EP4449017A1 - An energy transfer system, a method of manufacturing thereof, and a method of increasing a thermal stability of a working fluid therein - Google Patents
An energy transfer system, a method of manufacturing thereof, and a method of increasing a thermal stability of a working fluid thereinInfo
- Publication number
- EP4449017A1 EP4449017A1 EP22839760.0A EP22839760A EP4449017A1 EP 4449017 A1 EP4449017 A1 EP 4449017A1 EP 22839760 A EP22839760 A EP 22839760A EP 4449017 A1 EP4449017 A1 EP 4449017A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- energy transfer
- working fluid
- thermal
- coating layer
- transfer system
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Classifications
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F22—STEAM GENERATION
- F22B—METHODS OF STEAM GENERATION; STEAM BOILERS
- F22B37/00—Component parts or details of steam boilers
- F22B37/02—Component parts or details of steam boilers applicable to more than one kind or type of steam boiler
- F22B37/10—Water tubes; Accessories therefor
- F22B37/107—Protection of water tubes
- F22B37/108—Protection of water tube walls
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F28—HEAT EXCHANGE IN GENERAL
- F28F—DETAILS OF HEAT-EXCHANGE AND HEAT-TRANSFER APPARATUS, OF GENERAL APPLICATION
- F28F21/00—Constructions of heat-exchange apparatus characterised by the selection of particular materials
- F28F21/02—Constructions of heat-exchange apparatus characterised by the selection of particular materials of carbon, e.g. graphite
Definitions
- Theinvention relatestoanenergytransfersystem comprisinga thermalcircuitwithaworkingfluidconfiguredtoperform athermodynamiccycle and/oranenergytransferprocess.Furthermore,theinventionrelatestoamethod ofmanufacturinganenergytransfersystem.Additionally,theinventionrelatesto amethodofincreasingathermalstabilitylimittemperatureofaworkingfluidin anenergytransfersystem.
- thermodynamiccycles energytransfersystemsarewellknownandwidelyusedinvarious applications.
- aworkingfluid,possiblyincludingaheattransferfluid is usedinathermalcircuitconfiguredforcarryingoutathermodynamiccycleand/or anenergytransferprocess.
- variousthermalconversion systems make useoforganicfluidsasheattransfermedium orworkingfluidtorealizea thermodynamiccycle.
- theperformanceofanenergytransfersystemsisoftenlimited bythethermalstabilityoftheworkingfluid (e.g.organicfluid)theyadoptwhen characterizedbyrelativelyhigh operatingtemperatures.Moreparticularly,above acertaintemperaturethreshold,theorganicmoleculesmaystarttodecomposeby breakingdownintosmallercompoundsandthepropertiesoftheoriginalorganic fluidmaybelost.Thiscanresultinsignificantdropsintheperformanceofthe energytransfersystemsorevenitsfailureovertime.Additionally,such detrimentaleffectsmayalsoresultinanenvironmentalorsafetyhazard.
- the organiccompoundsresultingfrom thedecompositionprocess may,forexample,be toxicand/orleadtotheformationofasolidlayerwithinpipingandheat exchangers,whichreducesheattransferorevenclogstheflow passages.Inorder toeffectivelypreventthis,organicfluidshavealwaystobeoperatedat 2 temperatures below their
- the thermal stability of organic fluids currently employed in high temperatures applications does not exceed 400 - 425 °C for 5 stainless steel as containment material.
- the maximum operating temperature of thermal oils of industrial heaters and solar parabolic troughs may be at most 425 °C for stainless steel as containment material.
- the maximum temperature of state-of-the-art high-temperature ORC systems may be bound to the same limit.
- the fluids showing the best thermal stability, such as 10 benzene and toluene are, however, highly toxic and flammable.
- the maximum operating temperature of ORC units is in practice typically around 300 °C for stainless steel as containment material.
- the use of mixtures may increase the thermal stability of organic heat transfer media/working fluids.
- a blend of organic fluids may 15 exhibit, at the same temperature level, a lower decomposition rate than that of the single pure fluids of the mixture.
- the use of such mixtures may only allow a limited increase of the thermal stability limit temperature of a working fluid in an energy transfer system.
- the invention provides for an energy transfer system comprising a thermal circuit with a working fluid configured to perform a thermodynamic cycle and/or an energy transfer process, the thermal circuit comprising a piping system for conveying the working fluid, and at least one energy transfer device, wherein the energy transfer device is configured to transfer a portion of energy from one part of the thermal circuit to another part of the thermal circuit, and wherein at least a portion of the thermal circuit comprises a coating layer on surfaces in contact with the working fluid, wherein the coating layer includes an inert material that is inert with respect to the working fluid during operation and that maintains structural integrity at a temperature above 550 K, and wherein the inert material has, when in pure state/form, a thermal conductivity above 50 W/mK at room temperature.
- the thermal conductivity of the inert material in the pure state is above 500 W/mK at room temperature.
- the performance of the energy transfer system is often limited by the stability limit temperature of the working fluid.
- the temperature at which the working fluid can be used within the thermal circuit of the energy transfer system depends on its stability limit temperature.
- the temperature of the working fluid in the thermal circuit is kept below its thermal stability temperature in order to prevent detrimental effects such as fluid decomposition. In this way, the frequency in which the working fluid has to be replaced by new working fluid may be reduced. For example, a periodic replacement of the working fluid may be delayed, or even prevented.
- the present invention presents the advantage that due to the presence of the coating layer, the working fluid can be effectively used at higher temperatures in the vicinity of or above its thermal stability limit temperature, for instance, when used with stainless steel, in at least some parts of the thermal circuit in which the coating layer is provided at the contact surface between a solid material and the working fluid.
- the performance of the energy transfer system can be effectively increased.
- the working fluid is used at a temperature of at least 570 K.
- a more cost-effective solution can be obtained.
- the energy transfer system may require less maintenance.
- the coating layer may provide an inert surface in contact with the working fluid, resulting in a higher thermal stability for said working fluid.
- the material properties of the coating layer are selected such that the stability limit temperature of the working fluid can be increased. As a result, the design of the energy transfer system can be improved.
- the coating layer is provided for preventing deterioration and/or degradation of the working fluid at higher temperatures in the vicinity or above the thermal stability limit temperature when in contact with stainless steel in the thermal circuit.
- the coating layer may be a carbon based layer with a particular nanostructure which can effectively increase the stability of the working fluid at higher temperatures, in particular at temperatures above 570K.
- the coating layer is only applied on surfaces in contact with the working fluid at or approximate locations in the thermal circuit at which high temperature heat transfer occurs.
- the energy transfer system is configured to have the working fluid heated to a temperature above its thermal stability limit temperature for the material of the surface which is coated by the coating layer.
- the one or more surfaces being coated by the coating layer may be made of stainless steel.
- the energy transfer system may be configured to heat the working fluid to an increased temperature which is above its thermal stability limit temperature for stainless steel as uncoated containment material, in particular a temperature of at least 570K.
- the system can effectively increase the thermal stability limit of the working fluid.
- the piping system may include pipes, conduits, channels, holes and/or other components, such as reservoirs, pumps, etc. for conveying the working fluid.
- one or more (inner) surfaces of the piping system are coated with the inert material.
- the inert material has a damage temperature above 620 K, preferably above 670 K, even more preferably above 690 K.
- the damage temperature is the temperature at which the mechanical properties of the coating and its structural integrity start to degrade.
- the coating layer may be effectively used for increasing the thermal stability limit temperature of the working fluid in the thermal circuit of the energy transfer system. As a result, the achievable efficiency in the energy transfer system can be improved.
- the coating layer comprises silicon carbide as coating material.
- the coating material in a pure state/form
- the inert material when in a pure state/form, has a thermal conductivity above 1000 W/mK at room temperature.
- Such relatively high thermal conductivity of the inert material may be beneficial.
- the inert material in a pure state/form has a thermal conductivity in a range of 500 to 5000 W/mK, more preferably in a range of 1000 to 5000 W/mK at room temperature. It is preferred that the inert material has a high thermal conductivity.
- Such high thermal conductivity in combination with its inert properties can result in a higher thermal stability limit temperature of the working fluid, thereby enabling an enhancement of the performance and/or efficiency of the energy transfer system, without causing a decrease in the heat transfer properties of the heat transfer equipment.
- the inert material is graphene or contains graphene.
- the graphene coating layer has excellent properties for increasing the thermal stability of the working fluid. It can be used to locally increase the thermal stability of the working fluid in the thermal circuit, preferably at the higher temperature parts of said thermal circuit.
- the graphene coating layer may be applied locally on surfaces in contact with the working fluid near and/or inside the heat exchangers (e.g. at heat exchangers and approximate tubing).
- Graphene can enable a wide surface functional coating.
- a graphene coating layer is stable and is not consumed during operation due to its inert properties. Additionally, it has advantageous mechanical properties, such that breaking (cf. brittleness) can be prevented.
- the coating layer can retain its structural integrity for a relatively long period of time, even under harsh circumstances.
- graphene has excellent heat transfer properties and is a great thermal conductor. It can be used at high temperatures.
- the graphene coating layer may provide additional benefits, such as, smoothness of coating, non-stickiness of coating, anti-corrosive properties of coating, etc.
- the coating layer is applied locally only in one or more parts of the thermal circuit.
- the energy transfer system may have the coating layer around some or all of the components in the thermal circuit that are in direct contact with the working fluid. In some examples, only a subset of components in the thermal circuit are provided with the coating layer. Only parts of the thermal circuit where it is necessary to increase the thermal stability limit of the working fluid may be coated with the coating layer.
- the manufacturing costs may be significantly reduced.
- at least a subset of pipes of the piping system of the thermal circuit, where in contact with the working fluid, are coated with the coating layer.
- Graphene can have a very high thermal conductivity.
- lower conductivity graphene material may also be used.
- the actual thermal conductivity may depend on the coating thickness and the employed deposition process.
- the inert material in a pure state/form has a thermal conductivity in above that of a material of the surface on which it is applied.
- the inert material has a thermal stability above that of stainless steel.
- the heat transfer circuit of the energy transfer system comprises a first portion and a second portion, wherein the first portion is configured to convey the working fluid in a first temperature range, and wherein the second portion is configured to convey the working fluid in a second temperature range, wherein the first temperature range is below 550 K, preferably below 520 K, and wherein the second temperature range is above 570 K, preferably above 600 K, and wherein only surfaces in contact with working fluid in the second portion of the heat transfer circuit are coated with the coating layer.
- only parts of the thermal circuit are coated with the coating layer.
- the coating layer may be provided on surfaces in contact with the fluid being at higher temperatures.
- the higher temperature part where the coating may be applied includes the heat exchangers used to transfer the thermal energy from the thermal fluid (e.g. thermal oil) of the solar collectors to the power cycle, and the solar collector piping (e.g. made of stainless steel).
- the high temperature part that may be coated comprises the heat exchangers and the piping that goes to the turbine.
- at least a part of the surfaces of the turbine which are in contact with the working fluid can also be coated with the coating layer. It is not needed to coat the lower temperature parts of the thermal circuit, which can result in a more cost-effective solution. No coating may be provided on a power cycle side where the working fluid is steam.
- the coating may be applied in parts of the thermal circuit where it can be used for increasing the thermal stability of the working fluid(s).
- the second temperature range is between 570 K to 870 K, preferably 573 K to 870 K, more preferably 600 K to 820 K.
- the coating layer is only applied selectively in parts of the thermal circuit which require an increase of the thermal stability limit temperature of the working fluid.
- the lower temperature part of the thermal circuit may not require such coating, since the working fluid will not degrade and/or deteriorate at those temperatures.
- the coating layer forms a smooth surface, preferably having a thickness in a range of 1 to 2000 micrometer, more preferably in a range of 10 micrometer to 2000 micrometer, even more preferably in range of 15 micrometer to 1000 micrometer, most preferably in a range of 30 micrometer to 500 micrometer.
- the coating layer is formed by a plurality of layers applied on top of each other (cf. laminated layers).
- the coating layer may thus be a group of multiple layers of inert material.
- the coating layer is applied by spraying.
- a graphene coating may be applied over a surface by means of a spraying unit, such as for instance a spray gun.
- the graphene layer may provide sufficient stability under several thermal dilation cycles.
- the working fluid is non-corrosive.
- the fluid at higher temperatures in the thermal circuit e.g. above 300 degrees Celsius, for example above 400 degrees Celsius
- the working fluid in energy transfer systems are non-corrosive.
- working fluids in organic Rankine cycle systems, heat pumps, thermal oil baths, solar collectors may be non- corrosive with respect to the surfaces in contact with said working fluid.
- the working fluid is an organic liquid.
- a working fluid having to operate at temperatures below its thermal stability limit temperature may imply a limitation on the performance of the energy transfer system. This thermal stability limit temperature may be limited for organic fluids.
- the efficiency of ORC energy transfer systems may be a function of the maximum temperature of the thermodynamic cycle and/or the energy transfer process, in analogy with Carnot cycle efficiency.
- Preferred working fluids for heat transfer processes have a high heat capacity and a high boiling point to enable efficient heat transfer by an amount of fluid as small as possible, and to minimise the risk to vaporisation at high temperatures.
- the heat capacity denotes the amount of heat a working fluid can hold per unit change in its temperature.
- working fluids suitable for use with this invention include mineral oils, silicone-based fluids, natural organic hydrocarbons or synthetic organic hydrocarbons, organic blends, glycols, Other working fluids are also envisaged.
- the coating layer forms a smooth film with a surface roughness, for example in a range of about 0.1 micrometer to 5 micrometer.
- the coating layer may be a smooth surface providing limited flow resistance for the working fluid being guided in the thermal circuit.
- the heat transfer system is a thermal oil system, a geothermal loop or a concentrated solar collector system, or a thermal conversion system such as an organic Rankine cycle electrical generator, or a heat pump system.
- one or more surfaces coated with the coating layer are made of stainless steel.
- the thermal stability of the working fluid may be related to the material which the fluid is in contact with. The thermal stability limit temperature values are typically given for working fluids used with stainless steel as containment material.
- the method according to the invention provides for a cost-effective solution for obtaining a high thermal stability limit temperature.
- Stainless steel can be used which is coated by the coating layer for significantly increasing the thermal stability limit temperature.
- the coating layer provides an inert material in contact with the fluid thereby improving the thermal stability.
- the invention relates to a method of manufacturing an energy transfer system, the method comprising: providing a thermal circuit with a working fluid configured to perform a thermodynamic cycle and/or an energy transfer process, the thermal circuit provided with a piping system for conveying the working fluid and at least one energy transfer device, wherein the energy transfer device is configured to transfer a portion of energy from one part of the thermal circuit to another part of the thermal circuit; and providing at least a portion of the thermal circuit with a coating layer on surfaces in contact with the working fluid, wherein the coating layer includes inert material that is inert with respect to the working fluid during operation and which maintains structural integrity at a temperature above 550 K, and wherein the inert material in a pure state/form has a thermal conductivity above 50 W/mK at room temperature.
- the thermal conductivity is above 1000 W/mK at room temperature, preferably in a range of 1000 to 5000 W/mK at room temperature.
- the coating layer may effectively increase the thermal stability of the working fluid in the thermal circuit of the energy transfer system.
- the thermal stability may be influenced by the material with which the working fluid is in contact with.
- the solid material with which the working fluid is in contact with is stainless steel (e.g. parts of the devices, tubing, valves, etc.
- stainless steel is often used in Rankine cycle power application, solid collectors, etc. It has adequate properties and is relatively cheap.
- the commercially available working fluids are often heated to a maximum temperature of 440 degrees Celsius for retaining stability and/or prevent degradation (e.g. thermal decomposition, chemical reactions).
- the invention relates to a method of increasing a thermal stability limit temperature of a working fluid in an energy transfer system, the method including coating one or more surfaces in contact with the working fluid with a coating layer, wherein the coating layer includes an inert material which maintains structural integrity at a temperature above 550 K, and wherein the inert material in a pure state/form has a thermal conductivity above 50 W/mK at room temperature.
- the thermal conductivity is above 500 W/mK at room temperature, preferably above 1000 W/mK.
- the inert material in a pure state/form has a thermal conductivity in a range of 500 to 5000 W/mK at room temperature, preferably in a range of 1000 to 5000 W/mK at room temperature.
- the higher thermal stability that the coating layer (e.g. graphene coating layer) provides can effectively allow an increase in the maximum operating temperature in parts of the energy transfer system, such as to avoid detrimental effects such as decomposition and/or degradation of the working fluid.
- the maximum operating temperature of solar collectors, ORC systems, etc. can be increased in an efficient and cost-effective manner, thus leading to a significant increase in conversion efficiency of such energy transfer systems.
- the invention provides for a method of arranging the energy transfer system according to the disclosure. It will be appreciated that any of the aspects, features and options described in view of the system apply equally to the method of manufacturing and the described method of increasing a thermal stability limit temperature of a working fluid in an energy transfer system. It will also be clear that any one or more of the above aspects, features and options can be combined. BRIEF DESCRIPTION OF THE DRAWING The invention will further be elucidated on the basis of exemplary embodiments which are represented in a drawing. The exemplary embodiments are given by way of non-limitative illustration. It is noted that the figures are only schematic representations of embodiments of the invention that are given by way of non-limiting example. In the drawing: Fig.
- Fig. 1 shows a schematic diagram of an embodiment of an energy transfer system
- Fig. 2 shows a schematic diagram of an embodiment of an energy transfer system
- Fig. 3 shows a schematic diagram of an embodiment of an energy transfer system.
- DETAILED DESCRIPTION Fig. 1 shows a schematic diagram of an embodiment of an energy transfer system 1.
- the energy transfer system 1 comprises a thermal circuit 3 with a working fluid configured to perform a thermodynamic cycle and/or an energy transfer process
- the thermal circuit 3 comprises a piping system 5 for conveying the working fluid between components 7 in the thermal circuit 3.
- the thermal circuit 3 includes at least one energy transfer device, wherein the energy transfer device is configured to transfer a portion of energy from one part of the thermal circuit 3 to another part of the thermal circuit.
- the thermal circuit is arranged in a loop, wherein the working fluid is conveyed along the multiple components 5 and the piping system 5.
- At least a portion of the thermal circuit 3, for instance at least a portion of the piping system 5 and/or at least a portion of the components 5, comprises a coating layer on surfaces in contact with the working fluid, wherein the coating layer includes an inert material that is inert with respect to the working fluid during operation and that maintains structural integrity at a temperature above 550 K, and wherein the inert material in a pure state/form has a thermal conductivity above 50 W/mK at room temperature.
- the thermal conductivity is above 500 W/mK, preferably above 1000 W/mK at room temperature, preferably in a range of 1000 to 5000 W/mK at room temperature.
- the thermal stability limit temperature of the working fluid of the energy transfer system can be increased, and thereby the overall thermal efficiency of the energy transfer system can be effectively improved.
- the coating layer is inert and has good thermal properties (i.e. good thermal conductor).
- the coating layer can operate at relatively high temperatures, such as 570 K or more.
- graphene can be applied as a coating. The graphene coating layer does not become brittle at temperatures at which the heat exchangers are used.
- the mechanical properties of the graphene coating layer does not degrade at higher temperatures in parts of the thermal circuit.
- at least a portion of the contact surfaces in contact with the working fluid is coated with a graphene coating, which can permit using the energy transfer system at a higher temperature than hitherto possible. In this way, the performance of the energy transfer system can be significantly improved.
- the energy transfer system is an organic Rankine cycle (ORC) system.
- ORC organic Rankine cycle
- Such a system may be used for power production from low to medium temperature heat sources in the range of 80 to 350 °C and for small- medium power capacity applications at any temperature level.
- the ORC system may allow for exploitation of low-grade heat that otherwise would be wasted.
- Various other types of energy transfer systems may also be used.
- the energy transfer system may be a large scale solar power system.
- the maximum temperature in concentrated solar power plants adopting parabolic trough is bound to the thermal stability limit of the thermal oil used in the collectors.
- the power cycle of the plant is a steam power cycle, it results that the efficiency of the steam power cycle of these plants is about one-third lower than that of a state-of-the-art steam cycle.
- the system according to the disclosure provides a gain in the thermal stability of the working fluid and can then lead to an improvement in thermodynamic efficiency.
- the working fluid is non-corrosive. A non-corrosive working fluid may not result in a corrosion problem within the thermal circuit 3.
- the energy transfer system 1 is a thermal conversion system.
- FIG. 2 shows a schematic diagram of an embodiment of an energy transfer system 1.
- the energy transfer system 1 is an organic Rankine cycle (ORC) system.
- the ORC system 1 uses an organic, fluid with a molecular weight higher than steam.
- the organic fluid allows heat to be recovered from lower temperature heat sources than conventional water-steam cycles.
- the low temperature heat can be converted into useful work, which is further converted into electricity by a generator.
- the exemplary ORC generating system 1 comprises a thermal circuit 3 including an evaporator 9, an ORC expander 11 and a generator 13.
- the expander 11 and generator 13 are one unit.
- the thermal circuit 3 includes a condenser 15 and additional auxiliary equipment, such as a reservoir 17, a pump 19.
- the heat source 21 transfers thermal energy into the ORC system.
- the evaporator 9 vaporizes the organic working fluid previously pressurized by the pump of the thermal circuit 3.
- the pressurized organic fluid enters the expander 11, where expansion of the fluid drives a turbine to generate electrical power in the generator 13.
- the working fluid then is condensed through the condenser 15 back to the liquid phase and is further fed back into the system, through the reservoir 17 and the pump 19, to repeat the closed-loop cycle.
- the various components in the thermal circuit are connected by means of a tubing system 5 having pipes through which the working fluid is conveyed. Other variant arrangements are also possible.
- the thermal circuit 3 is provided with a coating layer on surfaces in contact with the working fluid, wherein the coating layer includes an inert material that is inert with respect to the working fluid during operation and that maintains structural integrity at a temperature above 550 K, and wherein the inert material in a pure state/form has a thermal conductivity above 50 W/mK at room temperature.
- the thermal conductivity is above 500 W/mK at room temperature, preferably above 1000 W/mK at room temperature.
- the thermal conductivity is in a range of 500 to 5000 W/mK at room temperature, preferably in a range of 1000 to 5000 W/.
- the coating layer may be in direct contact with the working fluid (e.g.
- the coating layer enables heating the working fluid to higher temperatures, whilst retaining the thermal stability of the working fluid. In this way, the thermal efficiency of the energy transfer system 1 can be higher.
- a material that may allow for higher thermal stability limits of the working fluid, such as for instance organic fluids, is graphene. Additionally, the graphene coating layer may provide for an extremely good heat transfer properties. It will be appreciated that various other energy transfer systems 1 may be used.
- the coating layer is applied in a solar collector piping. In some examples, the coating layer is applied in the piping of the high-temperature components of ORC systems.
- the coating layer is applied on one or more surfaces of components of the energy transfer system, such as for example turbines, heat exchanger unit, etc.
- the coating layer may be selectively applied on surfaces of the thermal circuit 3 in contact with the working fluid, for preventing deterioration and/or degradation of said working fluid at higher temperatures.
- Fig. 3 shows a schematic diagram of an embodiment of an energy transfer system 1, which is similar to the exemplary system 1 shown in fig.2.
- the coating layer is applied locally only in one or more parts of the thermal circuit 3, indicated by C.
- the heat transfer circuit 3 of the energy transfer system 1 comprises a first portion and a second portion C, wherein the first portion is configured to convey the working fluid in a first temperature range, and wherein the second portion is configured to convey the working fluid in a second temperature range.
- the first temperature range is below 500 K, preferably below 450 K
- the second temperature range is above 520 K, preferably above 550 K, more preferably above 570 K or above 573 K. Only surfaces in contact with working fluid in the second portion C of the heat transfer circuit are coated with the coating layer. In this way, a distinction is made between higher temperature parts of the thermal circuit 3 (cf. ‘C’) and lower temperature parts of the thermal circuit 3.
- the second temperature is in a range between 500 K to 870 K, preferably 550 K to 820 K, more preferably 573 to 820 K, most preferably 600 to 820K.
- like numerals may describe similar components in different views. Like numerals having different letter suffixes may represent different instances of similar components. "Optional” or “optionally” means that the subsequently described event or circumstance may or may not occur, and that the description includes instances where said event or circumstance occurs and instances where it does not.
Landscapes
- Engineering & Computer Science (AREA)
- Physics & Mathematics (AREA)
- Thermal Sciences (AREA)
- Mechanical Engineering (AREA)
- General Engineering & Computer Science (AREA)
- Other Surface Treatments For Metallic Materials (AREA)
- Lubricants (AREA)
- Other Air-Conditioning Systems (AREA)
Abstract
Description
Claims
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP21215727.5A EP4198390A1 (en) | 2021-12-17 | 2021-12-17 | An energy transfer system, a method of manufacturing thereof, and a method of increasing a thermal stability of a working fluid therein |
| PCT/EP2022/086456 WO2023111315A1 (en) | 2021-12-17 | 2022-12-16 | An energy transfer system, a method of manufacturing thereof, and a method of increasing a thermal stability of a working fluid therein |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| EP4449017A1 true EP4449017A1 (en) | 2024-10-23 |
| EP4449017B1 EP4449017B1 (en) | 2025-10-15 |
| EP4449017C0 EP4449017C0 (en) | 2025-10-15 |
Family
ID=78957131
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP21215727.5A Withdrawn EP4198390A1 (en) | 2021-12-17 | 2021-12-17 | An energy transfer system, a method of manufacturing thereof, and a method of increasing a thermal stability of a working fluid therein |
| EP22839760.0A Active EP4449017B1 (en) | 2021-12-17 | 2022-12-16 | An energy transfer system, a method of manufacturing thereof, and a method of increasing a thermal stability of a working fluid therein |
Family Applications Before (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP21215727.5A Withdrawn EP4198390A1 (en) | 2021-12-17 | 2021-12-17 | An energy transfer system, a method of manufacturing thereof, and a method of increasing a thermal stability of a working fluid therein |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US20250027730A1 (en) |
| EP (2) | EP4198390A1 (en) |
| CN (1) | CN118451279A (en) |
| WO (1) | WO2023111315A1 (en) |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100263842A1 (en) * | 2009-04-17 | 2010-10-21 | General Electric Company | Heat exchanger with surface-treated substrate |
| US20160305651A1 (en) * | 2015-04-20 | 2016-10-20 | Fireside Coatings, Inc. | Ceramic coating and process for applying the same |
-
2021
- 2021-12-17 EP EP21215727.5A patent/EP4198390A1/en not_active Withdrawn
-
2022
- 2022-12-16 EP EP22839760.0A patent/EP4449017B1/en active Active
- 2022-12-16 WO PCT/EP2022/086456 patent/WO2023111315A1/en not_active Ceased
- 2022-12-16 US US18/711,294 patent/US20250027730A1/en active Pending
- 2022-12-16 CN CN202280077999.2A patent/CN118451279A/en active Pending
Also Published As
| Publication number | Publication date |
|---|---|
| EP4198390A1 (en) | 2023-06-21 |
| EP4449017B1 (en) | 2025-10-15 |
| CN118451279A (en) | 2024-08-06 |
| WO2023111315A1 (en) | 2023-06-22 |
| US20250027730A1 (en) | 2025-01-23 |
| EP4449017C0 (en) | 2025-10-15 |
| WO2023111315A8 (en) | 2024-05-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8596066B2 (en) | Power plant using organic working fluids | |
| US8046999B2 (en) | High-temperature dual-source organic Rankine cycle with gas separations | |
| EP1873397B1 (en) | High temperature molten salt solar receiver | |
| EP3619475B1 (en) | District energy distributing system and method of providing mechanical work and heating heat transfer fluid of a district thermal energy circuit | |
| CN103119390B (en) | Method for combining energy storage device with separate thermal process | |
| TW201923225A (en) | System and method for generating electricity from heat inside the earth | |
| US20100276119A1 (en) | Compact, high-effectiveness, gas-to-gas compound recuperator with liquid intermediary | |
| WO2007147035A2 (en) | Heat transfer for ocean thermal energy conversion | |
| CN103477071A (en) | Organic rankine cycle for concentrated solar power system | |
| CA2699196A1 (en) | Heat exchanger with surface-treated substrate | |
| US4342197A (en) | Geothermal pump down-hole energy regeneration system | |
| JP2016061227A (en) | Cooling facility, combined cycle plant including the same, and cooling method | |
| US20180320559A1 (en) | Heat Recovery | |
| US20250027730A1 (en) | An energy transfer system, a method of manufacturing thereof, and a method of increasing a thermal stability of a working fluid therein | |
| EP3969828A1 (en) | High temperature heat storage system in energy power plants | |
| KR102045275B1 (en) | Discharged Thermal Energy Conversion Generation System for Offshore Plant | |
| Havsed | A Modular and Vacuum Based ORC for Low Temperature Geothermal Power | |
| KR101676757B1 (en) | waste heat eletric power generator using organic rankine cycle | |
| JP2017150771A (en) | Heat generation system and power generation system using the same | |
| IL185614A (en) | Organic working fluids |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20240705 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) | ||
| GRAP | Despatch of communication of intention to grant a patent |
Free format text: ORIGINAL CODE: EPIDOSNIGR1 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: GRANT OF PATENT IS INTENDED |
|
| INTG | Intention to grant announced |
Effective date: 20250508 |
|
| GRAS | Grant fee paid |
Free format text: ORIGINAL CODE: EPIDOSNIGR3 |
|
| GRAA | (expected) grant |
Free format text: ORIGINAL CODE: 0009210 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE PATENT HAS BEEN GRANTED |
|
| AK | Designated contracting states |
Kind code of ref document: B1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| REG | Reference to a national code |
Ref country code: GB Ref legal event code: FG4D Ref country code: CH Ref legal event code: F10 Free format text: ST27 STATUS EVENT CODE: U-0-0-F10-F00 (AS PROVIDED BY THE NATIONAL OFFICE) Effective date: 20251015 |
|
| REG | Reference to a national code |
Ref country code: CH Ref legal event code: R17 Free format text: ST27 STATUS EVENT CODE: U-0-0-R10-R17 (AS PROVIDED BY THE NATIONAL OFFICE) Effective date: 20251020 |
|
| REG | Reference to a national code |
Ref country code: DE Ref legal event code: R096 Ref document number: 602022023227 Country of ref document: DE |
|
| REG | Reference to a national code |
Ref country code: IE Ref legal event code: FG4D |
|
| U01 | Request for unitary effect filed |
Effective date: 20251029 |
|
| U07 | Unitary effect registered |
Designated state(s): AT BE BG DE DK EE FI FR IT LT LU LV MT NL PT RO SE SI Effective date: 20251105 |
|
| U20 | Renewal fee for the european patent with unitary effect paid |
Year of fee payment: 4 Effective date: 20251119 |
|
| REG | Reference to a national code |
Ref country code: CH Ref legal event code: U11 Free format text: ST27 STATUS EVENT CODE: U-0-0-U10-U11 (AS PROVIDED BY THE NATIONAL OFFICE) Effective date: 20260101 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: ES Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20251015 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: NO Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20260115 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: HR Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20251015 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: RS Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20260115 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: IS Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20260215 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: CH Payment date: 20260101 Year of fee payment: 4 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: PL Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20251015 |