EP4460571A1 - Means and methods to increase abiotic stress tolerance in plants - Google Patents
Means and methods to increase abiotic stress tolerance in plantsInfo
- Publication number
- EP4460571A1 EP4460571A1 EP23705327.7A EP23705327A EP4460571A1 EP 4460571 A1 EP4460571 A1 EP 4460571A1 EP 23705327 A EP23705327 A EP 23705327A EP 4460571 A1 EP4460571 A1 EP 4460571A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- plant
- seq
- spp
- gene
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 238000000034 method Methods 0.000 title claims abstract description 49
- 230000036579 abiotic stress Effects 0.000 title claims abstract description 14
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 115
- 230000014509 gene expression Effects 0.000 claims abstract description 36
- 230000001965 increasing effect Effects 0.000 claims abstract description 7
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 29
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 29
- 229920001184 polypeptide Polymers 0.000 claims description 28
- 108091033319 polynucleotide Proteins 0.000 claims description 27
- 102000040430 polynucleotide Human genes 0.000 claims description 27
- 239000002157 polynucleotide Substances 0.000 claims description 27
- 244000038559 crop plants Species 0.000 claims description 3
- 230000008641 drought stress Effects 0.000 abstract description 13
- 230000003247 decreasing effect Effects 0.000 abstract description 2
- 241000196324 Embryophyta Species 0.000 description 89
- 102000004169 proteins and genes Human genes 0.000 description 53
- 240000008042 Zea mays Species 0.000 description 23
- 108020004414 DNA Proteins 0.000 description 21
- 108010033040 Histones Proteins 0.000 description 19
- 150000001413 amino acids Chemical class 0.000 description 18
- 230000009466 transformation Effects 0.000 description 18
- 230000012010 growth Effects 0.000 description 16
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 15
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 15
- 210000004027 cell Anatomy 0.000 description 15
- 235000010469 Glycine max Nutrition 0.000 description 14
- 244000068988 Glycine max Species 0.000 description 14
- 108010073062 Transcription Activator-Like Effectors Proteins 0.000 description 14
- 240000003768 Solanum lycopersicum Species 0.000 description 13
- 244000098338 Triticum aestivum Species 0.000 description 13
- 241000209510 Liliopsida Species 0.000 description 12
- 240000007594 Oryza sativa Species 0.000 description 11
- 235000007164 Oryza sativa Nutrition 0.000 description 11
- 230000000694 effects Effects 0.000 description 11
- 102000039446 nucleic acids Human genes 0.000 description 11
- 108020004707 nucleic acids Proteins 0.000 description 11
- 150000007523 nucleic acids Chemical class 0.000 description 11
- 210000001519 tissue Anatomy 0.000 description 11
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 10
- 244000061176 Nicotiana tabacum Species 0.000 description 10
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 10
- 101710185494 Zinc finger protein Proteins 0.000 description 10
- 102100023597 Zinc finger protein 816 Human genes 0.000 description 10
- 235000005822 corn Nutrition 0.000 description 10
- 235000007688 Lycopersicon esculentum Nutrition 0.000 description 9
- 230000027455 binding Effects 0.000 description 9
- 241001233957 eudicotyledons Species 0.000 description 9
- 239000002773 nucleotide Substances 0.000 description 9
- 125000003729 nucleotide group Chemical group 0.000 description 9
- 238000006467 substitution reaction Methods 0.000 description 9
- 230000009261 transgenic effect Effects 0.000 description 9
- 238000013519 translation Methods 0.000 description 9
- 238000013461 design Methods 0.000 description 8
- 241000219194 Arabidopsis Species 0.000 description 7
- 241000219195 Arabidopsis thaliana Species 0.000 description 7
- 235000007244 Zea mays Nutrition 0.000 description 7
- 231100000350 mutagenesis Toxicity 0.000 description 7
- 238000013518 transcription Methods 0.000 description 7
- 230000035897 transcription Effects 0.000 description 7
- 239000013598 vector Substances 0.000 description 7
- 229920000742 Cotton Polymers 0.000 description 6
- 241000219146 Gossypium Species 0.000 description 6
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 230000006735 deficit Effects 0.000 description 6
- 238000012217 deletion Methods 0.000 description 6
- 230000037430 deletion Effects 0.000 description 6
- 230000004048 modification Effects 0.000 description 6
- 238000012986 modification Methods 0.000 description 6
- 238000002703 mutagenesis Methods 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 235000009566 rice Nutrition 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 239000011701 zinc Substances 0.000 description 6
- 229910052725 zinc Inorganic materials 0.000 description 6
- 108020005004 Guide RNA Proteins 0.000 description 5
- 102000006947 Histones Human genes 0.000 description 5
- 235000002560 Solanum lycopersicum Nutrition 0.000 description 5
- 240000006394 Sorghum bicolor Species 0.000 description 5
- 235000007230 Sorghum bicolor Nutrition 0.000 description 5
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 5
- 230000002378 acidificating effect Effects 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 235000009973 maize Nutrition 0.000 description 5
- 210000002706 plastid Anatomy 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 238000012546 transfer Methods 0.000 description 5
- 108091026890 Coding region Proteins 0.000 description 4
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 4
- 244000299507 Gossypium hirsutum Species 0.000 description 4
- 235000009432 Gossypium hirsutum Nutrition 0.000 description 4
- 101710163270 Nuclease Proteins 0.000 description 4
- 238000003559 RNA-seq method Methods 0.000 description 4
- 235000021307 Triticum Nutrition 0.000 description 4
- 108010017070 Zinc Finger Nucleases Proteins 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 230000002068 genetic effect Effects 0.000 description 4
- 108020004999 messenger RNA Proteins 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 230000035772 mutation Effects 0.000 description 4
- 244000075850 Avena orientalis Species 0.000 description 3
- 102000053602 DNA Human genes 0.000 description 3
- 230000004568 DNA-binding Effects 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 230000008439 repair process Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 238000011426 transformation method Methods 0.000 description 3
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 2
- 241000589158 Agrobacterium Species 0.000 description 2
- 241000589155 Agrobacterium tumefaciens Species 0.000 description 2
- 235000007319 Avena orientalis Nutrition 0.000 description 2
- 240000002791 Brassica napus Species 0.000 description 2
- 235000006008 Brassica napus var napus Nutrition 0.000 description 2
- 240000008100 Brassica rapa Species 0.000 description 2
- 235000006618 Brassica rapa subsp oleifera Nutrition 0.000 description 2
- 238000010356 CRISPR-Cas9 genome editing Methods 0.000 description 2
- 238000010453 CRISPR/Cas method Methods 0.000 description 2
- 108700020911 DNA-Binding Proteins Proteins 0.000 description 2
- 101710096438 DNA-binding protein Proteins 0.000 description 2
- 244000127993 Elaeis melanococca Species 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 101150068625 H1L gene Proteins 0.000 description 2
- 101000687346 Homo sapiens PR domain zinc finger protein 2 Proteins 0.000 description 2
- 206010020649 Hyperkeratosis Diseases 0.000 description 2
- 241001230286 Narenga Species 0.000 description 2
- 102100024885 PR domain zinc finger protein 2 Human genes 0.000 description 2
- 108091028664 Ribonucleotide Proteins 0.000 description 2
- 235000011684 Sorghum saccharatum Nutrition 0.000 description 2
- 244000062793 Sorghum vulgare Species 0.000 description 2
- 238000010459 TALEN Methods 0.000 description 2
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- PTFCDOFLOPIGGS-UHFFFAOYSA-N Zinc dication Chemical compound [Zn+2] PTFCDOFLOPIGGS-UHFFFAOYSA-N 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 238000005422 blasting Methods 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 210000003763 chloroplast Anatomy 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 210000002257 embryonic structure Anatomy 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 230000008595 infiltration Effects 0.000 description 2
- 238000001764 infiltration Methods 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 230000000442 meristematic effect Effects 0.000 description 2
- 230000009456 molecular mechanism Effects 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 230000008635 plant growth Effects 0.000 description 2
- 230000001323 posttranslational effect Effects 0.000 description 2
- 230000004845 protein aggregation Effects 0.000 description 2
- 210000001938 protoplast Anatomy 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 239000002336 ribonucleotide Substances 0.000 description 2
- 125000002652 ribonucleotide group Chemical group 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 238000012225 targeting induced local lesions in genomes Methods 0.000 description 2
- 230000001052 transient effect Effects 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 241001075517 Abelmoschus Species 0.000 description 1
- 241000208140 Acer Species 0.000 description 1
- 241000219068 Actinidia Species 0.000 description 1
- 235000011624 Agave sisalana Nutrition 0.000 description 1
- 244000198134 Agave sisalana Species 0.000 description 1
- 241000209136 Agropyron Species 0.000 description 1
- 240000007241 Agrostis stolonifera Species 0.000 description 1
- 241000234282 Allium Species 0.000 description 1
- 241000219318 Amaranthus Species 0.000 description 1
- 241000380131 Ammophila arenaria Species 0.000 description 1
- 235000003840 Amygdalus nana Nutrition 0.000 description 1
- 244000296825 Amygdalus nana Species 0.000 description 1
- 244000099147 Ananas comosus Species 0.000 description 1
- 235000007119 Ananas comosus Nutrition 0.000 description 1
- 235000007755 Annona Nutrition 0.000 description 1
- 235000011518 Annona purpurea Nutrition 0.000 description 1
- 240000006199 Annona purpurea Species 0.000 description 1
- 235000002764 Apium graveolens Nutrition 0.000 description 1
- 240000007087 Apium graveolens Species 0.000 description 1
- 241001605719 Appias drusilla Species 0.000 description 1
- 101000768857 Arabidopsis thaliana 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic Proteins 0.000 description 1
- 101001047926 Arabidopsis thaliana Hydroxymethylglutaryl-CoA lyase, mitochondrial Proteins 0.000 description 1
- 235000003911 Arachis Nutrition 0.000 description 1
- 244000105624 Arachis hypogaea Species 0.000 description 1
- 244000018217 Artocarpus elasticus Species 0.000 description 1
- 235000005340 Asparagus officinalis Nutrition 0.000 description 1
- 235000005781 Avena Nutrition 0.000 description 1
- 235000009393 Avena byzantina Nutrition 0.000 description 1
- 235000007320 Avena fatua Nutrition 0.000 description 1
- 241000209764 Avena fatua Species 0.000 description 1
- 235000018410 Avena fatua var sativa Nutrition 0.000 description 1
- 235000009123 Avena hybrida Nutrition 0.000 description 1
- 240000000372 Avena hybrida Species 0.000 description 1
- 235000010082 Averrhoa carambola Nutrition 0.000 description 1
- 240000006063 Averrhoa carambola Species 0.000 description 1
- 241000209128 Bambusa Species 0.000 description 1
- 244000036905 Benincasa cerifera Species 0.000 description 1
- 235000011274 Benincasa cerifera Nutrition 0.000 description 1
- 241000219164 Bertholletia Species 0.000 description 1
- 235000021533 Beta vulgaris Nutrition 0.000 description 1
- 241000335053 Beta vulgaris Species 0.000 description 1
- 239000002028 Biomass Substances 0.000 description 1
- 235000004480 Bombax malabaricum Nutrition 0.000 description 1
- 235000011331 Brassica Nutrition 0.000 description 1
- 241000219198 Brassica Species 0.000 description 1
- 235000005637 Brassica campestris Nutrition 0.000 description 1
- 235000014698 Brassica juncea var multisecta Nutrition 0.000 description 1
- 235000011293 Brassica napus Nutrition 0.000 description 1
- 240000000385 Brassica napus var. napus Species 0.000 description 1
- 235000011292 Brassica rapa Nutrition 0.000 description 1
- 235000004977 Brassica sinapistrum Nutrition 0.000 description 1
- 235000008635 Cadaba farinosa Nutrition 0.000 description 1
- 241000628166 Cadaba farinosa Species 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 244000052707 Camellia sinensis Species 0.000 description 1
- 244000292211 Canna coccinea Species 0.000 description 1
- 235000005273 Canna coccinea Nutrition 0.000 description 1
- 235000008697 Cannabis sativa Nutrition 0.000 description 1
- 244000025254 Cannabis sativa Species 0.000 description 1
- 235000002566 Capsicum Nutrition 0.000 description 1
- 240000008574 Capsicum frutescens Species 0.000 description 1
- 241000973255 Carex elata Species 0.000 description 1
- 235000009467 Carica papaya Nutrition 0.000 description 1
- 240000006432 Carica papaya Species 0.000 description 1
- 240000004927 Carissa macrocarpa Species 0.000 description 1
- 235000001479 Carissa macrocarpa Nutrition 0.000 description 1
- 235000003255 Carthamus tinctorius Nutrition 0.000 description 1
- 244000020518 Carthamus tinctorius Species 0.000 description 1
- 241000723418 Carya Species 0.000 description 1
- 235000014036 Castanea Nutrition 0.000 description 1
- 241001070941 Castanea Species 0.000 description 1
- 244000146553 Ceiba pentandra Species 0.000 description 1
- 235000003301 Ceiba pentandra Nutrition 0.000 description 1
- 241001148660 Cenchrus sp. Species 0.000 description 1
- 240000006740 Cichorium endivia Species 0.000 description 1
- 235000018536 Cichorium endivia Nutrition 0.000 description 1
- 244000241235 Citrullus lanatus Species 0.000 description 1
- 235000009831 Citrullus lanatus Nutrition 0.000 description 1
- 241000207199 Citrus Species 0.000 description 1
- 241000737241 Cocos Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 241000723377 Coffea Species 0.000 description 1
- 244000228088 Cola acuminata Species 0.000 description 1
- 244000205754 Colocasia esculenta Species 0.000 description 1
- 235000006481 Colocasia esculenta Nutrition 0.000 description 1
- 235000007706 Corchorus sp Nutrition 0.000 description 1
- 235000002787 Coriandrum sativum Nutrition 0.000 description 1
- 244000018436 Coriandrum sativum Species 0.000 description 1
- 241000723382 Corylus Species 0.000 description 1
- 235000014493 Crataegus Nutrition 0.000 description 1
- 241001092040 Crataegus Species 0.000 description 1
- 235000015655 Crocus sativus Nutrition 0.000 description 1
- 244000124209 Crocus sativus Species 0.000 description 1
- 235000010071 Cucumis prophetarum Nutrition 0.000 description 1
- 244000024469 Cucumis prophetarum Species 0.000 description 1
- 241000219122 Cucurbita Species 0.000 description 1
- 235000003198 Cynara Nutrition 0.000 description 1
- 241000208947 Cynara Species 0.000 description 1
- 230000033616 DNA repair Effects 0.000 description 1
- 244000000626 Daucus carota Species 0.000 description 1
- 235000002767 Daucus carota Nutrition 0.000 description 1
- 241000522190 Desmodium Species 0.000 description 1
- 240000001008 Dimocarpus longan Species 0.000 description 1
- 235000000525 Dimocarpus longan Nutrition 0.000 description 1
- 235000005903 Dioscorea Nutrition 0.000 description 1
- 244000281702 Dioscorea villosa Species 0.000 description 1
- 235000000504 Dioscorea villosa Nutrition 0.000 description 1
- 235000011511 Diospyros Nutrition 0.000 description 1
- 241000723267 Diospyros Species 0.000 description 1
- 241001057636 Dracaena deremensis Species 0.000 description 1
- 241000192043 Echinochloa Species 0.000 description 1
- 235000001942 Elaeis Nutrition 0.000 description 1
- 241000512897 Elaeis Species 0.000 description 1
- 235000001950 Elaeis guineensis Nutrition 0.000 description 1
- 235000018060 Elaeis melanococca Nutrition 0.000 description 1
- 235000007349 Eleusine coracana Nutrition 0.000 description 1
- 244000078127 Eleusine coracana Species 0.000 description 1
- 102100031780 Endonuclease Human genes 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 235000014966 Eragrostis abyssinica Nutrition 0.000 description 1
- 244000140063 Eragrostis abyssinica Species 0.000 description 1
- 235000009008 Eriobotrya japonica Nutrition 0.000 description 1
- 244000061508 Eriobotrya japonica Species 0.000 description 1
- PLUBXMRUUVWRLT-UHFFFAOYSA-N Ethyl methanesulfonate Chemical compound CCOS(C)(=O)=O PLUBXMRUUVWRLT-UHFFFAOYSA-N 0.000 description 1
- 244000080545 Eucalyptus sp Species 0.000 description 1
- 235000006914 Eucalyptus sp Nutrition 0.000 description 1
- 235000013420 Eugenia uniflora Nutrition 0.000 description 1
- 240000003813 Eugenia uniflora Species 0.000 description 1
- 235000000235 Euphoria longan Nutrition 0.000 description 1
- 108091029865 Exogenous DNA Proteins 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 235000009419 Fagopyrum esculentum Nutrition 0.000 description 1
- 240000008620 Fagopyrum esculentum Species 0.000 description 1
- 241001070947 Fagus Species 0.000 description 1
- 241000234643 Festuca arundinacea Species 0.000 description 1
- 235000008730 Ficus carica Nutrition 0.000 description 1
- 244000025361 Ficus carica Species 0.000 description 1
- 235000017317 Fortunella Nutrition 0.000 description 1
- 241000220223 Fragaria Species 0.000 description 1
- 235000008100 Ginkgo biloba Nutrition 0.000 description 1
- 244000194101 Ginkgo biloba Species 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 241000208818 Helianthus Species 0.000 description 1
- 235000003222 Helianthus annuus Nutrition 0.000 description 1
- 244000020551 Helianthus annuus Species 0.000 description 1
- 235000002941 Hemerocallis fulva Nutrition 0.000 description 1
- 240000009206 Hemerocallis fulva Species 0.000 description 1
- 235000005206 Hibiscus Nutrition 0.000 description 1
- 235000007185 Hibiscus lunariifolius Nutrition 0.000 description 1
- 244000284380 Hibiscus rosa sinensis Species 0.000 description 1
- 241000209219 Hordeum Species 0.000 description 1
- 235000007340 Hordeum vulgare Nutrition 0.000 description 1
- 240000005979 Hordeum vulgare Species 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 244000017020 Ipomoea batatas Species 0.000 description 1
- 235000002678 Ipomoea batatas Nutrition 0.000 description 1
- 241000758789 Juglans Species 0.000 description 1
- 235000013757 Juglans Nutrition 0.000 description 1
- 235000003228 Lactuca sativa Nutrition 0.000 description 1
- 240000008415 Lactuca sativa Species 0.000 description 1
- 241000219729 Lathyrus Species 0.000 description 1
- 240000004322 Lens culinaris Species 0.000 description 1
- 235000010666 Lens esculenta Nutrition 0.000 description 1
- 235000004431 Linum usitatissimum Nutrition 0.000 description 1
- 240000006240 Linum usitatissimum Species 0.000 description 1
- 235000018780 Luffa acutangula Nutrition 0.000 description 1
- 244000280244 Luffa acutangula Species 0.000 description 1
- 241000219745 Lupinus Species 0.000 description 1
- 241000605547 Luzula sylvatica Species 0.000 description 1
- 241000227653 Lycopersicon Species 0.000 description 1
- 235000002262 Lycopersicon Nutrition 0.000 description 1
- 244000276497 Lycopersicon esculentum Species 0.000 description 1
- 241000219816 Macrotyloma Species 0.000 description 1
- 240000003394 Malpighia glabra Species 0.000 description 1
- 235000014837 Malpighia glabra Nutrition 0.000 description 1
- 241000220225 Malus Species 0.000 description 1
- 235000000889 Mammea americana Nutrition 0.000 description 1
- 240000005984 Mammea americana Species 0.000 description 1
- 235000014826 Mangifera indica Nutrition 0.000 description 1
- 240000007228 Mangifera indica Species 0.000 description 1
- 240000003183 Manihot esculenta Species 0.000 description 1
- 240000001794 Manilkara zapota Species 0.000 description 1
- 235000011339 Manilkara zapota Nutrition 0.000 description 1
- 235000010624 Medicago sativa Nutrition 0.000 description 1
- 240000004658 Medicago sativa Species 0.000 description 1
- 241000213996 Melilotus Species 0.000 description 1
- 235000014435 Mentha Nutrition 0.000 description 1
- 241001072983 Mentha Species 0.000 description 1
- 241000878006 Miscanthus sinensis Species 0.000 description 1
- 235000009815 Momordica Nutrition 0.000 description 1
- 241000218984 Momordica Species 0.000 description 1
- 240000000249 Morus alba Species 0.000 description 1
- 235000008708 Morus alba Nutrition 0.000 description 1
- 241000234295 Musa Species 0.000 description 1
- 235000006508 Nelumbo nucifera Nutrition 0.000 description 1
- 240000002853 Nelumbo nucifera Species 0.000 description 1
- 235000006510 Nelumbo pentapetala Nutrition 0.000 description 1
- 244000183278 Nephelium litchi Species 0.000 description 1
- 235000015742 Nephelium litchi Nutrition 0.000 description 1
- 241000208125 Nicotiana Species 0.000 description 1
- 108010077850 Nuclear Localization Signals Proteins 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 241000795633 Olea <sea slug> Species 0.000 description 1
- 240000001439 Opuntia Species 0.000 description 1
- 241001446528 Ornithopus Species 0.000 description 1
- 241000209094 Oryza Species 0.000 description 1
- 240000001516 Oryza latifolia Species 0.000 description 1
- 240000008114 Panicum miliaceum Species 0.000 description 1
- 235000007199 Panicum miliaceum Nutrition 0.000 description 1
- 241001520808 Panicum virgatum Species 0.000 description 1
- 235000000370 Passiflora edulis Nutrition 0.000 description 1
- 244000288157 Passiflora edulis Species 0.000 description 1
- 240000004370 Pastinaca sativa Species 0.000 description 1
- 235000002769 Pastinaca sativa Nutrition 0.000 description 1
- 108091093037 Peptide nucleic acid Proteins 0.000 description 1
- 241000218196 Persea Species 0.000 description 1
- 240000009164 Petroselinum crispum Species 0.000 description 1
- 235000002770 Petroselinum crispum Nutrition 0.000 description 1
- 244000081757 Phalaris arundinacea Species 0.000 description 1
- 241000219833 Phaseolus Species 0.000 description 1
- 241000746983 Phleum pratense Species 0.000 description 1
- 241000233805 Phoenix Species 0.000 description 1
- 244000273256 Phragmites communis Species 0.000 description 1
- 235000014676 Phragmites communis Nutrition 0.000 description 1
- 244000064622 Physalis edulis Species 0.000 description 1
- 235000003447 Pistacia vera Nutrition 0.000 description 1
- 240000006711 Pistacia vera Species 0.000 description 1
- 241000219843 Pisum Species 0.000 description 1
- 241000209048 Poa Species 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 241000219000 Populus Species 0.000 description 1
- 241001494501 Prosopis <angiosperm> Species 0.000 description 1
- 235000011432 Prunus Nutrition 0.000 description 1
- 241000508269 Psidium Species 0.000 description 1
- 244000294611 Punica granatum Species 0.000 description 1
- 235000014360 Punica granatum Nutrition 0.000 description 1
- 235000014443 Pyrus communis Nutrition 0.000 description 1
- 240000001987 Pyrus communis Species 0.000 description 1
- 241000219492 Quercus Species 0.000 description 1
- 108091030071 RNAI Proteins 0.000 description 1
- 235000019057 Raphanus caudatus Nutrition 0.000 description 1
- 244000088415 Raphanus sativus Species 0.000 description 1
- 235000011380 Raphanus sativus Nutrition 0.000 description 1
- 108700005075 Regulator Genes Proteins 0.000 description 1
- 108091081062 Repeated sequence (DNA) Proteins 0.000 description 1
- 235000009411 Rheum rhabarbarum Nutrition 0.000 description 1
- 244000193032 Rheum rhaponticum Species 0.000 description 1
- 235000011483 Ribes Nutrition 0.000 description 1
- 241000220483 Ribes Species 0.000 description 1
- 240000000528 Ricinus communis Species 0.000 description 1
- 235000004443 Ricinus communis Nutrition 0.000 description 1
- 241001092459 Rubus Species 0.000 description 1
- 241000921305 Salix sp. Species 0.000 description 1
- 241000208829 Sambucus Species 0.000 description 1
- 235000007238 Secale cereale Nutrition 0.000 description 1
- 244000082988 Secale cereale Species 0.000 description 1
- 241000228160 Secale cereale x Triticum aestivum Species 0.000 description 1
- 235000009367 Sesamum alatum Nutrition 0.000 description 1
- 240000000452 Sesamum alatum Species 0.000 description 1
- 235000003434 Sesamum indicum Nutrition 0.000 description 1
- 241000220261 Sinapis Species 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 235000002634 Solanum Nutrition 0.000 description 1
- 241000207763 Solanum Species 0.000 description 1
- 244000244100 Solanum integrifolium Species 0.000 description 1
- 235000000099 Solanum integrifolium Nutrition 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- 244000061456 Solanum tuberosum Species 0.000 description 1
- 241000219315 Spinacia Species 0.000 description 1
- 244000045719 Syzygium Species 0.000 description 1
- 235000012096 Syzygium samarangense Nutrition 0.000 description 1
- 235000012308 Tagetes Nutrition 0.000 description 1
- 241000736851 Tagetes Species 0.000 description 1
- 235000004298 Tamarindus indica Nutrition 0.000 description 1
- 240000004584 Tamarindus indica Species 0.000 description 1
- 235000006468 Thea sinensis Nutrition 0.000 description 1
- 244000299461 Theobroma cacao Species 0.000 description 1
- 235000009470 Theobroma cacao Nutrition 0.000 description 1
- 108091028113 Trans-activating crRNA Proteins 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 241000219793 Trifolium Species 0.000 description 1
- 235000007218 Tripsacum dactyloides Nutrition 0.000 description 1
- 244000082267 Tripsacum dactyloides Species 0.000 description 1
- 241000209140 Triticum Species 0.000 description 1
- 235000007264 Triticum durum Nutrition 0.000 description 1
- 235000002041 Triticum macha Nutrition 0.000 description 1
- 244000102426 Triticum macha Species 0.000 description 1
- 235000007251 Triticum monococcum Nutrition 0.000 description 1
- 240000000581 Triticum monococcum Species 0.000 description 1
- 235000007247 Triticum turgidum Nutrition 0.000 description 1
- 240000002805 Triticum turgidum Species 0.000 description 1
- 241000209143 Triticum turgidum subsp. durum Species 0.000 description 1
- 235000004424 Tropaeolum majus Nutrition 0.000 description 1
- 240000001260 Tropaeolum majus Species 0.000 description 1
- 235000018946 Tropaeolum minus Nutrition 0.000 description 1
- 240000008573 Tropaeolum minus Species 0.000 description 1
- 235000012511 Vaccinium Nutrition 0.000 description 1
- 241000736767 Vaccinium Species 0.000 description 1
- 241000219873 Vicia Species 0.000 description 1
- 241000219977 Vigna Species 0.000 description 1
- 240000009038 Viola odorata Species 0.000 description 1
- 235000013487 Viola odorata Nutrition 0.000 description 1
- 235000009392 Vitis Nutrition 0.000 description 1
- 241000219095 Vitis Species 0.000 description 1
- 241001478412 Zizania palustris Species 0.000 description 1
- 241001247821 Ziziphus Species 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 244000193174 agave Species 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 239000001387 apium graveolens Substances 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 239000001390 capsicum minimum Substances 0.000 description 1
- 108091092356 cellular DNA Proteins 0.000 description 1
- 235000013339 cereals Nutrition 0.000 description 1
- 230000010428 chromatin condensation Effects 0.000 description 1
- 239000001407 cinnamomum spp. Substances 0.000 description 1
- 235000020971 citrus fruits Nutrition 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000012272 crop production Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 230000009274 differential gene expression Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 235000004879 dioscorea Nutrition 0.000 description 1
- 235000013399 edible fruits Nutrition 0.000 description 1
- -1 electroporation Substances 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 235000008995 european elder Nutrition 0.000 description 1
- 239000000835 fiber Substances 0.000 description 1
- 235000004426 flaxseed Nutrition 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 239000004459 forage Substances 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 238000012246 gene addition Methods 0.000 description 1
- 238000003197 gene knockdown Methods 0.000 description 1
- 230000009368 gene silencing by RNA Effects 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 101150030475 impact gene Proteins 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 230000011890 leaf development Effects 0.000 description 1
- 235000021374 legumes Nutrition 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 235000005739 manihot Nutrition 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000005305 organ development Effects 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000001739 pinus spp. Substances 0.000 description 1
- 230000008121 plant development Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000001902 propagating effect Effects 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 235000014774 prunus Nutrition 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000025469 response to water deprivation Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 210000000614 rib Anatomy 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 230000035882 stress Effects 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000004114 suspension culture Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8273—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for drought, cold, salt resistance
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
Definitions
- the present invention belongs to the field of agricultural biology.
- the present invention relates to improved crops which have a gene disruption in a histonl like gene which results in crops being tolerant to abiotic stress.
- Abiotic stresses such as drought, high temperature, and salinity, affect plant growth and productivity. Furthermore, global climate change may increase the frequency and severity of abiotic stresses, suggesting that development of plants with improved stress tolerance is critical for future sustainable crop production. Accordingly, there is a need to generate crops which are more resistant to abiotic stress.
- LER and LED are anticorrelated in mild drought conditions in a selected panel of a corn B73xH99 recombinant inbred line (RIL) population.
- RIL recombinant inbred line
- H1L histone Hl variants
- FIG. 2 Heatmap of all histone genes. Heat map showing the Iog2 fold change (log2FC) of expression of all histone genes based on description from PLAZA (Van Bel M. et al 2018, Nucleic Acids Research, Volume 46, Issue DI, 4 January 2018, Pages D1190-D1196). Water deficit (WD)/well-watered (WW) values indicate ratios of gene expression under WD relative to WW conditions at four to seven days after leaf four appearance. Re-watering (RW)/WD and RW/RW values indicate ratios of gene expression under RW relative to WD and RW at five or seven days after leaf four appearance, respectively. Histones with an opposite expression pattern were marked with a green box. Heat maps were made using pheatmap (R package from CRAN). The number refers to the day after leaf 4 appearance.
- FIG. 3 Hl-LIKE protein with annotation of the linker histone domain (green) and the gRNAs used in the CRISPR constructs.
- Construct 1 contains HlL_gRNA_l and HlL_gRNA_2.
- Construct 2 contains HlL_gRNA_3 and HlL_gRNA_4.
- the protein length of H1L is 236 amino acids.
- hll homozygous hll mutant
- WT wildtype
- WD water deficit
- WW well-watered
- LER leaf elongation rate.
- Arabidopsis thaliana AT
- Glycine max Glyma
- Solanum lycopersicum Solyc
- Sorghum bicolor Sobic
- Hl variants Protein alignment of Hl variants in dicots and monocots.
- the linker domain of the Hl variants shows a high degree of conservation, whereas the N- and C-terminal domain is highly variable.
- Blast hits for AtHISTONE1.3 in Zea mays (extracted from NCBI). re 10: Blast hits for ZmHISTONEl-LIKE.
- Selected species Sorghum bicolor, Oryza sativa, Triticum aestivum, Arabidopsis thaliana, Solanum lycopersicum, Gossypium hirsutum, Nicotiana tabacum and Glycine max (extracted from NCBI).
- Blast hits for ZmHISTONEl Selected species: Sorghum bicolor, Oryza sativa, Triticum aestivum, Arabidopsis thaliana, Solanum lycopersicum, Gossypium hirsutum, Nicotiana tabacum and Glycine max (extracted from NCBI).
- red box linker histone domain
- blue box RKP(K/R)SAG motif
- yellow box (S/A)EE(K/R)K
- green box (A/V)RxKRA(R/K)(R/K) motif
- * identical or conserved in all sequences in the alignment
- : conserved substitutions
- . semi-conserved substitutions. Analysis was done using ClustalO.
- the invention provides plants which are tolerant to abiotic stress, particularly drought stress, more particularly mild drought stress.
- the plants of the invention do not suffer from a yield penalty when they are submitted to conditions of abiotic stress such as drought stress.
- the present invention provides plants which have a disruption in the genome of the histonllike (H1L) gene.
- the corn H1L polynucleotide sequence is depicted in SEQ ID NO: 21 and the corresponding encoded polypeptide sequence is depicted in SEQ ID NO: 1.
- the invention provides a plant having a gene disruption in a polynucleotide encoding for SEQ ID NO: 1 or having a gene disruption in a polynucleotide encoding a plant orthologous polypeptide sequence of SEQ ID NO: 1.
- a plant is a cultivated crop.
- a plant orthologous polypeptide sequence of SEQ ID NO: 1 comprises SEQ ID NO: 18, 19 and 20.
- plant orthologous polypeptide sequences of SEQ ID NO: 1 are depicted in SEQ ID NO: 1, 2, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 or 17.
- the invention provides a seed or a plant cell derived from a plant having a gene disruption in a polynucleotide encoding a histonllike protein.
- a method for increasing tolerance to abiotic stress in a plant comprising: disrupting the expression of a polynucleotide in the plant encoding a histonllike protein.
- plant yield generally refers to a measurable product from a plant, particularly a crop. Yield and yield increase (in comparison to a starting plant which does not have a gene disruption in a particular gene or wild-type plant) can be measured in a number of ways, and it is understood that a skilled person will be able to apply the correct meaning in view of the particular embodiments, the particular crop concerned and the specific purpose or application concerned.
- the terms “improved yield” or “increased yield” can be used interchangeable.
- the term “improved yield” or the term “increased yield” means any improvement in the yield of any measured plant product, such as grain, fruit, leaf, stem, root, or fiber.
- yield preservation refers to conditions wherein the yield of the plant is not reduced, for example under conditions of abiotic stress.
- the activity of a histonllike protein may be reduced or eliminated by disrupting the gene encoding the histonllike gene.
- the disruption inhibits expression or activity of histonllike protein compared to a corresponding control plant cell lacking the disruption.
- the endogenous histonllike gene comprises two or more endogenous histonllike genes.
- plants the endogenous histonllike gene comprises three or more endogenous histonllike genes.
- two or more endogenous histonllike genes or “three or more endogenous histonllike genes” refers to two or more or three or more homologs of histonllike but it is not excluded that two or more or three or more combinations of homologs of histonllike are disrupted (or their activity reduced).
- the disruption step comprises insertion of one or more transposons, where the one or more transposons are inserted into the endogenous histonllike gene.
- the disruption comprises one or more point mutations in the endogenous histonllike gene.
- the disruption can be a homozygous disruption in the histonllike gene.
- the disruption is a heterozygous disruption in the histonllike gene.
- there is more than one disruption which can include homozygous disruptions, heterozygous disruptions or a combination of homozygous disruptions and heterozygous disruptions.
- Detection of expression products is performed either qualitatively (by detecting presence or absence of one or more product of interest) or quantitatively (by monitoring the level of expression of one or more product of interest).
- the expression product is an RNA expression product.
- aspects of the invention optionally include monitoring an expression level of a nucleic acid, polypeptide as noted herein for detection of histonllike or measuring the amount of abiotic stress tolerance in a plant or in a population of plants.
- a polynucleotide (such as an antisense polynucleotide) is introduced into a plant that upon introduction or expression, inhibits the expression of a histonllike gene of the invention.
- an expression cassette capable of expressing a polynucleotide that inhibits the expression of a histonllike polypeptide is an expression cassette capable of producing an RNA molecule that inhibits the transcription and/or translation of a histonllike polypeptide of the invention.
- the "expression” or “production” of a protein or polypeptide from a DNA molecule refers to the transcription and translation of the coding sequence to produce the protein or polypeptide
- the "expression” or “production” of a protein or polypeptide from an RNA molecule refers to the translation of the RNA coding sequence to produce the protein or polypeptide.
- polynucleotide includes reference to a deoxyribopolynucleotide, ribopolynucleotide or analogs thereof that have the essential nature of a natural ribonucleotide in that they hybridize, under stringent hybridization conditions, to substantially the same nucleotide sequence as naturally occurring nucleotides and/or allow translation into the same amino acid(s) as the naturally occurring nucleotide(s).
- a polynucleotide can be full-length or a subsequence of a native or heterologous structural or regulatory gene. Unless otherwise indicated, the term includes reference to the specified sequence as well as the complementary sequence thereof.
- DNAs or RNAs with backbones modified for stability or for other reasons are "polynucleotides" as that term is intended herein.
- DNAs or RNAs comprising unusual bases, such as inosine, or modified bases, such as tritylated bases, to name just two examples are polynucleotides as the term is used herein. It will be appreciated that a great variety of modifications have been made to DNA and RNA that serve many useful purposes known to those of skill in the art.
- polynucleotide as it is employed herein embraces such chemically, enzymatically or metabolically modified forms of polynucleotides, as well as the chemical forms of DNA and RNA characteristic of viruses and cells, including inter alia, simple and complex cells.
- nucleic acid includes reference to a deoxyribonucleotide or ribonucleotide polymer in either single- or double-stranded form, and unless otherwise limited, encompasses known analogues having the essential nature of natural nucleotides in that they hybridize to single-stranded nucleic acids in a manner similar to naturally occurring nucleotides (e.g. peptide nucleic acids).
- encoding or “encoded,” with respect to a specified nucleic acid, is meant comprising the information for transcription into an RNA and in some embodiments, translation into the specified protein.
- a nucleic acid encoding a protein may comprise non-translated sequences (e.g., introns) within translated regions of the nucleic acid, or may lack such intervening non-translated sequences (e.g., as in cDNA).
- the information by which a protein is encoded is specified by the use of codons. Typical ly, the amino acid sequence is encoded by the nucleic acid using the "universal" genetic code.
- ZFNs Zinc Finger Nucleases
- TALENS Transcription Activator-Like Effector Nucleases
- CRISPR/Cas Clustered Regularly Interspaced Short Palindromic Repeats/CRISPR-associated nuclease with an engineered crRNA/tracr RNA
- U.S. Patent Publication No. 20080182332 describes use of non-canonical zinc finger nucleases (ZFNs) for targeted modification of plant genomes and U.S. Patent Publication No. 20090205083 describes ZFN-mediated targeted modification of a plant EPSPs genomic locus.
- ZFNs non-canonical zinc finger nucleases
- zinc fingers defines regions of amino acid sequence within a DNA binding protein binding domain whose structure is stabilized through coordination of a zinc ion.
- a “zinc finger DNA binding protein” (or binding domain) is a protein, or a domain within a larger protein, that binds DNA in a sequence-specific manner through one or more zinc fingers, which are regions of amino acid sequence within the binding domain whose structure is stabilized through coordination of a zinc ion.
- the term zinc finger DNA binding protein is often abbreviated as zinc finger protein or ZFP.
- Zinc finger binding domains can be "engineered” to bind to a predetermined nucleotide sequence.
- Nonlimiting examples of methods for engineering zinc finger proteins are design and selection.
- a designed zinc finger protein is a protein not occurring in nature whose design/composition results principally from rational criteria.
- Rational criteria for design include application of substitution rules and computerized algorithms for processing information in a database storing information of existing ZFP designs and binding data. See, for example, U.S. Pat. Nos. 6,140,081; 6,453,242; 6,534,261 and 6,794,136; see also WO 98/53058; WO 98/53059; WO 98/53060; WO 02/016536 and WO 03/016496.
- a "TALE DNA binding domain” or "TALE” is a polypeptide comprising one or more TALE repeat domains/units. The repeat domains are involved in binding of the TALE to its cognate target DNA sequence.
- a single “repeat unit” (also referred to as a “repeat”) is typically 33-35 amino acids in length and exhibits at least some sequence homology with other TALE repeat sequences within a naturally occurring TALE protein. See, e.g., U.S. Patent Publication No. 20110301073, incorporated by reference herein in its entirety.
- CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
- Cas CRISPR Associated nuclease system.
- a "CRISPR DNA binding domain" is a short stranded RNA molecule that acting in concert with the CAS enzyme can selectively recognize, bind, and cleave genomic DNA.
- the CRISPR/Cas system can be engineered to create a double-stranded break (DSB) at a desired target in a genome, and repair of the DSB can be influenced by the use of repair inhibitors to cause an increase in error prone repair. See, e.g., Jinek et al (2012) Science 337, p. 816-821, Jinek et al, (2013), eLife 2:e00471, and David Segal, (2013) eLife 2:e00563).
- Zinc finger, CRISPR and TALE binding domains can be "engineered” to bind to a predetermined nucleotide sequence, for example via engineering (altering one or more amino acids) of the recognition helix region of a naturally occurring zinc finger.
- TALEs can be “engineered” to bind to a predetermined nucleotide sequence, for example by engineering of the amino acids involved in DNA binding (the repeat variable diresidue or RVD region). Therefore, engineered DNA binding proteins (zinc fingers or TALEs) are proteins that are non-naturally occurring.
- Non-limiting examples of methods for engineering DNA-binding proteins are design and selection.
- a designed DNA binding protein is a protein not occurring in nature whose design/composition results principally from rational criteria.
- Rational criteria for design include application of substitution rules and computerized algorithms for processing information in a database storing information of existing ZFP and/or TALE designs and binding data. See, for example, U.S. Pat. Nos. 6,140,081; 6,453,242; and 6,534,261; see also WO 98/53058; WO 98/53059; WO 98/53060; WO 02/016536 and WO 03/016496 and U.S. Publication Nos. 20110301073, 20110239315 and 20119145940.
- a "selected" zinc finger protein, CRISPR or TALE is a protein not found in nature whose production results primarily from an empirical process such as phage display, interaction trap or hybrid selection. See e.g., U.S. Pat. No. 5,789,538; U.S. Pat. No. 5,925,523; U.S. Pat. No. 6,007,988; U.S. Pat. No. 6,013,453; U.S. Pat. No. 6,200,759; WO 95/19431; WO 96/06166; WO 98/53057; WO 98/54311; WO 00/27878; WO 01/60970 WO 01/88197 and WO 02/099084 and U.S. Publication Nos. 20110301073, 20110239315 and
- the polynucleotide encodes a zinc finger protein that binds to a gene encoding a histonllike polypeptide, resulting in reduced expression of the gene.
- the zinc finger protein binds to a regulatory region of a histonllike gene.
- the zinc finger protein binds to a messenger RNA encoding a histonllike polypeptide and prevents its translation.
- the TALE protein binds to a regulatory region of a histonllike gene.
- the TALE protein binds to a messenger RNA encoding a histonllike polypeptide and prevents its translation.
- Additional methods for decreasing or eliminating the expression of endogenous genes in plants are also known in the art and can be similarly applied to the instant invention. These methods include other forms of mutagenesis, such as ethyl methanesulfonate-induced mutagenesis, deletion mutagenesis and fast neutron deletion mutagenesis used in a reverse genetics sense (with PCR) to identify plant lines in which the endogenous gene has been deleted. For examples of these methods see, Ohshima, et al, (1998) Virology 243:472-481; Okubara, et al, (1994) Genetics 137:867-874 and Quesada, et al, (2000) Genetics 154:421-436, each of which is herein incorporated by reference.
- mutagenesis such as ethyl methanesulfonate-induced mutagenesis, deletion mutagenesis and fast neutron deletion mutagenesis used in a reverse genetics sense (with PCR) to identify plant lines in which the endogen
- a fast and automatable method for screening for chemically induced mutations TILLING (Targeting Induced Local Lesions in Genomes), using denaturing HPLC or selective endonuclease digestion of selected PCR products is also applicable to the instant invention.
- TILLING Targeting Induced Local Lesions in Genomes
- Mutations that impact gene expression or that interfere with the function of the encoded protein are well known in the art. Insertional mutations in gene exons usually result in null-mutants. Mutations in conserved residues are particularly effective in inhibiting the activity of the encoded protein. conserveed residues of plant histonllike polypeptides suitable for mutagenesis with the goal to eliminate histonllike activity have been described.
- single stranded DNA can be used to downregulate the expression of histonllike genes.
- Methods for gene suppression using ssDNA are e.g. described in W02011/112570.
- protein interference as described in the patent application W02007071789 can be used to downregulate a gene product.
- the latter technology is a knock-down technology which in contrast to RNAi acts at the post-translational level (i.e. it works directly on the protein level by inducing a specific protein aggregation of a chosen target). Protein aggregation is essentially a misfolding event which occurs through the formation of intermolecular beta-sheets resulting in a functional knockout of a selected target.
- the invention encompasses still additional methods for reducing or eliminating the activity of the histonllike polypeptide.
- methods for altering or mutating a genomic nucleotide sequence in a plant include, but are not limited to, the use of RNA:DNA vectors, RNA:DNA mutational vectors, RNA:DNA repair vectors, mixed-duplex oligonucleotides, self-complementary RNA:DNA oligonucleotides and recombinogenic oligonucleotide bases.
- Such vectors and methods of use are known in the art. See, for example, US5565350; US5731181; US5756325; US5760012; US5795972 and US5871984, each of which are herein incorporated by reference.
- expression means the transcription of a specific gene or specific genes or specific genetic construct.
- expression in particular means the transcription of a gene or genes or genetic construct into structural RNA (rRNA, tRNA) or mRNA with or without subsequent translation of the latter into a protein. The process includes transcription of DNA and processing of the resulting mRNA product.
- introduction or “transformation” as referred to herein encompass the transfer of an exogenous polynucleotide into a host cell, irrespective of the method used for transfer.
- Plant tissue capable of subsequent clonal propagation may be transformed with a genetic construct of the present invention and a whole plant regenerated there from.
- the particular tissue chosen will vary depending on the clonal propagation systems available for, and best suited to, the particular species being transformed.
- tissue targets include leaf disks, pollen, embryos, cotyledons, hypocotyls, mega-gametophytes, callus tissue, existing meristematic tissue (e.g., apical meristem, axillary buds, and root meristems), and induced meristem tissue (e.g., cotyledon meristem and hypocotyl meristem).
- the polynucleotide may be transiently or stably introduced into a host cell and may be maintained non-integrated, for example, as a plasmid. Alternatively, it may be integrated into the host genome.
- the resulting transformed plant cell may then be used to regenerate a transformed plant in a manner known to persons skilled in the art.
- Transformation of plant species is now a fairly routine technique.
- any of several transformation methods may be used to introduce the gene of interest into a suitable ancestor cell.
- the methods described for the transformation and regeneration of plants from plant tissues or plant cells may be utilized for transient or for stable transformation. Transformation methods include the use of liposomes, electroporation, chemicals that increase free DNA uptake, injection of the DNA directly into the plant, particle gun bombardment, transformation using viruses or pollen and microprojection. Methods may be selected from the calcium/polyethylene glycol method for protoplasts (Krens, F.A. et al., (1982) Nature 296, 72-74; Negrutiu I et al.
- Transgenic plants including transgenic crop plants, are preferably produced via Agrobacterium-mediated transformation.
- An advantageous transformation method is the transformation in planta.
- agrobacteria to act on plant seeds or to inoculate the plant meristem with agrobacteria. It has proved particularly expedient in accordance with the invention to allow a suspension of transformed agrobacteria to act on the intact plant or at least on the flower primordia. The plant is subsequently grown on until the seeds of the treated plant are obtained (Clough and Bent, Plant J. (1998) 16, 735-743).
- Methods for Agrobacterium-mediated transformation of rice include well known methods for rice transformation, such as those described in any of the following: European patent application EP1198985, Aldemita and Hodges (Planta 199: 612-617, 1996); Chan et al.
- nucleic acids or the construct to be expressed is preferably cloned into a vector, which is suitable for transforming Agrobacterium tumefaciens, for example pBinl9 (Bevan et al (1984) Nucl. Acids Res. 12-8711).
- Agrobacteria transformed by such a vector can then be used in known manner for the transformation of plants, such as plants used as a model, like Arabidopsis or crop plants such as, by way of example, tobacco plants, for example by immersing bruised leaves or chopped leaves in an agrobacterial solution and then culturing them in suitable media.
- plants used as a model like Arabidopsis or crop plants such as, by way of example, tobacco plants, for example by immersing bruised leaves or chopped leaves in an agrobacterial solution and then culturing them in suitable media.
- the transformation of plants by means of Agrobacterium tumefaciens is described, for example, by Hofgen and Willmitzer in Nucl. Acid Res. (1988) 16, 9877 or is known inter alia from F.F. White, Vectors for Gene Transfer in Higher Plants; in Transgenic Plants, Vol. 1 , Engineering and Utilization, eds. S.D. Kung and R. Wu, Academic Press, 1993, pp. 15-
- the transformation of the chloroplast genome is generally achieved by a process which has been schematically displayed in Klaus et al., 2004 [Nature Biotechnology 22 (2), 225-229], Briefly the sequences to be transformed are cloned together with a selectable marker gene between flanking sequences homologous to the chloroplast genome. These homologous flanking sequences direct site specific integration into the plastome. Plastidal transformation has been described for many different plant species and an overview is given in Bock (2001) Transgenic plastids in basic research and plant biotechnology. J Mol Biol. 2001 Sep 21; 312 (3):425-38 or Maliga, P (2003) Progress towards commercialization of plastid transformation technology. Trends Biotechnol. 21, 20-28. Further biotechnological progress has recently been reported in form of marker free plastid transformants, which can be produced by a transient co-integrated maker gene (Klaus et al., 2004, Nature Biotechnology 22(2), 225-229).
- plant as used herein encompasses whole plants, ancestors and progeny of the plants and plant parts, including seeds, shoots, stems, leaves, roots (including tubers), flowers, and tissues and organs, wherein each of the aforementioned comprise the gene/nucleic acid of interest.
- plant also encompasses plant cells, suspension cultures, callus tissue, embryos, meristematic regions, gametophytes, sporophytes, pollen and microspores, again wherein each of the aforementioned comprises the gene/nucleic acid of interest.
- Plants that are particularly useful in the methods of the invention include in particular monocotyledonous and dicotyledonous plants including fodder or forage legumes, ornamental plants, food crops, trees or shrubs selected from the list comprising Acer spp., Actinidia spp., Abelmoschus spp., Agave sisalana, Agropyron spp., Agrostis stolonifera, Allium spp., Amaranthus spp., Ammophila arenaria, Ananas comosus, Annona spp., Apium graveolens, Arachis spp, Artocarpus spp., Asparagus officinalis, Avena spp.
- Avena sativa e.g. Avena sativa, Avena fatua, Avena byzantina, Avena fatua var. sativa, Avena hybrida
- Averrhoa carambola e.g. Bambusa sp.
- Benincasa hispida Bertholletia excelsea
- Beta vulgaris Brassica spp.
- Brassica napus e.g. Brassica napus, Brassica rapa ssp.
- the plant cell according to the invention is non-propagating or cannot be regenerated into a plant.
- HISTONE1-LIKE H1L
- knock-out mutants were generated in the B104 inbred line using the CRISPR-Cas9 system.
- the polynucleotide sequence of the corn H1L gene is depicted in SEQ ID NO: 21 and this gene was knocked out.
- SEQ ID NO: 21 encodes for the polypeptide depicted in SEQ ID NO: 1.
- Two independent constructs were made, each containing two guide RNAs (gRNAs) that specifically target the linker histone domain of the H1L gene and have no off targets in other (linker histone) genes (see Figure 3).
- gRNAs guide RNAs
- HlL_gRNA_l AGCAGGAAGCCCAAGTCCGC (SEQ ID NO: 22)
- HlL_gRNA_2 GCCCAATTACCGCAAGGTGC (SEQ ID NO: 23)
- HlL_gRNA_3 CGATCCTGTCGCAGGACGGC (SEQ ID NO: 24)
- HlL_gRNA_4 GGCCAGCACCTTGCGGTAAT (SEQ ID NO: 25)
- hll plants tend to have larger leaves compared to their segregating WT siblings under drought stress. Even more, hll plants under drought have one to two leaves more compared to WT resulting in a lower yield penalty and a more vigorous growth under water deficit conditions. No significant differences were found between hll and WT seedlings under well-watered conditions.
- HISTONE1- LIKE subclade can be recognized as a distinct group of linker histones in monocots
- H1L is upregulated under drought and downregulated upon re-watering. Under drought, hll CRISPR mutants show a more vigorous growth compared to their WT siblings.
- Arabidopsis Arabidopsis (AtH1.3, AT2G18050 - polypeptide sequence depicted in SEQ ID NO: 3) and tomato (SIH1-S, Solyc02g084240.3)
- Hl variants that belong to the same subclade of H1L, have been shown to be induced upon drought stress (Rutowicz et al., 2015; Scippa et al., 2004).
- H1L has one close homolog, namely HISTONE1 (Hl) ( Figure 5).
- Hl and H1L are closely related, Hl is downregulated under drought and upregulated upon rewatering, suggesting an opposite role for Hl compared to H1L in response to drought (see Figure 6).
- Hl and H1L protein sequences of rice, wheat and maize in the Hl-subclade and the H1L- subclade were aligned, together with AtH1.3 (SEQ. ID NO: 3) (Arabidopsis) and SIH1-S (tomato) and other dicot orthologs in tobacco (Nitab), soya bean (Glyma) and cotton (Gohir) (see Figure 7).
- Linker histones typically have a tripartite structure which is composed of a conserved central globular domain flanked by a highly variable short N-terminal domain and a longer highly basic C-terminal domain.
- the N- and C-terminal domains are prone to post-translational modifications which can cause alterations in chromatin condensation, resulting in differential gene expression (Gibbs and Kriwacki, 2018).
- Hl variants can be divided into two groups according to the length of the N-terminal domain, the first group has a short N- terminal domain consisting of 8 to 9 AA, the second group has a longer N-domain ranging from 25 to 47 AA.
- Monocot proteins belonging to the Hl subclade have a basic N-terminal domain containing no acidic amino acid residues.
- dicot proteins and proteins belonging to the H1L subclade have a mix of acidic and basic AA residues, most of them being acidic.
- Hl Blasting the protein sequence of AtH1.3 at NCBI, yields Hl as a first hit in Zea mays (see Figure 9). If we blast the sequence of H1L and Hl in the species described above in the protein alignment (see figure 9), the ranking of the monocot proteins is identical to their divergence into H1L and Hl subclades. For example, blasting H1L gives Sobic.010G021300, TraesCS7A03G0150000 and 0s06g0130800 as best hits in Sorghum, wheat and rice, respectively (see Figure 10). For Hl, the best hits in Sorghum, wheat and rice are Sobic.006G186700, TraesCS2A03G0956900 and 0s04g0253000 (see Figure 11).
- Orthologous protein sequences of corn H1L of different monocotyledonous plants are depicted in SEQ I D NO: 2, 4, 5, 6, 7, 8 and 9. Alignment of monocot species belonging to the H1L subclade with the dicot proteins from tomato (Solyc02g084240.2), tobacco (Nitab4.5_0002880g0020, Nitab4.5_0005721g0020) and cotton (Gohir.AllG176800) that were found in the H1L blast, shows conserved substitutions in the RKP(K/R)SAG motif, in the N-terminal domain (see Figure 13).
- the RKP(K/R)SAG motif changes into a (K/R)KP(K/R)SA motif by conserved substitution of residues. This conserved motif is not found in cotton, Arabidopsis thaliana and Glycine max, nor in proteins belonging to the monocot Hl subclade.
- the (A/V)RxKRA(R/K)(R/K) motif shows a low degree of conservation whereas the (S/A)EE(K/R)K motif is conserved as a AGKKE motif by amino acid substitutions in tomato (Solyc02g084240.2), tobacco (Nitab4.5_0002880g0020, Nitab4.5_0005721g0020) and cotton (Gohir.AllG176800, Gohir.DllG184700).
- the AGKKE and the (S/A)EE(K/R)K motif were not found in monocot proteins belonging to the Hl subclade, nor in Arabidopsis thaliana, Glycine max and cotton (with the exception of Gohir.AllG176800, Gohir.DllG184700).
- Dicotyledonous orthologous protein sequences of corn H1L (SEQ ID NO: 1) are depicted in SEQ ID NO: 10-17.
- SEQ ID NO: 1 Zea mays polypeptide sequence of ZmHlL
- SEQ ID NO: 2 Zea mays polypeptide sequence of ZmHIL (orthologue of SEQ ID NO: 1)
- SEQ ID NO: 3 (Arabidopsis thaliana Hl.3 polypeptide, encoded from gene AT2G18050)
- SEQ ID NO: 4 (Sorghum bicolor, H1L orthologue of SEQ ID NO: 1, NCBI accession: OQU75744)
- SEQ ID NO: 5 (Oryza sativa, orthologue of SEQ ID NO: 1, NCBI accession: XP_015644353)
- SEQ ID NO: 6 (Triticum aestivum, orthologue of SEQ ID NO: 1, NCBI accession: KAF7093214)
- SEQ ID NO: 7 (Triticum aestivum, orthologue of SEQ ID NO: 1, NCBI accession: KAF7093216)
- SEQ ID NO: 8 (Triticum aestivum, orthologue of SEQ ID NO: 1, NCBI accession: KAF7045985)
- SEQ ID NO: 9 (Triticum aestivum, orthologue of SEQ ID NO: 1, NCBI accession: XP_044442749) MATVMAAAAPAMVGAGEEVKEAVAAPEKVEEVKEAVAAPEKVEEVKEAGAGEEVMEVAAGEAKEAGAGEEAME
- SEQ ID NO: 10 Solanum lycopersicum, orthologue of SEQ ID NO: 1, NCBI accession: NP_001234389
- SEQ ID NO: 11 Gossypium hirsutum, orthologue of SEQ ID NO: 1, NCBI accession: XP_040937395)
- SEQ ID NO: 12 (Nicotiana tabacum, orthologue of SEQ ID NO: 1, NCBI accession: AAN37904)
- SEQ ID NO: 13 (Glycine max, orthologue of SEQ ID NO: 1, NCBI accession: XP_003537627)
- SEQ ID NO: 14 (Glycine max, orthologue of SEQ ID NO: 1, NCBI accession: KAG5089416)
- SEQ ID NO: 15 (Glycine max, orthologue of SEQ ID NO: 1, NCBI accession: NP_001237870)
- SEQ ID NO: 17 (Glycine max, orthologue of SEQ ID NO: 1, NCBI accession: ACU15107)
- SEQ ID NO: 21 polynucleotide sequence encoding SEQ ID NO: 1
- Przewloka M. R., Wierzbicki, A. T., Slusarczyk, J., Kuras, M., Grasser, K. D., Stemmer, C., & Jerzmanowski, A. (2002).
- a specialized histone Hl variant is required for adaptive responses to complex abiotic stress and related DNA methylation in Arabidopsis. Plant Physiology, 169(3), 2080-2101.
- N-and C-terminal domains determine differential nucleosomal binding geometry and affinity of linker histone isotypes H10 and Hlc. Journal of Biological Chemistry, 287(15), 11778-11787.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Cell Biology (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
Abstract
The present invention relates to plants having a decreased expression of the Histon1like gene which result in an increased tolerance to abiotic stress, such as drought stress. The invention also provides methods which can be used to decrease the Histon1like gene expression.
Description
MEANS AND METHODS TO INCREASE ABIOTIC STRESS TOLERANCE IN PLANTS
Field of the invention
The present invention belongs to the field of agricultural biology. In particular the present invention relates to improved crops which have a gene disruption in a histonl like gene which results in crops being tolerant to abiotic stress.
Introduction to the invention
Abiotic stresses, such as drought, high temperature, and salinity, affect plant growth and productivity. Furthermore, global climate change may increase the frequency and severity of abiotic stresses, suggesting that development of plants with improved stress tolerance is critical for future sustainable crop production. Accordingly, there is a need to generate crops which are more resistant to abiotic stress. In the present invention we have studied the molecular mechanisms underlying the re-watering effects on LER and LED, by detailed analysis of the transcriptome (by application of the RNAseq technology) at different time points upon drought and re-watering in corn leaves. Two main determinants for maize leaf size are the maximal growth rate (leaf elongation rate; LER) and the duration of the growth period (leaf elongation duration; LED). We identified how changes in environmental conditions affect LER and LED by applying mild drought stress on corn. The mild drought stress lowers the maximal growth rate, but prolongs the duration of growth, suggesting that the latter compensates, at least in part, for the reduction in growth rate (see Figure 1). Furthermore, LER and LED are anticorrelated in mild drought conditions in a selected panel of a corn B73xH99 recombinant inbred line (RIL) population. The prolonged growth duration increased the possibility to resume growth upon alleviation of the drought. Depending on the growth phase of the leaf, upon re-watering, growth could be either fully restored by increasing the maximal growth rate or partially restored by prolonging the duration of growth. To investigate the molecular mechanisms underlying the re-watering effects on LER and LED, the transcriptome (analysed via RNAseq technology) of the most basal half centimeter (dividing cells) of the fourth leaf of RIL89 corn plants (Baute et al., 2015) was profiled at different time points upon drought and re-watering. From the RNAseq data, it became clear that growth recovery from mild drought conditions activates or represses specific gene sets depending on the timing of re-watering during leaf development. Maize plants re-watered at four days after leaf appearance (resulting in a restoration of the maximal LER) showed one day later an increase in histone gene expression (Hl; H2A; H2B; H3 and H4). The majority of these histone encoding genes were downregulated under drought, as was reported
previously in rice (Hu and Lai, 2015). However, remarkably we identified three histones which showed an opposite expression pattern (see Figure 2) including GRMZM2G069911 (sequence is depicted in SEQ ID NO: 21), HISTONE1-LIKE (abbreviated herein further as H1L), which encodes for the protein depicted in SEQ ID NO: 1. Also in Arabidopsis, tobacco, tomato and cotton, specialized histone Hl variants were previously identified which are induced by drought stress and ABA (Przewloka et al., 2002; Scippa et al., 2004; Trivedi et al., 2012; Rutowicz et al., 2015). However, the H1L identified in corn is not the predicted closest orthologue of the latter histone Hl variants (such as Histone 1.3 depicted in SEQ ID NO: 3), H1L is also about 70 amino acids longer than the reported histone sequences and H1L was only identified after careful analysis of the transcriptome changes during mild drought stress. Remarkably, we show that the knockout of this histon like gene (H1L) in corn leads to an enhanced tolerance to abiotic stress, such as drought stress.
Figure legends
Figure 1: Leaf elongation rate (LER) and duration (LED) of leaf 4 under drought and upon rewatering in the RIL89 recombinant inbred line. Depending on the time of rewatering, different compensation mechanisms are used by the plant to compensate for the growth penalty under drought conditions. To study the recovery mechanisms upon rewatering, plants were sampled at different time point for RNAseq analysis. Legend: WW = well-watered, WD = water deficit, R(e)W = rewatering, the number refers to the day after leaf 4 appearance.
Figure 2: Heatmap of all histone genes. Heat map showing the Iog2 fold change (log2FC) of expression of all histone genes based on description from PLAZA (Van Bel M. et al 2018, Nucleic Acids Research, Volume 46, Issue DI, 4 January 2018, Pages D1190-D1196). Water deficit (WD)/well-watered (WW) values indicate ratios of gene expression under WD relative to WW conditions at four to seven days after leaf four appearance. Re-watering (RW)/WD and RW/RW values indicate ratios of gene expression under RW relative to WD and RW at five or seven days after leaf four appearance, respectively. Histones with an opposite expression pattern were marked with a green box. Heat maps were made using pheatmap (R package from CRAN). The number refers to the day after leaf 4 appearance.
Figure 3: Hl-LIKE protein with annotation of the linker histone domain (green) and the gRNAs used in the CRISPR constructs. Construct 1 contains HlL_gRNA_l and HlL_gRNA_2. Construct 2 contains HlL_gRNA_3 and HlL_gRNA_4. The protein length of H1L is 236 amino acids.
re 4 hll CIRPSR mutants under mild drought conditions hll mutants suffer less from drought compared to their WT siblings, resulting in a more vigorous growth, higher biomass and a lower yield penalty. Legend: hll = homozygous hll mutant, WT = wildtype, WD = water deficit, WW = well-watered, LER = leaf elongation rate.
Phylogenetic tree of Hl variants. Phylogenetic tree was built on protein sequences from
Arabidopsis thaliana (AT), Glycine max (Glyma), Solanum lycopersicum (Solyc), Sorghum bicolor (Sobic),
Oryza sativa (Os) and Zea mays (Zm). According to the presence of Hl and H1L in maize, each subclade was named respectively.
Heatmap of Hl and H1L in maize (zoomed in from Figure 2). Legend: WD water deficit, WW
= well-watered, RW = rewatering, the number refers to the day after leaf 4 appearance.
Protein alignment of Hl variants in dicots and monocots. The linker domain of the Hl variants shows a high degree of conservation, whereas the N- and C-terminal domain is highly variable. re 8 Alignment of the N-terminal domain of Hl variants in dicots and monocots showing the polarity and charge of the amino acid residues. Residues are coloured according to polarity and charge: green = neutral, polar, black = neutral, nonpolar, red = acidic, polar, blue = basic, polar.
Blast hits for AtHISTONE1.3 in Zea mays (extracted from NCBI). re 10: Blast hits for ZmHISTONEl-LIKE. Selected species: Sorghum bicolor, Oryza sativa, Triticum aestivum, Arabidopsis thaliana, Solanum lycopersicum, Gossypium hirsutum, Nicotiana tabacum and Glycine max (extracted from NCBI).
Blast hits for ZmHISTONEl. Selected species: Sorghum bicolor, Oryza sativa, Triticum aestivum, Arabidopsis thaliana, Solanum lycopersicum, Gossypium hirsutum, Nicotiana tabacum and Glycine max (extracted from NCBI).
Conserved motifs in monocot proteins belonging the HISTONE1-LIKE subclade Legend: red box = linker histone domain, blue box = RKP(K/R)SAG motif, yellow box = (S/A)EE(K/R)K, green box = (A/V)RxKRA(R/K)(R/K) motif, * = identical or conserved in all sequences in the alignment, : = conserved substitutions, . = semi-conserved substitutions. Analysis was done using ClustalO.
Conserved motifs in selected dicot proteins and monocot proteins belonging the HISTONE1-
LIKE subclade. Legend: red box = linker histone domain, blue, green and yellow boxes represent motifs that are conserved between species: blue box = (K/R)KP(K/R)SA motif, yellow box = (S/A)(G/E)(K/E)(K/R)(K/E) motif, green box = (A/V)(R/G)xK(K/R)x(R/K)(R/K) motif, * = identical or
conserved in all sequences in the alignment, : = conserved substitutions, . = semi-conserved substitutions. In Nicotiana tabacum, the Nitab4.5_0002880g0020 protein is identical to Nitab4.5_0005721g0020. Analysis was done using ClustalO.
Detailed description of the invention
To facilitate the understanding of this invention a number of terms are defined below. Terms defined herein (unless otherwise specified) have meanings as commonly understood by a person of ordinary skill in the areas relevant to the present invention. As used in this specification and its appended claims, terms such as "a", "an" and "the" are not intended to refer to only a singular entity, but include the general class of which a specific example may be used for illustration, unless the context dictates otherwise. The terminology herein is used to describe specific embodiments of the invention, but their usage does not delimit the invention, except as outlined in the claims.
The invention provides plants which are tolerant to abiotic stress, particularly drought stress, more particularly mild drought stress. The plants of the invention do not suffer from a yield penalty when they are submitted to conditions of abiotic stress such as drought stress.
The present invention provides plants which have a disruption in the genome of the histonllike (H1L) gene. The corn H1L polynucleotide sequence is depicted in SEQ ID NO: 21 and the corresponding encoded polypeptide sequence is depicted in SEQ ID NO: 1.
Thus in a first embodiment the invention provides a plant having a gene disruption in a polynucleotide encoding for SEQ ID NO: 1 or having a gene disruption in a polynucleotide encoding a plant orthologous polypeptide sequence of SEQ ID NO: 1.
In a particular embodiment a plant is a cultivated crop.
In a particular embodiment a plant orthologous polypeptide sequence of SEQ ID NO: 1 comprises SEQ ID NO: 18, 19 and 20.
In yet another particular embodiment plant orthologous polypeptide sequences of SEQ ID NO: 1 are depicted in SEQ ID NO: 1, 2, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 or 17.
In another particular embodiment the invention provides a seed or a plant cell derived from a plant having a gene disruption in a polynucleotide encoding a histonllike protein.
A method for increasing tolerance to abiotic stress in a plant, the method comprising: disrupting the expression of a polynucleotide in the plant encoding a histonllike protein.
The term "plant yield" as used herein generally refers to a measurable product from a plant, particularly a crop. Yield and yield increase (in comparison to a starting plant which does not have a gene disruption in a particular gene or wild-type plant) can be measured in a number of ways, and it is understood that
a skilled person will be able to apply the correct meaning in view of the particular embodiments, the particular crop concerned and the specific purpose or application concerned. The terms "improved yield" or "increased yield" can be used interchangeable. As used herein, the term "improved yield" or the term "increased yield" means any improvement in the yield of any measured plant product, such as grain, fruit, leaf, stem, root, or fiber. The term "yield preservation" refers to conditions wherein the yield of the plant is not reduced, for example under conditions of abiotic stress.
Thus, the activity of a histonllike protein may be reduced or eliminated by disrupting the gene encoding the histonllike gene. The disruption inhibits expression or activity of histonllike protein compared to a corresponding control plant cell lacking the disruption. In one embodiment, the endogenous histonllike gene comprises two or more endogenous histonllike genes. Similarly, in another embodiment, in particular plants the endogenous histonllike gene comprises three or more endogenous histonllike genes. The wording "two or more endogenous histonllike genes" or "three or more endogenous histonllike genes" refers to two or more or three or more homologs of histonllike but it is not excluded that two or more or three or more combinations of homologs of histonllike are disrupted (or their activity reduced)..
In another embodiment, the disruption step comprises insertion of one or more transposons, where the one or more transposons are inserted into the endogenous histonllike gene. In yet another embodiment, the disruption comprises one or more point mutations in the endogenous histonllike gene. The disruption can be a homozygous disruption in the histonllike gene. Alternatively, the disruption is a heterozygous disruption in the histonllike gene. In certain embodiments, when more than one histonllike gene is involved, there is more than one disruption, which can include homozygous disruptions, heterozygous disruptions or a combination of homozygous disruptions and heterozygous disruptions.
Detection of expression products is performed either qualitatively (by detecting presence or absence of one or more product of interest) or quantitatively (by monitoring the level of expression of one or more product of interest). In one embodiment, the expression product is an RNA expression product. Aspects of the invention optionally include monitoring an expression level of a nucleic acid, polypeptide as noted herein for detection of histonllike or measuring the amount of abiotic stress tolerance in a plant or in a population of plants.
Thus, many methods may be used to reduce or eliminate the activity of a histonllike gene. More than one method may be used to reduce the activity of a single plant histonllike gene. In addition, combinations of methods may be employed to reduce or eliminate the activity of two or more different histonllike genes. Non-limiting examples of methods of reducing or eliminating the expression of a plant histonllike are given below.
In some embodiments of the present invention, a polynucleotide (such as an antisense polynucleotide) is introduced into a plant that upon introduction or expression, inhibits the expression of a histonllike gene of the invention. The term "expression" as used herein refers to the biosynthesis of a gene product, including the transcription and/or translation of said gene product. For example, for the purposes of the present invention, an expression cassette capable of expressing a polynucleotide that inhibits the expression of a histonllike polypeptide is an expression cassette capable of producing an RNA molecule that inhibits the transcription and/or translation of a histonllike polypeptide of the invention. The "expression" or "production" of a protein or polypeptide from a DNA molecule refers to the transcription and translation of the coding sequence to produce the protein or polypeptide, while the "expression" or "production" of a protein or polypeptide from an RNA molecule refers to the translation of the RNA coding sequence to produce the protein or polypeptide.
As used herein, "polynucleotide" includes reference to a deoxyribopolynucleotide, ribopolynucleotide or analogs thereof that have the essential nature of a natural ribonucleotide in that they hybridize, under stringent hybridization conditions, to substantially the same nucleotide sequence as naturally occurring nucleotides and/or allow translation into the same amino acid(s) as the naturally occurring nucleotide(s). A polynucleotide can be full-length or a subsequence of a native or heterologous structural or regulatory gene. Unless otherwise indicated, the term includes reference to the specified sequence as well as the complementary sequence thereof. Thus, DNAs or RNAs with backbones modified for stability or for other reasons are "polynucleotides" as that term is intended herein. Moreover, DNAs or RNAs comprising unusual bases, such as inosine, or modified bases, such as tritylated bases, to name just two examples, are polynucleotides as the term is used herein. It will be appreciated that a great variety of modifications have been made to DNA and RNA that serve many useful purposes known to those of skill in the art. The term polynucleotide as it is employed herein embraces such chemically, enzymatically or metabolically modified forms of polynucleotides, as well as the chemical forms of DNA and RNA characteristic of viruses and cells, including inter alia, simple and complex cells.
As used herein, "nucleic acid" includes reference to a deoxyribonucleotide or ribonucleotide polymer in either single- or double-stranded form, and unless otherwise limited, encompasses known analogues having the essential nature of natural nucleotides in that they hybridize to single-stranded nucleic acids in a manner similar to naturally occurring nucleotides (e.g. peptide nucleic acids).
By "encoding" or "encoded," with respect to a specified nucleic acid, is meant comprising the information for transcription into an RNA and in some embodiments, translation into the specified protein. A nucleic acid encoding a protein may comprise non-translated sequences (e.g., introns) within translated regions of the nucleic acid, or may lack such intervening non-translated sequences (e.g., as in cDNA). The
information by which a protein is encoded is specified by the use of codons. Typical ly, the amino acid sequence is encoded by the nucleic acid using the "universal" genetic code.
Significant advances have been made in the last few years towards development of methods and compositions to target and cleave genomic DNA by site specific nucleases (e.g., Zinc Finger Nucleases (ZFNs), Meganucleases, Transcription Activator-Like Effector Nucleases (TALENS) and Clustered Regularly Interspaced Short Palindromic Repeats/CRISPR-associated nuclease (CRISPR/Cas) with an engineered crRNA/tracr RNA), to induce targeted mutagenesis, induce targeted deletions of cellular DNA sequences, and facilitate targeted recombination of an exogenous donor DNA polynucleotide within a predetermined genomic locus. See, for example, U.S. Patent Publication No. 20030232410; 20050208489; 20050026157; 20050064474; and 20060188987, and International Patent Publication No. WO 2007/014275, the disclosures of which are incorporated by reference in their entireties for all purposes. U.S. Patent Publication No. 20080182332 describes use of non-canonical zinc finger nucleases (ZFNs) for targeted modification of plant genomes and U.S. Patent Publication No. 20090205083 describes ZFN-mediated targeted modification of a plant EPSPs genomic locus. Current methods for targeted insertion of exogenous DNA typically involve co-transformation of plant tissue with a donor DNA polynucleotide containing at least one transgene and a site specific nuclease (e.g., ZFN) which is designed to bind and cleave a specific genomic locus of an actively transcribed coding sequence. This causes the donor DNA polynucleotide to stably insert within the cleaved genomic locus resulting in targeted gene addition at a specified genomic locus comprising an actively transcribed coding sequence.
As used herein the term "zinc fingers," defines regions of amino acid sequence within a DNA binding protein binding domain whose structure is stabilized through coordination of a zinc ion.
A "zinc finger DNA binding protein" (or binding domain) is a protein, or a domain within a larger protein, that binds DNA in a sequence-specific manner through one or more zinc fingers, which are regions of amino acid sequence within the binding domain whose structure is stabilized through coordination of a zinc ion. The term zinc finger DNA binding protein is often abbreviated as zinc finger protein or ZFP. Zinc finger binding domains can be "engineered" to bind to a predetermined nucleotide sequence. Nonlimiting examples of methods for engineering zinc finger proteins are design and selection. A designed zinc finger protein is a protein not occurring in nature whose design/composition results principally from rational criteria. Rational criteria for design include application of substitution rules and computerized algorithms for processing information in a database storing information of existing ZFP designs and binding data. See, for example, U.S. Pat. Nos. 6,140,081; 6,453,242; 6,534,261 and 6,794,136; see also WO 98/53058; WO 98/53059; WO 98/53060; WO 02/016536 and WO 03/016496.
A "TALE DNA binding domain" or "TALE" is a polypeptide comprising one or more TALE repeat domains/units. The repeat domains are involved in binding of the TALE to its cognate target DNA sequence. A single "repeat unit" (also referred to as a "repeat") is typically 33-35 amino acids in length and exhibits at least some sequence homology with other TALE repeat sequences within a naturally occurring TALE protein. See, e.g., U.S. Patent Publication No. 20110301073, incorporated by reference herein in its entirety.
The CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats)/Cas (CRISPR Associated) nuclease system. Briefly, a "CRISPR DNA binding domain" is a short stranded RNA molecule that acting in concert with the CAS enzyme can selectively recognize, bind, and cleave genomic DNA. The CRISPR/Cas system can be engineered to create a double-stranded break (DSB) at a desired target in a genome, and repair of the DSB can be influenced by the use of repair inhibitors to cause an increase in error prone repair. See, e.g., Jinek et al (2012) Science 337, p. 816-821, Jinek et al, (2013), eLife 2:e00471, and David Segal, (2013) eLife 2:e00563).
Zinc finger, CRISPR and TALE binding domains can be "engineered" to bind to a predetermined nucleotide sequence, for example via engineering (altering one or more amino acids) of the recognition helix region of a naturally occurring zinc finger. Similarly, TALEs can be "engineered" to bind to a predetermined nucleotide sequence, for example by engineering of the amino acids involved in DNA binding (the repeat variable diresidue or RVD region). Therefore, engineered DNA binding proteins (zinc fingers or TALEs) are proteins that are non-naturally occurring. Non-limiting examples of methods for engineering DNA-binding proteins are design and selection. A designed DNA binding protein is a protein not occurring in nature whose design/composition results principally from rational criteria. Rational criteria for design include application of substitution rules and computerized algorithms for processing information in a database storing information of existing ZFP and/or TALE designs and binding data. See, for example, U.S. Pat. Nos. 6,140,081; 6,453,242; and 6,534,261; see also WO 98/53058; WO 98/53059; WO 98/53060; WO 02/016536 and WO 03/016496 and U.S. Publication Nos. 20110301073, 20110239315 and 20119145940.
A "selected" zinc finger protein, CRISPR or TALE is a protein not found in nature whose production results primarily from an empirical process such as phage display, interaction trap or hybrid selection. See e.g., U.S. Pat. No. 5,789,538; U.S. Pat. No. 5,925,523; U.S. Pat. No. 6,007,988; U.S. Pat. No. 6,013,453; U.S. Pat. No. 6,200,759; WO 95/19431; WO 96/06166; WO 98/53057; WO 98/54311; WO 00/27878; WO 01/60970 WO 01/88197 and WO 02/099084 and U.S. Publication Nos. 20110301073, 20110239315 and
20119145940.
In one embodiment, the polynucleotide encodes a zinc finger protein that binds to a gene encoding a histonllike polypeptide, resulting in reduced expression of the gene. In particular embodiments, the zinc finger protein binds to a regulatory region of a histonllike gene. In other embodiments, the zinc finger protein binds to a messenger RNA encoding a histonllike polypeptide and prevents its translation. Methods of selecting sites for targeting by zinc finger proteins have been described, for example, in US6453242, and methods for using zinc finger proteins to inhibit the expression of genes in plants are described, for example, in US2003/0037355, each of which is herein incorporated by reference.
In another embodiment, the polynucleotide encoded a TALE protein that binds to a gene encoding a histonllike polypeptide, resulting in reduced expression of the gene. In particular embodiments, the TALE protein binds to a regulatory region of a histonllike gene. In other embodiments, the TALE protein binds to a messenger RNA encoding a histonllike polypeptide and prevents its translation. Methods of selecting sites for targeting by zinc finger proteins have been described in e.g. Moscou MJ, Bogdanove AJ (2009) (A simple cipher governs DNA recognition by TAL effectors. Science 326:1501) and Morbitzer R, Romer P, Boch J, Lahaye T (2010) (Regulation of selected genome loci using de novo-engineered transcription activator-like effector (TALE)-type transcription factors. Proc Natl Acad Sci USA 107:21617- 21622).
Additional methods for decreasing or eliminating the expression of endogenous genes in plants are also known in the art and can be similarly applied to the instant invention. These methods include other forms of mutagenesis, such as ethyl methanesulfonate-induced mutagenesis, deletion mutagenesis and fast neutron deletion mutagenesis used in a reverse genetics sense (with PCR) to identify plant lines in which the endogenous gene has been deleted. For examples of these methods see, Ohshima, et al, (1998) Virology 243:472-481; Okubara, et al, (1994) Genetics 137:867-874 and Quesada, et al, (2000) Genetics 154:421-436, each of which is herein incorporated by reference. In addition, a fast and automatable method for screening for chemically induced mutations, TILLING (Targeting Induced Local Lesions in Genomes), using denaturing HPLC or selective endonuclease digestion of selected PCR products is also applicable to the instant invention. See, McCallum, et al, (2000) Nat. Biotechnol 18:455- 457, herein incorporated by reference. Mutations that impact gene expression or that interfere with the function of the encoded protein are well known in the art. Insertional mutations in gene exons usually result in null-mutants. Mutations in conserved residues are particularly effective in inhibiting the activity of the encoded protein. Conserved residues of plant histonllike polypeptides suitable for mutagenesis with the goal to eliminate histonllike activity have been described.
Also single stranded DNA can be used to downregulate the expression of histonllike genes. Methods for gene suppression using ssDNA are e.g. described in W02011/112570.
In yet another embodiment protein interference as described in the patent application W02007071789 (means and methods for mediating protein interference) can be used to downregulate a gene product. The latter technology is a knock-down technology which in contrast to RNAi acts at the post-translational level (i.e. it works directly on the protein level by inducing a specific protein aggregation of a chosen target). Protein aggregation is essentially a misfolding event which occurs through the formation of intermolecular beta-sheets resulting in a functional knockout of a selected target. Through the use of a dedicated algorithm it is possible to accurately predict which amino acidic stretches in a chosen target protein sequence have the highest self-associating tendency (Fernandez-Escamilla A. M. et al (2004) Nat Biotechnol 22(10): 1302-6. By expressing these specific peptides in the cells the protein of interest can be specifically targeted by inducing its irreversible aggregation and thus its functional knock-out.
In yet another embodiment the invention encompasses still additional methods for reducing or eliminating the activity of the histonllike polypeptide. Examples of other methods for altering or mutating a genomic nucleotide sequence in a plant are known in the art and include, but are not limited to, the use of RNA:DNA vectors, RNA:DNA mutational vectors, RNA:DNA repair vectors, mixed-duplex oligonucleotides, self-complementary RNA:DNA oligonucleotides and recombinogenic oligonucleotide bases. Such vectors and methods of use are known in the art. See, for example, US5565350; US5731181; US5756325; US5760012; US5795972 and US5871984, each of which are herein incorporated by reference.
The term "expression" or "gene expression" means the transcription of a specific gene or specific genes or specific genetic construct. The term "expression" or "gene expression" in particular means the transcription of a gene or genes or genetic construct into structural RNA (rRNA, tRNA) or mRNA with or without subsequent translation of the latter into a protein. The process includes transcription of DNA and processing of the resulting mRNA product.
The term "introduction" or "transformation" as referred to herein encompass the transfer of an exogenous polynucleotide into a host cell, irrespective of the method used for transfer. Plant tissue capable of subsequent clonal propagation, whether by organogenesis or embryogenesis, may be transformed with a genetic construct of the present invention and a whole plant regenerated there from. The particular tissue chosen will vary depending on the clonal propagation systems available for, and best suited to, the particular species being transformed. Exemplary tissue targets include leaf disks, pollen, embryos, cotyledons, hypocotyls, mega-gametophytes, callus tissue, existing meristematic tissue (e.g., apical meristem, axillary buds, and root meristems), and induced meristem tissue (e.g., cotyledon meristem and hypocotyl meristem). The polynucleotide may be transiently or stably introduced into a
host cell and may be maintained non-integrated, for example, as a plasmid. Alternatively, it may be integrated into the host genome. The resulting transformed plant cell may then be used to regenerate a transformed plant in a manner known to persons skilled in the art.
The transfer of foreign genes into the genome of a plant is called transformation. Transformation of plant species is now a fairly routine technique. Advantageously, any of several transformation methods may be used to introduce the gene of interest into a suitable ancestor cell. The methods described for the transformation and regeneration of plants from plant tissues or plant cells may be utilized for transient or for stable transformation. Transformation methods include the use of liposomes, electroporation, chemicals that increase free DNA uptake, injection of the DNA directly into the plant, particle gun bombardment, transformation using viruses or pollen and microprojection. Methods may be selected from the calcium/polyethylene glycol method for protoplasts (Krens, F.A. et al., (1982) Nature 296, 72-74; Negrutiu I et al. (1987) Plant Mol Biol 8: 363- 373); electroporation of protoplasts (Shillito R.D. et al. (1985) Bio/Technol 3, 1099-1 102); microinjection into plant material (Crossway A et al., (1986) Mol. Gen Genet 202: 179-185); DNA or RNA-coated particle bombardment (Klein TM et al., (1987) Nature 327: 70) infection with (non-integrative) viruses and the like. Transgenic plants, including transgenic crop plants, are preferably produced via Agrobacterium-mediated transformation. An advantageous transformation method is the transformation in planta. To this end, it is possible, for example, to allow the agrobacteria to act on plant seeds or to inoculate the plant meristem with agrobacteria. It has proved particularly expedient in accordance with the invention to allow a suspension of transformed agrobacteria to act on the intact plant or at least on the flower primordia. The plant is subsequently grown on until the seeds of the treated plant are obtained (Clough and Bent, Plant J. (1998) 16, 735-743). Methods for Agrobacterium-mediated transformation of rice include well known methods for rice transformation, such as those described in any of the following: European patent application EP1198985, Aldemita and Hodges (Planta 199: 612-617, 1996); Chan et al. (Plant Mol Biol 22 (3): 491 - 506, 1993), Hiei et al. (Plant J 6 (2): 271 -282, 1994), which disclosures are incorporated by reference herein as if fully set forth. In the case of corn transformation, the preferred method is as described in either Ishida et al. (Nat. Biotech. 14(6): 745-50, 1996) or Frame et al. (Plant Physiol 129(1): 13-22, 2002), which disclosures are incorporated by reference herein as if fully set forth. Said methods are further described by way of example in B. Jenes et al., Techniques for Gene Transfer, in: Transgenic Plants, Vol. 1 , Engineering and Utilization, eds. S.D. Kung and R. Wu, Academic Press (1993) 128-143 and in Potrykus Annu. Rev. Plant Physiol. Plant Mol. Biol. 42 (1991) 205-225). The nucleic acids or the construct to be expressed is preferably cloned into a vector, which is suitable for transforming Agrobacterium tumefaciens, for example pBinl9 (Bevan et al (1984) Nucl. Acids Res. 12-8711). Agrobacteria transformed
by such a vector can then be used in known manner for the transformation of plants, such as plants used as a model, like Arabidopsis or crop plants such as, by way of example, tobacco plants, for example by immersing bruised leaves or chopped leaves in an agrobacterial solution and then culturing them in suitable media. The transformation of plants by means of Agrobacterium tumefaciens is described, for example, by Hofgen and Willmitzer in Nucl. Acid Res. (1988) 16, 9877 or is known inter alia from F.F. White, Vectors for Gene Transfer in Higher Plants; in Transgenic Plants, Vol. 1 , Engineering and Utilization, eds. S.D. Kung and R. Wu, Academic Press, 1993, pp. 15-38.
In addition to the transformation of somatic cells, which then have to be regenerated into intact plants, it is also possible to transform the cells of plant meristems and in particular those cells which develop into gametes. In this case, the transformed gametes follow the natural plant development, giving rise to transgenic plants. Thus, for example, seeds of Arabidopsis are treated with agrobacteria and seeds are obtained from the developing plants of which a certain proportion is transformed and thus transgenic [Feldman, KA and Marks MD (1987). Mol Gen Genet 208:1 -9; Feldmann K (1992). In: C Koncz, N-H Chua and J Shell, eds, Methods in Arabidopsis Research. Word Scientific, Singapore, pp. 274-289], Alternative methods are based on the repeated removal of the inflorescences and incubation of the excision site in the center of the rosette with transformed agrobacteria, whereby transformed seeds can likewise be obtained at a later point in time (Chang (1994). Plant J. 5: 551 -558; Katavic (1994). Mol Gen Genet, 245: 363-370). However, an especially effective method is the vacuum infiltration method with its modifications such as the "floral dip" method. In the case of vacuum infiltration of Arabidopsis, intact plants under reduced pressure are treated with an agrobacterial suspension [Bechthold, N (1993). CR Acad Sci Paris Life Sci, 316: 1 194-1 199], while in the case of the "floral dip" method the developing floral tissue is incubated briefly with a surfactant-treated agrobacterial suspension [Clough, SJ and Bent AF (1998) The Plant J. 16, 735-743], A certain proportion of transgenic seeds are harvested in both cases, and these seeds can be distinguished from non-transgenic seeds by growing under the above-described selective conditions. In addition the stable transformation of plastids is of advantages because plastids are inherited maternally is most crops reducing or eliminating the risk of transgene flow through pollen. The transformation of the chloroplast genome is generally achieved by a process which has been schematically displayed in Klaus et al., 2004 [Nature Biotechnology 22 (2), 225-229], Briefly the sequences to be transformed are cloned together with a selectable marker gene between flanking sequences homologous to the chloroplast genome. These homologous flanking sequences direct site specific integration into the plastome. Plastidal transformation has been described for many different plant species and an overview is given in Bock (2001) Transgenic plastids in basic research and plant biotechnology. J Mol Biol. 2001 Sep 21; 312 (3):425-38 or Maliga, P (2003) Progress towards
commercialization of plastid transformation technology. Trends Biotechnol. 21, 20-28. Further biotechnological progress has recently been reported in form of marker free plastid transformants, which can be produced by a transient co-integrated maker gene (Klaus et al., 2004, Nature Biotechnology 22(2), 225-229).
The term "plant" as used herein encompasses whole plants, ancestors and progeny of the plants and plant parts, including seeds, shoots, stems, leaves, roots (including tubers), flowers, and tissues and organs, wherein each of the aforementioned comprise the gene/nucleic acid of interest. The term "plant" also encompasses plant cells, suspension cultures, callus tissue, embryos, meristematic regions, gametophytes, sporophytes, pollen and microspores, again wherein each of the aforementioned comprises the gene/nucleic acid of interest.
Plants that are particularly useful in the methods of the invention include in particular monocotyledonous and dicotyledonous plants including fodder or forage legumes, ornamental plants, food crops, trees or shrubs selected from the list comprising Acer spp., Actinidia spp., Abelmoschus spp., Agave sisalana, Agropyron spp., Agrostis stolonifera, Allium spp., Amaranthus spp., Ammophila arenaria, Ananas comosus, Annona spp., Apium graveolens, Arachis spp, Artocarpus spp., Asparagus officinalis, Avena spp. (e.g. Avena sativa, Avena fatua, Avena byzantina, Avena fatua var. sativa, Avena hybrida), Averrhoa carambola, Bambusa sp., Benincasa hispida, Bertholletia excelsea, Beta vulgaris, Brassica spp. (e.g. Brassica napus, Brassica rapa ssp. [canola, oilseed rape, turnip rape]), Cadaba farinosa, Camellia sinensis, Canna indica, Cannabis sativa, Capsicum spp., Carex elata, Carica papaya, Carissa macrocarpa, Carya spp., Carthamus tinctorius, Castanea spp., Ceiba pentandra, Cichorium endivia, Cinnamomum spp., Citrullus lanatus, Citrus spp., Cocos spp., Coffea spp., Colocasia esculenta, Cola spp., Corchorus sp., Coriandrum sativum, Corylus spp., Crataegus spp., Crocus sativus, Cucurbita spp., Cucumis spp., Cynara spp., Daucus carota, Desmodium spp., Dimocarpus longan, Dioscorea spp., Diospyros spp., Echinochloa spp., Elaeis (e.g. Elaeis guineensis, Elaeis oleifera), Eleusine coracana, Eragrostis tef, Erianthus sp., Eriobotrya japonica, Eucalyptus sp., Eugenia uniflora, Fagopyrum spp., Fagus spp., Festuca arundinacea, Ficus carica, Fortunella spp., Fragaria spp., Ginkgo biloba, Glycine spp. (e.g. Glycine max, Soja hispida or Soja max), Gossypium hirsutum, Helianthus spp. (e.g. Helianthus annuus), Hemerocallis fulva, Hibiscus spp., Hordeum spp. (e.g. Hordeum vulgare), Ipomoea batatas, Juglans spp., Lactuca sativa, Lathyrus spp., Lens culinaris, Linum usitatissimum, Litchi chinensis, Lotus spp., Luffa acutangula, Lupinus spp., Luzula sylvatica, Lycopersicon spp. (e.g. Lycopersicon esculentum, Lycopersicon lycopersicum, Lycopersicon pyriforme), Macrotyloma spp., Malus spp., Malpighia emarginata, Mammea americana, Mangifera indica, Manihot spp., Manilkara zapota, Medicago sativa, Melilotus spp., Mentha spp., Miscanthus sinensis, Momordica spp., Morus nigra, Musa spp., Nicotiana spp., Olea spp., Opuntia spp., Ornithopus
spp., Oryza spp. (e.g. Oryza sativa, Oryza latifolia), Panicum miliaceum, Panicum virgatum, Passiflora edulis, Pastinaca sativa, Pennisetum sp., Persea spp., Petroselinum crispum, Phalaris arundinacea, Phaseolus spp., Phleum pratense, Phoenix spp., Phragmites australis, Physalis spp., Pinus spp., Pistacia vera, Pisum spp., Poa spp., Populus spp., Prosopis spp., Prunus spp., Psidium spp., Punica granatum, Pyrus communis, Quercus spp., Raphanus sativus, Rheum rhabarbarum, Ribes spp., Ricinus communis, Rubus spp., Saccharum spp., Salix sp., Sambucus spp., Secale cereale, Sesamum spp., Sinapis sp., Solanum spp. (e.g. Solanum tuberosum, Solanum integrifolium or Solanum lycopersicum), Sorghum bicolor, Spinacia spp., Syzygium spp., Tagetes spp., Tamarindus indica, Theobroma cacao, Trifolium spp., Tripsacum dactyloides, Triticosecale rimpaui, Triticum spp. (e.g. Triticum aestivum, Triticum durum, Triticum turgidum, Triticum hybernum, Triticum macha, Triticum sativum, Triticum monococcum or Triticum vulgare), Tropaeolum minus, Tropaeolum majus, Vaccinium spp., Vicia spp., Vigna spp., Viola odorata, Vitis spp., Zea mays, Zizania palustris, Ziziphus spp., amongst others.
In some embodiments, the plant cell according to the invention is non-propagating or cannot be regenerated into a plant.
All publications and patent applications in this specification are indicative of the level of ordinary skill in the art to which this invention pertains. All publications and patent applications are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated by reference.
Many modifications and other embodiments of the inventions set forth herein will come to mind to one skilled in the art to which these inventions pertain having the benefit of the teachings presented in the foregoing descriptions and the associated drawings. Therefore, it is to be understood that the inventions are not to be limited to the specific embodiments disclosed and that modifications and other embodiments are intended to be included within the scope of the appended claims. Although specific terms are employed herein, they are used in a generic and descriptive sense only and not for purposes of limitation.
Examples l.Generation of HISTONE1-LIKE CRISPR-Cas9 mutants
To investigate the role of HISTONE1-LIKE (H1L) under drought conditions, knock-out mutants were generated in the B104 inbred line using the CRISPR-Cas9 system. The polynucleotide sequence of the corn H1L gene is depicted in SEQ ID NO: 21 and this gene was knocked out. SEQ ID NO: 21 encodes for the polypeptide depicted in SEQ ID NO: 1. Two independent constructs were made, each containing two
guide RNAs (gRNAs) that specifically target the linker histone domain of the H1L gene and have no off targets in other (linker histone) genes (see Figure 3). Several lines per construct were obtained in the TO generation. TO plants were backcrossed with WT B104 plants and selfed in the T1 generation to obtain a segregating T2 generation that is free of T-DNA. guide RNA sequences binding on the H1L polynucleotide (SEQ ID NO: 21) encoding SEQ ID NO: 1 are depicted in SEQ ID NO: 22-25
HlL_gRNA_l = AGCAGGAAGCCCAAGTCCGC (SEQ ID NO: 22)
HlL_gRNA_2 = GCCCAATTACCGCAAGGTGC (SEQ ID NO: 23)
HlL_gRNA_3 = CGATCCTGTCGCAGGACGGC (SEQ ID NO: 24)
HlL_gRNA_4 = GGCCAGCACCTTGCGGTAAT (SEQ ID NO: 25)
2.Histonel-like CRISPR mutants perform better under drought stress
To study the role of H1L in growth repression under drought, a mild drought stress experiment was set up using the automatic watering WIWAM-line. Plant growth was studied by daily measurements of leaf 4 of a segregating hll CRISPR T2 population under well-watered (WW) and mild drought (water deficit, WD) conditions. Two independent lines were chosen for this experiment, line Da (construct 1) and line C (construct 2). Both lines have a fragment deletion between the gRNAs, a -266 bp deletion for line Da and a -79 bp deletion for line C. Under mild drought, hll plants have a higher LER and a lower LED compared to WT plants (see Figure 4). Although no significant differences were found for final leaf 4 length, hll plants tend to have larger leaves compared to their segregating WT siblings under drought stress. Even more, hll plants under drought have one to two leaves more compared to WT resulting in a lower yield penalty and a more vigorous growth under water deficit conditions. No significant differences were found between hll and WT seedlings under well-watered conditions.
3.The HISTONE1- LIKE subclade can be recognized as a distinct group of linker histones in monocots
In the leaf 4 division zone, H1L is upregulated under drought and downregulated upon re-watering. Under drought, hll CRISPR mutants show a more vigorous growth compared to their WT siblings. In Arabidopsis (AtH1.3, AT2G18050 - polypeptide sequence depicted in SEQ ID NO: 3) and tomato (SIH1-S, Solyc02g084240.3), Hl variants that belong to the same subclade of H1L, have been shown to be induced upon drought stress (Rutowicz et al., 2015; Scippa et al., 2004). In maize, H1L has one close homolog, namely HISTONE1 (Hl) (Figure 5). Although Hl and H1L are closely related, Hl is downregulated under drought and upregulated upon rewatering, suggesting an opposite role for Hl compared to H1L in response to drought (see Figure 6).
To further investigate the opposite responses of Hl and H1L under drought and the divergence of Hl variants in monocots, protein sequences of rice, wheat and maize in the Hl-subclade and the H1L- subclade were aligned, together with AtH1.3 (SEQ. ID NO: 3) (Arabidopsis) and SIH1-S (tomato) and other dicot orthologs in tobacco (Nitab), soya bean (Glyma) and cotton (Gohir) (see Figure 7). Protein alignment of the dicot orthologs and the proteins belonging to the Hl and H1L subclade, reveal a high degree of conservation of the linker domain and a high variability in the N- and C-terminal domains. Linker histones typically have a tripartite structure which is composed of a conserved central globular domain flanked by a highly variable short N-terminal domain and a longer highly basic C-terminal domain. The N- and C-terminal domains are prone to post-translational modifications which can cause alterations in chromatin condensation, resulting in differential gene expression (Gibbs and Kriwacki, 2018). Most linker histones are known to have a N-terminal domain ranging from 20 to 35 amino acids (AA) (Vyas and Brown, 2012). Interestingly, the N-terminal domain of the proteins belonging to the H1L subclade, have an extremely long N-terminal domain, ranging from 67 to 113 AA (counted until the start of the linker histone domain). In contrast, the longest N-terminal domain in the Hl subclade consists of 36 AA (TraesCS2A03G0957600), suggesting that the heterogeneity in drought response among subclades/variants may arise because of the variability in their terminal domains. In dicots, Hl variants can be divided into two groups according to the length of the N-terminal domain, the first group has a short N- terminal domain consisting of 8 to 9 AA, the second group has a longer N-domain ranging from 25 to 47 AA. Visualizing the amino acids of the N-terminal domain according to polarity and charge, could predict which homologs might be similarly regulated post-translational since polarity and charge are of critical importance to the structure and function of proteins (see Figure 8) (Zhou and Pang, 2018). Monocot proteins belonging to the Hl subclade have a basic N-terminal domain containing no acidic amino acid residues. In contrast, dicot proteins and proteins belonging to the H1L subclade have a mix of acidic and basic AA residues, most of them being acidic.
Blasting the protein sequence of AtH1.3 at NCBI, yields Hl as a first hit in Zea mays (see Figure 9). If we blast the sequence of H1L and Hl in the species described above in the protein alignment (see figure 9), the ranking of the monocot proteins is identical to their divergence into H1L and Hl subclades. For example, blasting H1L gives Sobic.010G021300, TraesCS7A03G0150000 and 0s06g0130800 as best hits in Sorghum, wheat and rice, respectively (see Figure 10). For Hl, the best hits in Sorghum, wheat and rice are Sobic.006G186700, TraesCS2A03G0956900 and 0s04g0253000 (see Figure 11). In dicots, the divergence in Hl and H1L initially was more difficult. Based on the blast results for H1L, Solyc02g084240.2, Gohir.AllG176800, Nitab4.5_0002880g0020 and Nitab4.5_0005721g0020 give higher hits than the first Hl ortholog we encounter in the table, namely 0s04g0253000. Although these genes are also present in the blast results for Hl.
Based on best blast hits, proteins from the H1L subclade were aligned to search for conserved amino acid residues, using ClustalO (Figure 12). For monocot species belonging to the H1L subclade, conserved residues were found in the N- and C-terminal domain of the proteins. In the N-terminal domain, there is conservation of a KPR-motif, which presumably functions as a nuclear localization signal. Next to this motif there is a conserved RKP(K/R)SAG (SEQ ID NO: 18) motif which, according to a protein domain search using the SMART database, refers to an AT-hook motif that allows the protein to bind to AT rich sequences in the genome. In the C-terminal domain there is conservation of a (S/A)EE(K/R)K (SEQ ID NO: 19) and a (A/V)RxKRA(R/K)(R/K) (SEQ ID NO: 20) motif for which no function was found searching multiple databases. Orthologous protein sequences of corn H1L of different monocotyledonous plants are depicted in SEQ I D NO: 2, 4, 5, 6, 7, 8 and 9. Alignment of monocot species belonging to the H1L subclade with the dicot proteins from tomato (Solyc02g084240.2), tobacco (Nitab4.5_0002880g0020, Nitab4.5_0005721g0020) and cotton (Gohir.AllG176800) that were found in the H1L blast, shows conserved substitutions in the RKP(K/R)SAG motif, in the N-terminal domain (see Figure 13). In tomato and tobacco, the RKP(K/R)SAG motif changes into a (K/R)KP(K/R)SA motif by conserved substitution of residues. This conserved motif is not found in cotton, Arabidopsis thaliana and Glycine max, nor in proteins belonging to the monocot Hl subclade. The (A/V)RxKRA(R/K)(R/K) motif shows a low degree of conservation whereas the (S/A)EE(K/R)K motif is conserved as a AGKKE motif by amino acid substitutions in tomato (Solyc02g084240.2), tobacco (Nitab4.5_0002880g0020, Nitab4.5_0005721g0020) and cotton (Gohir.AllG176800, Gohir.DllG184700). The AGKKE and the (S/A)EE(K/R)K motif were not found in monocot proteins belonging to the Hl subclade, nor in Arabidopsis thaliana, Glycine max and cotton (with the exception of Gohir.AllG176800, Gohir.DllG184700). Dicotyledonous orthologous protein sequences of corn H1L (SEQ ID NO: 1) are depicted in SEQ ID NO: 10-17.
Sequences
SEQ ID NO: 1: Zea mays polypeptide sequence of ZmHlL
MATVTEEVAPVVTVSEEPAPEAAKEVVEKPEEGKKPDEEGDERKKADPAAEKEKKADPAAEKEKKARKPRSRKPKSAG LHHPPYFEMIKEAILSQDGGKVGASPYAIAKHMGEKHRDVLPPNYRKVLAVQLRGFAAKGRLVKVKASFKLAAAEERK PSAAAKAKKKASAGMAKRKRAAAPAKMKPAAAASAPSREARKVRAKRARKVAPAPAQPKPKPARAAASGAGKKVN KASA
SEQ ID NO: 2 : Zea mays polypeptide sequence of ZmHIL (orthologue of SEQ ID NO: 1)
MATVTEVAPVVTVSEEPAPEAAKEVVEKPEEGKKPDEEGDERKKADPAAEKEKKADPAAEKEKKARKPRSRKPKSAGL HHPPYFEVSKDAVVVVVVLSVTHPCLDSHSDDRSLCLLGTWGDRGQMIKEAILSQDGGKVGASPYAIAKHMGEKHR
DVLPPNYRKVLAVQLRGFAAKGRLVKVKASFKLAAAEERKPSAAAKAKKKASAGMAKRKRAAAPAKMKPAAAASAP SREARKVRAKRARKVAPAPAQPKPKPARAAASGAGKKVNKASA
SEQ ID NO: 3 (Arabidopsis thaliana Hl.3 polypeptide, encoded from gene AT2G18050)
MAEDKILKKTPAAKKPRKPKTTTHPPYFQMIKEALMVLKEKNGSSPYAIAKKIEEKHKSLLPESFRKTLSLQLKNSVAKGK
LVKIRASYKLSDTTKM ITRQQDKKNKKNMKQEDKEITKRTRSSSTRPKKTVSVNKQEKKRKVKKARQPKSIKSSVGKKK AMKASAA
SEQ ID NO: 4 (Sorghum bicolor, H1L orthologue of SEQ ID NO: 1, NCBI accession: OQU75744)
MATVTEEVAPAVAQEPAPEEAKGVMETPEKVEEGKKPEEGVEGKKAAAEKEKKARKPRSRKPKSAGPHHPPYFEM IK
EAILSQDVGKVGASPYAIAKHIGEKHRDVLPPNYRKVLAVQLRGFAAKGRLVKVKASFKLAASEEKKAAAASAAAKTKK
TPPAKRKRAAAPAKKKPAVAAAAPPREARKARAKRARKVAPAPVQPKPKAARAAAGGGGKKANKASA
SEQ ID NO: 5 (Oryza sativa, orthologue of SEQ ID NO: 1, NCBI accession: XP_015644353)
MATATEEVAAAAAAAGEAPPPPPPAVVEEAKEALEAPKPEEAPKAEEGEEKKAEGEKEKEKAKKERKPRARKPRSAGP
HHPPYFEM IKEAIMALDGNGKAGSSPYAIAKYMGEQHMGVLPANYRKVLAVQLRNFAAKGRLVKVKASFKLSAAEE
KKATAAKAARSKAAKGVVGGAKRKRTPRPSAAAAKKPASSAEAKKAVPPARPARAKRARKAAPAKPMQPPKSIRSAI SKKANKASA
SEQ ID NO: 6 (Triticum aestivum, orthologue of SEQ ID NO: 1, NCBI accession: KAF7093214)
MATVMEEAGAVVMGGTGEEEVVAAPEKVEEVKEAGAGGVDVEVAGGEAKKAEEEQGEQGKGTEKKPRRRKPRSA
GPHHPPYFEMIKEAIMAAGDGKAGASAYAIAIAKRVGERHGEALPGNYRKVLATQLRGFAAKGRLVQVKASFRLAPA EEKKALQAATPKSKKRTTTAKKTASKNVAPAPARAKRAKKANKASA
SEQ ID NO: 7 (Triticum aestivum, orthologue of SEQ ID NO: 1, NCBI accession: KAF7093216)
MATLTEEVAAAAVVGAGEKAEAVATPEKVDEVKEAGAGGEEMEVAGGEAKKAEEEQGEQGKETEKKPRSRKPRSA
GPHHPPYFEMIKEAIMAAGDGKAGASAYAIAKRVGERHGEALPGNYRKVLGAQLRGFAAKGRLVRVKASFRLAPAEE KKAAPKSKKRTATTKKAASKKAAPAPARQKRAKKAGPPTAKPKPKQPKSIRGRKANKASA
SEQ ID NO: 8 (Triticum aestivum, orthologue of SEQ ID NO: 1, NCBI accession: KAF7045985)
MATVMEEAAAKAVVGAGEKAEAVATPEKVDEVKQAGAGGEEMEVAGGEAKKAEEGGEVKKAEGEEKKPRSRKPR
SAGPHHPPYFEM IKEAIMAAGDGQAGASAYAIAKRVGERHGEALPGNYRKVLAAQLRSFAAKGRLVRVKASFRLAPA EEKKALPAKKRTTKKAASKKARPKRAKKAGPPPAKPKPKQPKSIRARKANKASA
SEQ ID NO: 9 (Triticum aestivum, orthologue of SEQ ID NO: 1, NCBI accession: XP_044442749)
MATVMAAAAPAMVGAGEEVKEAVAAPEKVEEVKEAVAAPEKVEEVKEAGAGEEVMEVAAGEAKEAGAGEEAME
VAGGEAKKAEEGGEVKKTEGGQGKGEEKKPRSRKPRSAGPHHPPYFEMIKEAIMAAGDGKAGASAYAIAKRVGERH
GEALPGNYRKVLAAQLRSFAAKGRLVRVKASFRLAPAEEKKALPAKKTTTNKAASKKARPKRAKRAGPPPAKPKPKQP KSIRARKANKASA
SEQ ID NO: 10 (Solanum lycopersicum, orthologue of SEQ ID NO: 1, NCBI accession: NP_001234389)
MTAIGEVENPAVVQRPTEASKVKEQASATEKAVKEKKPRAPKEKKPKSAKAVTHPPYFQM IKEALLSLNEKGGSSPYA
VAKYMEDKHKDELPANFRKILGLQLKNSAAKGKLIKIKASYKLSEAGKKETTTKTSTKKLPKADSKKKPRSTRATSTAAKK
TEVPKKAKATPKPKKVGAKRTRKSTPAKAKQPKSIKSPAAKRAKKIAV
SEQ ID NO: 11 (Gossypium hirsutum, orthologue of SEQ ID NO: 1, NCBI accession: XP_040937395)
MATAEPEVPVTEQQPAAAEEPKPAEKPVKEKRPRAPKEKKPKQPKSAAHPPYFQMIKEALLALKEKSGSSPYAIAKYM
EEKHKAVLPANFRKILGLQLKNSAARGKLIKIKASYKLSEAGKKERAPVTKAKM EKKAKPASKPKKAEATKKPTKRVGAK KKSTPAKPKQPKSIKSPAAKKAKKAAA
SEQ ID NO: 12 (Nicotiana tabacum, orthologue of SEQ ID NO: 1, NCBI accession: AAN37904)
MSATGKVESSAVEQPPAKAPKAEDQPPATKKSVKEKKPRAPREKKPKSAKTVTHPPYFQM IKEALLALNEKGGSSPYAI
AKYMEDKHKDELPANFRKILGLQLKNSAAKGKLMKIKASYKLSVAGKKERTTASTKKVPKADTKKKPRSTRSTTATAKK TEVAKKAKPTQKPKKVGAKKIRKSTPAKAKQPKSIKSPAAKRAKKVAA
SEQ ID NO: 13 (Glycine max, orthologue of SEQ ID NO: 1, NCBI accession: XP_003537627)
MSAAEEAKVPAVEKPVEEVKAPKLAKEKKPKAPKEKKPKQAKTASHPPYLQMIKDALIALNEKGGSSPYAIAKYM EEK
HKAVLPANFKKILGLQLKNQAARGKLVKIKASYKLAEAAKKVKESTAKATKESRPKRNKIATAVAPKKTEAVKKPAKKV GPKKTKKVSTPAKPKQPRSIRSPTKRARKAAVAAA
SEQ ID NO: 14 (Glycine max, orthologue of SEQ ID NO: 1, NCBI accession: KAG5089416)
MSAAAEEANAPAVEKPVEEVKAPNPAKEKKPKAPKEKKPKQAKTASHPPYFQM IKEALIALNEKGGSSPYAIAKYMEE
KHKAVLPANFKKILGLQLKNQAARGKLVKIKASYKLTEAAKKENTAKVTKANAEKKESRPKRSKTATAAAPKKTEAVKR
AAKKVVPKKTKKVSTPAKPKQPKSIRSPTKRARKAAVAAA
SEQ ID NO: 15 (Glycine max, orthologue of SEQ ID NO: 1, NCBI accession: NP_001237870)
MSAAAEEANAPAVEKPVEEVKAPNPAKEKKPKAPKEKKPKQAKTASHPPYFQM IKEALIALNEKGGSSPYAIAKYMEE
KHKAVLPANFKKILGLQLKNQAARGKLVKIKASYKLTEAAKKENTAKVTKANAEKKESRPKRSKTATAAAPKKTEAVKR
AAKKVGPKKTKKVSTPAKPKQPKSIRSPTKRARKAAVAAA
SEQ ID NO: 16 (Glycine max, orthologue of SEQ ID NO: 1, NCBI accession: KAG5069708)
MSAAAEEANAPAVEKPVEEVKAPKPAKEKKPKAPKEKKPKQAKTASHPPYFQM IKEALIALNEKGGSSPYAIAKYMEE
KHKAVLPANFKKILGLQLKNQAARGKLVKIKASYKLTEAAKKENTAKVTKANAEKKESRPKRSKAATAAAPKKTEAVKR
AAKKVGPKKTKKVSTPAKPKQPKSIRSPTKRARKAAVAAA
SEQ ID NO: 17 (Glycine max, orthologue of SEQ ID NO: 1, NCBI accession: ACU15107)
MSAAAEEANAPAVEKPVEEVKAPNPAKEKKPKAPKEKKPKQAKTASHPPYFQM IKEALIALNEKGGSSPYAIAKYMEE
KHKAVLPANFKKILGLQLKNQAARGKLVKIKASYKLTEAAKKENTAKVTKATAEKKESRPKRSKTATAAAPKKTEAVKR
AAKKVGPKKTKKVSTPAKPKQPKSISLQPRGPGKQPLLRLDTCLV
SEQ ID NO: 21: polynucleotide sequence encoding SEQ ID NO: 1
ZmHl-like (Zea mays)
Variety B104 - gene name Zm00007a00000971
ATGGCAACCGTAACTGAGGAAGTTGCTCCGGTCGTCACCGTCTCCGAGGAGCCGGCGCCGGAAGCGGCGAAGG
AGGTGGTGGAGAAGCCGGAGGAGGGGAAGAAGCCCGACGAGGAGGGTGACGAGAGGAAGAAGGCCGACCC
CGCCGCCGAGAAGGAGAAGAAGGCCGACCCCGCCGCCGAGAAGGAGAAGAAGGCGAGGAAGCCGCGGAGCA
GGAAGCCCAAGTCCGCCGGGCTGCACCACCCGCCCTATTTCGAGGTGAGCAAAGATGCCGTCGTCGTCGTCGTC
GTCTTGTCGGTTACTCATCCGTGCTTGGATTCTCATTCTGATGATCGGTCGCTGTGTCTGCTGGGGACCTGGGGT
GATCGAGGTCAGATGATCAAGGAGGCGATCCTGTCGCAGGACGGCGGGAAGGTCGGGGCGAGCCCGTACGCG
ATCGCCAAGCACATGGGGGAGAAGCACCGGGACGTGCTCCCGCCCAATTACCGCAAGGTGCTGGCCGTGCAGC
TGCGCGGCTTCGCCGCCAAGGGCCGCCTCGTCAAGGTCAAGGCCTCCTTCAAGCTCGCCGCCGCCGAGGAGAGG
AAGCCCTCCGCGGCCGCGAAGGCGAAGAAGAAGGCGTCGGCGGGAATGGCCAAGCGCAAGAGGGCCGCCGCG
CCGGCCAAGATGAAGCCGGCGGCCGCTGCCTCGGCGCCGTCGAGGGAGGCACGTAAGGTGCGCGCGAAGCGA
GCGAGGAAGGTGGCCCCGGCGCCCGCGCAGCCCAAGCCCAAGCCAGCCCGCGCCGCCGCTTCCGGTGCCGGCA
AGAAGGTCAACAAGGCCAGCGCCTGA
References
Baute, J., Herman, D., Coppens, F., De Block, J., Slabbinck, B., Dell'Acqua, M., ... & Inze, D. (2015). Correlation analysis of the transcriptome of growing leaves with mature leaf parameters in a maize RIL population. Genome biology, 16(1), 1-26.
Gibbs, E. B., & Kriwacki, R. W. (2018). Linker histones as liquid-like glue for chromatin. Proceedings of the National Academy of Sciences, 115(A7), 11868-11870.
Nelissen, H., Sun, X. H., Rymen, B., Jikumaru, Y., Kojima, M., Takebayashi, Y., ... & Inze, D. (2018). The reduction in maize leaf growth under mild drought affects the transition between cell division and cell expansion and cannot be restored by elevated gibberellic acid levels. Plant biotechnology journal, 16(2), 615-627.
Przewloka, M. R., Wierzbicki, A. T., Slusarczyk, J., Kuras, M., Grasser, K. D., Stemmer, C., & Jerzmanowski, A. (2002). The" drought-inducible" histone His of tobacco play no role in male sterility linked to alterations in Hl variants. Planta, 215(3), 371-379.
Rutowicz, K., Puzio, M., Halibart-Puzio, J., Lirski, M., Kotliriski, M., Kroteri, M. A., ... & Jerzmanowski, A. (2015). A specialized histone Hl variant is required for adaptive responses to complex abiotic stress and related DNA methylation in Arabidopsis. Plant Physiology, 169(3), 2080-2101.
Scippa, G. S., Di Michele, M., Onelli, E., Patrignani, G., Chiatante, D., & Bray, E. A. (2004). The histone-like protein Hl-S and the response of tomato leaves to water deficit. Journal of Experimental Botany, 55(394), 99-109.
Trivedi, I., Ranjan, A., Sharma, Y. K., & Sawant, S. (2012). The histone Hl variant accumulates in response to water stress in the drought tolerant genotype of Gossypium herbaceum L. The protein journal, 31(6), 477-486.
Vyas, P., & Brown, D. T. (2012). N-and C-terminal domains determine differential nucleosomal binding geometry and affinity of linker histone isotypes H10 and Hlc. Journal of Biological Chemistry, 287(15), 11778-11787.
Zhou, H. X., & Pang, X. (2018). Electrostatic interactions in protein structure, folding, binding, and condensation. Chemical reviews, 118(4), 1691-1741.
Claims
1. A plant having a gene disruption in a polynucleotide encoding for SEQ ID NO: 1 or having a gene disruption in a polynucleotide encoding a plant orthologous polypeptide sequence of SEQ ID NO: 1.
2. A plant according to claim 1 which is a cultivated crop plant.
3. A plant according to claims 1 or 2 wherein the plant orthologous polypeptide sequence comprises SEQ ID NO: 18, 19 and 20.
4. A plant according to any one of claims 1 to 3 wherein the plant orthologous polypeptide sequence is depicted in SEQ ID NO: 1, 2, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 or 17.
5. A seed or plant cell derived from a plant according to any one of claims 1 to 4.
6. A method for increasing tolerance to abiotic stress in a plant, the method comprising: disrupting the expression of a polynucleotide in the plant encoding SEQ ID NO: 1 or disrupting the expression of a polynucleotide encoding a plant orthologous sequence of SEQ ID NO: 1.
7. The method according to claim 6, wherein the polynucleotide encodes a polypeptide sequence comprising SEQ ID NO: 18, 19 and 20.
8. The method according to claims 6 or 7 wherein the polynucleotide encodes a polypeptide sequence depicted in SEQ ID NO: 1, 2, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 or 17.
22
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP22150288 | 2022-01-05 | ||
| PCT/EP2023/050097 WO2023131616A1 (en) | 2022-01-05 | 2023-01-04 | Means and methods to increase abiotic stress tolerance in plants |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP4460571A1 true EP4460571A1 (en) | 2024-11-13 |
Family
ID=80122242
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP23705327.7A Pending EP4460571A1 (en) | 2022-01-05 | 2023-01-04 | Means and methods to increase abiotic stress tolerance in plants |
Country Status (2)
| Country | Link |
|---|---|
| EP (1) | EP4460571A1 (en) |
| WO (1) | WO2023131616A1 (en) |
Family Cites Families (38)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1048254C (en) | 1993-12-09 | 2000-01-12 | 托马斯杰弗逊大学 | Compounds for introducing predetermined alterations into target genes |
| US6140466A (en) | 1994-01-18 | 2000-10-31 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
| EP0770129B1 (en) | 1994-01-18 | 2005-11-23 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
| GB9824544D0 (en) | 1998-11-09 | 1999-01-06 | Medical Res Council | Screening system |
| CA2196419C (en) | 1994-08-20 | 2007-08-21 | Yen Choo | Improvements in or relating to binding proteins for recognition of dna |
| US5789538A (en) | 1995-02-03 | 1998-08-04 | Massachusetts Institute Of Technology | Zinc finger proteins with high affinity new DNA binding specificities |
| US5760012A (en) | 1996-05-01 | 1998-06-02 | Thomas Jefferson University | Methods and compounds for curing diseases caused by mutations |
| US5731181A (en) | 1996-06-17 | 1998-03-24 | Thomas Jefferson University | Chimeric mutational vectors having non-natural nucleotides |
| US5925523A (en) | 1996-08-23 | 1999-07-20 | President & Fellows Of Harvard College | Intraction trap assay, reagents and uses thereof |
| GB9710807D0 (en) | 1997-05-23 | 1997-07-23 | Medical Res Council | Nucleic acid binding proteins |
| GB9710809D0 (en) | 1997-05-23 | 1997-07-23 | Medical Res Council | Nucleic acid binding proteins |
| US6140081A (en) | 1998-10-16 | 2000-10-31 | The Scripps Research Institute | Zinc finger binding domains for GNN |
| US6453242B1 (en) | 1999-01-12 | 2002-09-17 | Sangamo Biosciences, Inc. | Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites |
| US6534261B1 (en) | 1999-01-12 | 2003-03-18 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US6794136B1 (en) | 2000-11-20 | 2004-09-21 | Sangamo Biosciences, Inc. | Iterative optimization in the design of binding proteins |
| CN1279172C (en) | 1999-07-22 | 2006-10-11 | 独立行政法人农业生物资源研究所 | Method of transforming rice plants |
| US7151201B2 (en) | 2000-01-21 | 2006-12-19 | The Scripps Research Institute | Methods and compositions to modulate expression in plants |
| US20020061512A1 (en) | 2000-02-18 | 2002-05-23 | Kim Jin-Soo | Zinc finger domains and methods of identifying same |
| US20030044787A1 (en) | 2000-05-16 | 2003-03-06 | Joung J. Keith | Methods and compositions for interaction trap assays |
| JP2002060786A (en) | 2000-08-23 | 2002-02-26 | Kao Corp | Bactericidal antifouling agent for hard surfaces |
| GB0108491D0 (en) | 2001-04-04 | 2001-05-23 | Gendaq Ltd | Engineering zinc fingers |
| AU2002341541A1 (en) * | 2001-06-22 | 2003-03-03 | Syngenta Participations Ag | Abiotic stress responsive polynucleotides and polypeptides |
| WO2003016496A2 (en) | 2001-08-20 | 2003-02-27 | The Scripps Research Institute | Zinc finger binding domains for cnn |
| AU2003251286B2 (en) | 2002-01-23 | 2007-08-16 | The University Of Utah Research Foundation | Targeted chromosomal mutagenesis using zinc finger nucleases |
| US20030232410A1 (en) | 2002-03-21 | 2003-12-18 | Monika Liljedahl | Methods and compositions for using zinc finger endonucleases to enhance homologous recombination |
| JP2006502748A (en) | 2002-09-05 | 2006-01-26 | カリフォルニア インスティテュート オブ テクノロジー | Methods of using chimeric nucleases to induce gene targeting |
| US8409861B2 (en) | 2003-08-08 | 2013-04-02 | Sangamo Biosciences, Inc. | Targeted deletion of cellular DNA sequences |
| US7888121B2 (en) | 2003-08-08 | 2011-02-15 | Sangamo Biosciences, Inc. | Methods and compositions for targeted cleavage and recombination |
| US8344211B2 (en) * | 2008-08-13 | 2013-01-01 | Ceres, Inc. | Plant nucleotide sequences and corresponding polypeptides |
| WO2007014275A2 (en) | 2005-07-26 | 2007-02-01 | Sangamo Biosciences, Inc. | Targeted integration and expression of exogenous nucleic acid sequences |
| CA2632331C (en) | 2005-12-22 | 2015-02-10 | Vib Vzw | Molecules with a beta-aggregating region and their use in inducing protein aggregation |
| ES2586210T3 (en) | 2006-12-14 | 2016-10-13 | Sangamo Biosciences, Inc. | Optimized non-canon zinc finger proteins |
| US8399218B2 (en) | 2007-09-27 | 2013-03-19 | Dow Agrosciences, Llc | Engineered zinc finger proteins targeting 5-enolpyruvyl shikimate-3-phosphate synthase genes |
| US20110239315A1 (en) | 2009-01-12 | 2011-09-29 | Ulla Bonas | Modular dna-binding domains and methods of use |
| PE20130649A1 (en) | 2010-03-08 | 2013-07-13 | Monsanto Technology Llc | POLYNUCLEOTIDE MOLECULES FOR GENETIC REGULATION IN PLANTS |
| EP3156062A1 (en) | 2010-05-17 | 2017-04-19 | Sangamo BioSciences, Inc. | Novel dna-binding proteins and uses thereof |
| WO2014151749A1 (en) * | 2013-03-15 | 2014-09-25 | Pioneer Hi-Bred International, Inc. | Maize microrna sequences and targets thereof for agronomic traits |
| US10648951B2 (en) | 2017-11-14 | 2020-05-12 | Ge Sensing & Inspection Technologies Gmbh | Classification of ultrasonic indications using pattern recognition |
-
2023
- 2023-01-04 WO PCT/EP2023/050097 patent/WO2023131616A1/en not_active Ceased
- 2023-01-04 EP EP23705327.7A patent/EP4460571A1/en active Pending
Also Published As
| Publication number | Publication date |
|---|---|
| WO2023131616A1 (en) | 2023-07-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8350119B2 (en) | Transgenic plants comprising as transgene A class I TCP or Clavata 1 (CLV1) or CAH3 polypeptide having increased seed yield and a method for making the same | |
| EP2228386B1 (en) | Plants having enhanced yield-related traits and a method for making the same | |
| US8697947B2 (en) | Plants having increased yield-related traits and a method for making the same | |
| CN101258246B (en) | Enhancement of plant yield by Ste20-like gene expression | |
| US8440881B2 (en) | Plants having enhanced yield-related traits and a method for making the same | |
| CN103987848A (en) | Plants with enhanced yield-related traits and methods for their preparation | |
| US20140344996A1 (en) | Methods and means to produce abiotic stress tolerant plants | |
| CN103233037A (en) | Plants having enhanced yield-related traits and/or increased abiotic stress resistance, and a method for making the same | |
| CN104328137A (en) | Plants having enhanced abiotic stress tolerance and/or enhanced yield-related traits and a method for making the same | |
| CN105408485B (en) | Means and methods for producing performance in plants | |
| US20250179509A1 (en) | Native delivery of biomolecules into plant cells using ionic complexes with cell-penetrating peptides | |
| AU2006311005B2 (en) | Plants having improved growth characteristics and a method for making the same | |
| CN104099368A (en) | Plants having improved characteristics and a method for making the same | |
| CN102770545A (en) | Plants having enhanced yield-related traits and a method for making the same | |
| US8569576B2 (en) | Plants having enhanced yield-related traits and a method for making the same | |
| WO2023131616A1 (en) | Means and methods to increase abiotic stress tolerance in plants | |
| CN101356188A (en) | Plants having improved growth characteristics and methods for making the same | |
| EP2976429B1 (en) | Means and methods for the reduction of photorespiration in crops | |
| EP2371845A1 (en) | Plants having enhanced yield-related traits and a method for making the same | |
| MX2008006975A (en) | Plants having improved growth characteristics and methods for making the same |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20240722 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) |