting cancer growth, including complete cancer remission, and/or inhibiting cancer metastasis, as well as inhibiting cancer recurrence.
- Cancer growth generally refers to any one of a number of indices that indicate change within the cancer to a more developed form.
- indices for measuring an inhibition of cancer growth include a decrease in cancer cell survival, a decrease in tumour volume or morphology (for example, as determined using computed tomographic (CT), sonography, or other imaging method), a delayed tumour growth, a destruction of tumour vasculature, improved performance in delayed hypersensitivity skin test, an increase in the activity of anti-cancer immune cells or other anti-cancer immune responses, and a decrease in levels of tumour-specific antigens.
- Activating or enhancing immune responses to cancerous tumours in an individual may improve the capacity of the individual to resist cancer growth, in particular growth of a cancer already present the subject and/or decrease the propensity for cancer growth in the individual.
- the combination treatment described herein are capable of inhibiting the development or progression of a cancer.
- the ability of a given combination treatment to inhibit the development or progression of a cancer can be analysed e.g. using an in vivo model.
- the in vivo model may involve measuring tumour growth in a patient derived xenograft (PDX) model. Further details of this exemplary method is described in the examples.
- Inhibition of the development of a cancer may be inferred by observation of slower tumour growth or a decrease in tumour size following administration of the antibody molecule, for example by measuring the tumour growth inhibition (%TGI).
- %TGI can be measured by comparing the size of the tumour measured at day 0 with the size of the tumour measured at the end of the study time for those subjects administered with the antibody molecule, and comparing this to the tumour growth over the same time period for subjects administered with a control antibody molecule.
- the combination treatment described herein has a %TGI of at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%.
- Inhibition of the development of a cancer may be inferred by observation of a delayed or prevented onset of, and/or reduced severity of, symptoms of the cancer in response to treatment with the antibody molecule.
- Inhibition of the progression of a cancer may be inferred by observation of delayed, prevented and/or reduced invasion and/or metastasis in response to treatment with the antibody molecule.
- the combination treatment described herein may be capable of inhibiting the development or progression of a cancer to less than 100%, e.g. one of 99% or less, 95% or less, 90% or less, 85% or less, 75% or less, 70% or less, 65% or less, 60% or less, 55% or less, 50% or less, 45% or less, 40% or less, 35% or less, 30% or less, 25% or less, 20% or less, 15% or less, 10% or less, 5% or less, or 1% or less of the development/progression of the cancer in the absence of treatment (or treatment with an appropriate control).
- the combination treatment described herein is capable of inhibiting the development or progression of a cancer to less than 1 times, e.g.
- the combination treatment described herein is capable of inhibiting the development or progression of a cancer to a greater extent than the use of the single agent (i.e. antibody molecule or EGFR TKI) administered individually.
- the combination treatment described herein may be capable of inhibiting the development or progression of a cancer to less than 100%, e.g.
- the combination treatment described herein exerts a synergistic effect on inhibiting the development or progression of a cancer.
- This example describes the creation of bispecific antibody molecules that are capable of binding both EGFR and cMET.
- Top hits exhibiting strong inhibitory effect were selected and subjected to DNA sequencing. Unique genes were then converted to human immunoglobulin G2 (IgG2) antibodies and produced in mammalian cells essentially as described (Persic; 1997). The purified antibodies were then ranked based on their inhibitory effect in the HGF:cMET HTRF® binding assay. The most potent antibody, 0021U3-B09, was selected for further characterization.
- IgG2 immunoglobulin G2
- variable framework regions of 0021U3-B09 were targeted specifically and altered to match the closest human germline sequence.
- VH region seven amino acid residues were mutated to match the reference human germline sequence IGHVl-8*01.
- VL region three residues were mutated to match the reference human germline sequence IGKV 1-5*03. All residues in VH and VL regions were successfully changed to the germline residues without loss of activity.
- 0021U3-B09 was affinity optimized using a hybridization-based mutagenesis method essentially as described (Kunkel 1985).
- a large scFv library derived from 0021U3-B09 sequence was created by oligonucleotide-directed mutagenesis of the VH complementarity determining regions 3 (CDR3) using standard molecular biology techniques.
- the library was subjected to affinity-based solution phase selections to select variants with a higher affinity to human and cynomolgus cMET antigens.
- Crude scFv-containing periplasmic extracts from the CDR-targeted selection outputs were screened for improved inhibitory activity in the HGF:cMET HTRF® binding assay.
- Variants exhibiting significantly improved inhibitory effect compared to parent 0021U3-B09, were subjected to DNA sequencing and unique genes were converted to human IgG2.
- the purified antibodies were then ranked based on their inhibitory effect.
- the most potent antibody, B09-57 was selected for further characterization.
- EGFR-specific scFv antibodies were isolated from a large naive human scFv phage display library in a series of repeated panning selection cycles on recombinant mammalian expressed biotinylated monomeric human EGFR (Medlmmune) essentially as described (Vaughan, 1996). ScFv-displaying phage from the round 3 of the selection output were screened for their binding to human and cynomolgus EGFR in ELISA. Top hits showing cross reactivity were selected and subjected to DNA sequencing. Unique genes were then converted to human immunoglobulin G1 (IgGl) antibodies and produced in mammalian cells essentially as described (Persic, 1997). The purified antibodies were then ranked based on their binding to the EGFR -expressing cell line, A431, by flow cytometry. Antibody Tdev-0004 exhibiting specific cell binding was selected for further characterization.
- IgGl immunoglobulin G1
- Variant RAA22 and QD6 were derived by optimizing the anti-EGFR Tdev-0004 mAb.
- the VH region was initially fully germlined by mutating all 13 non-germline framework residues. Upon germlining, the binding of the fully germlined variant to cynomolgus EGFR was significantly impaired. To restore the binding to cynomolgus EGFR, four non-germline residues; K68, 173, R76 and T78 were selectively back mutated. Amino acid residues are numbered by Kabat numbering system (Kabat and Wu 1991). The resulting, partially germlined variant, named H4, was used as a template sequence for the affinity optimization.
- Variant H4 was affinity optimized by parsimonious mutagenesis of all six CDRs using a QuikChange Lightning Multi Site-Directed Mutagenesis Kit (Agilent), according to the manufacturer’s instructions. Single amino acid mutagenized VH and VL libraries were expressed in bacteria as Fab fragments and screened for improved binding to human and cynomolgus EGFR in ELISA. Variants exhibiting improved binding compared to parent H4 were subjected to DNA sequencing and unique genes were converted to human IgGl. Variant RAA22 was identified with a single mutation in CDRH3.
- variable domains of the anti-cMET mAb B09-57 and anti-EGFR mAbs RAA22 and QD6 were utilized for the construction of monovalent bispecific anti-EGFR/cMET antibodies on the backbone of the DuetMab platform (Mazor, 2015).
- the VH gene of the anti-cMET B09-57 was inserted into a human gamma- 1 constant heavy chain carrying the “Knob” mutation (T366W) and the alternative interchain cysteine mutations (F126C and C219V).
- the VL gene of B09-57 was inserted in frame into a human Kappa constant domain carrying the corresponding alternative interchain cysteine mutations (S121C and C214V) designed to pair with the “Knob” heavy chain.
- the VH genes of the anti-EGFR RAA22 and affinity optimized QD6 were inserted into a human gamma- 1 constant heavy chain carrying the “Hole” mutations (T366S, L368A, and Y407V), while the VL genes of RAA22 and B09-57 were inserted in frame into a human Lambda constant domain designed to pair with the “Hole” heavy chain.
- the assembled monovalent bispecific anti-EGFR/cMET DuetMab antibodies were designated as RAA22/B09-57 and QD6/B09-57 (FIG. 1). DuetMab antibodies were produced from mammalian cells as previously described (Mazor, 2017).
- This example tests various biochemical and biophysical properties of the RAA22, QD6 and B09-57 monoclonal antibodies and RAA22/B09-57 and QD6/B09-57 bispecific antibodies molecules, including their binding affinity to EGFR and c-Met, respectively and their ability to bind both antigens simultaneously.
- kinetic rate constants (kon and koff), and equilibrium dissociation constants (KD) of EGFR-CMET DuetMAbs for recombinant human, cynomolgus monkey, and murine EGFR and cMET antigens were determined at 25°C by SPR using an antibody capture assay on a BIAcore T200 instrument (GE Healthcare, Pittsburgh, PA).
- Mouse anti-human IgG was immobilized on a CM4 sensor chip with a final surface density of -2000 resonance units (RUs). A reference flow cell surface was also prepared on this sensor chip using identical immobilization protocol.
- Test and control article antibodies were prepared at 5-20 nM in instrument buffer (HBS-EP buffer; 0.01M HEPES, pH 7.4, 0.15M NaCl, 3mM EDTA, and 0.005% P-20), along with 3-fold serial dilutions of purified EGFR (0.27 - 200nM human, 0.4 - 900nM cyno, and 4-1000nM murine) or cMET proteins (0.27 to 66 nM human and 0.27 - 22nM cyno) in instrument buffer.
- a sequential approach was utilized for kinetic measurements.
- Antibodies were first injected over the capture surface, at a flow rate of lOpL/minute.
- Mouse cMET ND a ND not determined.
- Kinetic measurements to soluble monomeric forms of EGFR and cMET were performed using a BIACore instrument. KD were calculated as the ratio of k o ff/k on from a non-linear fit of the data.
- bispecific antibody molecule QD6/B09-57 binds human c-Met with a high affinity ( ⁇ 2 nM kD) and human EGFR with a high affinity ( ⁇ 6 nM kD), whilst bispecific antibody molecule RAA22/B09-57 binds human c-Met with a similarly high affinity ( ⁇ 2 nM kD) but binds human EGFR with a reduced affinity ( ⁇ 45 nM kD) in comparison to QD6/B09-57.
- R374 a non-binding IgGl isotype control antibody
- B09 anti-cMET antibody
- QD6 anti-EGFR antibody
- RAA22 anti-EGFR antibody
- QD6/B09 bispecific EGFR/c-MET DuetMAb
- RAA22/B09 bispecific EGFR/c-MET DuetMAb
- PaniX anti-EGFR antibody
- MetMab anti-cMET antibody
- Mabll311 anti-HER4 antibody
- Wells were incubated with 50 microliters of the indicated primary antibodies diluted in PBS-T in a 1:3 dilution series, starting at 10 pg/mL and ending at 0.002 pg/mL, except for the HER4 binding mAb control, MAB1131, for which the series started at 1 pg/mL.
- the wells were washed 4 times in PBS- T, then 50 pl of goat anti-human Fab HRP-labeled secondary antibody, diluted 1:5000 in PBS-T, was added to each well and incubated for one hour at room temperature. 50 microliters of TMB substrate solution was added to all wells and incubated at room temperature for 5 -30 min, until intense signal was observed in the positive control wells.
- TMB stop solution 50 microliters was added to all wells and the absorbance was read at 450 nm on a SpectraMax M5 microplate reader. Data were analyzed in the SoftMax Pro 5 software and plotted using GraphPad Prism 7 graphing software.
- ELISA assays were carried out as described above. As shown in FIG 3A, the high affinity EGFR IgG, QD6, as well as the monovalent bispecific EGFR/cMET DuetMAb, QD6/B09, bound to human, cynomolgus monkey, and mouse EGFR and gave robust signals in the ELISA assay. In contrast, the lowered affinity EGFR IgG, RAA22, bound more weakly to human, cynomolgus monkey, and mouse EGFR compared to QD6. Binding to mouse EGFR was weak, but detectable.
- the B09/IgG construct showed very small level of internalization (FIG 4B, right).
- the rapid and extensive decrease of the membrane signal corresponded to a very moderate increase of the cytoplasm signal, likely due to extensive dissociation of pre-bound B09/IgG from c-MET receptor on the cell surface.
- the dissociation of the antibody subsequently resulted in modest internalization of B09/IgG.
- RAA22/B09 DuetMab showed internalization profiles very different when compared to its single-arm control antibodies. As seen in FIG 4B, cytoplasmic intensity values were 10.98- and 4.70- fold higher for RAA22/B09 DuetMab than RAA22-IgG and B09-IgG, respectively. While inefficient internalization of B09/IgG maybe attributed to its pronounced dissociation, RAA22/IgG did undergo rapid internalization. However, due to the lower affinity of the EGFR-arm, the number of RAA22/IgG molecules were 10.98-fold less (based on fluorescent intensity) than for the RAA22-B09 DuetMab.
- the ADC cytotoxic activity was tested in multiple cell lines as follows. Cells were plated at a density of 10,000 cells per well of 96-well plates in a volume of 100 pL in their recommended culture media supplemented with 10% fetal bovine serum. A 3X concentration of each dose of antibody to be tested was prepared by serial dilution of the antibody stock in culture medium. Fifty microliters of each test article was added to cells in triplicate such that the final antibody concentration ranged from 60 nM to 0.0009 nM. The treated cells were cultured for 72 hours at 37 degrees C in a humidified incubator. The metabolic activity was determined using CellTiter-Glo Luminescent Viability Assay from Promega according to manufacturer’s instructions. Data were plotted as percent metabolic activity relative to untreated control. IC50 values were determined using logistic non-linear regression analysis between the maximal viability (untreated cells) and the maximal response (peak inhibition) with GraphPad Prism software.
- PDX Patient derived xenograft
- PDX models of human cancer have become a well-established alternative to tumor cell line based tumor xenografts.
- PDX models are established from a patient’s primary tumor tissue implanted directly into immunodeficient mice to yield in vivo propagated tumors in the mouse.
- the tumors thus derived are subsequently propagated in additional mice, without culturing in vitro, to establish a bank of low passage PDX tumor tissue which can be used to implant study mice.
- One key feature of PDX models is that they largely maintain the histological and genomic heterogeneity and preserve the gene expression profile of the corresponding original patient tumor.
- PDX models Compared to tumor cell line based xenograft models, which use clonal populations of tumor cells that have been adapted to growth in vitro, the characteristics of PDX models are intended to more accurately replicate the features of real human tumors, thus improving the predictive value of pre-clinical mouse models. Indeed, numerous studies have shown that the response and resistance profiles of PDX models to standard of care treatments closely correlate with clinical data in human subjects with a given tumor profile.
- mice are typically treated at a single dose level established from prior dose range finding studies, with an optional treatment control group for each model.
- mice were implanted unilaterally on the flank with tumor fragments harvested from host animals, each implanted from a specific passage lot. Pre-study tumor volumes were recorded beginning approximately one week prior to its estimated start date. When tumors reached the appropriate Tumor Volume Initiation (TVI) range (125-250 mm 3 ), animals were randomized into treatment and control groups and intravenous (IV) dosing was initiated (Day 0); animals were followed individually throughout the study. Initial dosing began on Day 0; animals in all groups were dosed I.V.
- TVI Tumor Volume Initiation
- the lowered affinity ADC showed an overall trend of increased number and depth of responses observed, compared to the higher affinity ADC. This activity trend was slightly reversed for the PDX models that were least responsive to the lowered affinity ADC, which correlated somewhat to lower cMET expression.
- the EGFR binding arm of both bispecific antibodies was derived from the same mouse EGFR cross reactive antibody (see Example 1).
- the intrinsic binding affinity of the QD6/B09 antibody toward mouse EGFR was approximately 6 nM, whereas the affinity of the RAA22/B09 bispecific antibody was approximately 575 nM.
- the unexpected improvement in the activity of the lowered EGFR affinity could be attributed to a reduced impact from the EGFR sink in normal tissues, such as the skin, resulting in higher overall circulating exposure of the ADC. Regardless, these data demonstrate that reducing the affinity toward EGFR of the EGFR-cMET bispecific antibody did not compromise the in vivo efficacy of the resulting ADC, but unexpectedly improved the activity compared to the higher affinity ADC.
- the lowered affinity ADC was generally more efficacious than the high affinity ADC.
- the lowered affinity ADC induced regressions at 2 or 3 mg/kg dose levels, demonstrating that the lowered affinity ADC is efficacious at modest doses.
- Subcutaneous in vivo tumor models are the mainstay for examining the efficacy of anti-cancer agents.
- this tumor implantation site is accompanied by a number of limitations that need to be considered when interpreting in vivo results. These deficiencies include, tumor vascularization and the lack of tissue-specific stroma in the growth and response of the tumor.
- MEDI-PANC-08 LUC a Luciferase expressing PDX variant whose growth could be tracked using Imaging.
- the MEDI-PANC-08 pancreatic PDX model used in this study came from the Internal Medlmmune PDX library.
- the PDX tumor was initially propagated in seed NSG (NOD.Cg-Prkdc scld I12rg tmlWjl /SzJ) mice, to generate sufficient tumor material to seed the efficacy study.
- NSG NOD.Cg-Prkdc scld I12rg tmlWjl /SzJ mice
- mice Upon reaching ⁇ 150-250mm3 in size, mice were randomized (based on tumor volume) into treatment groups and treated with the ADCs (QlWx4). Two EGFR-cMET bispecific ADCs were examined at 1, 2 and 3 mg/kg the QD6/B09 (high affinity) and RAA2/B09 (low affinity). An Isotype control ADC (R347-AZ1508) was also tested at 3 mg/kg. All Antibody-Drug Conjugates were diluted in buffer (25mM Histidine, 7% Sucrose, 0.02% PS80, pH 6.0), immediately prior to use and administered i.v. via the tail vein. Tumor and body weight measurements were collected twice weekly and tumor volume calculated using the equation (LxW2)/2, where L and W refer to the length and width dimensions, respectively.
- the luciferase expressing PDX model (MEDI-PANC-08 LUC ) was grown subcutaneously in NSG seed mice and at a volume of 800- 1200mm 3 the tumors were harvested and cut into fragments of approximately 2mm 3 . The tumor fragments were subsequently sutured to the pancreas of NSG mice (Day Zero). Luciferase signal was determined weekly using the IVIS Spectrum In vivo Imaging system. Briefly, 10 minutes prior to imaging, 200ul of luciferin dissolved in DPBS (15 mg/ml) was injected intra-peritoneally (i.p.). The mice were anesthetized under 3% isoflurane, laid on their right side and luminescence measured.
- mice Fourteen days after tumor implant, when luminescent signal was clearly detectable, the mice were randomized into their respective groups based on the luminescence. The mice were treated with Isotype control (R347-AZ1508, 3 mg/kg - QlWx4), Gemcitabine (75 mg/kg, Q2Dx5) and RAA2/B09 ADC (2 and 3 mg/kg - QlWx4). Luminescence was measured weekly. Study endpoints included body weight loss, deterioration of body condition and lethargy. Data were analyzed using the Living Image software (Perkin Elmer) and plotted as Average Radiance [p/s/cm2/sr] against time.
- high and low affinity EGFR-cMET bispecific ADCs were compared in an in vivo efficacy study using the MEDI-PANC-08 pancreatic PDX model. As shown in Panels A and B of FIG 11, a disparate difference was observed between the 2 molecules. The high affinity QD6/B09 ADC did not show efficacy at any of the 3 dose levels tested. Conversely, the low Affinity RAA2/B09 ADC produced complete tumor regression by day 65 followed by tumor re-growth at the 3 mg/kg dose level and tumor growth inhibition at 2 mg/kg.
- pancreatic cancer Whilst subcutaneous tumor models have become the work-horse for in vivo efficacy studies, a major deficiency is that tumors are not grown at the site of origin and hence any drug response might not truly reflect of how patients will respond.
- an orthotopic model of pancreatic cancer was developed using the MEDI-PANC-08 tumor that had been transgenically modified to stably express luciferase. Following surgical implantation on the pancreas, tumors were allowed to establish and subsequently randomized based on luminescent signal. The mice were then treated with either the Low affinity RAA2/B09 EGFR-cMET ADC, isotype control or gemcitabine (a chemotherapy drug). Following treatment, the luminescence was measured weekly.
- PK analyses were carried out to compare the plasma PK parameters of the low and high affinity EGFR-cMET ADCs, including peak and total exposure, clearance, and half-life in mice and cynomolgus monkeys.
- a key aim was to determine whether reducing the affinity for EGFR would impact the circulating exposure of the EGFR-cMET bispecific ADC.
- PK samples were collected in mice and cynomolgus monkeys for both QD6/B09-57-AZ1508 and RAA/B09-57-AZ1508 across various dose levels.
- Non-compartmental analysis was performed to estimate PK parameters for QD6/B09-57-AZ1508 and RAA22/B09-57-AZ1508 based on total ADC concentrations across species and dose levels.
- the quantification range covers 100 ng/mL-15,000 ng/mL, with the dilution QC covering up to 525,000 ng/mL.
- the standard curve was fitted with the simplest possible model.
- the accuracy and precision of the assay is within 20% for all levels except the lower limit of quantification (LLOQ), which is at 25%.
- Both RAA22/B09-57-AZ1508 and QD6/B09-57-AZ1508 exhibited linear PK in mice at the dose levels tested, with dose -proportional exposure (Cmax and AUC), comparable CL and ti/2 observed at 0.5 mg/kg to 10 mg/kg for RAA22/B09-57-AZ1508 and at 1 mg/kg to 10 mg/kg for QD6/B09-57- AZ15O8, respectively.
- PK comparison between RAA22/B09-57-AZ1508 and QD6/B09-57-AZ1508 is assessed at 1, 3, 5, 10 mg/kg dose levels that were tested for both compounds and the mean PK parameters based on NCA is summarized in Table 5.
- Table 5 Mean NCA PK parameters by Dose levels between RAA22/B09-57-
- RAA22/B09-57-AZ1508 exhibited linear PK in cynomolgus monkeys at 2 mg/kg to 5 mg/kg, with dose-proportional exposure (Cmax and AUC), comparable CL and ti/2 observed.
- QD6/B09-57-AZ1508 exhibited non-linear PK in cynomolgus monkeys at 0.67 mg/kg to 3 mg/kg, with more than dose-proportional exposure (Cmax and AUC) shown, and faster CL and shorter ti/2 observed at lower dose levels.
- PK comparison between RAA22/B09-57-AZ1508 and QD6/B09-57-AZ1508 in cynomolgus monkeys is assessed at 2 and 3 mg/kg dose levels that were tested for both compounds and the mean PK parameters based on NCA is summarized in Table 7.
- the DuetMab RAA22/B09 (with the “Maia” cysteine insertion after serine 239) bispecific antibody produced according to Example 1 was conjugated to the topoisomerase inhibitor SG3932 via “classical” conjugation to native cysteines in the bispecific antibody.
- the efficacy of the EGFR/cMET topoisomerase I inhibitor ADC was investigated using a PDX trial.
- the PDX trial was carried out essentially as described above for Example 5 using a variety of different PDX models obtained from pancreatic, colon, NSCLC and squamous head and neck carcinoma (SQHN) tumors. Animals were injected with a single dose of the EGFR-cMET Maia Topo ADC at 10 mg/kg. The results of the PDX trial using the EGFR-cMET Maia Topo ADC are reported in FIG 14.
- SUBSTITUTE SHEET (RULE 26) containing the topoisomerase I inhibitor was efficacious in the PDX models representing multiple tumor types.
- the ADC with the topoisomerase I inhibitor produced and tested in Example 8 used the RAA22/B09 bispecific antibody containing the “Maia” cysteine insertion after serine 239. However, given that SG3932 conjugates to native cysteines, the Maia cysteine insertion is not necessary. We therefore sought to modify the RAA22/B09 Maia Topo ADC produced in Example 8 to remove this cysteine insertion.
- the newly generated “EGFR-cMET TM’ molecule comprising variable regions from RAA22 and B09, with the 239i mutation removed and the TM introduced has the amino acid sequences set forth in the following table:
- TCEP Tris(2-carboxyethyl)phosphine
- PBS phosphate- buffered saline pH 7.4
- EDTA ethylenediaminetetraacetic acid
- SG3932 was then added as a DMSO solution (12.5 molar equivalent/antibody) for a 10% (v/v) final DMSO concentration. The solution was incubated for 2 hours at room temperature and then quenched by the addition of A-acetyl cysteine (5 micromoles/SG3932) and incubated at room temperature for 15 min. The reaction mixture filtered using 0.2 uM sterile filter and then stored at 2-8°C overnight. Excess free drug was removed via Tangential Flow Filtration unit (TFF) using mPES, MidiKros® 30 kDa fiber filter with 375 cm 2 surface area, into buffer containing 30 mm Histidine, 30 mM Arginine, pH 6.8.
- TMF Tangential Flow Filtration unit
- the efficacy of the EGFR-cMET TM ADC was investigated using a PDX trial.
- the PDX trial was carried out essentially as described above for Example 5 using a range of different PDX models obtained from pancreatic, colon, NSCLC and SQHN tumours. Animals were injected with a single dose of the EGFR-cMET TM ADC at 5 mg/kg.
- the results of the PDX trial using the EGFR-cMET TM ADC are reported in FIG 15. Results from this experiment demonstrate that the EGFR-cMET TM ADC was able to induce tumour growth inhibition or regression in numerous PDX models tested
- TM ADC EGFR-cMET Maia Topo ADC
- Maina ADC EGFR-cMET Maia Topo ADC
- the animals were doses with 2.5 mg/kg, 5 mg/kg or 10 mg/kg of each ADC and tumour growth monitored. Also included in this experiment was an untreated control (“untreated) and animal dosed with unconjugated EGFR-cMET TM (TM mAb). The results are shown in FIG 16.
- the EGFR-cMET TM ADC was also shown to be effective at reducing tumour growth in NSCLC tumours that express either wild type or mutant EGFR. Results demonstrate that the EGFR-cMET TM ADC is active in both wild type and mutant EGFR PDX models are shown in FIG 17. This is advantageous, as it indicates that the ADCs will be able to provide a benefit in multiple therapeutic settings and across a range of different EGFR genotypes.
- PK pharmacokinetic
- This example compares the ADC efficacy in combination with the third generation tyrosine kinase inhibitor TKI osimertinib (‘Osi’) in various EGFR mutant tumour models using a PDX trial.
- Osi third generation tyrosine kinase inhibitor TKI osimertinib
- mice or bearing patient-derived xenografts were carried out at Georgianamic nude-Foxnlnu mice) and Genendesign (Balb/C nude mice). All studies were compliant with the AstraZeneca Global Standard on Animal Care and Welfare. Models were established from viable human tumor tissue or fluid and have been serially passaged in animals a limited number of times to maintain tumor heterogeneity. Mice were implanted unilaterally on the flank with tumor fragments harvested from host animals, each implanted from a specific passage lot. Pre-study tumor volumes were recorded beginning approximately one week prior to its estimated start date. When tumors reached the appropriate Tumor Volume for Initiation (TVI) range (150-300 mm 3 ), animals were randomized into treatment and control groups.
- TVI Tumor Volume for Initiation
- Treatments- Animals receiving either EGFR-cMET Topli antibody drug conjugate (ADC) described in Example 9 or the control EGFR-cMET mAb were administered a single intravenous (IV) dose at the indicated dose level on Day 0; animals were dosed IV by weight (at a dose volume of 5 ml/kg). Starting on Day 0, animals in the osimertinib treatment group received the drug formulated in an oral dosing solution at 2.5mg/ml in vehicle (0.5% w/v HPMC (hydroxyl propyl methyl cellulose) in deionised water); animals were dosed orally by weight at a dosing volume of 10 mL/kg to give a final dose level of 25 mg/kg.
- ADC EGFR-cMET Topli antibody drug conjugate
- Osimertinib treated animals were dosed daily for the first 21 days of the study. Animals in the combination treatment groups received both the EGFR-cMET ADC and osimertinib, with each treatment administered according to the monotherapy dosing schedule described above. All animals were followed individually throughout the study.
- PR partial responders
- mice lacking palpable tumors were classified as complete responders (CR); a CR that persisted until study completion were considered tumor-free survivors (TFS).
- Tumor growth observations in the untreated control group were carried out until the mean tumor volume of the group (uncensored) reached the humane endpoint of 1500mm 3 , or until Day 60, whichever came first.
- Tumor growth observations in the treatment groups were carried out until Day 60; if tumors in individual mice in the treatment groups reached the humane endpoint of 1500mm 3 , the animals were euthanized and observations in the other treatment animals continued. Some animals exhibiting a sustained response were observed beyond 60 days.
- FIG 19A and C shows the results for EGFR mutant models ‘LUN487’ and ‘LUN439’ containing the EGFR L858R mutation representing 1 st line EGFRm non-small cell lung cancer (NSCLC).
- the EGFR- cMET TM ADC was dosed at 2, 4 and 8 MPK (mg/kg).
- a group was also dosed with mAb-only control (EGFR-cMET mAb) at 8 mPK or osimertinib only at 25 MPK.
- the results show that EGFR-cMET TM ADC monotherapy showed a dose-dependent response.
- PDX models responded to osimertinib. No treatment response was observed for the mAb-only control.
- FIG 19B and D shows the results for EGFR mutant models ‘LUN487’ and ‘LUN439’ where EGFR- cMET TM ADC was dosed at 2 or 4 MPK alone or in combination with Osimertinib (25 MPK).
- the combination of EGFR-cMET TM ADC and osimertinib demonstrated improved tumor growth inhibition compared to either agent (EGFR-cMET TM ADC or osimertinib) administered individually.
- FIG 20A shows the results for EGFR mutant model ‘CTG-2992’ containing an Exon20 insertion representing primary resistance to osimertinib.
- the EGFR-cMET TM ADC was dosed at 2, 4 and 8 MPK (mg/kg).
- a group was also dosed with mAb-only control (EGFR-cMET mAb) at 8 mPK or Osimertinib only at 25 MPK.
- the results show that EGFR-cMET TM ADC monotherapy showed a dose-dependent response.
- PDX models responded to Osimertinib.
- FIG 20B shows the results for EGFR mutant model ‘CTG-2992’ where the EGFR-cMET TM ADC and osimertinib were administered in combination.
- EGFR-cMET TM ADC was dosed at 2 or 4 MPK.
- the combination of EGFR-cMET TM ADC and osimertinib demonstrated improved tumor growth inhibition compared to either agent (EGFR-cMET TM ADC or osimertinib) administered individually.
- FIG 21A shows the results for EGFR mutant models ‘CTG-2803’ representing acquired resistance to osimertinib.
- the EGFR-cMET TM ADC was dosed at 2, 4 and 8 MPK (mg/kg).
- a group was also dosed with mAb-only control (EGFR-cMET mAb) at 8 mPK or Osimertinib only at 25 MPK.
- the results show that EGFR-cMET TM ADC monotherapy showed a dose-dependent response.
- PDX models did not respond to osimertinib or mAb-only monotherapies.
- FIG 21B shows the results for EGFR mutant models ‘CTG-2803’ where the EGFR-cMET TM ADC and osimertinib were administered in combination.
- EGFR-cMET TM ADC was dosed at 2 or 4 MPK.
- the combination of EGFR-cMET TM ADC and osimertinib demonstrated improved tumor growth inhibition compared to either agent (EGFR-cMET TM ADC or osimertinib) administered individually.
- This example sets to further evaluate the combination efficacy of osimertinib and the EGFR-cMET TM ADC in NSCLC PDX models with mutant EGFR.
- An additional 23 NSCLC PDX models were enrolled, encompassing a variety of EGFR mutations. Studies were performed largely as set out in the section 5.1 of Example 10.
- mice for each PDX were generally set into three groups, receiving either osimertinib 25 mg/kg daily for 21 days, EGFR-cMET TM ADC 2 mg/kg or osimertinib 25 mg/kg daily and EGFR-cMET TM ADC 2 mg/kg.
- isotype-ADC R347 controls dosed at 8 mg/kg and/or naked EGFR-cMET TM mAb controls dosed at 8 mg/kg.
- FIGs 22A, 22B and 22C Responses for each of the models for each of the three treatment groups are shown in FIGs 22A, 22B and 22C.
- results show that responses were observed in 14/23 (61%) models in the combination group, whereas the osimertinib and EGFR-cMET TM ADC monotherapy groups displayed response rates in 8/23 (34.8%) and 7/23 (30.4%) models, respectively.
- a response is defined as a 30% regression in tumor volume from baseline. Regressions were analysed starting from one week after dosing. The values reported are the best response observed over the duration of the study. More detailed response data as well as information about the EGFR mutation status is provided in the Table below.
- Table 9 shows the best overall response for each study arm for each model R means response, NR means no response. % change indicates change in tumor volume compared to baseline
- HFR3 - RVKITADISTRTTYMELSSLRSEDTAVYYCAR (SEQ ID NO: 10)
- VH variable heavy region of low affinity anti-EGFR binding arm
- Amino acid sequence of the VH region of anti-EGFR antibody clone QD6 (SEQ ID NO: 18):
- VL variable light region of anti-EGFR antibody clone RAA22
- Amino acid sequence of the VL region of high affinity anti-EGFR binding arm (SEQ ID NO: 22):
- VH variable heavy region of anti-cMet binding arm B09-GL
- VL variable light region of anti-cMet binding arm B09-GL
- Amino acid sequence of a human immunoglobulin G1 CH region modified to include “Knob” mutation, interchain cysteine mutations, a cysteine to form a stabilizing disulfide bridge and with a cysteine insertion (SEQ ID NO: 43): Following substitutions are underlined:
- “Knob” mutation T366W
- interchain cysteine mutations F126C and C219V
- stabilizing cysteine mutation S354C
- cysteine insertion C239i
- “Knob” mutation T366W
- interchain cysteine mutations F126C and C219V
- stabilizing cysteine mutation S354C
- WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of a human immunoglobulin G1 CH region modified to include “Hole” mutations, a cysteine to form a stabilizing disulfide bridge and without a cysteine insertion (SEQ ID NO: 46):
- “Hole” mutations T366S, L368A, and Y407V); and stabilizing cysteine mutation (Y349C), where numbering of residues is according to EU index.
- Amino acid sequence of a wild-type human immunoglobulin kappa constant region (SEQ ID NO: 47): RTVAAPSVFIFPPSDEQLKSGTASVVCELNNFYPREAKVQWKVDNAEQSGNSQESVTEQDSKDSTYSESSTLTLS KADYEKHKVYACEVTHQGESSPVTKSFNRGEC
- Amino acid sequence of a human immunoglobulin kappa constant region modified to include S121C and C214V substitutions (SEQ ID NO: 48):
- Amino acid sequence of the heavy chain of anti-cMet binding arm B09-GL with cysteine insertion (SEQ ID NO: 50): Following substitutions are underlined:
- “Knob” mutation T366W
- interchain cysteine mutations F126C and C219V
- stabilizing cysteine mutation S354C
- cysteine insertion C239i
- Amino acid sequence of the heavy chain of anti-cMet binding arm B09-GL without cysteine insertion (SEQ ID NO: 51 ):
- Knob mutation T366W
- interchain cysteine mutations F126C and C219V
- stabilizing cysteine mutation S354C
- Amino acid sequence of the light chain of anti-cMet binding arm B09-GL (SEQ ID NO: 52):
- Amino acid sequence of the heavy chain of high affinity anti-EGFR binding arm (QD6) with cysteine insertion SEQ ID NO: 53:
- “Hole” mutations T366S, L368A, and Y407V); stabilizing cysteine mutation (Y349C); and cysteine insertion (C239i), where numbering of residues is according to EU index.
- Amino acid sequence of the heavy chain of high affinity anti-EGFR binding arm (QD6) without cysteine insertion SEQ ID NO: 54:
- “Hole” mutations T366S, L368A, and Y407V); and stabilizing cysteine mutation (Y349C), where numbering of residues is according to EU index.
- Amino acid sequence of the light chain of high affinity anti-EGFR binding arm (QD6) (SEQ ID NO: 55):
- Amino acid sequence of the heavy chain of low affinity anti-EGFR binding arm (RAA22) with cysteine insertion SEQ ID NO: 56:
- “Hole” mutations T366S, L368A, and Y407V); stabilizing cysteine mutation (Y349C); and cysteine insertion (C239i), where numbering of residues is according to EU index.
- Amino acid sequence of the heavy chain of low affinity anti-EGFR binding arm (RAA22) without cysteine insertion SEQ ID NO: 57:
- “Hole” mutations T366S, L368A, and Y407V); and stabilizing cysteine mutation (Y349C), where numbering of residues is according to EU index.
- Amino acid sequence of the light chain of low affinity anti-EGFR binding arm (RAA22) (SEQ ID NO: 58):
- Amino acid sequence of the heavy chain of low affinity anti-EGFR binding arm (RAA22) with triple mutation (TM) (SEQ ID NO: 59):
- Triple mutation (TM; L234F, L235E and P331S); “Knob” mutation (T366W); interchain cysteine mutations (F126C and C219V); stabilizing cysteine mutation (S354C), where numbering of residues is according to EU index.
- Triple mutation (TM; L234F, L235E and P33 IS); “Hole” mutations (T366S, L368A, and Y407V); and stabilizing cysteine mutation (Y349C), where numbering of residues is according to EU index.
- Amino acid sequence of the light chain of low affinity anti-EGFR binding arm (RAA22) in “EGFR-cMET TM” antibody (SEQ ID NO: 61):
- Amino acid sequence of the light chain of anti-cMet binding arm in “EGFR-cMET TM” antibody (SEQ ID NO: 62): DIQMTQSPSTLSASVGDRVTITCRASEGIYHWLAWYQQKPGKAPKLLIYKASSLASGVPSRFSGSGTEFTLTISS LQPDDFATYYCQQYSNYPPTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- T366W Triple mutation (TM; L234F, L235E and P331S); “Knob” mutation (T366W); interchain cysteine mutations (F126C and C219V); stabilizing cysteine mutation (S354C), where numbering of residues is according to EU index.
- Triple mutation (TM; L234F, L235E and P33 IS); “Hole” mutations (T366S, L368A, and Y407V); and stabilizing cysteine mutation (Y349C), where numbering of residues is according to EU index.
- Amino acid sequence of a human immunoglobulin lambda constant region modified to include S121C and C214V substitutions (SEQ ID NO: 65):
- Amino acid sequence of the human EGFR extracellular domain (SEQ ID NO: 68):
- Amino acid sequence of the cynomolgus monkey EGFR extracellular domain (SEQ ID NO: 69):
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Oncology (AREA)
- Biomedical Technology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
Description
Claims
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| MA71241A MA71241A (en) | 2022-06-27 | 2023-06-26 | COMBINATIONS INVOLVING EPIDERMAL GROWTH FACTOR RECEPTOR TYROSINE KINASE INHIBITORS FOR THE TREATMENT OF CANCER |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202263367068P | 2022-06-27 | 2022-06-27 | |
| PCT/EP2023/067249 WO2024002938A1 (en) | 2022-06-27 | 2023-06-26 | Combinations involving epidermal growth factor receptor tyrosine kinase inhibitors for the treatment of cancer |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP4543920A1 true EP4543920A1 (en) | 2025-04-30 |
Family
ID=87074671
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP23736622.4A Pending EP4543920A1 (en) | 2022-06-27 | 2023-06-26 | Combinations involving epidermal growth factor receptor tyrosine kinase inhibitors for the treatment of cancer |
Country Status (10)
| Country | Link |
|---|---|
| EP (1) | EP4543920A1 (en) |
| JP (1) | JP2025525410A (en) |
| KR (1) | KR20250029133A (en) |
| CN (1) | CN119421895A (en) |
| AU (1) | AU2023300198A1 (en) |
| CA (1) | CA3259492A1 (en) |
| IL (1) | IL317733A (en) |
| MA (1) | MA71241A (en) |
| TW (1) | TW202417040A (en) |
| WO (1) | WO2024002938A1 (en) |
Family Cites Families (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPS61134325A (en) | 1984-12-04 | 1986-06-21 | Teijin Ltd | Expression of hybrid antibody gene |
| GB8607679D0 (en) | 1986-03-27 | 1986-04-30 | Winter G P | Recombinant dna product |
| DE69536015D1 (en) | 1995-03-30 | 2009-12-10 | Pfizer Prod Inc | Quinazolinone derivatives |
| GB9508538D0 (en) | 1995-04-27 | 1995-06-14 | Zeneca Ltd | Quinazoline derivatives |
| DE10063435A1 (en) | 2000-12-20 | 2002-07-04 | Boehringer Ingelheim Pharma | Chinazoline derivatives, pharmaceuticals containing these compounds, their use and process for their preparation |
| WO2004005326A2 (en) | 2002-07-09 | 2004-01-15 | Morphochem Aktiengellschaft Fu | Tubulysin conjugates |
| AP2204A (en) | 2004-05-06 | 2011-02-07 | Warner Lambert Co | 4-phenylamino-quinazolin-6-yl-amides. |
| ES2579805T3 (en) | 2004-09-23 | 2016-08-16 | Genentech, Inc. | Antibodies and conjugates engineered with cysteine |
| TW200902554A (en) | 2007-05-08 | 2009-01-16 | Genentech Inc | Cysteine engineered anti-MUC16 antibodies and antibody drug conjugates |
| AU2008312457B2 (en) | 2007-10-19 | 2014-04-17 | Genentech, Inc. | Cysteine engineered anti-TENB2 antibodies and antibody drug conjugates |
| MX2013001402A (en) | 2010-08-06 | 2013-08-29 | Endocyte Inc | Processes for preparing tubulysins. |
| MY161925A (en) | 2011-07-27 | 2017-05-15 | Astrazeneca Ab | 2 - (2, 4, 5 - substituted -anilino) pyrimidine derivatives as egfr modulators useful for treating cancer |
| ES2641953T3 (en) | 2011-10-31 | 2017-11-14 | Beta Pharmaceuticals Co., Ltd. | Methods of preparation of Icotinib and Icotinib hydrochloride, and intermediaries thereof |
| PT2794905T (en) | 2011-12-20 | 2020-06-30 | Medimmune Llc | Modified polypeptides for bispecific antibody scaffolds |
| US9034885B2 (en) | 2012-01-13 | 2015-05-19 | Acea Biosciences Inc. | EGFR modulators and uses thereof |
| MX362247B (en) | 2013-03-06 | 2019-01-09 | Astrazeneca Ab | Quinazoline inhibitors of activating mutant forms of epidermal growth factor receptor. |
| DK3035936T3 (en) | 2013-08-23 | 2019-06-11 | Neupharma Inc | CERTAIN CHEMICAL DEVICES, COMPOSITIONS AND METHODS |
| GB201400034D0 (en) | 2014-01-02 | 2014-02-19 | Astrazeneca Ab | Pharmaceutical Compositions comprising AZD9291 |
| UY36075A (en) | 2014-04-11 | 2015-10-30 | Medimmune Llc | TUBULISINE DERIVATIVES |
| JP6468611B2 (en) | 2014-05-13 | 2019-02-13 | アリアド ファーマシューティカルズ, インコーポレイテッド | Heteroaryl compounds for kinase inhibition |
| CN105315259B (en) | 2014-07-29 | 2018-03-09 | 上海艾力斯医药科技有限公司 | Pyridine amine pyrimidine derivates, its preparation method and application |
| PL3205650T3 (en) | 2014-10-11 | 2021-12-06 | Shanghai Hansoh Biomedical Co., Ltd. | Egfr inhibitor, and preparation and application thereof |
| NZ730012A (en) | 2014-10-13 | 2019-06-28 | Yuhan Corp | Compounds and compositions for modulating egfr mutant kinase activities |
| CN105085489B (en) | 2014-11-05 | 2019-03-01 | 益方生物科技(上海)有限公司 | Pyrimidine or pyridine compound, its preparation method and medical use |
| SG11201704685TA (en) | 2014-12-11 | 2017-07-28 | Beta Pharma Inc | Substituted 2-anilinopyrimidine derivatives as egfr modulators |
| US10494373B2 (en) | 2015-04-29 | 2019-12-03 | Guangdong Zhongsheng Pharmaceutical Co., Ltd | Fused-ring or tricyclic aryl pyrimidine compound used as kinase inhibitor |
| WO2023083846A1 (en) * | 2021-11-10 | 2023-05-19 | Astrazeneca Ab | Antibody molecules and conjugates |
-
2023
- 2023-06-26 IL IL317733A patent/IL317733A/en unknown
- 2023-06-26 MA MA71241A patent/MA71241A/en unknown
- 2023-06-26 CA CA3259492A patent/CA3259492A1/en active Pending
- 2023-06-26 TW TW112123734A patent/TW202417040A/en unknown
- 2023-06-26 JP JP2024576475A patent/JP2025525410A/en active Pending
- 2023-06-26 AU AU2023300198A patent/AU2023300198A1/en active Pending
- 2023-06-26 EP EP23736622.4A patent/EP4543920A1/en active Pending
- 2023-06-26 KR KR1020257001662A patent/KR20250029133A/en active Pending
- 2023-06-26 CN CN202380049828.3A patent/CN119421895A/en active Pending
- 2023-06-26 WO PCT/EP2023/067249 patent/WO2024002938A1/en not_active Ceased
Also Published As
| Publication number | Publication date |
|---|---|
| IL317733A (en) | 2025-02-01 |
| AU2023300198A1 (en) | 2025-02-13 |
| CA3259492A1 (en) | 2024-01-04 |
| MA71241A (en) | 2025-04-30 |
| TW202417040A (en) | 2024-05-01 |
| WO2024002938A1 (en) | 2024-01-04 |
| CN119421895A (en) | 2025-02-11 |
| JP2025525410A (en) | 2025-08-05 |
| KR20250029133A (en) | 2025-03-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2022384597B2 (en) | Antibody molecules and conjugates | |
| JP7118117B2 (en) | Selective method for producing antibody-drug conjugates | |
| US11584801B2 (en) | Anti-5T4 antibodies and antibody-drug conjugates | |
| RU2727663C2 (en) | Immunoconjugates, containing antibodies against her2 and pyrrolbenzodiazepines | |
| KR20240004708A (en) | Antibody-drug conjugate targeting nectin-4 and method and use thereof | |
| JP2024088757A (en) | Antibodies to PMEL17 and conjugates thereof | |
| EP4161581A1 (en) | Bispecific antibody-drug conjugates targeting egfr and muc1 and uses thereof | |
| AU2023300198A1 (en) | Combinations involving epidermal growth factor receptor tyrosine kinase inhibitors for the treatment of cancer | |
| JP7861115B2 (en) | Antibody molecules and complexes | |
| HK40086745A (en) | Method for selectively manufacturing antibody-drug conjugate |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20250127 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| RAV | Requested validation state of the european patent: fee paid |
Extension state: MA Effective date: 20250127 Extension state: TN Effective date: 20250127 |
|
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 40126792 Country of ref document: HK |