EP4436595A1 - Reducing risk of antigen mimicry in immunogenic medicaments - Google Patents
Reducing risk of antigen mimicry in immunogenic medicamentsInfo
- Publication number
- EP4436595A1 EP4436595A1 EP22814525.6A EP22814525A EP4436595A1 EP 4436595 A1 EP4436595 A1 EP 4436595A1 EP 22814525 A EP22814525 A EP 22814525A EP 4436595 A1 EP4436595 A1 EP 4436595A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- protein
- antigenic polypeptide
- cross
- antigenic
- host
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/575—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- This disclosure relates to the field of immunology, specifically to immunogenic compositions, methods for improving safety and/or reducing side effects of immunogenic compositions, and immunogenic compositions having improved safety and/or side effect profiles.
- Adverse reactions following administration of vaccines are not limited to only certain vaccines against only a certain pathogenic organism, as side effects have been observed for a broad range of vaccines against a variety of pathogens including, for example, coronavirus, influenza, hepatitis, human papilloma virus, smallpox, anthrax, and typhoid.
- pathogens including, for example, coronavirus, influenza, hepatitis, human papilloma virus, smallpox, anthrax, and typhoid.
- pathogens including, for example, coronavirus, influenza, hepatitis, human papilloma virus, smallpox, anthrax, and typhoid.
- pathogens including, for example, coronavirus, influenza, hepatitis, human papilloma virus, smallpox, anthrax, and typhoid.
- Vaccines (Basel), Oct 15 ;9( 10): 1186, 2021 (stating that post-vaccine myocarditis has been reported for live vaccines (e.g., smallpox, anthrax and some typhoid vaccines).
- the present disclosure provides methods for reducing the side effects of immunogenic compositions and for improving side effect profdes of immunogenic compositions. Reducing the side effects of immunogenic compositions by reducing and/or preventing antigen mimicry and immune cross-reactivity associated with immunogenic compositions is a desirable outcome in the safety and efficacy of vaccines.
- the present disclosure is based, at least in part, on the discovery that antigenic polypeptide constructs comprised in immunogenic compositions can be analyzed for antigenic peptide sequences having high homology with peptides comprised in host proteins that are predicted to be antigenic after immunization. Without wishing to be bound by theory, subsequent modification of the antigenic peptide sequences results in immunogenic compositions capable of eliciting an immune response but having attenuated cross-reactivity with potentially antigenic host proteins.
- an immunogenic composition for administration to a host comprising (1) a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct, and/or (2) a modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct, wherein the modified antigenic polypeptide or viral spike protein construct differs from an unmodified antigenic polypeptide or viral spike protein construct at one or more antigenic peptide sequences, wherein the modified antigenic polypeptide or viral spike protein construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide or viral spike protein construct; wherein an antigenic peptide sequence of the unmodified antigenic polypeptide construct or viral spike protein comprises 5 or more consecutive amino acids having at least about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue, and wherein the modified antigenic polypeptide
- the antigenic peptide sequence of the unmodified antigenic polypeptide construct or viral spike protein comprises 9 or more consecutive amino acids having at least about 75% sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue, and wherein the modified antigenic polypeptide or viral spike protein construct comprises an antigenic peptide sequence of 9 consecutive amino acids having less than about 75% sequence identity with the cross-reactive host peptide.
- the antigenic peptide sequence of the unmodified antigenic polypeptide construct or viral spike protein comprises 15 consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue, and wherein the modified antigenic polypeptide or viral spike protein construct comprises an antigenic peptide sequence of 15 consecutive amino acids having less than about 50% sequence identity with the cross-reactive host peptide.
- an immunogenic composition for administration to a host, the composition comprising (1) a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct, and/or (2) a modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct, wherein the modified antigenic polypeptide or viral spike protein construct differs from an unmodified antigenic polypeptide or viral spike protein construct at one or more antigenic peptide sequences, wherein the modified antigenic polypeptide or viral spike protein construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide or viral spike protein construct; wherein an antigenic peptide sequence of the unmodified antigenic polypeptide construct or viral spike protein comprises 9 consecutive amino acids having at least about 75% sequence identity or 15 consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue, and wherein the modified antigenic polypeptid
- an immunogenic composition for administration to a host comprising a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct, a) wherein the modified antigenic polypeptide construct differs from an unmodified antigenic polypeptide construct (such as, for example, SARS-CoV-2 spike protein) at one or more antigenic peptide sequences (such as, for example, any one of the antigenic peptide sequences set forth in SEQ ID Nos: 3-127); b. wherein the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide construct; c.
- an unmodified antigenic polypeptide construct such as, for example, SARS-CoV-2 spike protein
- antigenic peptide sequences such as, for example, any one of the antigenic peptide sequences set forth in SEQ ID Nos: 3-127
- the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide
- an antigenic peptide sequence of the unmodified antigenic polypeptide construct (such as, for example, any one of the antigenic peptide sequences set forth in SEQ ID Nos: 3-127) comprises 9 consecutive amino acids having at least about 75% sequence identity or 15 consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide (such as, for example, any one of the cross-reactive host peptide sequence set forth in SEQ ID NOs: 128-137) comprised in a cross-reactive host polypeptide expressed in a host tissue (such as, for example, the respective polypeptide named in Table 5 for SEQ ID Nos: 128-137); and d.
- the modified antigenic polypeptide construct comprises an antigenic peptide sequence of 9 consecutive amino acids having less than about 75% sequence identity or 15 consecutive amino acids having less than about 50% amino acid sequence identity with the cross-reactive host peptide.
- an immunogenic composition for administration to a host comprising a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct, a) wherein the modified antigenic polypeptide construct differs from an unmodified antigenic polypeptide construct (such as, for example, SARS-CoV-2 spike protein) at one or more antigenic peptide sequences (such as, for example, any one of the antigenic peptide sequences set forth in SEQ ID Nos: 1-2); b. wherein the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide construct; c.
- an unmodified antigenic polypeptide construct such as, for example, SARS-CoV-2 spike protein
- antigenic peptide sequences such as, for example, any one of the antigenic peptide sequences set forth in SEQ ID Nos: 1-2
- the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide
- an antigenic peptide sequence of the unmodified antigenic polypeptide construct (such as, for example, any one of the antigenic peptide sequences set forth in SEQ ID Nos: 185-194) comprises 9 consecutive amino acids having at least about 75% sequence identity or 15 consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide (such as, for example, any one of the respective cross-reactive host peptide sequence set forth in SEQ ID NOs: 175-184) comprised in a cross-reactive host polypeptide expressed in a host tissue (such as, for example, the respective polypeptide named in Table 3 for SEQ ID Nos: 175-184); and d.
- a cross-reactive host peptide such as, for example, any one of the respective cross-reactive host peptide sequence set forth in SEQ ID Nos: 175-184
- a host tissue such as, for example, the respective polypeptide named in Table 3 for SEQ ID Nos: 175-184
- modified antigenic polypeptide construct comprises an antigenic peptide sequence of 9 consecutive amino acids having less than about 75% sequence identity or 15 consecutive amino acids having less than about 50% amino acid sequence identity with the cross-reactive host peptide (such as, for example, any one of the respective cross-reactive host peptide sequence set forth in SEQ ID NOs: 175-184).
- an immunogenic composition for administration to a host comprising a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct, a) wherein the modified antigenic polypeptide construct differs from an unmodified antigenic polypeptide construct (such as, for example, SARS-CoV-2 spike protein) at one or more antigenic peptide sequences (such as, for example, any one of the antigenic peptide sequences set forth in SEQ ID Nos: 1-2); b. wherein the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide construct; c.
- an unmodified antigenic polypeptide construct such as, for example, SARS-CoV-2 spike protein
- antigenic peptide sequences such as, for example, any one of the antigenic peptide sequences set forth in SEQ ID Nos: 1-2
- the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide
- an antigenic peptide sequence of the unmodified antigenic polypeptide construct (such as, for example, any one of the antigenic peptide sequences set forth in even numbered SEQ ID Nos: 140-174) comprises 9 consecutive amino acids having at least about 75% sequence identity or 15 consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide (such as, for example, any one of the respective cross-reactive host peptide sequence set forth in odd numbered SEQ ID NOs: 139-173) comprised in a cross-reactive host polypeptide expressed in a host tissue (such as, for example, the respective polypeptide named in Table 3 for odd numbered SEQ ID Nos: 139-173); and d.
- a cross-reactive host peptide such as, for example, any one of the respective cross-reactive host peptide sequence set forth in odd numbered SEQ ID Nos: 139-173
- a host tissue such as, for example, the respective polypeptide named in Table 3 for odd numbered SEQ ID
- modified antigenic polypeptide construct comprises an antigenic peptide sequence of 9 consecutive amino acids having less than about 75% sequence identity or 15 consecutive amino acids having less than about 50% amino acid sequence identity with the cross-reactive host peptide (such as, for example, any one of the respective cross-reactive host peptide sequence set forth in odd numbered SEQ ID NOs: 139-173).
- an immunogenic composition comprising (1) a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct, and/or (2) a modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct, the method comprising: identifying at least one antigenic peptide sequence comprised in an unmodified antigenic polypeptide or viral spike protein construct, wherein the antigenic peptide sequence comprises 5 or more consecutive amino acids having at least about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue; and modifying the antigenic peptide sequence of the unmodified antigenic polypeptide or viral spike protein construct to have less than about 50% amino acid sequence identity with the cross-reactive host peptide to form the modified antigenic polypeptide or viral spike protein construct and/or a nucleic acid encoding the modified antigenic polypeptide or
- modifying the antigenic peptide sequence to have less than about 50% identity with the cross-reactive host peptide reduces or prevents cross-reactivity of the immunogenic composition to the cross-reactive host peptide compared to the cross-reactivity of an immunogenic composition comprising an unmodified antigenic polypeptide or viral spike protein construct having an unmodified antigenic peptide sequence.
- the immunogenic composition comprising the modified antigenic polypeptide or viral spike protein construct elicits an immune response.
- an immunogenic composition comprising (1) a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct, and/or (2) a modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct, the method comprising: identifying at least one antigenic peptide sequence comprised in an unmodified antigenic polypeptide or viral spike protein construct, wherein the antigenic peptide sequence comprises 9 consecutive amino acids having at least about 75% sequence identity or 15 consecutive amino acids having at least about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue; and modifying the antigenic peptide sequence of the unmodified antigenic polypeptide or viral spike protein construct to have less than about 50% amino acid sequence identity with the cross-reactive host peptide to form the modified antigenic polypeptide or viral spike protein construct and/or a nucleic acid encoding the
- a method for reducing or preventing crossreactivity of (1) an antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct, and/or (2) a viral spike protein construct and/or a nucleic acid encoding the viral spike protein construct comprising: identifying at least one antigenic peptide sequence comprised in an unmodified antigenic polypeptide or viral spike protein construct, wherein the antigenic peptide sequence comprises 5 or more consecutive amino acids having at least about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue; and modifying the antigenic peptide sequence of the unmodified antigenic polypeptide or viral spike protein construct to produce a modified antigenic peptide sequence having less than about 50% amino acid sequence identity with the cross-reactive host peptide to produce a modified antigenic polypeptide or viral spike protein construct comprising the modified antigenic peptide sequence and/
- a method for reducing or preventing cross-reactivity of (1) an antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct, and/or (2) a viral spike protein construct and/or a nucleic acid encoding the viral spike protein construct comprising: identifying at least one antigenic peptide sequence comprised in an unmodified antigenic polypeptide or viral spike protein construct, wherein the antigenic peptide sequence comprises 9 consecutive amino acids having less than about 75% sequence identity or 15 consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue; and modifying the antigenic peptide sequence of the unmodified antigenic polypeptide or viral spike protein construct to produce a modified antigenic peptide sequence having less than about 50% amino acid sequence identity with the cross-reactive host peptide to produce a modified antigenic polypeptide or viral spike protein construct comprising the modified antigenic
- the antigenic polypeptide construct is a viral protein, a bacterial protein, a protein of a host parasite, a fungal protein, a cancer protein, or a protein wherein reduction of the concentration of the protein treats a disease or condition.
- the viral protein is a protein from an arenavirus, astrovirus, bunyavirus, calicivirus, coronavirus, filovirus, flavivirus, hepadnavirus, hepevirus, orthomyxovirus, paramyxovirus, picomavirus, reovirus, retrovirus, rhabdovirus, or togavirus.
- the viral protein is a viral membrane protein, a viral capsid protein, a viral envelope protein, and/or a viral non-structural protein.
- the viral protein is a viral spike protein.
- the bacterial protein is a protein from Streptococcus, Neisseria, Salmonella, Vibrio, Clostridium, Bacillus, or Mycobacterium. In some embodiments, the bacterial protein is a bacterial cell surface protein and/or a bacterial cell wall protein.
- the parasite protein is a protein from Leishmania, Plasmodium, or Schistosoma. In some embodiments, the parasite protein is a parasite cell surface protein and/or a parasite secreted protein.
- the fungal protein is a protein from Candida, Cryptococcus, or Aspergillus .
- the fungal protein is a fungal cell surface protein and/or a fungal cell wall protein.
- the nucleic acid is RNA.
- the RNA is double stranded, single stranded, antisense single stranded, messenger RNA (mRNA), selfamplifying RNA (saRNA), and/or modified RNA (modRNA).
- the RNA is comprised in an expression vector.
- the immunogenic composition is an RNA vaccine.
- the nucleic acid is DNA.
- the DNA is double stranded, single stranded, and/or antisense single stranded.
- the DNA is comprised in an expression vector.
- the immunogenic composition is a DNA vaccine.
- the immunogenic composition comprises a polypeptide. In some instances, the immunogenic composition comprises a polypeptide vaccine.
- the antigenic peptide sequence of the modified antigenic polypeptide construct has less than about 65%, about 60%, about 55%, about 50%, about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, or about 10% identity with the cross-reactive host peptide.
- the modified antigenic polypeptide construct has at least about 51%, about 52%, about 53%, about 54%, about 55%, about 56%, about 57%, about 58%, about 59%, about 60%, about 61%, about 62%, about 63%, about 64%, about 65%, about 66%, about 67%, about 68%, about 69%, about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% sequence identity with the unmodified antigenic polypeptide construct.
- the cross-reactive host polypeptide is expressed in the heart, brain, kidney, liver, and/or lung tissue. In specific embodiments, the cross-reactive host polypeptide is expressed in the heart tissue. In some embodiments, the cross-reactive host polypeptide is located within the following proteins: nebulette (NEBL), ryanodine receptor 2 (RYR2), ATPase sarcoplasmic/endoplasmic reticulum Ca 2+ transporting 2 (ATP2A2), titin (TTN), kelch like family member 41 (KLHL41), myosin heavy chain 6 (MYH6), myosin heavy chain 7 (MYH7), otogelin (OTOG), nicotinamide nucleotide transhydrogenase (NNT), and/or nebulin related anchoring protein (NRAP).
- NEBL nebulette
- RYR2 ryanodine receptor 2
- At least one cross-reactive host polypeptide comprises and/or is located within NEBL. In specific embodiments, at least one cross-reactive host polypeptide comprises and/or is located within RYR2. In some preferred embodiments, the cross-reactive host polypeptide is expressed in the heart, brain, kidney, liver, and/or lung tissue. In specific embodiments, the cross-reactive host polypeptide is expressed in the heart tissue.
- the cross-reactive host polypeptide is located within the following proteins: myosin 6 (MYH6), ankyrin repeat domain l(ANKRDl), synaptopodin 2-like protein (SYNPO2L), myosin 7(MYH7), ankyrin repeat and SOCS box containing 15(ASB15), cysteine and glycine rich protein 3(CSRP3), desmoplakin (DSP), oxoglutarate dehydrogenase (OGDH), ATP synthase -coupling factor 6, mitochondrial(ATP5PF), and/or pericentriolar material 1 protein (PCM1).
- at least one cross-reactive host polypeptide is located within MYH6.
- At least one cross-reactive host polypeptide is located within MYH6 and has, for example, the amino acid sequence SEQ ID NO: 128. In specific embodiments, at least one cross-reactive host polypeptide is located within PCM1. In specific embodiments, at least one cross-reactive host polypeptide is located within PCM1 and comprises, for example, the amino acid sequence SEQ ID NO: 137. In specific embodiments, at least one cross-reactive host polypeptide comprises the amino acid sequence selected from any one of SEQ ID NO: 3-25. [0022] In some embodiments, the antigenic peptide sequence of the unmodified antigenic polypeptide construct after the ranking strategy is preferably selected from any one of the peptides of SEQ ID NO: 3-138.
- the antigenic peptide sequence of the unmodified antigenic polypeptide construct has the amino acid sequence selected from any one of SEQ ID NO: 3-138. In some embodiments, the antigenic peptide sequence ofthe unmodified antigenic polypeptide construct has the amino acid sequence selected from any one of SEQ ID NO: 3-25. In some embodiments, the antigenic peptide sequence of the unmodified antigenic polypeptide construct has the amino acid sequence selected from any one of SEQ ID NO: 26- 36. In some embodiments, the antigenic peptide sequence of the unmodified antigenic polypeptide construct has the amino acid sequence selected from any one of SEQ ID NO: 37- 60.
- the antigenic peptide sequence of the unmodified antigenic polypeptide construct has the amino acid sequence selected from any one of SEQ ID NO: 61- 70. In some embodiments, the antigenic peptide sequence of the unmodified antigenic polypeptide construct has the amino acid sequence selected from any one of SEQ ID NO: 71- 94. In some embodiments, the antigenic peptide sequence of the unmodified antigenic polypeptide construct has the amino acid sequence selected from any one of SEQ ID NO: 95- 104. In some embodiments, the antigenic peptide sequence of the unmodified antigenic polypeptide construct has the amino acid sequence selected from any one of SEQ ID NO: 105- 127.
- the antigenic peptide sequence of the unmodified antigenic polypeptide construct has the amino acid sequence selected from any one of SEQ ID NO: 128- 137. Such preferred peptides may be used for further analyses such as antigenicity predictions.
- an immunogenic composition produced according to any method disclosed herein.
- an immunogenic composition comprising any antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct disclosed herein.
- the immunogenic composition elicits an immune response comprising an antibody response.
- the immunogenic composition elicits an immune response comprising a T cell response.
- an immunogenic composition for administration to a host comprising a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct, wherein the modified antigenic polypeptide construct differs from an unmodified antigenic polypeptide construct at one or more antigenic peptide sequences, wherein the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide construct; wherein an antigenic peptide sequence of the unmodified antigenic polypeptide construct comprises 5 or more consecutive amino acids having at least about 50% amino acid sequence identity with a cross- reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue, and wherein the modified antigenic polypeptide construct comprises an antigenic peptide sequence of 5 or more consecutive amino acids having less than about 50% amino acid sequence identity with the cross-reactive host peptide.
- an immunogenic composition for administration to a host comprising a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct, wherein the modified antigenic polypeptide construct differs from an unmodified antigenic polypeptide construct at one or more antigenic peptide sequences, wherein the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide construct; wherein an antigenic peptide sequence of the unmodified antigenic polypeptide construct comprises 9 consecutive amino acids having at least about 75% sequence identity or 15consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide comprised in a cross- reactive host polypeptide expressed in a host tissue, and wherein the modified antigenic polypeptide construct comprises an antigenic peptide sequence of 9 consecutive amino acids having less than about 75% sequence identity or 15 consecutive amino acids having less than about 50% amino acid sequence identity with the cross-reactive host peptide.
- E2 The immunogenic composition of El, wherein the antigenic polypeptide construct is a viral protein, a bacterial protein, a protein of a host parasite, a fungal protein, a cancer protein, or a protein wherein reduction of the concentration of the protein treats a disease or condition.
- the antigenic polypeptide construct is a viral protein, a bacterial protein, a protein of a host parasite, a fungal protein, a cancer protein, or a protein wherein reduction of the concentration of the protein treats a disease or condition.
- E3 The immunogenic composition of E2, wherein the viral protein is a protein from an arenavirus, astrovirus, bunyavirus, calicivirus, coronavirus, filovirus, flavivirus, hepadnavirus, hepevirus, orthomyxovirus, paramyxovirus, picomavirus, reovirus, retrovirus, rhabdovirus, or togavirus.
- the viral protein is a protein from an arenavirus, astrovirus, bunyavirus, calicivirus, coronavirus, filovirus, flavivirus, hepadnavirus, hepevirus, orthomyxovirus, paramyxovirus, picomavirus, reovirus, retrovirus, rhabdovirus, or togavirus.
- E4 The immunogenic composition of E2 or E3, wherein the viral protein is a viral membrane protein, a viral capsid protein, a viral envelope protein, and/or a viral non-structural protein.
- E5. The immunogenic composition of any one of E2-E4, wherein the viral protein is a viral spike protein.
- E6 The immunogenic composition of E2, wherein the bacterial protein is a protein from Streptococcus, Neisseria, Salmonella, Vibrio, Clostridium, Bacillus, or Mycobacterium.
- E7 The immunogenic composition of clause 2, wherein the bacterial protein is a bacterial cell surface protein and/or a bacterial cell wall protein.
- E8 The immunogenic composition of E2, wherein the parasite protein is a protein from Leishmania, Plasmodium, or Schistosoma.
- E9 The immunogenic composition of E2, wherein the parasite protein is a parasite cell surface protein and/or a parasite secreted protein.
- E10 The immunogenic composition of E2, wherein the fungal protein is a protein from Candida, Cryptococcus, or Aspergillus .
- El l The immunogenic composition of E2, wherein the fungal protein is a fungal cell surface protein and/or a fungal cell wall protein.
- E12. The immunogenic composition of any one of El-El 1, wherein nucleic acid is RNA.
- El 3 The immunogenic composition of El 2, wherein the RNA is double stranded, single stranded, antisense single stranded, messenger RNA (mRNA), self-amplifying RNA (saRNA), and/or modified RNA (modRNA).
- mRNA messenger RNA
- saRNA self-amplifying RNA
- modRNA modified RNA
- E14 The immunogenic composition of E12 or E13, wherein the RNA is comprised in an expression vector.
- El 5 The immunogenic composition of any one of E12-E14, wherein the immunogenic composition is an RNA vaccine.
- E16 The immunogenic composition of any one of clauses El-El 1, wherein the nucleic acid is DNA.
- El 7 The immunogenic composition of El 6, wherein the DNA is double stranded, single stranded, and/or antisense single stranded.
- E19 The immunogenic composition of any one of E16-E18, wherein the immunogenic composition is a DNA vaccine.
- E20 The immunogenic composition of any one of El-El l, wherein the immunogenic composition comprises a polypeptide.
- E21 The immunogenic composition of any one of E1-E20, wherein the antigenic peptide sequence of the modified antigenic polypeptide construct has less than about 50%, about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, or about 10% identity with the cross-reactive host peptide.
- E22 The immunogenic composition of any one of E1-E21, wherein the modified antigenic polypeptide construct has at least about 51%, about 52%, about 53%, about 54%, about 55%, about 56%, about 57%, about 58%, about 59%, about 60%, about 61%, about 62%, about 63%, about 64%, about 65%, about 66%, about 67%, about 68%, about 69%, about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% sequence identity with the unmodified antigenic polypeptide construct.
- E23 The immunogenic composition of any one of E1-E22, wherein the cross- reactive host polypeptide is expressed in the heart, brain, kidney, liver, and/or lung tissue.
- E24 The immunogenic composition of any one of E1-E23, wherein the cross- reactive host polypeptide is expressed in the heart tissue.
- E25 The immunogenic composition of any one of E1-E24, wherein the cross- reactive host polypeptide is located within the following proteins: nebulette (NEBL), ryanodine receptor 2 (RYR2), ATPase sarcoplasmic/endoplasmic reticulum Ca 2+ transporting 2 (ATP2A2), titin (TTN), kelch like family member 41 (KLHL41), myosin heavy chain 6 (MYH6), myosin heavy chain 7 (MYH7), otogelin (OTOG), nicotinamide nucleotide transhydrogenase (NNT), and/or nebulin related anchoring protein (NRAP).
- NEBL nebulette
- RYR2 ryanodine receptor 2
- TTN titin
- KLHL41 kelch like family member 41
- MYH6 myosin
- myosin 6 MYH6
- ANKRDl synaptopodin 2-like protein
- MYH7 myosin 7
- SOCS box containing 15 ASB15
- cysteine and glycine rich protein 3 CSRP3
- DSP desmoplakin
- E26 The immunogenic composition of E25, wherein at least one cross- reactive host polypeptide comprises and/or is located within NEBL. In some embodiments, the immunogenic composition of E25, wherein at least one cross-reactive host polypeptide is comprised located withins MYH6.
- E27 The immunogenic composition of E25, wherein at least one cross- reactive host polypeptide comprises and/or is located within RYR2. In some embodiments, the immunogenic composition of E25, wherein at least one cross-reactive host polypeptide is located within PCM1.
- an immunogenic composition for administration to a host comprising a modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct, wherein the modified viral spike protein construct differs from an unmodified viral spike protein construct at one or more antigenic peptide sequences, wherein the modified viral spike protein construct has at least about 50% amino acid sequence identity with the unmodified viral spike protein construct, wherein an antigenic peptide sequence of the unmodified viral spike protein construct comprises 5 or more consecutive amino acids having at least about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue, and wherein the modified viral spike protein construct comprises an antigenic peptide sequence of 5 or more consecutive amino acids having less than about 50% amino acid sequence identity with the cross-reactive host peptide.
- an immunogenic composition for administration to a host comprising a modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct, wherein the modified viral spike protein construct differs from an unmodified viral spike protein construct at one or more antigenic peptide sequences, wherein the modified viral spike protein construct has at least about 50% amino acid sequence identity with the unmodified viral spike protein construct, wherein an antigenic peptide sequence of the unmodified viral spike protein construct comprises 9 consecutive amino acids having at least about 75% sequence identity or 15consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue, and wherein the modified viral spike protein construct comprises an antigenic peptide sequence of 9 consecutive amino acids having less than about 75% sequence identity or 15consecutive amino acids having less than about 50% sequence identity with the cross-reactive host peptide.
- E29 The immunogenic composition of E28, wherein the viral spike protein is a spike protein from arenavirus, astrovirus, bunyavirus, calicivirus, coronavirus, filovirus, flavivirus, hepadnavirus, hepevirus, orthomyxovirus, paramyxovirus, picomavirus, reovirus, retrovirus, rhabdovirus, or togavirus.
- the viral spike protein is a spike protein from arenavirus, astrovirus, bunyavirus, calicivirus, coronavirus, filovirus, flavivirus, hepadnavirus, hepevirus, orthomyxovirus, paramyxovirus, picomavirus, reovirus, retrovirus, rhabdovirus, or togavirus.
- E30 The immunogenic composition of E28 or E29, wherein nucleic acid is
- E31 The immunogenic composition of E30, wherein the RNA is double stranded, single stranded, antisense single stranded, messenger RNA (mRNA), self-amplifying RNA (saRNA), and/or modified RNA (modRNA).
- mRNA messenger RNA
- saRNA self-amplifying RNA
- modRNA modified RNA
- E32 The immunogenic composition of E30 or 31, wherein the RNA is comprised in an expression vector.
- E33 The immunogenic composition of any one of E30-E32, wherein the immunogenic composition is an RNA vaccine.
- E34 The immunogenic composition of E28 or E29, wherein the nucleic acid is DNA.
- E35 The immunogenic composition of E34, wherein the DNA is double stranded, single stranded, and/or antisense single stranded.
- E36 The immunogenic composition of E34 or E35, wherein the DNA is comprised in an expression vector.
- E37 The immunogenic composition of any one of E34-E36, wherein the immunogenic composition is a DNA vaccine.
- E38 The immunogenic composition of E28 or E29, wherein the immunogenic composition comprises a polypeptide.
- E39 The immunogenic composition of any one of E28-E38, wherein the antigenic peptide sequence of the modified viral spike protein construct has less than about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, or about 10% identity with the cross-reactive host peptide.
- E40 The immunogenic composition of any one of E28-E39, wherein the modified viral spike protein construct has at least about 51%, about 52%, about 53%, about 54%, about 55%, about 56%, about 57%, about 58%, about 59%, about 60%, about 61%, about 62%, about 63%, about 64%, about 65%, about 66%, about 67%, about 68%, about 69%, about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% sequence identity with the unmodified viral spike protein construct.
- E41 The immunogenic composition of any one of E28-E40, wherein the cross-reactive host polypeptide is expressed in the heart, brain, kidney, liver, and/or lung tissue.
- E42 The immunogenic composition of any one of E28-E41, wherein the cross-reactive host polypeptide is expressed in the heart tissue.
- E43 The immunogenic composition of any one of E28-E42, wherein the cross-reactive host polypeptide is located within the following proteins: nebulette (NEBL), ryanodine receptor 2 (RYR2), ATPase sarcoplasmic/endoplasmic reticulum Ca 2+ transporting 2 (ATP2A2), titin (TTN), kelch like family member 41 (KLHL41), myosin heavy chain 6 (MYH6), myosin heavy chain 7 (MYH7), otogelin (OTOG), nicotinamide nucleotide transhydrogenase (NNT), and/or nebulin related anchoring protein (NRAP).
- NEBL nebulette
- RYR2 ryanodine receptor 2
- TTN titin
- KLHL41 myosin heavy chain 6
- MYH7 myosin heavy
- myosin 6 MYH6
- ANKRDl synaptopodin 2-like protein
- SYNPO2L synaptopodin 2-like protein
- MYH7 myosin 7
- ankyrin repeat and SOCS box containing 15 ASB15
- E44 The immunogenic composition of E43, wherein at least one cross- reactive host polypeptide comprises and/or is located within NEBL. In some embodiments, the immunogenic composition of E43, wherein at least one cross-reactive host polypeptide is located within MYH6.
- E45 The immunogenic composition of E43, wherein at least one cross- reactive host polypeptide comprises and/or is located within RYR2. In some embodiments, the immunogenic composition of E43, wherein at least one cross-reactive host polypeptide is located within PCM1
- a method for producing an immunogenic composition comprising a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct, the method comprising: identifying at least one antigenic peptide sequence comprised in an unmodified antigenic polypeptide construct, wherein the antigenic peptide sequence comprises 5 or more consecutive amino acids having at least about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in the host tissue; and modifying the antigenic peptide sequence of the unmodified antigenic polypeptide construct to have less than about 50% amino acid sequence identity with the cross-reactive host peptide to form the modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct, wherein the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide construct.
- a method for producing an immunogenic composition comprising a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct, the method comprising: identifying at least one antigenic peptide sequence comprised in an unmodified antigenic polypeptide construct, wherein the antigenic peptide sequence comprises 9 consecutive amino acids having at least about 75% sequence identity or 15consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in the host tissue; and modifying the antigenic peptide sequence of the unmodified antigenic polypeptide construct to have less than about 50% amino acid sequence identity with the cross-reactive host peptide to form the modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct, wherein the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide construct
- E47 The method of E46, wherein modifying the antigenic peptide sequence to have less than about 50% identity with the cross-reactive host peptide reduces or prevents cross-reactivity of the immunogenic composition to the cross-reactive host peptide compared to the cross-reactivity of an immunogenic composition comprising an unmodified antigenic polypeptide construct having an unmodified antigenic peptide sequence.
- E48 The method of E46 or E47, wherein the immunogenic composition comprising the modified antigenic polypeptide construct elicits an immune response.
- E49 The method of any one of E46-E48, wherein the antigenic polypeptide construct is a viral protein, a bacterial protein, a protein of a host parasite, a fungal protein, a cancer protein, or a protein wherein reduction of the concentration of the protein treats a disease or condition.
- E50 The method of E49, wherein the viral protein is a protein from an arenavirus, astrovirus, bunyavirus, calicivirus, coronavirus, filovirus, flavivirus, hepadnavirus, hepevirus, orthomyxovirus, paramyxovirus, picomavirus, reovirus, retrovirus, rhabdovirus, or togavirus.
- the viral protein is a protein from an arenavirus, astrovirus, bunyavirus, calicivirus, coronavirus, filovirus, flavivirus, hepadnavirus, hepevirus, orthomyxovirus, paramyxovirus, picomavirus, reovirus, retrovirus, rhabdovirus, or togavirus.
- E51 The method of E49 or E50, wherein the viral protein is a viral membrane protein, a viral capsid protein, a viral envelope protein, and/or a viral non-structural protein.
- E52 The method of any one of E49-E51, wherein the viral protein is a viral spike protein.
- E53 The method of E49, wherein the bacterial protein is a protein from
- Streptococcus Neisseria, Salmonella, Vibrio, Clostridium, Bacillus, or Mycobacterium .
- E54 The method of E49, wherein the bacterial protein is a bacterial cell surface protein and/or a bacterial cell wall protein.
- E55 The method of E49, wherein the parasite protein is a protein from
- E56 The method of E49, wherein the parasite protein is a parasite cell surface protein and/or a parasite secreted protein.
- E57 The method of E49, wherein the fungal protein is a protein from
- Candida Cryptococcus, or Aspergillus .
- E58 The method of E49, wherein the fungal protein is a fungal cell surface protein and/or a fungal cell wall protein.
- E59 The method of any one of E46-E58, wherein nucleic acid is RNA.
- E60 The method of E59, wherein the RNA is double stranded, single stranded, antisense single stranded, messenger RNA (mRNA), self-amplifying RNA (saRNA), and/or modified RNA (modRNA).
- mRNA messenger RNA
- saRNA self-amplifying RNA
- modRNA modified RNA
- E62 The method of any one of E59-E61, wherein the immunogenic composition is an RNA vaccine.
- E63 The method of any one of E46-E58, wherein the nucleic acid is DNA.
- E64 The method of E63, wherein the DNA is double stranded, single stranded, and/or antisense single stranded.
- E65 The method of E63 or E64, wherein the DNA is comprised in an expression vector.
- E66 The method of any one of E63-E65, wherein the immunogenic composition is a DNA vaccine.
- E67 The method of any one of E46-E58, wherein the immunogenic composition comprises a polypeptide.
- E68 The method of any one of E46-E67, wherein the antigenic peptide sequence of the modified antigenic polypeptide construct has less than about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, or about 10% identity with the cross-reactive host peptide.
- E69 The method of any one of E46-E68, wherein the modified antigenic polypeptide construct has at least about 51%, about 52%, about 53%, about 54%, about 55%, about 56%, about 57%, about 58%, about 59%, about 60%, about 61%, about 62%, about 63%, about 64%, about 65%, about 66%, about 67%, about 68%, about 69%, about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% sequence identity with the unmodified antigenic polypeptide construct.
- E70 The method of any one of E46-E69, wherein the cross-reactive host polypeptide is expressed in the heart, brain, kidney, liver, and/or lung tissue.
- E71 The method of any one of E46-E70, wherein the cross-reactive host polypeptide is expressed in the heart tissue.
- E72 The method of any one of E46-E71, wherein the cross-reactive host polypeptide comprises and/or is located within the following proteins: nebulette (NEBL), ryanodine receptor 2 (RYR2), ATPase sarcoplasmic/endoplasmic reticulum Ca 2+ transporting 2 (ATP2A2), titin (TTN), kelch like family member 41 (KLHL41), myosin heavy chain 6 (MYH6), myosin heavy chain 7 (MYH7), otogelin (OTOG), nicotinamide nucleotide transhydrogenase (NNT), and/or nebulin related anchoring protein (NRAP).
- NEBL nebulette
- RYR2 ryanodine receptor 2
- TTN titin
- KLHL41 myosin heavy chain 6
- MYH7 my
- E72 wherein at least one cross-reactive host polypeptide comprises and/or is located within MYH6.
- E73 The method of E72, wherein at least one cross-reactive host polypeptide comprises and/or is located within NEBL. In another embodiment, the method of E72, wherein at least one cross-reactive host polypeptide comprises and/or is located within PCM1.
- E74 The method of E72, wherein at least one cross-reactive host polypeptide comprises and/or is located within RYR2.
- a method for producing an immunogenic composition comprising a modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct, the method comprising: identifying at least one antigenic peptide sequence comprised in an unmodified viral spike protein construct, wherein the antigenic peptide sequence comprises 5 or more consecutive amino acids having at least about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue; and modifying the antigenic peptide sequence of the unmodified viral spike protein construct to have less than about 50% amino acid sequence identity with the cross-reactive host peptide to form the modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct, wherein the modified viral spike protein construct has at least about 50% amino acid sequence identity with the unmodified viral spike protein construct.
- a method for producing an immunogenic composition comprising a modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct, the method comprising: identifying at least one antigenic peptide sequence comprised in an unmodified viral spike protein construct, wherein the antigenic peptide sequence comprises 9 consecutive amino acids having at least about 75% sequence identity or 15 consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide comprised in a cross- reactive host polypeptide expressed in a host tissue; and modifying the antigenic peptide sequence of the unmodified viral spike protein construct to have less than about 50% amino acid sequence identity with the cross-reactive host peptide to form the modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct, wherein the modified viral spike protein construct has at least about 50% amino acid sequence identity with the unmodified viral spike protein construct.
- E76 The method of E75, wherein modifying the antigenic peptide sequence to have less than about 50% identity with the cross-reactive host peptide reduces or prevents cross-reactivity of the immunogenic composition to the cross-reactive host peptide compared to the cross-reactivity of an immunogenic composition comprising an unmodified viral spike protein construct having an unmodified antigenic peptide sequence.
- E77 The method of E75 or E76, wherein the immunogenic composition comprising the modified viral spike protein construct elicits an immune response.
- E78 The method of any one of E75-E77, wherein the viral spike protein is a spike protein from an arenavirus, astrovirus, bunyavirus, calicivirus, coronavirus, filovirus, flavivirus, hepadnavirus, hepevirus, orthomyxovirus, paramyxovirus, picomavirus, reovirus, retrovirus, rhabdovirus, or togavirus.
- the viral spike protein is a spike protein from an arenavirus, astrovirus, bunyavirus, calicivirus, coronavirus, filovirus, flavivirus, hepadnavirus, hepevirus, orthomyxovirus, paramyxovirus, picomavirus, reovirus, retrovirus, rhabdovirus, or togavirus.
- E79 The method of any one of E75-E78, wherein nucleic acid is RNA.
- E80 The method of E79, wherein the RNA is double stranded, single stranded, antisense single stranded, messenger RNA (mRNA), self-amplifying RNA (saRNA), and/or modified RNA (modRNA).
- mRNA messenger RNA
- saRNA self-amplifying RNA
- modRNA modified RNA
- E81 The method of E79 or E80, wherein the RNA is comprised in an expression vector.
- E82 The method of any one of E79-E81, wherein the immunogenic composition is an RNA vaccine.
- E83 The method of any one of E75-E78, wherein the nucleic acid is DNA.
- E84 The method of E83, wherein the DNA is double stranded, single stranded, and/or antisense single stranded.
- E85 The method of E83 or E84, wherein the DNA is comprised in an expression vector.
- E87 The method of any one of E75-E78, wherein the immunogenic composition comprises a polypeptide.
- E88 The method of any one of E75-E87, wherein the antigenic peptide sequence of the modified viral spike protein construct has less than about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, or about 10% identity with the cross-reactive host peptide.
- E89 The method of any one of E75-E88, wherein the modified viral spike protein construct has at least about 51%, about 52%, about 53%, about 54%, about 55%, about 56%, about 57%, about 58%, about 59%, about 60%, about 61%, about 62%, about 63%, about 64%, about 65%, about 66%, about 67%, about 68%, about 69%, about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% sequence identity with the unmodified viral spike protein construct.
- E90 The method of any one of E75-E89, wherein the cross-reactive host polypeptide is expressed in heart, brain, kidney, liver, and/or lung tissue.
- E91 The method of any one of E75-E90, wherein the cross-reactive host polypeptide is expressed in heart tissue.
- E92 The method of any one of E75-E91, wherein the cross-reactive host polypeptide is located within the following proteins: nebulette (NEBL), ryanodine receptor 2 (RYR2), ATPase sarcoplasmic/endoplasmic reticulum Ca 2+ transporting 2 (ATP2A2), titin (TTN), kelch like family member 41 (KLHL41), myosin heavy chain 6 (MYH6), myosin heavy chain 7 (MYH7), otogelin (OTOG), nicotinamide nucleotide transhydrogenase (NNT), and/or nebulin related anchoring protein (NRAP).
- NEBL nebulette
- RYR2 ryanodine receptor 2
- TTN titin
- KLHL41 kelch like family member 41
- MYH6 myosin heavy
- myosin 6 MYH6
- ANKRD1 ankyrin repeat domain 1
- SYNPO2L synaptopodin 2- like protein
- MYH7 myosin 7
- SOCS box containing 15 ASB15
- cysteine and glycine rich protein 3 CS
- E93 The method of E92, wherein at least one cross-reactive host polypeptide comprises and/or is located within NEBL. In another embodiment, the method of E92, wherein at least one cross-reactive host polypeptide comprises and/or is located within MYH6. [0119] E94. The method of E92, wherein at least one cross-reactive host polypeptide comprises and/or is located within RYR2. In another embodiment, the method of E92, wherein at least one cross-reactive host polypeptide comprises and/or is located within PCM1
- an immunogenic composition produced according to the method of any one of E46-E74 or E66-E82.
- a method for reducing or preventing cross-reactivity of an antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct comprising: identifying at least one antigenic peptide sequence comprised in an unmodified antigenic polypeptide construct, wherein the antigenic peptide sequence comprises 5 or more consecutive amino acids having at least about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue; and modifying the antigenic peptide sequence of the unmodified antigenic polypeptide construct to produce a modified antigenic peptide sequence having less than about 50% amino acid sequence identity with the cross-reactive host peptide to produce a modified antigenic polypeptide construct comprising the modified antigenic peptide sequence and/or a nucleic acid encoding the modified antigenic polypeptide construct comprising the modified antigenic peptide sequence, wherein the modified antigenic
- a method for reducing or preventing cross-reactivity of an antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct comprising: identifying at least one antigenic peptide sequence comprised in an unmodified antigenic polypeptide construct, wherein the antigenic peptide sequence comprises 9 consecutive amino acids having at least about 75% sequence identity or 15 consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue; and modifying the antigenic peptide sequence of the unmodified antigenic polypeptide construct to produce a modified antigenic peptide sequence having less than about 50% amino acid sequence identity with the cross-reactive host peptide to produce a modified antigenic polypeptide construct comprising the modified antigenic peptide sequence and/or a nucleic acid encoding the modified antigenic polypeptide construct comprising the modified antigenic peptide sequence, wherein the modified
- E97 The method of E96, wherein the modified antigenic polypeptide construct elicits an immune response.
- E98 The method of E96 or E97, wherein the antigenic polypeptide construct is a viral protein, a bacterial protein, a protein of a host parasite, a fungal protein, a cancer protein, or a protein wherein reduction of the concentration of the protein treats a disease or condition.
- E99 The method of E98, wherein the viral protein is a protein from an arenavirus, astrovirus, bunyavirus, calicivirus, coronavirus, filovirus, flavivirus, hepadnavirus, hepevirus, orthomyxovirus, paramyxovirus, picomavirus, reovirus, retrovirus, rhabdovirus, or togavirus.
- the viral protein is a protein from an arenavirus, astrovirus, bunyavirus, calicivirus, coronavirus, filovirus, flavivirus, hepadnavirus, hepevirus, orthomyxovirus, paramyxovirus, picomavirus, reovirus, retrovirus, rhabdovirus, or togavirus.
- E100 The method of E98 or E99, wherein the viral protein is a viral membrane protein, a viral capsid protein, a viral envelope protein, and/or a viral non-structural protein.
- E101 The method of any one of E98-E100, wherein the viral protein is a viral spike protein.
- E102 The method of E98, wherein the bacterial protein is a protein from
- Streptococcus Neisseria, Salmonella, Vibrio, Clostridium, Bacillus, or Mycobacterium .
- E103 The method of E98, wherein the bacterial protein is a bacterial cell surface protein and/or a bacterial cell wall protein.
- E104 The method of E98, wherein the parasite protein is a protein from
- E105 The method of E98, wherein the parasite protein is aparasite cell surface protein and/or a parasite secreted protein.
- E106 The method of E98, wherein the fungal protein is a protein from
- Candida Cryptococcus, or Aspergillus .
- E107 The method of E98, wherein the fungal protein is a fungal cell surface protein and/or a fungal cell wall protein.
- E108 The method of any one of E96-E 107, wherein nucleic acid is RNA.
- E109 The method of E108, wherein the RNA is double stranded, single stranded, antisense single stranded, messenger RNA (mRNA), self-amplifying RNA (saRNA), and/or modified RNA (modRNA).
- mRNA messenger RNA
- saRNA self-amplifying RNA
- modRNA modified RNA
- E110 The method of E108 or E109, wherein the RNA is comprised in an expression vector.
- El 12. The method of El 11, wherein the DNA is double stranded, single stranded, and/or antisense single stranded.
- El 14 The method of any one of E96-E113, wherein the antigenic peptide sequence of the modified antigenic polypeptide construct has less than about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, or about 10% identity with the cross-reactive host peptide.
- El 15. The method of any one of E96-E114, wherein the modified antigenic polypeptide construct has at least about 51%, about 52%, about 53%, about 54%, about 55%, about 56%, about 57%, about 58%, about 59%, about 60%, about 61%, about 62%, about 63%, about 64%, about 65%, about 66%, about 67%, about 68%, about 69%, about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% sequence identity with the unmodified antigenic polypeptide construct.
- El 16. The method of any one of E96-E115, wherein the cross-reactive host polypeptide is expressed in heart, brain, kidney, liver, and/or lung tissue.
- El 17. The method of any one of E96-E116, wherein the cross-reactive host polypeptide is expressed in heart tissue.
- El 18 The method of any one of E96-E117, wherein the cross-reactive host polypeptide is located within the following proteins: nebulette (NEBL), ryanodine receptor 2 (RYR2), ATPase sarcoplasmic/endoplasmic reticulum Ca 2+ transporting 2 (ATP2A2), titin (TTN), kelch like family member 41 (KLHL41), myosin heavy chain 6 (MYH6), myosin heavy chain 7 (MYH7), otogelin (OTOG), nicotinamide nucleotide transhydrogenase (NNT), and/or nebulin related anchoring protein (NRAP).
- myosin 6 MYH6
- ANKRD1 ankyrin repeat domain 1
- SYNPO2L synaptopodin 2-like protein
- MYH7 myosin 7
- SOCS box containing 15 ASB15
- cysteine and glycine rich protein 3 CSRP3
- El 19 The method of El 18, wherein at least one cross-reactive host polypeptide comprises and/or is located within NEBL. In another embodiment, the method of El 18, wherein at least one cross-reactive host polypeptide comprises and/or is located within MYH6.
- E120 The method of El 18, wherein at least one cross-reactive host polypeptide comprises and/or is located within RYR2. In another embodiment, the method of El 18, wherein at least one cross-reactive host polypeptide is located within comprises PCM1. [0146] E121. According to another aspect of the present disclosure, there is provided an immunogenic composition comprising the antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct any one of E96-E120.
- E122 The immunogenic composition of E121, wherein nucleic acid is RNA.
- El 23 The immunogenic composition of El 22, wherein the RNA is double stranded, single stranded, antisense single stranded, messenger RNA (mRNA), self-amplifying RNA (saRNA), and/or modified RNA (modRNA).
- mRNA messenger RNA
- saRNA self-amplifying RNA
- modRNA modified RNA
- E124 The immunogenic composition of E122 or E123, wherein the RNA is comprised in an expression vector.
- El 25 The immunogenic composition of any one of E122-E124, wherein the immunogenic composition is an RNA vaccine.
- E126 The immunogenic composition E121, wherein the nucleic acid is DNA.
- El 27 The immunogenic composition of El 26, wherein the DNA is double stranded, single stranded, and/or antisense single stranded.
- E128 The immunogenic composition of E126 or E127, wherein the DNA is comprised in an expression vector.
- E129 The immunogenic composition of any one of E126-E128, wherein the immunogenic composition is a DNA vaccine.
- El 30 The immunogenic composition of E121, wherein the immunogenic composition comprises a polypeptide.
- a method for reducing or preventing cross-reactivity of a viral spike protein construct and/or a nucleic acid encoding the viral spike protein construct comprising: identifying at least one antigenic peptide sequence of an unmodified viral spike protein construct, wherein the antigenic peptide sequence comprises 5 or more consecutive amino acids having at least about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue; and modifying the antigenic peptide sequence of the unmodified viral spike protein construct to produce a modified antigenic peptide sequence having less than about 50% amino acid sequence identity with the cross- reactive host peptide to produce a modified viral spike protein construct comprising the modified antigenic peptide sequence and/or a nucleic acid encoding the modified viral spike protein construct comprising the modified antigenic peptide sequence, wherein the modified viral spike protein construct has at least about 50% amino acid sequence identity with the un
- a method for reducing or preventing crossreactivity of a viral spike protein construct and/or a nucleic acid encoding the viral spike protein construct comprising: identifying at least one antigenic peptide sequence of an unmodified viral spike protein construct, wherein the antigenic peptide sequence comprises 9 consecutive amino acids having at least about 75% sequence identity or 15 consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue; and modifying the antigenic peptide sequence of the unmodified viral spike protein construct to produce a modified antigenic peptide sequence having less than about 50% amino acid sequence identity with the cross-reactive host peptide to produce a modified viral spike protein construct comprising the modified antigenic peptide sequence and/or a nucleic acid encoding the modified viral spike protein construct comprising the modified antigenic peptide sequence, wherein the modified viral spike protein construct has at least about 50% amino acid sequence identity with
- E131 wherein the modified viral protein construct elicits an immune response.
- E133 The method of E131 or E132, wherein the viral spike protein is a spike protein from an arenavirus, astrovirus, bunyavirus, calicivirus, coronavirus, filovirus, flavivirus, hepadnavirus, hepevirus, orthomyxovirus, paramyxovirus, picomavirus, reovirus, retrovirus, rhabdovirus, or togavirus.
- E134 The method of E131 or E133, wherein nucleic acid is RNA.
- RNA double stranded, single stranded, antisense single stranded, messenger RNA (mRNA), self-amplifying RNA (saRNA), and/or modified RNA (modRNA).
- mRNA messenger RNA
- saRNA self-amplifying RNA
- modRNA modified RNA
- E136 The method of E134 or E135, wherein the RNA is comprised in an expression vector.
- E137 The method of E131 or E133, wherein the nucleic acid is DNA.
- E138 The method of El 37, wherein the DNA is double stranded, single stranded, and/or antisense single stranded.
- E139 The method of E137 or E138, wherein the DNA is comprised in an expression vector.
- E140 The method of any one of E131-E139, wherein the antigenic peptide sequence of the modified viral spike protein construct has less than about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, or about 10% identity with the cross-reactive host peptide.
- E 141 The method of any one of E 131 -E 140, wherein the modified viral spike protein construct has at least about 51%, about 52%, about 53%, about 54%, about 55%, about 56%, about 57%, about 58%, about 59%, about 60%, about 61%, about 62%, about 63%, about
- El 42 The method of any one of E131-E141, wherein the cross-reactive host polypeptide is expressed in heart, brain, kidney, liver, and/or lung tissue.
- El 43 The method of any one of E131-E142, wherein the cross-reactive host polypeptide is expressed in heart tissue.
- El 44 The method of any one of E131-E143, wherein the cross-reactive host polypeptide is located within the following proteins: nebulette (NEBL), ryanodine receptor 2 (RYR2), ATPase sarcoplasmic/endoplasmic reticulum Ca 2+ transporting 2 (ATP2A2), titin (TTN), kelch like family member 41 (KLHL41), myosin heavy chain 6 (MYH6), myosin heavy chain 7 (MYH7), otogelin (OTOG), nicotinamide nucleotide transhydrogenase (NNT), and/or nebulin related anchoring protein (NRAP).
- NEBL nebulette
- RYR2 ryanodine receptor 2
- TTN titin
- KLHL41 myosin heavy chain 6
- MYH7 myosin heavy
- myosin 6 MYH6
- ANKRD1 ankyrin repeat domain 1
- SYNPO2L synaptopodin 2-like protein
- MYH7 myosin 7
- SOCS box containing 15 ASB15
- cysteine and glycine rich protein 3 CSRP3
- El 45 The method of El 44, wherein at least one cross-reactive host polypeptide comprises and/or is located within NEBL.
- an immunogenic composition comprising the viral spike protein construct and/or a nucleic acid encoding the viral spike protein construct any one of E131-146.
- E148 The immunogenic composition of E147, wherein nucleic acid is RNA.
- E149 The immunogenic composition of E148, wherein the RNA is double stranded, single stranded, antisense single stranded, messenger RNA (mRNA), self-amplifying RNA (saRNA), and/or modified RNA (modRNA).
- mRNA messenger RNA
- saRNA self-amplifying RNA
- modRNA modified RNA
- E150 The immunogenic composition of E148 or E149, wherein the RNA is comprised in an expression vector.
- E151 The immunogenic composition of any one of E148-E150, wherein the immunogenic composition is an RNA vaccine.
- E152 The immunogenic composition E147, wherein the nucleic acid is DNA.
- E153 The immunogenic composition of E152, wherein the DNA is double stranded, single stranded, and/or antisense single stranded.
- E154 The immunogenic composition of E152 or E153, wherein the DNA is comprised in an expression vector.
- E155 The immunogenic composition of any one of E152-E154, wherein the immunogenic composition is a DNA vaccine.
- El 56 The immunogenic composition of El 47, wherein the immunogenic composition comprises a polypeptide.
- E157 According to another aspect of the present disclosure, there is provided a method of vaccinating a subject, comprising administering to the subject in need thereof an effective amount of the immunogenic composition of any of any one of E1-E45, E95, E121- E130, or E147-E156.
- E158 A method for treating or preventing an infectious disease, comprising administering to a subject in need thereof an effective amount of the immunogenic composition of any one of E1-E45, E95, E121-E130, or E147-E156.
- E159 The method of E158, wherein the immunogenic composition elicits an immune response comprising an antibody response.
- El 62 A method identifying a potential toxicity of an immunogenic composition in a biological host system, the immunogenic composition comprising an antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct, the method comprising: a. identifying one or more proteins of the host that have a degree of similarity to the antigenic polypeptide construct; b. identifying properties of the one or more proteins, the properties comprising cellular location, gene- and protein-tissue expression profdes, and/or toxic state associations; c. ranking or sorting the one or more proteins using one or more of the properties; d. identifying immunogenicity of the one or more proteins; e. comparing the ranking or sorting in step c. with the immunogenicity of the one or more proteins in step d to produce a degree of correspondence; f. predicting which of the one or more proteins are the most likely to cause a potential toxicity based on the degree of correspondence.
- E165 The method of any one of clauses E162-E164, wherein the immunogenic composition is a vaccine.
- El 66 The method of any one of clauses E162-E165, wherein the method comprises searching a human proteome with a spike protein peptide and identifying a protein from the human proteome with homology to the spike protein peptide.
- E168 The method any one of clauses E162-E167, wherein ranking or sorting the one or more proteins using one or more of the properties comprises ranking cellular locations that are extracellular or on a surface of a cell as more likely to cause the potential toxicity than intracellular locations, ranking gene- and protein-tissue expression profiles that overlap in tissue location of the potential toxicity as more likely to cause the potential toxicity than other tissue locations, and/or ranking toxic state associations that overlap or are related to the potential toxicity as more likely to cause the potential toxicity than other toxic state associations.
- identifying immunogenicity of the one or more proteins comprises identifying a ranking or sorting of degree of immunogenicity and/or degree of potential immunogenicity.
- comparing the ranking or sorting in step c. with the immunogenicity of the one or more proteins in step d to produce a degree of correspondence comprises comparing the rank of likely to cause the potential toxicity and degree of immunogenicity and/or degree of potential immunogenicity and ranking: more likely to cause the potential toxicity and greater degree of immunogenicity and/or degree of potential immunogenicity as a greater degree of correspondence than either of less likely to cause the potential toxicity and greater degree of immunogenicity and/or degree of potential immunogenicity or more likely to cause the potential toxicity and less degree of immunogenicity and/or degree of potential immunogenicity, and either of less likely to cause the potential toxicity and greater degree of immunogenicity and/or degree of potential immunogenicity or more likely to cause the potential toxicity and less degree of immunogenicity and/or degree of potential immunogenicity as a greater degree of correspondence than less likely to cause the potential toxicity and less degree of immunogenicity and/or degree of potential immunogenicity.
- E172 The method any one of clauses E162- E171, wherein each of the steps are performed on a computational model.
- FIG. 1 illustrates a strategy for analyzing antigenic polypeptide constructs for antigenic peptide sequences having high homology with peptides comprised in host proteins to predict an immune response to the antigenic polypeptide construct that will have crossreactivity to the host protein.
- FIG. 2 illustrates a strategy for a viral spike protein-to-human protein peptide homology search.
- FIG. 3 illustrates the concept of molecular mimicry in the context of an mRNA vaccine against a viral spike protein.
- the term “about” is used according to its plain and ordinary meaning in the area of cell and molecular biology to indicate that a value includes the inherent variation or standard deviation of error for the measurement or quantitation method being employed to determine the value.
- the term “about” may encompass a range ofvalues that are within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less of the measurement or quantitation.
- A, B, and/or C includes: A alone, B alone, C alone, a combination of A and B, a combination of A and C, a combination of B and C, or a combination of A, B, and C.
- A, B, and/or C includes: A alone, B alone, C alone, a combination of A and B, a combination of A and C, a combination of B and C, or a combination of A, B, and C.
- “and/or” operates as an inclusive or.
- essentially all is defined as “at least 95%”; if essentially all members of a group have a certain property, then at least 95% of members of the group have that property. In some instances, essentially all means equal to any one of, at least any one of, or between any two of 95, 96, 97, 98, 99, or 100 % of members of the group have that property.
- compositions and methods for their use can “comprise,” “consist essentially of,” or “consist of’ any of the ingredients or steps disclosed throughout the specification.
- the words “comprising” (and any form of comprising, such as “comprise” and “comprises”), “having” (and any form of having, such as “have” and “has”), “including” (and any form of including, such as “includes” and “include”) or “containing” (and any form of containing, such as “contains” and “contain”) are inclusive or open-ended and will be understood to imply the inclusion of a stated step or element or group of steps or elements but not the exclusion of any other step or element or group of steps or elements.
- inhibiting or “reducing” or any variation of these terms includes any measurable decrease or complete inhibition to achieve a desired result
- promote or “increase” or any variation of these terms includes any measurable increase to achieve a desired result or production of a protein or molecule.
- the terms “reference,” “standard,” or “control” describe a value relative to which a comparison is performed. For example, an agent, subject, population, sample, or value of interest is compared with a reference, standard, or control agent, subject, population, sample, or value of interest.
- a reference, standard, or control may be tested and/or determined substantially simultaneously and/or with the testing or determination of interest for an agent, subject, population, sample, or value of interest and/or may be determined or characterized under comparable conditions or circumstances to the agent, subject, population, sample, or value of interest under assessment.
- the term “antigen mimicry,” “molecular mimicry,” and any variation of these terms refers to a phenomenon in which an antigenic peptide or protein sequence used in an immunogenic composition cross-reacts with endogenously-expressed host proteins.
- the endogenously-expressed human proteins act as an “antigen mimic” or “molecular mimic” of the antigenic peptide or protein sequence.
- immune responses raised against the antigenic peptide or protein sequence can cross-react with endogenously-expressed human proteins that share similar or identical peptide sequences (or structures) with the antigenic peptide or protein sequence.
- the concept of molecular mimicry in the context of an mRNA vaccine against a viral spike protein is illustrated in FIG. 3
- the cross-reactive host protein or polypeptide is expressed in heart, brain, kidney, liver, and/or lung tissue.
- the cross-reactive host polypeptide is located withing the following proteins: nebulette (NEBL), ryanodine receptor 2 (RYR2), ATPase sarcoplasmic/endoplasmic reticulum Ca 2+ transporting 2 (ATP2A2), titin (TTN), kelch like family member 41 (KLHL41), myosin heavy chain 6 (MYH6), myosin heavy chain 7 (MYH7), otogelin (OTOG), nicotinamide nucleotide transhydrogenase (NNT), and/or nebulin related anchoring protein (NRAP).
- NEBL nebulette
- RYR2 ryanodine receptor 2
- TTN titin
- KLHL41 kelch like family
- the cross-reactive host protein or polypeptide is expressed in heart, brain, kidney, liver, and/or lung tissue.
- the cross-reactive host polypeptide is located withing the following proteins: myosin 6 (MYH6), ankyrin repeat domain 1 (ANKRD1), synaptopodin 2-like protein (SYNPO2L), myosin 7 (MYH7), ankyrin repeat and SOCS box containing 15 (ASB15), cysteine and glycine rich protein 3 (CSRP3), desmoplakin (DSP), oxoglutarate dehydrogenase (OGDH), ATP synthase-coupling factor 6, mitochondrial (ATP5PF), and/or pericentriolar material 1 protein (PCM1).
- MYH6 myosin 6
- ANKRD1 ankyrin repeat domain 1
- SYNPO2L synaptopodin 2-like protein
- MYH7 myosin 7
- SOCS box containing 15 ASB15
- RNA means a nucleic acid molecule that includes ribonucleotide residues (such as containing the nucleotide base(s) adenine (A), cytosine (C), guanine (G) and/or uracil (U)).
- ribonucleotide means a nucleotide with a hydroxyl group at the 2’ position of a [3-D-ribofuranosyl group.
- RNA can be messenger RNA (mRNA) that relates to a RNA transcript which encodes a peptide or protein.
- mRNA generally contains a 5' untranslated region (5'- UTR), a polypeptide coding region, and a 3' untranslated region (3'-UTR).
- RNA can encompass double stranded RNA, antisense RNA, single stranded RNA, isolated RNA, synthetic RNA, RNA that is recombinantly produced, and modified RNA (modRNA).
- RNA is defined as an RNA molecule that can be recombinant or has been isolated from total genomic nucleic acid.
- a “modified RNA” or “modRNA” refers to an RNA molecule having at least one addition, deletion, substitution, and/or alteration of one or more nucleotides as compared to naturally occurring RNA. Such alterations can refer to the addition of non-nucleotide material to internal RNA nucleotides, or to the 5' and/or 3' end(s) of RNA.
- such modRNA contains at least one modified nucleotide, such as an alteration to the base of the nucleotide.
- a modified nucleotide can replace one or more uridine and/or cytidine nucleotides. For example, these replacements can occur for every instance of uridine and/or cytidine in the RNA sequence, or can occur for only select uridine and/or cytidine nucleotides.
- Such alterations to the standard nucleotides in RNA can include non-standard nucleotides, such as chemically synthesized nucleotides or deoxynucleotides.
- at least one uridine nucleotide can be replaced with 1 -methylpseudouridine in an RNA sequence. Other such altered nucleotides are known to those of skill in the art.
- RNA is produced by in vitro transcription using a DNA template, where DNA refers to a nucleic acid that contains deoxyribonucleotides.
- the RNA can be replicon RNA (replicon), in particular self-replicating RNA, or self-amplifying RNA (saRNA).
- DNA means a nucleic acid molecule that includes deoxyribonucleotide residues (such as containing the nucleotide base(s) adenine (A), cytosine (C), guanine (G) and/or thymine (T)).
- DNA can contain all, or a majority of, deoxyribonucleotide residues.
- deoxyribonucleotide means a nucleotide lacking a hydroxyl group at the 2’ position of a [3-D-ribofiiranosyl group.
- DNA can encompass double stranded DNA, antisense DNA, single stranded DNA, isolated DNA, synthetic DNA, DNA that is recombinantly produced, and modified DNA.
- a “protein,” “polypeptide,” or “peptide” refers to a molecule comprising at least two amino acid residues.
- wild-type refers to the endogenous version of a molecule that occurs naturally in an organism.
- wild-type versions of a protein or polypeptide are employed, however, in many embodiments of the disclosure, a modified protein or polypeptide is employed to generate an immune response.
- a “modified protein” or “modified polypeptide” or a “variant” refers to a protein or polypeptide whose chemical structure, particularly its amino acid sequence, is altered with respect to the wild-type protein or polypeptide.
- a modified/variant protein or polypeptide has at least one modified activity or function (recognizing that proteins or polypeptides may have multiple activities or functions). It is specifically contemplated that a modified/variant protein or polypeptide may be altered with respect to one activity or function yet retain a wild-type activity or function in other respects, such as immunogenicity.
- a protein is specifically mentioned herein, it is in general a reference to a native (wild-type) or recombinant (modified) protein.
- the protein may be isolated directly from the organism of which it is native, produced by recombinant DNA/exogenous expression methods, produced by solid-phase peptide synthesis (SPPS), or other in vitro methods.
- nucleic acid segments and recombinant vectors incorporating nucleic acid sequences that encode a polypeptide (e.g., an antigen or fragment thereof).
- a polypeptide e.g., an antigen or fragment thereof.
- recombinant may be used in conjunction with a polypeptide or the name of a specific polypeptide, and this generally refers to a polypeptide produced from a nucleic acid molecule that has been manipulated in vitro or that is a replication product of such a molecule.
- RNA, DNA, and/or peptides or polypeptides can be used as a modality to treat and/or prevent a number of diseases and/or conditions in mammals, including humans.
- Methods described herein comprise administration of the RNA, DNA, and/or peptides or polypeptides described herein to a mammal, such as a human.
- RNA, DNA, and/or peptides or polypeptides include an antigen-coding RNA or DNA vaccine or a peptide or polypeptide vaccine to induce robust neutralizing antibodies and accompanying/concomitant T-cell response to achieve protective immunization with preferably minimal vaccine doses.
- RNA or DNA can be used to encode at least one antigen intended to generate an immune response in said mammal.
- pathogenic antigenic polypeptide constructs are peptide or protein antigens derived from a pathogen associated with infectious disease, including viruses, bacteria, parasites, and fungi.
- the antigenic polypeptide constructs can comprise one or more antigenic peptide sequences that elicit an immune response.
- the antigenic polypeptide constructs are viral spike protein constructs, and the viral spike protein constructs can comprise one or more antigenic peptide sequences that elicit an immune response.
- Viral antigenic polypeptide constructs can be from a protein from an arenavirus, astrovirus, bunyavirus, calicivirus, coronavirus, filovirus, flavivirus, hepadnavirus, hepevirus, orthomyxovirus, paramyxovirus, picomavirus, reovirus, retrovirus, rhabdovirus, or togavirus, for example.
- the viral protein is a viral membrane protein, a viral capsid protein, a viral envelope protein, and/or a viral non-structural protein.
- the viral protein is a viral spike protein.
- the viral antigenic polypeptide constructs can be selected from antigens derived from viral pathogens including an arenavirus (such as Lassa virus, or lymphocytic choriomeningitis virus (LCMV)); an astrovirus; a bunyavirus (such as a Hantavirus); a calicivirus; a coronavirus (such as a severe acute respiratory syndrome virus (SARS) - e.g.
- an arenavirus such as Lassa virus, or lymphocytic choriomeningitis virus (LCMV)
- an astrovirus such as a Hantavirus
- a bunyavirus such as a Hantavirus
- a calicivirus such as a severe acute respiratory syndrome virus (SARS) - e.g.
- SARS severe acute respiratory syndrome virus
- SARS-CoV-2 SARS-CoV-2, or a middle east respiratory syndrome (MERS) virus
- a filovirus such as Ebola virus or Marburg virus
- a flavivirus such as Yellow Fever virus, West Nile virus, or Hepatitis C virus (HCV)
- HCV Hepatitis C virus
- a hepadnavirus a hepevirus
- an orthomyxovirus such as Influenza A virus, Influenza B virus, or Influenza C virus
- a paramyxovirus such as Rubeola virus, or Rubulavirus
- a picomavirus such as Poliovirus, Hepatitis A virus, or Rhinovirus
- a reovirus such as Rotavirus
- a retrovirus such as Human Immunodeficiency Virus (HIV), or Human T-lymphotropic virus (HTLV)
- a rhabdovirus such as Rabies virus or Rabies lyssavirus
- a togavirus such as Sindbis
- antigenic polypeptide constructs can be from a protein from bacterial pathogens including Staphylococcus, Streptococcus, Neisseria, Salmonella, Vibrio, Clostridium, Bacillus, or Mycobacterium.
- the bacterial antigen is a bacterial protein, and in some embodiments, the bacterial protein is a bacterial membrane protein and/or a bacterial cell wall protein.
- Antigens derived from Staphylococcus species including Methicillin-resistant Staphylococcus aureus (MRSA) that are contemplated for use include virulence regulators, such as the Agr system, Sar and Sae, the Ari system, Sar homologues (Rot, MgrA, SarS, SarR, SarT, SarU, SarV, SarX, SarZ and TcaR), the Srr system and TRAP.
- MRSA Methicillin-resistant Staphylococcus aureus
- Staphylococcus proteins that may serve as antigens include Clp proteins, HtrA, MsrR, aconitase, CcpA, SvrA, Msa, CfvA and CfvB (see, e.g., Staphylococcus: Molecular Genetics, 2008 Caister Academic Press, Ed. Jodi Lindsay).
- the genomes for two species of Staphylococcus aureus (N315 and Mu50) have been sequenced and are publicly available, for example at PATRIC (PATRIC: The VBI PathoSystems Resource Integration Center, Snyder et al., 2007).
- Staphylococcus proteins for use as antigens may also be identified in other public databases such as GenBank®, Swiss-Prot®, and TrEMBL®.
- Antigens derived from Streptococcus pneumoniae that are contemplated for use in certain embodiments described herein include pneumolysin, PspA, choline -binding protein A (CbpA), NanA, NanB, SpnHL, PavA, LytA, Pht, and pilin proteins (RrgA; RrgB; RrgC).
- Antigenic proteins of Streptococcus pneumoniae are also known in the art and may be used as an antigen in some embodiments (see, e.g., Zysk et al., 2000).
- antigenic polypeptide constructs examples include, but are not limited to, Actinomyces polypeptides, Bacillus polypeptides, Bacteroides polypeptides, Bordetella polypeptides, Bartonella polypeptides, Borrelia polypeptides (e.g., B.
- influenzae type b outer membrane protein Helicobacter polypeptides, Klebsiella polypeptides, L-form bacteria polypeptides, Leptospira polypeptides, Listeria polypeptides, Mycobacteria polypeptides, Mycoplasma polypeptides, Neisseria polypeptides, Neorickettsia polypeptides, Nocardia polypeptides, Pasteurella polypeptides, Peptococcus polypeptides, Peptostreptococcus polypeptides, Pneumococcus polypeptides (i.e., S.
- pneumoniae polypeptides Proteus polypeptides, Pseudomonas polypeptides, Rickettsia polypeptides, Rochalimaea polypeptides, Salmonella polypeptides, Shigella polypeptides, Staphylococcus polypeptides, group A streptococcus polypeptides (e.g., S. pyogenes M proteins), group B streptococcus (S. agalactiae) polypeptides, Treponema polypeptides, and Yersinia polypeptides (e.g., Y. pestis Fl and V antigens).
- group A streptococcus polypeptides e.g., S. pyogenes M proteins
- group B streptococcus (S. agalactiae) polypeptides e.g., Treponema polypeptides
- Yersinia polypeptides e.
- one or more of the bacterial pathogens and/or one or more bacterial antigens in the above lists may be excluded.
- the antigenic polypeptide constructs can be from a protein from parasitic pathogens including Leishmania, Plasmodium, or Schistosoma.
- the parasite antigen is a parasite protein, and in some embodiments, the parasite protein is a parasite cell surface protein and/or a parasite secreted protein.
- parasite antigens that can be used for antigenic polypeptide constructs include, but are not limited to, Babesia polypeptides, Balantidium polypeptides, Besnoitia polypeptides, Cryptosporidium polypeptides, Eimeria polypeptides, Encephalitozoon polypeptides, Entamoeba polypeptides, Giardia polypeptides, Hammondia polypeptides, Hepatozoon polypeptides, Isospora polypeptides, Leishmania polypeptides, Microsporidia polypeptides, Neospora polypeptides, Nosema polypeptides, Pentatrichomonas polypeptides, Plasmodium polypeptides, Acanthocheilonema polypeptides, Aelurostrongylus polypeptides, Ancylostoma polypeptides, Angiostrongylus polypeptides, Ascaris polypeptides, Brugia polypeptides, Bunostom
- PfCSP falciparum circumsporozoite
- PfSSP2 sporozoite surface protein 2
- PfLSAl c- term carboxyl terminus of liver state antigen 1
- PfExp-1 exported protein 1
- Pneumocystis polypeptides Sarcocystis polypeptides
- Schistosoma polypeptides Theileria polypeptides, Toxoplasma polypeptides, Trypanosoma polypeptides, and polypeptides (including antigens as well as allergens) from fleas; ticks, including hard ticks and soft ticks; flies, such as midges, mosquitoes, sand flies, black flies, horse flies, horn flies, deer flies, tsetse flies, stable flies, myiasis-causing flies and biting gnats; ants; spiders, lice; mites; and true bugs, such as bed bugs and kiss
- antigenic polypeptide constructs can be from a protein from fungal pathogens including Candida, Cryptococcus, or Aspergillus .
- the fungal antigen is a fungal protein, and in some embodiments, the fungal protein is a fungal surface protein and/or a fungal cell wall protein.
- fungal antigens that can be used for antigenic polypeptide constructs include, but are not limited to, Absidia polypeptides, Acremonium polypeptides, Alternaria polypeptides, Aspergillus polypeptides, Basidiobolus polypeptides, Bipolaris polypeptides, Blastomyces polypeptides, Candida polypeptides, Coccidioides polypeptides, Conidiobolus polypeptides, Cryptococcus polypeptides, Curvalaria polypeptides, Epidermophyton polypeptides, Exophiala polypeptides, Geotrichum polypeptides, Histoplasma polypeptides, Madurella polypeptides, Malassezia polypeptides, Microsporum polypeptides, Moniliella polypeptides, Mortierella polypeptides, Mucor polypeptides, Paecilomyces polypeptides, Penicillium polypeptides, Phialemonium polypeptides, Phialophora polypeptide
- antigenic polypeptide constructs can be from a protein from a cancer protein, or a protein wherein reduction of the concentration of the protein treats a disease or condition.
- Exemplary tumor-/cancer-associated antigens and tumor neoantigens that can be used for antigenic polypeptide constructs include EBNA, CD123, HER1, HER2, CA-125, CA 19-9, CA 72-4, CA 15-3 ⁇ CA 27.29 ⁇ BCAA, CA-195, CA- 242, CA-50, CA LX, MN-CA IX, TRAIL/DR4, CD2, CD5, CD7, CD19, CD20, CD22, CD23, CD24, CD30, CD33, CD38, CD44v6, CD47, CD56, CD68/P1, CD70, CD97, CD99, CD123, CD 171, CD 179, CD200, CD319 (CS1), HLA-G, carcinoembryonic antigen, alphafetoprotein,
- ART-4 CAMEL, CEA, Cyp-B, hTERT, hTRT, iCE, MUC1, MUC2, MUC16, MUC18, Phosphoinositide 3-kinases (PI3Ks), TRK receptors, PRAME, P15, P16, RU1, RU2, SART-1, SART-3, Wilms’ tumor antigen (WT1), AFP, [3-catenin, Caspase-8/m, CDK-4/m, ELF2M, GnT-V, G250, HAGE, HSP70-2M, HST-2, KIAA0205, MUM-1, MUM-2, MUM-3, Myosin/m, RAGE, SART-2, TRP-2/INT2, 707-AP, Annexin II, CDC27/m, TPI/mbcr-abl, BCR-ABL, E2A-PRL, H4-RET, IGH-IGK, MYL-RAR, interferon regulatory factor 4 (
- sequences for antigens are known in the art, for example, in the GenBank® database: CD 19 (Accession No. NG_007275.1), EBNA (Accession No. NG_002392.2), WT1 (Accession No. NG_009272.1), CD 123 (Accession No. NC_000023.11), NY-ESO (Accession No. NC_000023.11), EGFRvIII (Accession No. NG_007726.3), MUC1 (Accession No. NG_029383.1), HER2 (Accession No. NG_007503.1), CA-125 (Accession No. NG_055257.1), WT1 (Accession No.
- Tumor-associated antigens may be derived from prostate, breast, colorectal, lung, pancreatic, renal, mesothelioma, ovarian, liver, brain, bone, stomach, spleen, testicular, cervical, anal, gall bladder, thyroid, or melanoma cancers, as examples.
- Exemplary tumor- associated antigens or tumor cell-derived antigens include MAGE 1, 3, and MAGE 4 (or other MAGE antigens such as those disclosed in International Patent Publication No. WO 99/40188); PRAME; BAGE; RAGE, Lü (also known as NY ESO 1); SAGE; and HAGE or GAGE.
- tumor antigens are expressed in a wide range of tumor types such as melanoma, lung carcinoma, sarcoma, and bladder carcinoma. See, e.g., U.S. Patent No. 6,544,518.
- Prostate cancer tumor-associated antigens include, for example, prostate specific membrane antigen (PSMA), prostate-specific antigen (PSA), prostate-carcinoma tumor antigen- 1 (PCTA-1), prostatic acid phosphates, NKX3.1, and six-transmembrane epithelial antigen of the prostate (STEAP).
- one or more of the tumor-/cancer-associated antigens in the above list may be excluded.
- antigenic polypeptide constructs can be from a protein from Acinetobacter baumannii, Anciplcisma genus, Anciplcisma phagocy tophilum, Ancylostoma braziliense, Ancylostoma duodenale, Arcanobacterium haemolyticum, Ascaris lumbricoides, Aspergillus genus, Astroviridae, Babesia genus, Bacillus anthracis, Bacillus cereus, Bartonella henselae, BK virus, Blastocystis hominis, Blastomyces dermatitidis, Bordetella pertussis, Borrelia burgdorferi, Borrelia genus, Borrelia spp, Brucella genus, Brugia malayi, Bunyaviridae family, Burkholderia cepacia and other Burkholderia species, Burkholderia mallei
- viruses include, but are not limited to, those caused and/or impacted by viral infection.
- viruses include, but are not limited to, an arenavirus (such as Lassa virus, or lymphocytic choriomeningitis virus (LCMV)); an astrovirus; a bunyavirus (such as a Hantavirus); a calicivirus; a coronavirus (such as a severe acute respiratory syndrome virus (SARS) - e.
- SARS-CoV-2 SARS-CoV-2, or a middle east respiratory syndrome (MERS) virus
- a filovirus such as Ebola virus or Marburg virus
- a flavivirus such as Yellow Fever virus, West Nile virus, or Hepatitis C virus (HCV)
- HCV Hepatitis C virus
- a hepadnavirus a hepevirus
- an orthomyxovirus such as Influenza A virus, Influenza B virus, or Influenza C virus
- a paramyxovirus such as Rubeola virus, or Rubulavirus
- a picomavirus such as Poliovirus, Hepatitis A virus, or Rhinovirus
- a reovirus such as Rotavirus
- a retrovirus such as Human Immunodeficiency Virus (HIV), or Human T-lymphotropic virus (HTLV)
- a rhabdovirus such as Rabies virus or Rabies lyssavirus
- a togavirus such as Sindbis
- Conditions and/or diseases that can be treated with the RNA, DNA, and/or peptide or polypeptide compositions include, but are not limited to, those caused and/or impacted by bacteria, fungi, parasites, cancer, rare diseases, and other diseases or conditions caused by overproduction, underproduction, or improper production of proteins, DNA, or RNA, such as mRNA or siRNA.
- an antigen intended to generate an immune response is encoded by a nucleic acid.
- the nucleic acid encodes one or more peptide or protein antigen(s) derived from a pathogen associated with one or more infectious disease(s), including virus(es), bacteria, parasite(s), and fungi.
- the nucleic acids encoding the antigenic polypeptide constructs can comprise one or more nucleotide sequences corresponding to one or more antigenic peptide sequences that elicit an immune response.
- Nucleic acid sequences can exist in a variety of instances such as: isolated segments; recombinant vectors of incorporated sequences or recombinant polynucleotides encoding polypeptides, such as antigens or one or both chains of an antibody, or a fragment, derivative, mutein, or variant thereof; polynucleotides sufficient for use as hybridization probes, PCR primers, or sequencing primers for identifying, analyzing, mutating or amplifying a polynucleotide; anti-sense nucleic acids for inhibiting expression of a polynucleotide; mRNA; saRNA; and complementary sequences of the foregoing described herein.
- Nucleic acids may encode an antigen or epitope to which antibodies may bind.
- Nucleic acids encoding fusion proteins that include antigens or epitopes are also provided.
- the nucleic acids can be singlestranded or double-stranded and can comprise RNA and/or DNA nucleotides and artificial variants thereof (e.g., peptide nucleic acids).
- polynucleotide refers to a nucleic acid molecule that can be recombinant or has been isolated from total genomic nucleic acid. Included within the term “polynucleotide” are oligonucleotides (nucleic acids 100 residues or less in length), recombinant vectors, including, for example, plasmids, cosmids, phage, viruses, and the like. Polynucleotides include, in certain aspects, regulatory sequences, isolated substantially away from their naturally occurring genes or protein encoding sequences.
- Polynucleotides may be singlestranded (coding or antisense) or double- stranded, and may be RNA, DNA (genomic, cDNA or synthetic), analogs thereof, or a combination thereof. Additional coding or non-coding sequences may, but need not, be present within a polynucleotide.
- the term “gene” is used to refer to a nucleic acid that encodes a protein, polypeptide, or peptide (including any sequences required for proper transcription, post-translational modification, or localization). As will be understood by those in the art, this term encompasses genomic sequences, expression cassettes, cDNA sequences, and smaller engineered nucleic acid segments that express, or may be adapted to express, proteins, polypeptides, domains, peptides, fusion proteins, and mutants. A nucleic acid encoding all or part of a polypeptide may contain a contiguous nucleic acid sequence encoding all or a portion of such a polypeptide. It also is contemplated that a particular polypeptide may be encoded by nucleic acids containing variations having slightly different nucleic acid sequences but, nonetheless, encode the same or substantially similar polypeptide.
- polynucleotide variants having substantial identity to the sequences disclosed herein; those comprising equal to any one of, at least any one of, at most any one of, or between any two of 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or higher sequence identity, compared to a polynucleotide sequence provided herein using the methods described herein (e.g., BLAST analysis using standard parameters).
- the isolated polynucleotide will comprise a nucleotide sequence encoding a polypeptide that has at least 90% identity to an amino acid sequence described herein, over the entire length of the sequence; or a nucleotide sequence complementary to said isolated polynucleotide. In some embodiments, the isolated polynucleotide will comprise a nucleotide sequence encoding a polypeptide that has at least 95% identity to an amino acid sequence described herein, over the entire length of the sequence; or a nucleotide sequence complementary to said isolated polynucleotide.
- nucleic acid segments regardless of the length of the coding sequence itself, may be combined with other nucleic acid sequences, such as promoters, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, other coding segments, and the like, such that their overall length may vary considerably.
- the nucleic acids can be any length.
- nucleotides in length can comprise one or more additional sequences, for example, regulatory sequences, and/or be a part of a larger nucleic acid, for example, a vector.
- a nucleic acid fragment of almost any length may be employed, with the total length being limited by the ease of preparation and use in the intended recombinant nucleic acid protocol.
- a nucleic acid sequence may encode a polypeptide sequence with additional heterologous coding sequences, for example to allow for purification of the polypeptide, transport, secretion, post-translational modification, or for therapeutic and/or prophylatic benefits such as targeting or efficacy.
- a tag or other heterologous polypeptide may be added to the modified polypeptide -encoding sequence, wherein “heterologous” refers to a polypeptide that is not the same as the modified polypeptide.
- the one or more antigenic polypeptide constructs and/or antigenic peptide sequences thereof encoded by a nucleic acid elicit an immune response.
- the immune response may be against the antigenic polypeptide constructs and/or antigenic peptide sequences and/or a homologous endogenously-expressed (e.g. cross-reactive) host protein.
- the antigenic polypeptide constructs and/or antigenic peptide sequences and the homologous endogenously-expressed (e.g. cross-reactive) host protein may be equal to any one of, at least any one of, at most any one of, or between any two of 50%, 51%, 52%, 53%, 54%, 55%, 56%,
- the nucleic acids may comprise equal to any one of, at least any one of, at most any one of, or between any two of 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40,
- the one or more antigenic polypeptide constructs and/or antigenic peptide sequence thereof encoded by a nucleic acid are modified such that the antigenic polypeptide constructs and/or antigenic peptide sequences thereof continue to elicit an immune response but homology with a homologous endogenously-expressed (e.g., cross- reactive) host protein is reduced to reduce or prevent cross-reactivity of the immune response to the host protein after immunization with a nucleic acid encoding the antigenic polypeptide constructs and/or antigenic peptide sequences thereof.
- a homologous endogenously-expressed host protein e.g., cross- reactive
- the homology between the antigenic polypeptide constructs and/or antigenic peptide sequences and the homologous endogenously- expressed (e.g., cross-reactive) host protein may be reduced by modifying the nucleic acid encoding the antigenic polypeptide constructs and/or antigenic peptide sequences thereof such that the nucleic acid encoding the antigenic polypeptide constructs and/or antigenic peptide sequences and the nucleic acid, e.g., genomic DNA, mRNA, or cDNA, encoding the homologous endogenously-expressed (e.g., cross-reactive) host protein may be equal to any one of, at least any one of, at most any one of, or between any two of 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 2
- the nucleic acids of the disclosure encoding the modified antigenic polypeptide constructs and/or modified antigenic peptide sequences thereof may include equal to any one of, at least any one of, at most any one of, or between any two of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more mutations in the sequence encoding the modified antigenic polypeptide constructs and/or modified antigenic peptide compared to nucleic acids, e.g., genomic DNA, mRNA, cDNA, encoding unmodified antigenic polypeptide constructs and/or unmodified antigenic peptide sequences
- the portions of the nucleic acids of the disclosure encoding the modified antigenic polypeptide constructs and/or modified antigenic peptide sequences thereof may equal to any one of, at least any one of, at most any one of, or between any two of 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%,
- Changes can be introduced by mutation into a nucleic acid, thereby leading to changes in the amino acid sequence of a polypeptide (e.g., an antigen or antibody or antibody derivative) that it encodes. Mutations can be introduced using any technique known in the art. In one embodiment, one or more particular amino acid residues are changed using, for example, a site-directed mutagenesis protocol. In another embodiment, one or more randomly selected residues are changed using, for example, a random mutagenesis protocol. In some instances, however it is made, a mutant polypeptide can be expressed and screened for a desired property. [0017] Mutations can be introduced into a nucleic acid without significantly altering the biological activity of a polypeptide that it encodes.
- one or more mutations can be introduced into a nucleic acid that selectively changes the biological activity of a polypeptide that it encodes. See, e.g. , Romain Studer et al., Biochem. J. 449:581-594 (2013).
- the mutation can quantitatively or qualitatively change the biological activity. Examples of quantitative changes include increasing, reducing or eliminating the activity. Examples of qualitative changes include altering the antigen specificity of an antibody.
- the RNA molecule described herein is a coding RNA molecule.
- Coding RNA includes a functional RNA molecule that may be translated into a peptide or polypeptide.
- the coding RNA molecule includes at least one open reading frame coding for at least one peptide or polypeptide.
- the coding RNA molecule may include one (monocistronic), two (bicistronic) or more (multicistronic) open reading frames (ORFs), which may be a sequence of codons that is translatable into a polypeptide or protein of interest.
- the coding RNA molecule may be a messenger RNA (mRNA) molecule, viral RNA molecule, or self-amplifying RNA molecule (saRNA, also referred to as a replicon).
- mRNA messenger RNA
- saRNA self-amplifying RNA molecule
- the RNA molecule is an mRNA.
- the RNA molecule is a saRNA.
- the saRNA molecule may be a coding RNA molecule.
- the RNA molecule may encode one polypeptide of interest or more, such as an antigen or more than one antigen, e.g., two, three, four, five, six, seven, eight, nine, ten, or more polypeptides.
- one RNA molecule may also encode more than one polypeptide of interest or more, such as an antigen, e.g., a bicistronic, or tricistronic RNA molecule that encodes different or identical antigens.
- the sequence of the RNA molecule may be codon optimized or deoptimized for expression in a desired host, such as a human cell.
- the RNA molecule includes equal to any one of, at least any one of, at most any one of, or between any two of from about 20 to about 100,000 nucleotides (e.g., equal to any one of, at least any one of, at most any one of, or between any two of from 30 to 50, from 30 to 100, from 30 to 250, from 30 to 500, from 30 to 1,000, from 30 to 1,500, from 30 to 3,000, from 30 to 5,000, from 30 to 7,000, from 30 to 10,000, from 30 to 25,000, from 30 to 50,000, from 30 to 70,000, from 100 to 250, from 100 to 500, from 100 to 1,000, from 100 to 1,500, from 100 to 3,000, from 100 to 5,000, from 100 to 7,000, from 100 to 10,000, from 100 to 25,000, from 100 to 50,000, from 100 to 70,000, from 100 to 100,000, from 500 to 1,000, from 500 to 1,500, from 500 to 2,000, from 500 to 3,000, from 500 to 5,000, from 500 to 7,000, from 500 to
- the RNA molecule includes at least 100 nucleotides.
- the RNA has a length between 100 and 15,000 nucleotides; between 7,000 and 16,000 nucleotides; between 8,000 and 15,000 nucleotides; between 9,000 and 12,500 nucleotides; between 11,000 and 15,000 nucleotides; between 13,000 and 16,000 nucleotides; between 7,000 and 25,000 nucleotides.
- one or more of the nucleotide size ranges in the list may be excluded.
- the sequence of the RNA molecule may be modified if desired, for example to increase the efficacy of expression or replication of the RNA, or to provide additional stability or resistance to degradation.
- the RNA sequence may be modified with respect to its codon usage, for example, to increase translation efficacy and half-life of the RNA.
- the RNA molecules may include one or more structural and/or chemical modifications or alterations which impart useful properties to the polynucleotide including, in some embodiments, the lack of a substantial induction of the innate immune response of a cell into which the polynucleotide is introduced.
- a “structural” feature or modification is one in which two or more linked nucleotides are inserted, deleted, duplicated, inverted or randomized in an RNA molecule without significant chemical modification to the nucleotides themselves. Because chemical bonds will necessarily be broken and reformed to effect a structural modification, structural modifications are of a chemical nature and hence are chemical modifications. However, structural modifications will result in a different sequence of nucleotides.
- the polynucleotide “ATCG” may be chemically modified to “AT-5meC-G”.
- the same polynucleotide may be structurally modified from “ATCG” to “ATCCCG”.
- the dinucleotide “CC” has been inserted, resulting in a structural modification to the polynucleotide.
- the RNA molecule may include one or more modified nucleotides in addition to any 5' cap structure. Naturally occurring nucleotide modifications are known in the art. [0025] In some embodiments, the RNA molecule does not include modified nucleotides, e.g., does not include modified nucleobases, and all of the nucleotides in the RNA molecule are conventional standard ribonucleotides A, U, G, and C, with the exception of an optional 5' cap that may include, for example, 7-methylguanosine, which is further described below. In some embodiments, the RNA may include a 5' cap comprising a 7'-methylguanosine, and the first 1, 2 or 3 5' ribonucleotides may be methylated at the 2' position of the ribose.
- Modified nucleobases which may be incorporated into modified nucleosides and nucleotides and be present in the RNA molecules include, for example, m5C (5- methylcytidine), m5U (5 -methyluridine), m6A (N6-methyladenosine), s2U (2- thiouridine), Um (2'-0-methyluridine), mlA (1 -methyladenosine); m2A (2- methyladenosine); Am (2-1-0- methyladenosine); ms2m6A (2-methylthio-N6- methyladenosine); i6A (N6- isopentenyladenosine); ms2i6A (2-methylthio- N6isopentenyladenosine); io6A (N6-(cis- hydroxyisopentenyl)adenosine); ms2io6A (2- methylthio-N6-(cis), methyl
- Additional exemplary modified nucleotides include any one of N-l- methylpseudouridine; pseudouridine, N6-methyladenosine, 5 -methylcytidine, and 5- methyluridine.
- the modified nucleotide is N-l -methylpseudouridine.
- the RNA molecule may include phosphoramidate, phosphorothioate, and/or methylphosphonate linkages.
- the RNA molecule includes a modified nucleotide selected from any one of pseudouridine, N1 -methylpseudouridine, N1 -ethylpseudouridine, 2- thiouridine, 4 '-thiouridine, 5-methylcytosine, 5 -methyluridine, 2-thio-l -methyl- 1 -deazapseudouridine, 2-thio-l-methyl-pseudouridine, 2-thio-5-aza-uridine, 2-thio- dihydropseudouridine, 2-thio-dihydrouridine, 2-thio-pseudouridine, 4-methoxy-2-thio- pseudouridine, 4-methoxy-pseudouridine, 4-thio-l -methyl -pseudouridine
- the UTR is derived from an mRNA that is naturally abundant in a specific tissue (e.g., lymphoid tissue), to which the mRNA expression is targeted.
- the UTR increases protein synthesis.
- the UTR may increase protein synthesis by increasing the time that the mRNA remains in translating polysomes (message stability) and/or the rate at which ribosomes initiate translation on the message (message translation efficiency).
- the UTR sequence may prolong protein synthesis in a tissue-specific manner.
- the 5' UTR and the 3' UTR sequences are computationally derived.
- the 5' UTR and the 3' UTRs are derived from a naturally abundant mRNA in a tissue.
- the tissue may be, for example, liver, a stem cell, or lymphoid tissue.
- the lymphoid tissue may include, for example, any one of a lymphocyte (e.g., a B-lymphocyte, a helper T- lymphocyte, a cytotoxic T-lymphocyte, a regulatory T-lymphocyte, or a natural killer cell), a macrophage, a monocyte, a dendritic cell, a neutrophil, an eosinophil and a reticulocyte.
- the 5' UTR and the 3' UTR are derived from an alphavirus.
- the 5' UTR and the 3' UTR are from a wild-type alphavirus. Examples of alphaviruses are described below. [0031]
- the RNA molecule includes a 5 ' UTR and the 3 ' UTR derived from a naturally abundant mRNA in a tissue.
- the RNA molecule includes a 5' UTR and the 3' UTR derived from an alphavirus.
- the RNA molecule includes a 5 ' UTR and the 3 ' UTR from a wild-type alphavirus .
- the RNA molecule includes a 5' cap.
- the 5' and 3' UTRs may be operably linked to an ORF, which may be a sequence of codons that is capable of being translated into a polypeptide of interest.
- ORF an open reading frame
- the RNA molecule may include one (monocistronic), two (bicistronic) or more (multicistronic) open reading frames (ORFs).
- the ORF encodes a modified antigenic polypeptide construct.
- the ORF further includes one or more subgenomic promoters.
- the RNA molecule includes a subgenomic promoter operably linked to the ORF.
- the subgenomic promoter comprises a cisacting regulatory element.
- the cis-acting regulatory element is an AU- rich element.
- the AU-rich element is au, auaaaagau, auaaaagau, auag, auauauauau, auauauau, auauauauauau, augaugaugau, augau, auaaaagaua, or auaaaagaug.
- a RNA molecule may include (i) an ORF encoding a replicase which may transcribe RNA from the RNA molecule and (ii) an ORF encoding at least one modified antigenic polypeptide construct.
- the polymerase may be an alphavirus replicase, e.g., including any one of the non-structural alphavirus proteins nsPl, nsP2, nsP3 and nsP4, or a combination thereof.
- the RNA molecule includes alphavirus nonstructural protein nsPl.
- the RNA molecule includes alphavirus nonstructural protein nsP2.
- the RNA molecule includes alphavirus nonstructural protein nsP3. In some embodiments, the RNA molecule includes alphavirus nonstructural protein nsP4. In some embodiments, the RNA molecule includes alphavirus nonstructural proteins nsPl, nsP2, and nsP3. In some embodiments, the RNA molecule includes alphavirus nonstructural proteins nsPl, nsP2, nsP3, and nsP4. In some embodiments, the RNA molecule includes any combination of nsPl, nsP2, nsP3, and nsP4. In some embodiments, the RNA molecule does not include nsP4.
- the RNA molecule does not encode alphavirus structural proteins.
- the RNA molecule may have one or more additional (e.g., downstream) open reading frames, e.g., to encode further antigen(s) or to encode accessory polypeptides.
- a first RNA molecule does not include an ORF encoding a modified antigenic polypeptide or protein
- a second RNA or a saRNA molecule includes an ORF encoding the modified antiogenic polypeptide or protein.
- the first RNA molecule does not include a subgenomic promoter.
- the first RNA molecule includes an ORF for a nonstructural protein derived from an alphavirus.
- the ORF encoding a nonstructural protein in the first RNA molecule and in the second RNA or the saRNA molecule are identical.
- the second RNA or the saRNA molecule further includes an ORF encoding a modified antiogenic polypeptide or protein.
- the second RNA or the saRNA molecule may lead to a production of genomic RNA copies of itself in a cell, but not to the production of RNA- containing virions.
- the second RNA or the saRNA molecule cannot perpetuate itself in infectious form.
- the genes encoding alphavirus structural proteins, which are necessary for perpetuation in wild-type alphaviruses are absent from the second RNA or saRNA molecules of the present disclosure, and their place is taken by a gene(s) encoding the polypeptide of interest, such that the subgenomic transcript encodes the modified antiogenic polypeptide or protein, rather than the structural alphavirus virion proteins.
- the RNA molecule described herein may include a gene of interest.
- the gene of interest can encode a polypeptide of interest selected from, e.g., biologies, antibodies, vaccines, therapeutic polypeptides or peptides, cell penetrating peptides, secreted polypeptides, plasma membrane polypeptides, cytoplasmic or cytoskeletal polypeptides, intracellular membrane bound polypeptides, nuclear polypeptides, polypeptides associated with human disease, targeting moieties or those polypeptides encoded by the human genome for which no therapeutic indication has been identified but which nonetheless have utility in areas of research and discovery.
- a polypeptide of interest selected from, e.g., biologies, antibodies, vaccines, therapeutic polypeptides or peptides, cell penetrating peptides, secreted polypeptides, plasma membrane polypeptides, cytoplasmic or cytoskeletal polypeptides, intracellular membrane bound polypeptides, nuclear polypeptides, polypeptide
- the sequence for a particular gene of interest is readily identified by one of skill in the art using public and private databases, e.g. , GenBank.
- the RNA molecule includes a coding region for an antigen derived from a pathogen associated with infectious disease or cancer, as described elsewhere herein.
- the RNA molecule described herein includes a 5' cap.
- the 5 '-cap moiety is a natural 5 '-cap.
- a “natural 5 '-cap” is defined as a cap that includes 7-methylguanosine connected to the 5' end of an mRNA molecule through a 5' to 5' triphosphate linkage.
- the 5 '-cap moiety is a 5'- cap analog.
- the 5' end of the RNA is capped with a modified ribonucleotide, which may be incorporated during RNA synthesis (e.g., co-transcriptional capping) or may be enzymatically engineered after RNA transcription (e.g., post-transcriptional capping).
- the 5' end of the RNA molecule is capped with a modified ribonucleotide via an enzymatic reaction after RNA transcription.
- capping is performed after purification, e.g., tangential flow filtration, of the RNA molecule.
- an exemplary enzymatic reaction for capping may include use of Vaccinia Virus Capping Enzyme (VCE)
- the 5' terminal cap includes a cap analog, for example, a 5' terminal cap may include a guanine analog.
- Exemplary guanine analogs include, but are not limited to, inosine, N1 -methyl -guanosine, 2'fluoro-guanosine, 7-deaza-guanosine, 8-oxo-guanosine, 2-amino- guanosine, LNA-guanosine, and 2-azido-guanosine.
- the capping region may include a single cap or a series of nucleotides forming the cap.
- the capping region may be equal to any one of, at least any one of, at most any one of, or between any two of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or at least 2, or 10 or fewer nucleotides in length.
- the cap is absent.
- a first and/or second operational region of the RNA may be equal to any one of, at least any one of, at most any one of, or between any two of 3 to 40, e.g. , 5-30, 10-20, 15, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, or at least 4, or 30 or fewer nucleotides in length and may comprise, in addition to a Start and/or Stop codon, one or more signal and/or restriction sequences.
- poly A tail refers to a stretch of consecutive adenine residues, which may be attached to the 3' end of the RNA molecule.
- the poly-A tail may increase the half-life of the RNA molecule.
- Poly-A tails may play key regulatory roles in enhancing translation efficiency and regulating the efficiency of mRNA quality control and degradation. Short sequences or hyperpolyadenylation may signal for RNA degradation.
- Exemplary designs include a poly-A tails of about 40 adenine residues to about 80 adenine residues.
- the RNA molecule further includes an endonuclease recognition site sequence immediately downstream of the poly A tail sequence.
- the RNA molecule further includes a poly-A polymerase recognition sequence (e.g., AAUAAA) near its 3' end.
- a poly-A polymerase recognition sequence e.g., AAUAAA
- a “full length” RNA molecule is one that includes a 5 '-cap and a poly A tail.
- the poly A tail includes 5-400 nucleotides in length.
- the poly A tail nucleotide length may be equal to any one of, at least any one of, at most any one of, or between any two of 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, and 400.
- the RNA molecule includes a poly A tail that includes about 25 to about 400 adenosine nucleotides, a sequence of about 50 to about 400 adenosine nucleotides, a sequence of about 50 to about 300 adenosine nucleotides, a sequence of about 50 to about 250 adenosine nucleotides, a sequence of about 60 to about 250 adenosine nucleotides, or a sequence of about 40 to about 100 adenosine nucleotides.
- the RNA molecule includes a poly A tail includes a sequence of greater than 30 adenosine nucleotides (“As”).
- the RNA molecule includes a poly A tail that includes about 40 As. In some embodiments, the RNA molecule includes a poly A tail that includes about 80 As. As used herein, regarding poly A tail length, the term “about” refers to a deviation of ⁇ 10% of the value(s) to which it is attached.
- the 3' poly-A tail has a stretch of at least 10 consecutive adenosine residues and at most 300 consecutive adenosine residues. In some embodiments, the RNA molecule includes at least 20 consecutive adenosine residues and at most 40 consecutive adenosine residues. In some embodiments, the RNA molecule includes about 40 consecutive adenosine residues. In some embodiments, the RNA molecule includes about 80 consecutive adenosine residues.
- the RNA molecule is purified, e.g., such as by filtration that may occur via, e.g., ultrafiltration, diafiltration, or, e.g., tangential flow ultrafiltration/ diafiltration .
- the RNA molecule is a saRNA.
- saRNA self-amplifying RNA
- replicon refer to RNA with the ability to replicate itself.
- Self-amplifying RNA molecules may be produced by using replication elements derived from a virus or viruses, e.g. , alphaviruses, and substituting the structural viral polypeptides with a nucleotide sequence encoding a polypeptide of interest.
- a self-amplifying RNA molecule is typically a positivestrand molecule that may be directly translated after delivery to a cell, and this translation provides an RNA-dependent RNA polymerase which then produces both antisense and sense transcripts from the delivered RNA.
- the delivered RNA leads to the production of multiple daughter RNAs.
- These daughter RNAs, as well as collinear subgenomic transcripts may be translated themselves to provide in situ expression of an encoded gene of interest, e.g., a viral antigen, or may be transcribed to provide further transcripts with the same sense as the delivered RNA which are translated to provide in situ expression of the protein of interest, e.g. , an antigen.
- the overall result of this sequence of transcriptions is an amplification in the number of the introduced saRNAs and so the encoded gene of interest, e.g. , a viral antigen, can become a major polypeptide product of the cells.
- the self-amplifying RNA includes at least one or more genes selected from any one of viral replicases, viral proteases, viral helicases, and other nonstructural viral proteins.
- the self-amplifying RNA may also include 5'- and 3 '-end tractive replication sequences, and optionally a heterologous sequence that encodes a desired amino acid sequence (e.g., an antigen of interest).
- a subgenomic promoter that directs expression of the heterologous sequence may be included in the self-amplifying RNA.
- the heterologous sequence e.g. , an antigen of interest
- IRS internal ribosome entry site
- the self-amplifying RNA molecule is not encapsulated in a virus-like particle.
- Self-amplifying RNA molecules described herein may be designed so that the self-amplifying RNA molecule cannot induce production of infectious viral particles. This may be achieved, for example, by omitting one or more viral genes encoding structural proteins that are necessary to produce viral particles in the self-amplifying RNA.
- an alphavirus such as Sinbis virus (SIN), Semliki forest virus, and Venezuelan equine encephalitis virus (VEE)
- one or more genes encoding viral structural proteins, such as capsid and/or envelope glycoproteins may be omitted.
- a self-amplifying RNA molecule described herein encodes (i) an RNA- dependent RNA polymerase that may transcribe RNA from the self-amplifying RNA molecule and (ii) a polypeptide of interest, e.g., a viral antigen.
- the polymerase may be an alphavirus replicase, e.g., including any one of alphavirus protein nsPl, nsP2, nsP3, nsP4, and any combination thereof.
- the selfamplifying RNA molecules described herein may include one or more modified nucleotides (e.g., pseudouridine, N6-methyladenosine, 5- methylcytidine, 5 -methyluridine). In some embodiments, the self-amplifying RNA molecules does not include a modified nucleotide (e.g. , pseudouridine, N6-methyladenosine, 5- methylcytidine, 5 -methyluridine).
- modified nucleotides e.g., pseudouridine, N6-methyladenosine, 5- methylcytidine, 5 -methyluridine.
- the saRNA construct may encode at least one non-structural protein (NSP), disposed 5' or 3' of the sequence encoding at least one peptide or polypeptide of interest.
- the sequence encoding at least one NSP is disposed 5' of the sequences encoding the peptide or polypeptide of interest.
- the sequence encoding at least one NSP may be disposed at the 5' end of the RNA construct.
- at least one non- structural protein encoded by the RNA construct may be the RNA polymerase nsP4.
- the saRNA construct encodes nsPl, nsP2, nsP3 and, nsP4.
- nsPl is the viral capping enzyme and membrane anchor of the replication complex (RC).
- nsP2 is an RNA helicase and the protease responsible for the ns polyprotein processing.
- nsP3 interacts with several host proteins and may modulate protein poly- and mono-ADP- ribosylation.
- nsP4 is the core viral RNA-dependent RNA polymerase.
- the polymerase may be an alphavirus replicase, e.g., comprising one or more of alphavirus proteins nsPl, nsP2, nsP3, and nsP4.
- the self-amplifying RNA molecules do not encode alphavirus structural proteins.
- the selfamplifying RNA may lead to the production of genomic RNA copies of itself in a cell, but not to the production of RNA that includes virions. Without being bound by theory or mechanism, the inability to produce these virions means that, unlike a wild-type alphavirus, the selfamplifying RNA molecule cannot perpetuate itself in infectious form.
- the alphavirus structural proteins which are necessary for perpetuation in wild-type viruses can be absent from selfamplifying RNAs of the present disclosure and their place can be taken by gene(s) encoding the immunogen of interest, such that the subgenomic transcript encodes the immunogen rather than the structural alphavirus virion proteins.
- the self-amplifying RNA molecule may have two open reading frames.
- the first (5') open reading frame can encode a replicase; the second (3') open reading frame can encode a polypeptide comprising an antigen of interest.
- the RNA may have additional (e.g., downstream) open reading frames, e.g., to encode further antigens or to encode accessory polypeptides.
- the saRNA molecule further includes (1) an alphavirus 5' replication recognition sequence, and (2) an alphavirus 3' replication recognition sequence.
- the 5' sequence of the self-amplifying RNA molecule is selected to ensure compatibility with the encoded replicase.
- self-amplifying RNA molecules described herein may also be designed to induce production of infectious viral particles that are attenuated or virulent, or to produce viral particles that are capable of a single round of subsequent infection.
- the saRNA molecule is alphavirus-based.
- Alphaviruses include a set of genetically, structurally, and serologically related arthropod-borne viruses of the Togaviridae family.
- Exemplary viruses and virus subtypes within the alphavirus genus include Sindbis virus (SINV), Semliki Forest virus (SFV), Ross River virus (RRV), and Venezuelan equine encephalitis virus (VEEV).
- Sindbis virus SINV
- SFV Semliki Forest virus
- RRV Ross River virus
- VEEV Venezuelan equine encephalitis virus
- the self-amplifying RNA described herein may incorporate an RNA replicase derived from any one of SFV, SINV, VEEV, RRV, or other viruses belonging to the alphavirus family.
- the self-amplifying RNA described herein may incorporate sequences derived from a mutant or wild-type virus sequence, e.g., the attenuated TC83 mutant of
- Alphavirus-based saRNAs are (+)-stranded saRNAs that may be translated after delivery to a cell, which leads to translation of a replicase (or replicase- transcriptase).
- the replicase is translated as a polyprotein which auto-cleaves to provide a replication complex which creates genomic (-)-strand copies of the (+)-strand delivered RNA.
- These (-)-strand transcripts may themselves be transcribed to give further copies of the (+)-stranded parent RNA and also to give a subgenomic transcript which encodes the desired gene product. Translation of the subgenomic transcript thus leads to in situ expression of the desired gene product by the infected cell.
- Suitable alphavirus saRNAs may use a replicase from a SINV, a SFV, an eastern equine encephalitis virus, a VEEV, or mutant variants thereof.
- the self-amplifying RNA molecule is derived from or based on a virus other than an alphavirus, such as a positive-stranded RNA virus, and in particular a picomavirus, flavivirus, rubivirus, pestivirus, hepacivirus, calicivirus, or coronavirus.
- a virus other than an alphavirus such as a positive-stranded RNA virus, and in particular a picomavirus, flavivirus, rubivirus, pestivirus, hepacivirus, calicivirus, or coronavirus.
- Suitable wild-type alphavirus sequences are well-known and are available from sequence depositories, such as the American Type Culture Collection, Rockville, Md.
- alphaviruses include Aura (ATCC VR-368), Bebaru virus (ATCC VR-600, ATCC VR-1240), Cabassou (ATCC VR-922), Chikungunya virus (ATCC VR-64, ATCC VR-1241), Eastern equine encephalomyelitis virus (ATCC VR-65, ATCC VR-1242), Fort Morgan (ATCC VR-924), Getah virus (ATCC VR-369, ATCC VR-1243), Kyzylagach (ATCC VR-927), Mayaro (ATCC VR- 66), Mayaro virus (ATCC VR-1277), Middleburg (ATCC VR-370), Mucambo virus (ATCC VR-580, ATCC VR-1244), Ndumu (ATCC VR-371), Pixuna virus (ATCC VR- 372, ATCC VR-1245), Ross River virus (ATCC VR-373, ATCC VR-1246), Semliki Forest (ATCC VR-67, ATCC VR-1247), Sindbis virus (ATCC VR-68, ATCC VR
- the self-amplifying RNA molecules described herein are larger than other types of RNA (e.g., mRNA).
- the self-amplifying RNA molecules described herein include at least about 4 kb.
- the self-amplifying RNA may be equal to any one of, at least any one of, at most any one of, or between any two of 3 kb, 4 kb, 5 kb, 6 kb, 7 kb, 8 kb, 9 kb, 10 kb, 11 kb, 12 kb, 13 kb, 14 kb, 15 kb, 16 kb.
- the self-amplifying RNA may include at least about 5 kb, at least about 6 kb, at least about 7 kb, at least about 8 kb, at least about 9 kb, at least about 10 kb, at least about 11 kb, at least about 12 kb, or more than 12 kb.
- the self-amplifying RNA is about 4 kb to about 12 kb, about 5 kb to about 12 kb, about 6 kb to about 12 kb, about 7 kb to about 12 kb, about 8 kb to about 12 kb, about 9 kb to about 12 kb, about 10 kb to about 12 kb, about 11 kb to about 12 kb, about 5 kb to about 11 kb, about 5 kb to about 10 kb, about 5 kb to about 9 kb, about 5 kb to about 8 kb, about 5 kb to about 7 kb, about 5 kb to about 6 kb, about 6 kb to about 12 kb, about 6 kb to about 11 kb, about 6 kb to about 10 kb, about 6 kb to about 9 kb, about 6 kb to about 8 kb, about 6 kb to about 7 kb, about 7 kb
- the self-amplifying RNA molecule may encode a single polypeptide antigen or, optionally, two or more of polypeptide antigens linked together in a way that each of the sequences retains its identity (e.g. , linked in series) when expressed as an amino acid sequence.
- the polypeptides generated from the self-amplifying RNA may then be produced as a fusion polypeptide or engineered in such a manner to result in separate polypeptide or peptide sequences.
- the self-amplifying RNA described herein may encode one or more polypeptide antigens that include a range of epitopes. In some embodiments, the self- amplifying RNA described herein may encode epitopes capable of eliciting either a helper T- cell response or a cytotoxic T-cell response or both.
- the antigenic polypeptide constructs can comprise one or more antigenic peptide sequences that elicit an immune response.
- pathogenic antigenic polypeptide constructs are peptide or protein antigens derived from a pathogen associated with infectious disease, including viruses, bacteria, parasites, and fungi.
- the antigenic polypeptide constructs are peptide or protein antigens derived from cancer, rare diseases, and other diseases or conditions caused by overproduction, underproduction, or improper production of proteins, DNA, or RNA, such as mRNA or siRNA.
- peptides or proteins can exist in a variety of instances such as: fragments or functional derivatives, recombinant polypeptides, such as antigens or one or both chains of an antibody, or a fragment, derivative, mutein, or variant thereof, peptides or proteins sufficient for use as hybridization probes, peptides or proteins for inhibiting expression of a polynucleotide, and complementary amino acid sequences of the foregoing described herein.
- Peptides or proteins may be an epitope to which antibodies may bind.
- the peptides or proteins can comprise RNA and/or DNA nucleotides (e.g., peptide nucleic acids).
- the size of a protein or peptide or derivative of a corresponding amino sequence described or referenced herein can be, for example, equal to any one of, at least any one of, at most any one of, or between any two of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97
- proteins or peptides may be mutated by truncation, rendering them shorter than their corresponding wild-type form, also, they might be altered by fusing or conjugating a heterologous protein or peptide sequence with a particular function (e.g., for targeting or localization, for enhanced immunogenicity, for purification purposes, etc.).
- domain refers to any distinct functional or structural unit of a protein or peptide, and generally refers to a sequence of amino acids with a structure or function recognizable by one skilled in the art.
- the one or more antigenic polypeptide constructs and/or antigenic peptide sequences thereof elicit an immune response.
- the immune response may be against the antigenic polypeptide constructs and/or antigenic peptide sequences and/or a homologous endogenously-expressed (e.g. cross-reactive) host protein.
- the antigenic polypeptide constructs and/or antigenic peptide sequences and the homologous endogenously- expressed e.g.
- cross-reactive host protein may be equal to any one of, at least any one of, at most any one of, or between any two of 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% similar, identical, or homologous.
- the one or more antigenic polypeptide constructs and/or antigenic peptide sequences thereof may comprise equal to any one of, at least any one of, at most any one of, or between any two of 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44,
- the one or more antigenic polypeptide constructs and/or antigenic peptide sequence thereof are modified such that the antigenic polypeptide constructs and/or antigenic peptide sequences thereof continue to elicit an immune response but homology with a homologous endogenously-expressed (e.g., cross-reactive) host protein is reduced to reduce or prevent cross-reactivity after immunization with the antigenic polypeptide constructs and/or antigenic peptide sequences thereof.
- a homologous endogenously-expressed host protein is reduced to reduce or prevent cross-reactivity after immunization with the antigenic polypeptide constructs and/or antigenic peptide sequences thereof.
- the homology between the antigenic polypeptide constructs and/or antigenic peptide sequences and the homologous endogenously-expressed (e.g., cross-reactive) host protein may be reduced by modifying the antigenic polypeptide constructs and/or antigenic peptide sequences thereof such that the modified antigenic polypeptide constructs and/or antigenic peptide sequences and the homologous endogenously- expressed (e.g., cross-reactive) host protein may be equal to any one of, at least any one of, at most any one of, or between any two of 0%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%,
- the modified antigenic polypeptide constructs and/or modified antigenic peptide sequences thereof may include equal to any one of, at least any one of, at most any one of, or between any two of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more variant amino acids (e.g. , amino acid substitutions, insertions, and/or deletions) compared to unmodified antigenic polypeptide constructs and/or unmodified antigenic peptide sequences thereof.
- variant amino acids e.g. , amino acid substitutions, insertions, and/or deletions
- modified antigenic polypeptide constructs and/or modified antigenic peptide sequences thereof may equal to any one of, at least any one of, at most any one of, or between any two of 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%,
- Nucleotide as well as protein, polypeptide, and peptide sequences for various genes have been previously disclosed, and may be found in the recognized computerized databases. Two commonly used databases are the National Center for Biotechnology Information’s Genbank and GenPept databases (on the World Wide Web at ncbi.nlm.nih.gov) and The Universal Protein Resource (UniProt; on the World Wide Web at uniprot.org). The coding regions for these genes may be amplified and/or expressed using the techniques disclosed herein or as would be known to those of ordinary skill in the art.
- antigenic polypeptide constructs and/or antigenic peptide sequences thereof and/or nucleic acids encoding the antigenic polypeptide constructs or antigenic peptide sequences thereof of the present disclosure may be modified, such that they are substantially identical to the antigenic polypeptide constructs or antigenic peptide sequences thereof and/or nucleic acids encoding the antigenic polypeptide constructs or antigenic peptide sequences thereof comprised in immunogenic compositions described herein.
- the modified antigenic polypeptide constructs and/or antigenic peptide sequences thereof and/or nucleic acids encoding the antigenic polypeptide constructs or antigenic peptide sequences thereof continue to be bound by antibodies to elicit an immune response but produce attenuated immune cross-reactivity after immunization.
- Polypeptide and/or nucleic acid sequences are “substantially identical” when optimally aligned using such programs as Clustal Omega, IGBLAST, GAP or BESTFIT using default gap weights, they share at least 80% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, or at least 99% sequence identity or any range therein.
- the antigenic polypeptide constructs and/or nucleic acids encoding the antigenic polypeptide constructs of the disclosure may include equal to any one of, at least any one of, at most any one of, or between any two of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more variant amino acids (e.g., amino acid substitutions, insertions, and/or deletions) or be equal to any one of, at least any one of, at most any one of, or between any two of 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%,
- variant amino acids e.g., amino acid substitutions, insertions, and/or deletions
- the antigenic polypeptide constructs and/or nucleic acids encoding the antigenic polypeptide constructs may comprise equal to any one of, at least any one of, at most any one of, or between any two of 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16,
- the modified antigenic polypeptide constructs and/or nucleic acids encoding the antigenic polypeptide constructs may comprise a polynucleotide that has been engineered to contain distinct sequences while at the same time retaining the capacity to encode the “wildtype” or standard protein or peptide or “modified” or “variant” protein or peptide. This can be accomplished to the degeneracy of the genetic code, i.e., the presence of multiple codons, which encode for the same amino acids.
- the term “functionally equivalent codon” is used herein to refer to codons that encode the same amino acid, such as the six different codons for arginine.
- neutral substitutions or “neutral mutations” which refers to a change in the codon or codons that encode biologically equivalent amino acids.
- one of skill in the art may wish to introduce a mutation into a polynucleotide to reduce cross-reactivity of the protein encoded by the polynucleotide with endogenously-expressed host proteins while not disturbing the ability of that polynucleotide to encode a protein that is bound by an antibody and that elicits an immune response.
- Biologically functional equivalents are thus defined herein as those proteins (and polynucleotides) having substitutions or mutations in selected amino acids (or codons) that retain the ability to be bound by an antibody and elicit an immune response and/or proteins (and polynucleotides) having substitutions or mutations in selected amino acids (or codons) that have reduced homology with endogenously-expressed host proteins, such that cross-reactivity of the proteins is diminished, for example.
- a polynucleotide may be (and encode) a biological functional equivalent with significant changes. Certain amino acids may be substituted for other amino acids in a protein structure without appreciable loss of interactive binding capacity with structures such as, for example, antigen-binding regions of antibodies, binding sites on substrate molecules, receptors, and such like.
- Substitutional variants typically contain the exchange of one amino acid for another at one or more sites within the protein, and may be designed to modulate one or more properties of the polypeptide, with or without the loss of other functions or properties. Substitutions may be conservative, that is, one amino acid is replaced with one of similar shape and charge.
- Conservative substitutions are well known in the art and include, for example, the changes of: alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; and valine to isoleucine or leucine.
- Non-conservative changes do not disrupt the biological activity of the protein, as the structural change is not one that impinges of the protein’s ability to carry out its designed function. It is thus contemplated by the inventors that various changes may be made in the sequence of genes and proteins disclosed herein, while still fulfilling the goals of the present invention.
- substitutions may be non-conservative such that a function or activity of the polypeptide is affected.
- Non-conservative changes typically involve substituting a residue with one that is chemically dissimilar, such as a polar or charged amino acid for a nonpolar or uncharged amino acid, and vice versa.
- Non-conservative substitutions may involve the exchange of a member of one of the amino acid classes for a member from another class.
- alteration of the function of a polypeptide is intended by introducing one or more substitutions.
- certain amino acids may be substituted for other amino acids in a protein structure without appreciable loss of interactive binding capacity. Structures such as, for example, an enzymatic catalytic domain or interaction components may have amino acid substituted to maintain such function. Since it is the interactive capacity and nature of a protein that defines that protein’s biological functional activity, certain amino acid substitutions can be made in a protein sequence, and in its underlying DNA coding sequence, and nevertheless produce a protein with like properties. It is thus contemplated by the inventors that various changes may be made in the DNA sequences of genes without appreciable loss of their biological utility or activity.
- Deletion variants typically lack one or more residues of the native or wild-type protein. Individual residues can be deleted or a number of contiguous amino acids can be deleted. A stop codon may be introduced (by substitution or insertion) into an encoding nucleic acid sequence to generate a truncated protein. For example, it is contemplated that peptides may be mutated by truncation, or deletion of a number of contiguous amino acids, rendering them shorter than their corresponding endogenous form.
- Insertional mutants typically involve the addition of amino acid residues at a nonterminal point in the polypeptide. This may include the insertion of one or more amino acid residues. Terminal additions may also be generated and can include fusion proteins which are multimers or concatemers of one or more peptides or polypeptides described or referenced herein. For example, it is contemplated that peptides might be altered by fusing or conjugating a heterologous protein or polypeptide sequence with a particular function (e.g. , for targeting or localization, for enhanced activity, for purification purposes, etc.).
- polypeptides of the disclosure may be chemically modified. Glycosylation of the polypeptides can be altered, for example, by modifying one or more sites of glycosylation within the polypeptide sequence to increase the affinity of the polypeptide for antigen (U.S. Pat. Nos. 5,714,350 and 6,350,861).
- amino acid and nucleic acid sequences may include additional residues, such as additional N- or C-terminal amino acids, or 5' or 3' sequences, respectively, and yet still be essentially as set forth in one of the sequences disclosed herein, so long as the sequence meets the criteria set forth above, including the maintenance of biological protein activity where protein expression is concerned.
- the addition of terminal sequences particularly applies to nucleic acid sequences that may, for example, include various noncoding sequences flanking either of the 5' or 3' portions of the coding region.
- Modified antigenic polypeptide constructs and/or nucleic acids encoding the antigenic polypeptide constructs of the disclosure can be substitutional, insertional, or deletion variants, for example.
- Amino acid substitutions are generally based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and/or the like.
- An analysis of the size, shape and/or type of the amino acid side-chain substituents reveals that arginine, lysine and/or histidine are all positively charged residues; that alanine, glycine and/or serine are all a similar size; and/or that phenylalanine, tryptophan and/or tyrosine all have a generally similar shape.
- arginine, lysine and/or histidine; alanine, glycine and/or serine; and/or phenylalanine, tryptophan and/or tyrosine; are defined herein as biologically functional equivalents.
- the hydropathic index of amino acids may be considered.
- the hydropathy profile of a protein is calculated by assigning each amino acid a numerical value (“hydropathy index”) and then repetitively averaging these values along the peptide chain. Each amino acid has been assigned a value based on its hydrophobicity and charge characteristics.
- the importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, 1982).
- the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like. It is also known that certain amino acids may be substituted for other amino acids having a similar hydropathy index or score, and still retain a similar biological activity. In making changes based upon the hydropathy index, in certain embodiments, the substitution of amino acids whose hydropathy indices are within ⁇ 2 is included. In some aspects of the disclosure, those that are within ⁇ 1 are included, and in other aspects of the disclosure, those within ⁇ 0.5 are included.
- hydrophilicity values have been assigned to these amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0+1); glutamate (+3.0+1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5+1); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); and tryptophan (-3.4).
- the substitution of amino acids whose hydrophilicity values are within ⁇ 2 are included, in other embodiments, those which are within ⁇ 1 are included, and in still other embodiments, those within ⁇ 0.5 are included.
- One skilled in the art can also analyze the three-dimensional structure and amino acid sequence in relation to that structure in similar proteins or polypeptides. In view of such information, one skilled in the art may predict the alignment of amino acid residues with respect to its three-dimensional structure. One skilled in the art may choose not to make changes to amino acid residues predicted to be on the surface of the protein, since such residues may be involved in important interactions with other molecules. Moreover, one skilled in the art may generate test variants containing a single amino acid substitution at each desired amino acid residue.
- single or multiple amino acid substitutions may be made in the naturally occurring sequence. Substitutions can be made in that portion of the protein that lies outside the domain(s) forming intermolecular contacts. In such embodiments, conservative amino acid substitutions can be used that do not substantially change the structural characteristics of the protein or polypeptide (e.g., one or more replacement amino acids that do not disrupt the primary, secondary, or tertiary structure that characterizes the native protein).
- amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- Exemplary substitutions that take into consideration the various foregoing characteristics are well known and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
- an “amino molecule” refers to any amino acid, amino acid derivative, or amino acid mimic as would be known to one of ordinary skill in the art.
- the residues of the peptide or protein are sequential, without any non-amino molecule interrupting the sequence of amino molecule residues.
- the sequence may comprise one or more non-amino molecule moieties.
- the sequence of residues of the proteinaceous molecule may be interrupted by one or more non- amino molecule moieties.
- Peptides and proteins include the twenty “natural” amino acids, and post-translational modifications thereof. However, in vitro peptide synthesis permits the use of modified and/or unusual amino acids.
- protein encompasses amino molecule sequences comprising at least one of the 20 common amino acids in naturally synthesized proteins, or at least one modified or unusual amino acid, including but not limited to those shown in the Table below.
- peptide mimetics that mimic elements of protein secondary and tertiary structure are described in Johnson et al. (1993).
- the underlying rationale behind the use of peptide mimetics is that the peptide backbone of proteins exists chiefly to orient amino acid side chains in such a way as to facilitate molecular interactions, such as those of antibody and/or antigen.
- a peptide mimetic is thus designed to permit molecular interactions similar to the natural molecule.
- peptide mimetic concept Some successful applications of the peptide mimetic concept have focused on mimetics of [3-tums within proteins, which are known to be highly antigenic. Likely [3-tum structure within a polypeptide can be predicted by computer-based algorithms, as discussed herein. Once the component amino acids of the turn are determined, mimetics can be constructed to achieve a similar spatial orientation of the essential elements of the amino acid side chains.
- Beta II turns have been mimicked successfully using cyclic L-pentapeptides and those with D-amino acids.
- Johannesson et al. (1999) report on bicyclic tripeptides with reverse turn inducing properties.
- alpha-helix mimetics are disclosed in U.S. Patents 5,446,128; 5,710,245; 5,840,833; and 5,859,184. These structures render the peptide or protein more thermally stable, also increase resistance to proteolytic degradation. Six, seven, eleven, twelve, thirteen and fourteen membered ring structures are disclosed.
- Beta-turns permit changed side substituents without having changes in corresponding backbone conformation, and have appropriate termini for incorporation into peptides by standard synthesis procedures.
- Other types of mimetic turns include reverse and gamma turns. Reverse turn mimetics are disclosed in U.S. Patents 5,475,085 and 5,929,237, and gamma turn mimetics are described in U.S. Patents 5,672,681 and 5,674,976.
- nucleic acid molecules encoding peptides of interest, e.g. , antigens. These nucleic acids may be generated by methods known in the art.
- the nucleic acid molecules may be used to express large quantities of the polypeptide of interest, such as an antigen.
- RNA or DNA molecules comprising a nucleic acid molecule encoding a polypeptide of the desired sequence or a portion thereof (e.g. , a fragment containing one or more polypeptides, or antigens).
- RNA or DNA molecules comprising nucleic acid molecules may encode antigens, fusion proteins, modified antibodies, antibody fragments, and probes thereof.
- the RNA or DNA molecules may contain nucleic acid sequences that serve other functions as well.
- isolated means altered or removed from the natural state through human intervention.
- a DNA or RNA naturally present in a living animal is not “isolated,” but a synthetic DNA or RNA, or a DNA or RNA partially or completely separated from the coexisting materials of its natural state is “isolated.”
- An isolated DNA or RNA can exist in substantially purified form, or can exist in a non-native environment such as, for example, a cell into which the DNA or RNA has been delivered.
- the DNA or RNA molecule is an analog and may include modifications, particularly modifications that increase nuclease resistance, improve binding affinity, and/or improve binding specificity.
- modifications particularly modifications that increase nuclease resistance, improve binding affinity, and/or improve binding specificity.
- the sugar portion of a nucleoside or nucleotide is replaced by a carbocyclic moiety, it is no longer a sugar.
- other substitutions such a substitution for the inter-sugar phosphodiester linkage are made, the resulting material is no longer a true species. All such compounds are considered to be analogs.
- reference to the sugar portion of a nucleic acid species shall be understood to refer to either a true sugar or to a species taking the structural place of the sugar of wild type nucleic acids.
- reference to inter-sugar linkages shall be taken to include moieties serving to join the sugar or sugar analog portions in the fashion of wild type nucleic acids.
- Modified oligonucleotides and oligonucleotide analogs may exhibit increased chemical and/or enzymatic stability relative to their naturally occurring counterparts.
- Extracellular and intracellular nucleases generally do not recognize and therefore do not bind to the backbone-modified compounds.
- the lack of a negatively charged backbone may facilitate cellular penetration.
- the modified intemucleoside linkages are intended to replace naturally-occurring phosphodiester-5'-methylene linkages with four atom linking groups to confer nuclease resistance and enhanced cellular uptake to the resulting compound.
- Modifications may be achieved using solid supports which may be manually manipulated or used in conjunction with a DNA or RNA synthesizer using methodology commonly known to those skilled in DNA or RNA synthesizer art. Generally, the procedure involves functionalizing the sugar moieties of two nucleosides which will be adjacent to one another in the selected sequence. In a 5' to 3' sense, an “upstream” synthon such as structure H is modified at its terminal 3' site, while a “downstream” synthon such as structure Hl is modified at its terminal 5' site.
- Oligonucleosides linked by hydrazines, hydroxylamines, and other linking groups can be protected by a dimethoxytrityl group at the 5 '-hydroxyl and activated for coupling at the 3'-hydroxyl with cyanoethyldiisopropyl-phosphite moieties. These compounds can be inserted into any desired sequence by standard, solid phase, automated DNA or RNA synthesis techniques. One of the most popular processes is the phosphoramidite technique. Oligonucleotides containing a uniform backbone linkage can be synthesized by use of CPG- solid support and standard nucleic acid synthesizing machines such as Applied Biosystems Inc.
- the initial nucleotide (number 1 at the 3 '-terminus) is attached to a solid support such as controlled pore glass. In sequence specific order, each new nucleotide is attached either by manual manipulation or by the automated synthesizer system.
- Free amino groups can be alkylated with, for example, acetone and sodium cyanoboro hydride in acetic acid.
- the alkylation step can be used to introduce other, useful, functional molecules on the macromolecule.
- useful functional molecules include but are not limited to reporter molecules, RNA cleaving groups, groups for improving the pharmacokinetic properties of an oligonucleotide, and groups for improving the pharmacodynamic properties of an oligonucleotide.
- Such molecules can be attached to or conjugated to the macromolecule via attachment to the nitrogen atom in the backbone linkage. Alternatively, such molecules can be attached to pendent groups extending from a hydroxyl group of the sugar moiety of one or more of the nucleotides. Examples of such other useful functional groups are provided by WO1993007883, which is herein incorporated by reference, and in other of the above-referenced patent applications.
- Solid supports may include any of those known in the art for polynucleotide synthesis, including controlled pore glass (CPG), oxalyl controlled pore glass, TentaGel Support — an aminopolyethyleneglycol derivatized support or Poros — a copolymer of polystyrene/divinylbenzene. Attachment and cleavage of nucleotides and oligonucleotides can be effected via standard procedures. As used herein, the term solid support further includes any linkers (e.g., long chain alkyl amines and succinyl residues) used to bind a growing oligonucleoside to a stationary phase such as CPG.
- CPG controlled pore glass
- TentaGel Support an aminopolyethyleneglycol derivatized support
- Poros a copolymer of polystyrene/divinylbenzene. Attachment and cleavage of nucleotides and oli
- the oligonucleotide may be further defined as having one or more locked nucleotides, ethylene bridged nucleotides, peptide nucleic acids, or a 5 '(E)-vinyl -phosphonate (VP) modification.
- the oligonucleotides have one or more phosphorothioated DNA or RNA bases.
- RNA or DNA molecules discussed above.
- Prokaryote- and/or eukaryote-based systems or cell free systems can be employed for use with an embodiment to produce nucleic acid sequences, or their cognate polypeptides, proteins and peptides.
- Commercially and widely available systems include but are not limited to bacterial, mammalian, yeast, insect cell, and cell free systems.
- Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins.
- Appropriate cell lines, host systems, or expression systems can be chosen to ensure the correct modification and processing of the nucleic acid or polypeptide(s) expressed.
- Those skilled in the art are able to express a vector to produce a nucleic acid sequence or its cognate polypeptide, protein, or peptide using an appropriate expression system.
- antigenic polypeptide constructs and/or nucleic acids encoding the antigenic polypeptide constructs of the present disclosure are achieved by operably linking a nucleic acid encoding the antigenic polypeptide constructs and/or nucleic acids encoding the antigenic polypeptide constructs to a promoter, and incorporating the construct into an expression vector, which is taken up and expressed by cells.
- the vectors can be suitable for replication and, in some cases, integration in eukaryotes. Typical vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
- the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid.
- Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
- a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers (see, e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
- the expression vector may be provided to a cell in the form of a viral vector.
- Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001) Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in other virology and molecular biology manuals.
- Viruses that are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses (including selfinactivating lentivirus vectors).
- retroviruses include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses (including selfinactivating lentivirus vectors).
- retroviruses include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses (including selfinactivating lentivirus vectors).
- adenoviruses provide a convenient platform for gene delivery systems.
- a selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art.
- the recombinant virus can then be isolated and delivered to cells of the subject either in viv
- the nucleic acid encoding antigenic polypeptide constructs and/or nucleic acids encoding the antigenic polypeptide constructs of the present disclosure is introduced into cells using a recombinant vector such as a viral vector including, for example, a lentivirus, a retrovirus, gamma-retroviruses, an adeno-associated virus (AAV), a herpesvirus, or an adenovirus.
- a viral vector including, for example, a lentivirus, a retrovirus, gamma-retroviruses, an adeno-associated virus (AAV), a herpesvirus, or an adenovirus.
- Vectors can also comprise other components or functionalities that further modulate gene delivery and/or gene expression, or that otherwise provide beneficial properties to the targeted cells.
- Such other components include, for example, components that influence binding or targeting to cells (including components that mediate cell-type or tissue-specific binding); components that influence uptake of the vector nucleic acid by the cell; components that influence localization of the polynucleotide within the cell after uptake (such as agents mediating nuclear localization); and components that influence expression of the polynucleotide.
- Such components also might include markers, such as detectable and/or selection markers that can be used to detect or select for cells that have taken up and are expressing the nucleic acid delivered by the vector.
- markers such as detectable and/or selection markers that can be used to detect or select for cells that have taken up and are expressing the nucleic acid delivered by the vector.
- Such components can be provided as a natural feature of the vector (such as the use of certain viral vectors which have components or functionalities mediating binding and uptake), or vectors can be modified to provide such functionalities.
- a large variety of such vectors are known in the art and are generally available.
- the vector When a vector is maintained in a host cell, the vector can either be stably replicated by the cells during mitosis as an autonomous structure, incorporated within the genome of the host cell, or maintained in the host cell’s nucleus or cytoplasm.
- Eukaryotic expression cassettes included in the vectors particularly contain (in a 5'- to-3' direction) regulatory elements including a eukaryotic transcriptional promoter operably linked to a protein-coding sequence, splice signals including intervening sequences, a transcriptional termination/polyadenylation sequence, post-transcriptional regulatory elements, and origins of replication.
- regulatory elements including a eukaryotic transcriptional promoter operably linked to a protein-coding sequence, splice signals including intervening sequences, a transcriptional termination/polyadenylation sequence, post-transcriptional regulatory elements, and origins of replication.
- Suitable methods for nucleic acid delivery to effect expression of compositions are anticipated to include virtually any method by which a particular nucleic acid (e.g., RNA, mRNA, saRNA, DNA) can be introduced into a cell, a tissue or an organism, as described herein or as would be known to one of ordinary skill in the art. Such methods may include, but are not limited to, direct delivery of nucleic acids such as by injection (U.S.
- One illustrative delivery vehicle is a lipid and/or a liposome. The use of lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo, or in vivo). In another aspect, the nucleic acid may be associated with a lipid.
- the nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid.
- Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution.
- Lipids are fatty substances which may be naturally occurring or synthetic lipids.
- lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
- a nucleic acid may be entrapped in a lipid complex such as, for example, a liposome.
- Liposomes are vesicular structures characterized by a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers (Ghosh and Bachhawat, 1991).
- liposomes used may vary upon the nature of the liposome as well as the cell used, for example, about 5 to about 20 ⁇ g vector DNA per 1 to 10 million of cells may be contemplated.
- Liposome-mediated nucleic acid delivery and expression of foreign DNA in vitro has been very successful (Nicolau and Sene, 1982; Fraley et al., 1979; Nicolau et al., 1987).
- the feasibility of liposome-mediated delivery and expression of foreign DNA in cultured chick embryo, HeLa and hepatoma cells has also been demonstrated (Wong et al., 1980).
- a liposome may be complexed with a hemagglutinating virus (HVJ). This has been shown to facilitate fusion with the cell membrane and promote cell entry of liposome-encapsulated DNA (Kaneda etal., 1989).
- a liposome may be complexed or employed in conjunction with nuclear non-histone chromosomal proteins (HMG-1) (Kato et al., 1991).
- HMG-1 nuclear non-histone chromosomal proteins
- a liposome may be complexed or employed in conjunction with both HVJ and HMG- 1.
- a delivery vehicle may comprise a ligand and a liposome.
- lipids suitable for use can be obtained from commercial sources.
- lipofectamine can be obtained from Thermo Fisher Scientific, Waltham, Mass.
- dimyristyl phosphatidylcholine (“DMPC”) can be obtained from Sigma, St. Louis, Mo.
- dicetyl phosphate (“DCP”) can be obtained from K & K Laboratories (Plainview, N.Y.)
- cholesterol (“Choi”) can be obtained from Calbiochem- Behring
- dimyristyl phosphatidylglycerol (“DMPG”) and other lipids may be obtained from Avanti Polar Lipids, Inc. (Birmingham, Ala.).
- Liposome is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution.
- compositions that have different structures in solution than the normal vesicular structure are also encompassed.
- the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules.
- lipofectamine-nucleic acid complexes are also contemplated.
- a nucleic acid is introduced into a cell via electroporation. Electroporation involves the exposure of a suspension of cells and DNA to a high-voltage electric discharge. Recipient cells can be made more susceptible to transformation by mechanical wounding. Also the amount of vectors used may vary upon the nature of the cells used, for example, about 5 to about 20 pg vector DNA per 1 to 10 million of cells may be contemplated.
- a nucleic acid is introduced to the cells using calcium phosphate precipitation.
- Human KB cells have been transfected with adenovirus 5 DNA (Graham and Van Der Eb, 1973) using this technique.
- mouse L(A9), mouse C127, CHO, CV-1, BHK, NIH3T3 and HeLa cells were transfected with a neomycin marker gene (Chen and Okayama, 1987), and rat hepatocytes were transfected with a variety of marker genes (Rippe et al., 1990).
- a nucleic acid is delivered into a cell using DEAE-dextran followed by polyethylene glycol.
- reporter plasmids were introduced into mouse myeloma and erythroleukemia cells (Gopal, 1985).
- RNA or DNA can be transfected into cells according to a variety of methods known in the art. RNA or DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. Some RNA or DNA may employ control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells.
- the polypeptide of interest expression construct or RNA or DNA replicase can be placed under control of a promoter that is linked to T-cell activation, such as one that is controlled by NF AT- 1 or NF-KB, both of which are transcription factors that can be activated upon T-cell activation.
- Control of expression allows T cells, such as tumortargeting T cells, to sense their surroundings and perform real-time modulation of cytokine signaling, both in the T cells themselves and in surrounding endogenous immune cells.
- T cells such as tumortargeting T cells
- cytokine signaling both in the T cells themselves and in surrounding endogenous immune cells.
- RNA molecule such as a saRNA, or DNA.
- techniques and conditions that would allow large-scale production of RNA or DNA molecules, as well as production of the nucleic acids encoded by vectors and their cognate polypeptides, proteins, or peptides.
- RNA or DNA and transfection technique For transfection of mammalian cells, it is known, depending upon the RNA or DNA and transfection technique used, only a small fraction of cells may integrate the foreign RNA or DNA into their cells. Regardless of the method used to introduce exogenous nucleic acids into a host cell, in order to identify and select these integrants, a variety of assays may be performed.
- Such assays include, for example, “molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; “biochemical” assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the disclosure.
- “molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR
- biochemical assays such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the disclosure.
- cells containing an exogenous nucleic acid may be identified in vitro or in vivo by including a marker in the expression vector or the exogenous nucleic acid. Such markers would confer an identifiable change to the cell permitting easy identification of cells containing the expression vector.
- a selection marker may be one that confers a property that allows for selection.
- a positive selection marker may be one in which the presence of the marker allows for its selection, while a negative selection marker is one in which its presence prevents its selection.
- An example of a positive selection marker is a drug resistance marker.
- markers conferring a phenotype that allows for the discrimination of transformants based on the implementation of conditions are also contemplated.
- screenable enzymes as negative selection markers such as herpes simplex virus thymidine kinase (tk) or chloramphenicol acetyltransferase (CAT) may be utilized.
- tk herpes simplex virus thymidine kinase
- CAT chloramphenicol acetyltransferase
- One of skill in the art would also know how to employ immunologic markers, possibly in conjunction with FACS analysis. The marker used is not believed to be important, so long as it is capable of being expressed simultaneously with the nucleic acid encoding a gene product. Further examples of selection and screenable markers are well known to one of skill in the art.
- Selectable markers may include a type of reporter gene used in laboratory microbiology, molecular biology, and genetic engineering to indicate the success of a transfection or other procedure meant to introduce foreign DNA into a cell.
- Selectable markers are often antibiotic resistance genes; cells that have been subjected to a procedure to introduce foreign DNA are grown on a medium containing an antibiotic, and those cells that can grow have successfully taken up and expressed the introduced genetic material. Examples of selectable markers include: the Abicr gene or Neo gene from Tn5, which confers antibiotic resistance to geneticin.
- a screenable marker may comprise a reporter gene, which allows the researcher to distinguish between wanted and unwanted cells. Certain embodiments of the present invention utilize reporter genes to indicate specific cell lineages.
- the reporter gene can be located within expression elements and under the control of the ventricular- or atrial-selective regulatory elements normally associated with the coding region of a ventricular- or atrial- selective gene for simultaneous expression.
- a reporter allows the cells of a specific lineage to be isolated without placing them under drug or other selective pressures or otherwise risking cell viability.
- reporter examples include genes encoding cell surface proteins (e.g. , CD4, HA epitope), fluorescent proteins, antigenic determinants and enzymes (e.g., [3-galactosidase).
- cell surface proteins e.g. , CD4, HA epitope
- fluorescent proteins e.g., antigenic determinants
- enzymes e.g., [3-galactosidase.
- the vector containing cells may be isolated, e.g., by FACS using fluorescently-tagged antibodies to the cell surface protein or substrates that can be converted to fluorescent products by a vector encoded enzyme.
- the reporter gene is a fluorescent protein.
- a broad range of fluorescent protein genetic variants have been developed that feature fluorescence emission spectral profiles spanning almost the entire visible light spectrum. Mutagenesis efforts in the original Aequorea victoria jellyfish green fluorescent protein have resulted in new fluorescent probes that range in color from blue to yellow, and are some of the most widely used in vivo reporter molecules in biological research. Longer wavelength fluorescent proteins, emitting in the orange and red spectral regions, have been developed from the marine anemone, Discosoma striata, and reef corals belonging to the class Anthozoa. Still other species have been mined to produce similar proteins having cyan, green, yellow, orange, and deep red fluorescence emission. Developmental research efforts are ongoing to improve the brightness and stability of fluorescent proteins, thus improving their overall usefulness.
- the cells of the disclosure may be specifically formulated and/or they may be cultured in a particular medium.
- the cells may be formulated in such a manner as to be suitable for delivery to a recipient without deleterious effects.
- the medium in certain aspects can be prepared using a medium used for culturing animal cells as their basal medium, such as any of AIM V, X-VIVO-15, NeuroBasal, EGM2, TeSR, BME, BGJb, CMRL 1066, Glasgow MEM, Improved MEM Zinc Option, IMDM, Medium 199, Eagle MEM, aMEM, DMEM, Ham, RPMI-1640, and Fischer's media, as well as any combinations thereof, but the medium may not be particularly limited thereto as far as it can be used for culturing animal cells. Particularly, the medium may be xeno-free or chemically defined.
- a medium used for culturing animal cells as their basal medium, such as any of AIM V, X-VIVO-15, NeuroBasal, EGM2, TeSR, BME, BGJb, CMRL 1066, Glasgow MEM, Improved MEM Zinc Option, IMDM, Medium 199, Eagle MEM, aMEM, DMEM, Ham
- the medium can be a serum-containing or serum-free medium, or xeno-free medium. From the aspect of preventing contamination with heterogeneous animal-derived components, serum can be derived from the same animal as that of the stem cell(s).
- the serum- free medium refers to medium with no unprocessed or unpurified serum and accordingly, can include medium with purified blood-derived components or animal tissue-derived components (such as growth factors).
- the medium may contain or may not contain any alternatives to serum.
- the alternatives to serum can include materials which appropriately contain albumin (such as lipid- rich albumin, bovine albumin, albumin substitutes such as recombinant albumin or a humanized albumin, plant starch, dextrans and protein hydrolysates), transferrin (or other iron transporters), fatty acids, insulin, collagen precursors, trace elements, 2-mercaptoethanol, 3'- thiolgiycerol, or equivalents thereto.
- the alternatives to serum can be prepared by the method disclosed in International Publication No. 98/30679, for example (incorporated herein in its entirety). Alternatively, any commercially available materials can be used for more convenience.
- the commercially available materials include knockout Serum Replacement (KSR), Chemically-defined Lipid concentrated (Gibco), and Glutamax (Gibco).
- the medium may comprise one, two, three, four, five, six, seven, eight, nine, ten, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 ormore of the following: Vitamins such as biotin; DL Alpha Tocopherol Acetate; DL Alpha-Tocopherol; Vitamin A (acetate); proteins such as BSA (bovine serum albumin) or human albumin, fatty acid free Fraction V; Catalase; Human Recombinant Insulin; Human Transferrin; Superoxide Dismutase; Other Components such as Corticosterone; D-Galactose; Ethanolamine HC1; Glutathione (reduced); L-Carnitine HC1; Linoleic Acid; Linolenic Acid; Progesterone; Putrescine 2HC1; Sodium Selenite; and/or T3 (triodo-I-thyronine). In specific embodiments, one or more of these may be explicitly excluded.
- Vitamins such as biotin; DL Alpha Tocop
- the medium further comprises vitamins.
- the medium comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 of the following (and any range derivable therein): biotin, DL alpha tocopherol acetate, DL alpha-tocopherol, vitamin A, choline chloride, calcium pantothenate, pantothenic acid, folic acid nicotinamide, pyridoxine, riboflavin, thiamine, inositol, vitamin B12, or the medium includes combinations thereof or salts thereof.
- the medium comprises or consists essentially of biotin, DL alpha tocopherol acetate, DL alpha-tocopherol, vitamin A, choline chloride, calcium pantothenate, pantothenic acid, folic acid nicotinamide, pyridoxine, riboflavin, thiamine, inositol, and vitamin B 12.
- the vitamins include or consist essentially of biotin, DL alpha tocopherol acetate, DL alpha-tocopherol, vitamin A, or combinations or salts thereof.
- the medium further comprises proteins.
- the proteins comprise albumin or bovine serum albumin, a fraction of BSA, catalase, insulin, transferrin, superoxide dismutase, or combinations thereof.
- the medium further comprises one or more of the following: corticosterone, D-Galactose, ethanolamine, glutathione, L-camitine, linoleic acid, linolenic acid, progesterone, putrescine, sodium selenite, or triodo-I-thyronine, or combinations thereof.
- the medium comprises one or more of the following: a B-27® supplement, xeno-free B-27® supplement, GS21TM supplement, or combinations thereof.
- the medium comprises or further comprises amino acids, monosaccharides, inorganic ions.
- the amino acids comprise arginine, cystine, isoleucine, leucine, lysine, methionine, glutamine, phenylalanine, threonine, tryptophan, histidine, tyrosine, or valine, or combinations thereof.
- the inorganic ions comprise sodium, potassium, calcium, magnesium, nitrogen, or phosphorus, or combinations or salts thereof.
- the medium further comprises one or more of the following: molybdenum, vanadium, iron, zinc, selenium, copper, or manganese, or combinations thereof.
- the medium comprises or consists essentially of one or more vitamins discussed herein and/or one or more proteins discussed herein, and/or one or more of the following: corticosterone, D-Galactose, ethanolamine, glutathione, L-camitine, linoleic acid, linolenic acid, progesterone, putrescine, sodium selenite, or triodo-I-thyronine, a B-27® supplement, xeno-free B-27® supplement, GS21TM supplement, an amino acid (such as arginine, cystine, isoleucine, leucine, lysine, methionine, glutamine, phenylalanine, threonine, tryptophan, histidine, tyrosine, or valine), monosaccharide, inorganic ion (such as sodium, potassium, calcium, magnesium, nitrogen, and/or phosphorus) or salts thereof, and/or molyb
- the medium can also contain one or more externally added fatty acids or lipids, amino acids (such as non-essential amino acids), vitamin(s), growth factors, cytokines, antioxidant substances, 2-mercaptoethanol, pyruvic acid, buffering agents, and/or inorganic salts. . In specific embodiments, one or more of these may be explicitly excluded.
- One or more of the medium components may be added at a concentration of at least, at most, or about 0.1, 0.5, 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 180, 200, 250 ng/L, ng/mL, pg/mL, mg/mL, or any range derivable therein.
- the cells of the disclosure are specifically formulated. They may or may not be formulated as a cell suspension. In specific cases they are formulated in a single dose form. They may be formulated for systemic or local administration.
- the cells are formulated for storage prior to use, and the cell formulation may comprise one or more cry opreservation agents, such as DMSO (for example, in 5% DMSO).
- the cell formulation may comprise albumin, including human albumin, with a specific formulation comprising 2.5% human albumin.
- the cells may be formulated specifically for intravenous administration; for example, they are formulated for intravenous administration over less than one hour.
- the cells are in a formulated cell suspension that is stable at room temperature for 1, 2, 3, or 4 hours or more from time of thawing.
- nucleic acid molecules disclosed herein may be obtained from any source that produces nucleic acids. Methods of isolating mRNA are well known in the art. See e.g., Sambrook et al., supra.
- the disclosure relates to an immunogenic composition for administration to a host.
- the host is a human. In other embodiments, the host is a non-human.
- the composition comprises a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct.
- the modified antigenic polypeptide construct can differ from an unmodified antigenic polypeptide construct at one or more antigenic peptide sequences.
- the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide construct.
- an antigenic peptide sequence of the unmodified antigenic polypeptide construct comprises 5 or more consecutive amino acids having at least about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue.
- the modified antigenic polypeptide construct comprises an antigenic peptide sequence of 5 or more consecutive amino acids having less than about 50% amino acid sequence identity with the cross-reactive host peptide.
- the composition comprises a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct.
- the modified antigenic polypeptide construct can differ from an unmodified antigenic polypeptide construct at one or more antigenic peptide sequences.
- the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide construct.
- an antigenic peptide sequence of the unmodified antigenic polypeptide construct comprises 9 consecutive amino acids having at least about 75% sequence identity or 15 consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue.
- the modified antigenic polypeptide construct comprises an antigenic peptide sequence of 9 consecutive amino acids having less than about 75% sequence identity or 15consecutive amino acids having less than about 50% amino acid sequence identity with the cross-reactive host peptide.
- the composition comprises a modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct.
- the modified viral spike protein construct can differ from an unmodified viral spike protein construct at one or more antigenic peptide sequences.
- the modified viral spike protein construct has at least about 50% amino acid sequence identity with the unmodified viral spike protein construct.
- an antigenic peptide sequence of the unmodified viral spike protein construct comprises 5 or more consecutive amino acids having at least about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue.
- the modified viral spike protein construct comprises an antigenic peptide sequence of 5 or more consecutive amino acids having less than about 50% amino acid sequence identity with the cross-reactive host peptide.
- the composition comprises a modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct.
- the modified viral spike protein construct can differ from an unmodified viral spike protein construct at one or more antigenic peptide sequences.
- the modified viral spike protein construct has at least about 50% amino acid sequence identity with the unmodified viral spike protein construct.
- an antigenic peptide sequence of the unmodified viral spike protein construct comprises 9 consecutive amino acids having at least about 75% sequence identity or 15 consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue.
- the modified viral spike protein construct comprises an antigenic peptide sequence of 9 consecutive amino acids having less than about 75% sequence identity or 15 consecutive amino acids having less than about 50% amino acid sequence identity with the cross-reactive host peptide.
- the compositions described herein are immunogenic compositions.
- the compositions described herein include at least one isolated nucleic acid or polypeptide molecule as described herein.
- the compositions described herein are vaccines.
- the immunogenic compositions comprise RNA, and the immunogenic compositions are RNA vaccines.
- the immunogenic compositions comprise DNA, and vaccines are DNA vaccines.
- the immunogenic compositions comprise a polypeptide, and vaccines are polypeptide vaccines.
- Conditions and/or diseases that can be treated with the RNA, DNA, and/or peptide or polypeptide compositions include, but are not limited to, those caused and/or impacted by infection, cancer, rare diseases, and other diseases or conditions caused by overproduction, underproduction, or improper production of proteins, DNA, or RNA, such as mRNA or siRNA.
- the composition is substantially free of one or more impurities or contaminants and, for instance, includes nucleic acid or polypeptide molecules that are equal to any one of, at least any one of, at most any one of, or between any two of 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% pure; at least 98% pure, or at least 99% pure.
- the composition further includes a lipid-based delivery system, which delivers a nucleic acid molecule to the interior of a cell, where it can then replicate, inhibit protein expression of interest, and/or express the encoded polypeptide of interest.
- the delivery system may have adjuvant effects which enhance the immunogenicity of an encoded antigen.
- the composition further includes neutral lipids, cationic lipids, cholesterol, and polyethylene glycol (PEG), and forms nanoparticles that encompass, or encapsulate, the nucleic acid molecules.
- the composition further includes any one of a cationic lipid, a liposome, a lipid nanoparticle, a polyplex, a cochleate, a virosome, an immune-stimulating complex, a microparticle, a microsphere, a nanosphere, a unilamellar vesicle, a multilamellar vesicle, an oil-in-water emulsion, a water- in-oil emulsion, an emulsome, a polycationic peptide, and a cationic nanoemulsion.
- the nucleic acid molecule is encapsulated in, bound to or adsorbed on any one of a cationic lipid, a liposome, a lipid nanoparticle, a polyplex, a cochleate, a virosome, an immune -stimulating complex, a microparticle, a microsphere, a nanosphere, a unilamellar vesicle, a multilamellar vesicle, an oil-in-water emulsion, a water-in-oil emulsion, an emulsome, a polycationic peptide, and a cationic nanoemulsion, or a combination thereof.
- encapsulate As used herein, “encapsulate,” “encapsulated,” “encapsulation,” and grammatically comparable variants thereof mean that at least a portion of a substance is enclosed or surrounded by another material or another substance in a composition.
- a substance such as a nucleic acid
- a composition such as a lipid.
- compositions further comprise one or more stabilizing agents and one or more buffers.
- a nucleic acid molecule e.g. , a naked or encapsulated nucleic acid, or a polypeptide as disclosed herein may be comprised in a solution comprising the one or more stabilizing agents and one or more buffers.
- the stabilizing agent comprises sucrose, mannose, sorbitol, raffinose, trehalose, mannitol, inositol, sodium chloride, arginine, lactose, hydroxyethyl starch, dextran, polyvinylpyrolidone, glycine, or a combination thereof.
- the stabilizing agent is a disaccharide, or sugar.
- the stabilizing agent is sucrose.
- the stabilizing agent is trehalose.
- the stabilizing agent is a combination of sucrose and trehalose.
- the total concentration of the stabilizing agent(s) in the composition is about 5% to about 10% w/v.
- the total concentration of the stabilizing agent can be equal to any one of, at least any one of, at most any one of, or between any two of 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, or 20% w/v or any range or value derivable therein.
- the total concentration of the stabilizing agent(s) in the composition is 10% w/v.
- the amino acid concentration is 5% w/v.
- buffering agents include, but are not limited to, citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, d- gluconic acid, calcium glycerophosphate, calcium lactate, calcium lactobionate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, amino-sulfonate buffers (e.g.,
- the buffer is a HEPES buffer, a Tris buffer, or a PBS buffer. In one embodiment, the buffer is Tris buffer. In another embodiment, the buffer is a HEPES buffer. In a further embodiment, the buffer is a PBS buffer. In some embodiments, the concentration of the buffer in the composition is about 10 mM.
- the buffer concentration can be equal to any one of, at least any one of, at most any one of, or between any two of 1 mM, 2 mM, 3 mM, 4 mM, 5 mM, 6 mM, 7 mM, 8 mM, 9 mM, 10 mM, 11 mM, 12 mM, 13 mM, 14 mM, 15 mM, 16 mM, 17 mM, 18 mM, 19 mM, or 20 mM, or any range or value derivable therein.
- the buffer concentration is 10 mM.
- the buffer can be at a neutral pH, pH 6.5 to 8.5, pH 7.0 to pH 8.0, or pH 7.2 to pH 7.6.
- the buffer can be at pH 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3,
- the buffer is at pH 7.4.
- compositions may further include one or more salts and/or one or more pharmaceutically acceptable surfactants, preservatives, carriers, diluents, and/or excipients, in some cases.
- the composition further includes a pharmaceutically acceptable vehicle.
- each of a buffer, stabilizing agent, salt, surfactant, preservative, and excipient are included in the compositions.
- any one or more of a buffer, stabilizing agent, salt, surfactant, preservative, excipient, carrier, diluent, or vehicle may be excluded from compositions.
- salts include but not limited to sodium salts and/or potassium salts.
- the sodium salt comprises sodium chloride.
- the potassium salt comprises potassium chloride.
- the concentration of the salts in the composition can be about 70 mM to about 140 mM.
- the salt concentration can be equal to any one of, at least any one of, at most any one of, or between any two of 50 mM, 60 mM, 70 mM, 80 mM, 90 mM, 100 mM, 120 mM, 130 mM, 140 mM, 150 mM, 160 mM, 170 mM, 180 mM, 190 mM, or 200 mM, or any range or value derivable therein.
- the salt concentration is 70 mM. In specific embodiments, the salt concentration is 140 mM.
- the salt can be at a neutral pH, pH 6.5 to 8.5, pH 7.0 to pH 8.0, or pH 7.2 to pH 7.6.
- the salt can be at a pH equal to any one of, at least any one of, at most any one of, or between any two of 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, or
- excipients which refer to ingredients in the compositions that are not active ingredients, include but are not limited to carriers, binders, diluents, lubricants, thickeners, surface active agents, preservatives, stabilizers, emulsifiers, buffers, flavoring agents, disintegrants, coatings, plasticizers, compression agents, wet granulation agents, or colorants.
- Preservatives for use in the compositions disclosed herein include but are not limited to benzalkonium chloride, chlorobutanol, paraben and thimerosal.
- “pharmaceutically acceptable carrier” includes any and all aqueous solvents (e.g., water, alcoholic/aqueous solutions, saline solutions, parenteral vehicles, such as sodium chloride, Ringer’s dextrose, etc.), non-aqueous solvents (e.g., propylene glycol, polyethylene glycol, vegetable oil, and injectable organic esters, such as ethyloleate), dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial or antifungal agents, anti-oxidants, chelating agents, and inert gases), isotonic agents, absorption delaying agents, salts, drugs, drug stabilizers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, fluid and nutrient replenishers, such like materials and combinations thereof, as would be known to one of ordinary skill in the art.
- aqueous solvents e.g.
- Diluents include but are not limited to ethanol, glycerol, water, sugars such as lactose, sucrose, mannitol, and sorbitol, and starches derived from wheat, com rice, and potato; and celluloses such as microcrystalline cellulose.
- the amount of diluent in the composition can range from about 10% to about 90% by weight of the total composition, about 25% to about 75%, about 30% to about 60% by weight, or about 12% to about 60%.
- compositions described herein can be carried out via any of the accepted modes of administration of agents for serving similar utilities.
- Pharmaceutical compositions may be formulated into preparations in solid, semi-solid, liquid or gaseous forms, such as tablets, capsules, powders, granules, ointments, solutions, suspensions, suppositories, injections, inhalants, gels, microspheres, and aerosols.
- Typical routes of administering such pharmaceutical compositions include, without limitation, oral, topical, transdermal, inhalation, parenteral, sublingual, buccal, rectal, vaginal, and intranasal.
- parenteral includes subcutaneous injections, intravenous, intramuscular, intradermal, intrastemal injection, or infusion techniques.
- Pharmaceutical compositions described herein are formulated so as to allow the active ingredients contained therein to be bioavailable upon administration of the composition to a patient.
- Compositions that will be administered to a subject or patient take the form of one or more dosage units, where for example, a tablet may be a single dosage unit, and a container of a compound in aerosol form may hold a plurality of dosage units.
- composition to be administered will, in any event, contain a therapeutically and/or prophylactically effective amount of a compound within the scope of this disclosure, or a pharmaceutically acceptable salt thereof, for treatment of a disease or condition of interest in accordance with the teachings described herein.
- a pharmaceutical composition within the scope of this disclosure may be in the form of a solid or liquid.
- the carrier(s) are particulate, so that the compositions are, for example, in tablet or powder form.
- the carrier(s) may be liquid, with the compositions being, for example, an oral syrup, injectable liquid, or an aerosol, which is useful in, for example, inhalator administration.
- the pharmaceutical composition is preferably in either solid or liquid form, where semi-solid, semi-liquid, suspension, and gel forms are included within the forms considered herein as either solid or liquid.
- the pharmaceutical composition may be formulated into a powder, granule, compressed tablet, pill, capsule, chewing gum, wafer or the like form.
- Such a solid composition will typically contain one or more inert diluents or edible carriers.
- one or more of the following may be present or exclude: binders such as carboxymethylcellulose, ethyl cellulose, microcrystalline cellulose, gum tragacanth, or gelatin; excipients such as starch, lactose, or dextrins; disintegrating agents such as alginic acid, sodium alginate, Primogel, com starch and the like; lubricants such as magnesium stearate or Sterotex; glidants such as colloidal silicon dioxide; sweetening agents such as sucrose or saccharin; a flavoring agent such as peppermint, methyl salicylate, or orange flavoring; and a coloring agent.
- binders such as carboxymethylcellulose, ethyl cellulose, microcrystalline cellulose, gum tragacanth, or gelatin
- excipients such as starch, lactose, or dextrins
- disintegrating agents such as al
- the pharmaceutical composition When the pharmaceutical composition is in the form of a capsule, for example, a gelatin capsule, it may contain, in addition to materials of the above type, a liquid carrier such as polyethylene glycol or oil.
- the pharmaceutical composition may be in the form of a liquid, for example, an elixir, syrup, solution, emulsion or suspension.
- the liquid may be for oral administration or for delivery by injection, as two examples.
- preferred composition contain, in addition to the present compounds, one or more of a sweetening agent, preservatives, dye/colorant, and flavor enhancer.
- a surfactant, preservative, wetting agent, dispersing agent, suspending agent, buffer, stabilizer, and isotonic agent may be included or exclude.
- a liquid pharmaceutical composition may include or exclude one or more of the following adjuvants: sterile diluents such as water for injection, saline solution, preferably physiological saline, Ringer's solution, isotonic sodium chloride, fixed oils such as synthetic mono or diglycerides which may serve as the solvent or suspending medium, polyethylene glycols, glycerin, propylene glycol or other solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates, or phosphates; and agents for the adjustment of tonicity such as sodium chloride or dextrose; agents to act as cryoprotectants such as sucrose or trehalose.
- the parenteral preparation can be enclosed in ampoules, disposable syringes, or multiple dose
- a liquid pharmaceutical composition intended for either parenteral or oral administration should contain an amount of a compound such that a suitable dosage will be obtained.
- compositions may be prepared by methodology well known in the pharmaceutical art.
- a pharmaceutical composition intended to be administered by injection can be prepared by combining the nucleic acid or polypeptide with sterile, distilled water or other carrier so as to form a solution.
- a surfactant may be added to facilitate the formation of a homogeneous solution or suspension.
- Surfactants are compounds that non- covalently interact with a compound consistent with the teachings herein so as to facilitate dissolution or homogeneous suspension of the compound in the aqueous delivery system.
- compositions within the scope of the disclosure are administered in a therapeutically and/or prophylactically effective amount, which will vary depending upon a variety of factors including the activity of the specific therapeutic and/or prophylactic agent employed; the metabolic stability and length of action of the therapeutic and/or prophylactic agent; the age, body weight, general health, gender, and diet of the patient; the mode and time of administration; the rate of excretion; the drug combination; the severity of the particular disorder or condition; and the subject undergoing therapy.
- the disclosure relates to a method for producing an immunogenic composition comprising a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct.
- the method can comprise one or both of the following steps: identifying at least one antigenic peptide sequence comprised in an unmodified antigenic polypeptide construct, and modifying the antigenic peptide sequence of the unmodified antigenic polypeptide construct to have less than about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue to form the modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct.
- the method comprises both of the steps of identifying at least one antigenic peptide sequence comprised in an unmodified antigenic polypeptide construct, and modifying the antigenic peptide sequence of the unmodified antigenic polypeptide construct to have less than about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue to form the modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct.
- the disclosure also relates to a method for reducing or preventing cross-reactivity of an antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct.
- the method can comprise one or both of the following steps: identifying at least one antigenic peptide sequence comprised in an unmodified antigenic polypeptide construct, and modifying the antigenic peptide sequence of the unmodified antigenic polypeptide construct to produce a modified antigenic peptide sequence having less than about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue to produce a modified antigenic polypeptide construct comprising the modified antigenic peptide sequence and/or a nucleic acid encoding the modified antigenic polypeptide construct comprising the modified antigenic peptide sequence.
- the method comprises both of the steps of identifying at least one antigenic peptide sequence comprised in an unmodified antigenic polypeptide construct, and modifying the antigenic peptide sequence of the unmodified antigenic polypeptide construct to produce a modified antigenic peptide sequence having less than about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue to produce a modified antigenic polypeptide construct comprising the modified antigenic peptide sequence and/or a nucleic acid encoding the modified antigenic polypeptide construct comprising the modified antigenic peptide sequence.
- modifying the antigenic peptide sequence reduces or prevents crossreactivity of the modified antigenic polypeptide construct to the cross-reactive host peptide compared to the cross-reactivity of an unmodified antigenic polypeptide construct comprising an unmodified antigenic peptide sequence.
- the antigenic peptide sequence comprises 5 or more consecutive amino acids having at least about 50% amino acid sequence identity with a cross- reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue.
- the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide construct.
- the antigenic peptide sequence comprises 9 consecutive amino acids having at least about 75% sequence identity or 15 consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue.
- the modified antigenic polypeptide construct has at least about 50% amino acid sequence identity with the unmodified antigenic polypeptide construct.
- antigenic peptide sequences of antigenic polypeptide constructs to be modified to reduce or prevent cross-reactivity with host peptides comprised in a cross-reactive host polypeptides expressed in a host tissue can be identified using one or more of peptide sharing analysis (e.g., protein alignment), mRNA and protein expression profiles of cross-reactive host peptides comprised in a cross-reactive host polypeptides expressed in a host tissue, rank-based approaches to account for the cellular location of the proteins and additional evidence (e.g., disease association, genetic linkage, and immune function), and algorithmic immunogenicity prediction tools (e.g., http://tools.iedb.org/main/tcell).
- peptide sharing analysis e.g., protein alignment
- mRNA and protein expression profiles of cross-reactive host peptides comprised in a cross-reactive host polypeptides expressed in a host tissue rank-based approaches to account for the cellular location of the proteins and additional evidence (e.g., disease association
- the cross-reactivity of the modified antigenic polypeptide construct and/or compositions thereof produced by the methods of the present disclosure with a host peptide sequence comprised in a cross-reactive host polypeptide expressed in a host tissue is reduced or prevented compared to the cross-reactivity of an unmodified antigenic peptide sequence and/or an unmodified antigenic polypeptide construct and/or compositions thereof with a host peptide sequence comprised in a cross-reactive host polypeptide expressed in a host tissue.
- the cross-reactivity of the modified antigenic polypeptide construct and/or compositions thereof produced by the methods of the present disclosure with a host peptide sequence comprised in a cross-reactive host polypeptide expressed in a host tissue is reduced or prevented compared to the cross-reactivity of an unmodified antigenic peptide sequence and/or an unmodified antigenic polypeptide construct and/or compositions thereof with a host peptide sequence comprised in a cross-reactive host polypeptide expressed in a host tissue by equal to any one of, at least any one of, at most any one of, or between any two of about 5% or higher, about 10% or more, about 15% or more, about 20% or more, about 30% or more, about 40% or more, about 50% or more, about 60% or more, about 70% or more, about 80% or more, about 90% or more, about 1-fold or more, about 2-fold or more, about 3- fold or more, about 4-fold or more, about 5-fold or more, about 10-fold or more, about 20-fold or
- the modified antigenic polypeptide construct and/or compositions thereof produced by the methods of the present disclosure have an efficacy, intracellular delivery, and/or immunogenicity equivalent to or higher than the efficacy, intracellular delivery, and/or immunogenicity of an unmodified antigenic peptide sequence and/or an unmodified antigenic polypeptide construct and/or compositions thereof.
- the modified antigenic polypeptide construct and/or compositions thereof produced by the methods of the present disclosure have an efficacy, intracellular delivery, and/or immunogenicity higher than the efficacy, intracellular delivery, and/or immunogenicity of an unmodified antigenic peptide sequence and/or an unmodified antigenic polypeptide construct and/or compositions thereof by equal to any one of, at least any one of, at most any one of, or between any two of about 5% or higher, about 10% or more, about 15% or more, about 20% or more, about 30% or more, about 40% or more, about 50% or more, about 60% or more, about 70% or more, about 80% or more, about 90% or more, about 1-fold or more, about 2-fold or more, about 3-fold or more, about 4-fold or more, about 5-fold or more, about 10-fold or more, about 20-fold or more, about 30-fold or more, about 40- fold or more, about 50-fold or more, about 100-fold or more, about 200-fold or more, about 300-
- the disclosure relates to a method for producing an immunogenic composition comprising a modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct.
- the method can comprise one or both of the following steps: identifying at least one antigenic peptide sequence comprised in an unmodified viral spike protein construct, and modifying the antigenic peptide sequence of the unmodified viral spike protein construct to have less than about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue to form the modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct.
- the method comprises both of the steps of identifying at least one antigenic peptide sequence comprised in an unmodified viral spike protein construct, and modifying the antigenic peptide sequence of the unmodified viral spike protein construct to have less than about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue to form the modified viral spike protein construct and/or a nucleic acid encoding the modified viral spike protein construct.
- the disclosure also relates to a method for reducing or preventing cross-reactivity of a viral spike protein construct and/or a nucleic acid encoding the viral spike protein construct.
- the method can comprise one or both of the following steps: identifying at least one antigenic peptide sequence comprised in an unmodified viral spike protein construct, and modifying the antigenic peptide sequence of the unmodified viral spike protein construct to produce a modified antigenic peptide sequence having less than about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue to produce a modified viral spike protein construct comprising the modified antigenic peptide sequence and/or a nucleic acid encoding the modified viral spike protein construct comprising the modified antigenic peptide sequence.
- the method comprises both of the steps of identifying at least one antigenic peptide sequence comprised in an unmodified viral spike protein construct, and modifying the antigenic peptide sequence of the unmodified viral spike protein construct to produce a modified antigenic peptide sequence having less than about 50% amino acid sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue to produce a modified viral spike protein construct comprising the modified antigenic peptide sequence and/or a nucleic acid encoding the modified viral spike protein construct comprising the modified antigenic peptide sequence.
- modifying the antigenic peptide sequence reduces or prevents cross-reactivity of the modified viral spike protein construct to the cross-reactive host peptide compared to the cross-reactivity of an unmodified viral spike protein construct comprising an unmodified antigenic peptide sequence.
- the antigenic peptide sequence comprises 5 or more consecutive amino acids having at least about 50% amino acid sequence identity with a cross- reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue.
- the modified viral spike protein construct has at least about 50% amino acid sequence identity with the unmodified viral spike protein construct.
- the antigenic peptide sequence comprises 9 consecutive amino acids having at least about 75% sequence identity or 15 consecutive amino acids having at least about 50% sequence identity with a cross-reactive host peptide comprised in a cross-reactive host polypeptide expressed in a host tissue .
- the modified viral spike protein construct has at least about 50% amino acid sequence identity with the unmodified viral spike protein construct.
- antigenic peptide sequences of viral spike protein constructs to be modified to reduce or prevent cross-reactivity with host peptides comprised in a cross- reactive host polypeptides expressed in a host tissue can be identified using one or more of peptide sharing analysis (e.g., protein alignment), mRNA and protein expression profiles of cross-reactive host peptides comprised in a cross-reactive host polypeptides expressed in a host tissue, rank-based approaches to account for the cellular location of the proteins and additional evidence (e.g., disease association, genetic linkage, and immune function), and algorithmic immunogenicity prediction tools (e.g., http://tools.iedb.org/main/tcell).
- peptide sharing analysis e.g., protein alignment
- mRNA and protein expression profiles of cross-reactive host peptides comprised in a cross-reactive host polypeptides expressed in a host tissue rank-based approaches to account for the cellular location of the proteins and additional evidence (e.g., disease association, genetic link
- the cross-reactivity of the modified viral spike protein construct and/or compositions thereof produced by the methods of the present disclosure with a host peptide sequence comprised in a cross-reactive host polypeptide expressed in a host tissue is reduced or prevented compared to the cross-reactivity of an unmodified viral spike protein sequence and/or an unmodified viral spike protein construct and/or compositions thereof with a host peptide sequence comprised in a cross-reactive host polypeptide expressed in a host tissue.
- the cross-reactivity of the modified viral spike protein construct and/or compositions thereof produced by the methods of the present disclosure with a host peptide sequence comprised in a cross-reactive host polypeptide expressed in a host tissue is reduced or prevented compared to the cross-reactivity of an unmodified viral spike protein sequence and/or an unmodified viral spike protein construct and/or compositions thereof with a host peptide sequence comprised in a cross-reactive host polypeptide expressed in a host tissue by equal to any one of, at least any one of, at most any one of, or between any two of about 5% or higher, about 10% or more, about 15% or more, about 20% or more, about 30% or more, about 40% or more, about 50% or more, about 60% or more, about 70% or more, about 80% or more, about 90% or more, about 1-fold or more, about 2-fold or more, about 3- fold or more, about 4-fold or more, about 5-fold or more, about 10-fold or more, about 20-fold or more, about 30-fold or
- the modified viral spike protein construct and/or compositions thereof produced by the methods of the present disclosure have an efficacy, intracellular delivery, and/or immunogenicity equivalent to or higher than the efficacy, intracellular delivery, and/or immunogenicity of an unmodified viral spike protein sequence and/or an unmodified viral spike protein construct and/or compositions thereof.
- the modified viral spike protein construct and/or compositions thereof produced by the methods of the present disclosure have an efficacy, intracellular delivery, and/or immunogenicity higher than the efficacy, intracellular delivery, and/or immunogenicity of an unmodified viral spike protein sequence and/or an unmodified viral spike protein construct and/or compositions thereof by equal to any one of, at least any one of, at most any one of, or between any two of about 5% or higher, about 10% or more, about 15% or more, about 20% or more, about 30% or more, about 40% or more, about 50% or more, about 60% or more, about 70% or more, about 80% or more, about 90% or more, about 1-fold or more, about 2-fold or more, about 3-fold or more, about 4-fold or more, about 5-fold or more, about 10-fold or more, about 20-fold or more, about 30-fold or more, about 40- fold or more, about 50-fold or more, about 100-fold or more, about 200-fold or more, about 300-fold or more, about 400
- the disclosure relates to a method of inducing an immune response in a subject.
- the method includes administering to the mammalian cell an effective amount of a composition as described herein.
- the disclosure relates to a method of vaccinating a subject.
- the method includes administering to the subject in need thereof an effective amount of a composition described herein.
- the disclosure relates to a method of treating or preventing an infectious disease.
- the method includes administering to the subject an effective amount of a composition as described herein.
- disclosure relates to a method of treating or preventing an infectious disease in a subject by, for example, inducing an immune response to an infectious disease in the subject.
- the method includes administering a priming composition that includes an effective amount of a composition described herein, and administering a booster composition including an effective amount of an adenoviral vector encoding an antigen.
- the method includes administering a priming composition including an effective amount of an adenoviral vector encoding an antigen, and administering a booster composition that includes an effective amount of a composition described herein.
- the composition elicits an immune response including an antibody response.
- the composition elicits an immune response including a T cell response.
- Computational toxicology concerns the use of computational tools to support integrative approaches to toxicological research and chemical safety assessments via predictive modeling, analyses of complex, multifaceted data sets, and extrapolation and translation among evidence streams, particularly new approach methodologies that rely upon alternatives to animal testing. Understanding which biological pathway targets are related to different types of organ level toxicities may be useful to design new in vitro assays and to develop new predictive computational methods and/or interpret their results.
- the disclosure relates to a method of identifying a potential toxicity of an immunogenic composition in a biological host system.
- the immunogenic composition may include an antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct.
- the method includes a. identifying one or more proteins of the host that have a degree of similarity to the antigenic polypeptide construct; b. identifying properties of the one or more proteins, the properties comprising cellular location, gene- and protein-tissue expression profiles, and/or toxic state associations; c. ranking or sorting the one or more proteins using one or more of the properties; d. identifying immunogenicity of the one or more proteins; e.
- step c. comparing the ranking or sorting in step c. with the immunogenicity of the one or more proteins in step d to produce a degree of correspondence; and f. predicting which of the one or more proteins are the most likely to cause a potential toxicity based on the degree of correspondence.
- One or more of the steps may be performed on a computer. In some embodiments all of the steps above are performed on a computer. In some embodiments one or more of the steps are performed on a different computer than one or more of the other steps. Performing one or more of the steps on a computer may include performing the steps in a single or in a combination of computational models.
- identifying a potential toxicity may include identifying a potential toxicity from a list or database of toxicities that the immunogenic composition is likely to increase a risk in a biological host system, if the immunogenic composition is administered to the biological host.
- identifying a potential toxicity may include identifying an immunogenic composition or a portion of an immunogenic composition, such as a portion of the antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct that is likely to increase the risk of a specific toxicity in a biological host system if the immunogenic composition is administered to the biological host.
- identifying a potential toxicity includes identifying a potential toxicity from a list or database of toxicities that the immunogenic composition is likely to increase a risk of in a biological host system if the immunogenic composition is administered to the biological host and includes identifying an immunogenic composition or a portion of an immunogenic composition, such as a portion of the antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct that is likely to increase the risk of a specific toxicity in a biological host system if the immunogenic composition is administered to the biological host.
- the potential toxicity can be any toxicity of the biological host.
- the potential toxicity is a toxicity associated with administration to the biological host of the immunogenic composition or a portion of an immunogenic composition, such as the antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct.
- the potential toxicity includes myocarditis or pericarditis.
- the potential toxicity includes myocarditis or pericarditis and the antigenic polypeptide construct is a viral spike protein.
- the antigenic polypeptide is a prefusion spike protein, such as any of the spike proteins comprising a SARS-CoV-2 S ectodomain trimer comprising protomers, which comprise an amino acid sequence at least 95% identical to residues 16-1208 of SEQ ID NO: 2 and comprising proline substitutions at positions 986 and 987 of SEQ ID NO: 2 that stabilize the S ectodomain trimer in a prefusion conformation, as described in WO2021163365 (PCT/US2021/017709), filed Feburary 11, 2021 by The United States of America, as represented by The Secretary, Department of Health and Human Services.
- WO2021163365 PCT/US2021/017709
- sequence of SEQ ID NO: 2 from WO2021163365, filed Feburary 11, 2021, is: MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI IRGWIFGTTLDSKTQSLLIV NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE GKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN CVADYSVLYNSASFSTFKCYGVSPTK
- stabilization of the perfusion conformation is obtained by introducing two consecutive proline substitutions at residues K986 and V987 in the spike protein (see SEQ ID NO: 2 described in WO2021163365 (PCT/US2021/017709), filed Feburary 11, 2021).
- the pre-fusion stabilized spike protein comprises at least one pre fusion stabilizing mutation, wherein the at least one pre-fusion stabilizing mutation comprises the following amino acid substitutions: K986P and V987P (see SEQ ID NO: 2 described in WO2021163365 (PCT/US2021/017709), filed Feburary 11, 2021).
- the stabilized spike protein has an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% identity to the amino acid sequence of: MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI IRGWIFGTTLDSKTQSLLIV NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE GKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGE
- the immunogenic composition can be a vaccine.
- the immunogenic composition can be a treatment or preventative treatment for an infection, cancer, rare diseases, and/or other diseases or conditions caused by overproduction, underproduction, or improper production of proteins, DNA, or RNA, such as mRNA or siRNA.
- the host can be a plant or an animal.
- the host can be a mammal.
- the host can be a human.
- the method includes searching a human proteome with a spike protein peptide and identifying a protein from the human proteome with homology to the spike protein peptide. In some instances, the method includes identifying whether the protein from the human proteome with homology to the spike protein peptide is present in a target organ.
- ranking or sorting the one or more proteins using one or more of the properties includes ranking cellular locations that are extracellular or on a surface of a cell as more likely to cause the potential toxicity than intracellular locations, ranking gene- and protein-tissue expression profdes that overlap in tissue location of the potential toxicity as more likely to cause the potential toxicity than other tissue locations, and/or ranking toxic state associations that overlap or are related to the potential toxicity as more likely to cause the potential toxicity than other toxic state associations.
- the ranking or sorting can be from greatest to least or can assign a numerical degree of likelihood to cause the potential toxicity. In some instances, all of cellular locations, gene- and protein-tissue expression profiles, and toxic state associations are used in this method.
- Cellular locations, gene- and protein-tissue expression profiles, and toxic state associations can be gathered from one or more premade lists or databases. In some instances, cellular locations, gene- and protein-tissue expression profiles, and toxic state associations can be predicted by computational methods and the predicted properties can be used in the methods herein.
- identifying immunogenicity of the one or more proteins comprises identifying a ranking or sorting of degree of immunogenicity and/or degree of potential immunogenicity.
- the ranking or sorting can be from greatest to least or can assign a numerical degree of immunogenicity and/or potential immunogenicity.
- Immunogenicity can be the ability of the one or more proteins to provoke an immune response in the biological host.
- the immunogenicity of the one or more proteins can be calculated or gathered from one or more premade lists or databases. In some instances, immunogenicity can be predicted by computational methods and the predicted immunogenicity can be used in the methods herein. [0198] Comparing the ranking or sorting in step c.
- step d to produce a degree of correspondence can include comparing the rank or degree of likelihood to cause the potential toxicity and the degree of immunogenicity and/or degree of potential immunogenicity and ranking: more likely to cause the potential toxicity and greater degree of immunogenicity and/or degree of potential immunogenicity as a greater degree of correspondence than either of less likely to cause the potential toxicity and greater degree of immunogenicity and/or degree of potential immunogenicity or more likely to cause the potential toxicity and less degree of immunogenicity and/or degree of potential immunogenicity, and either of less likely to cause the potential toxicity and greater degree of immunogenicity and/or degree of potential immunogenicity or more likely to cause the potential toxicity and less degree of immunogenicity and/or degree of potential immunogenicity as a greater degree of correspondence than less likely to cause the potential toxicity and less degree of immunogenicity and/or degree of potential immunogenicity.
- the degree of correspondence can be from greatest to least or can assign a numerical degree of correspondence.
- Predicting which of the one or more proteins are the most likely to cause a potential toxicity based on the degree of correspondence can include predicting a greater degree of correspondence as more likely to cause a potential toxicity.
- the method can further include modifying the antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct to produce a modified antigenic polypeptide construct and/or a nucleic acid encoding the modified antigenic polypeptide construct that is less likely to cause the potential toxicity when compared to the antigenic polypeptide construct and/or a nucleic acid encoding the antigenic polypeptide construct.
- the modification process can include, but is not limited to, modifying the nucleic acid or protein sequence, changing one or more of the naturally occurring nucleotides or amino acids to analogs or non-naturally occurring nucleotides or amino acid, removing one or more of the nucleotides or amino acids, adding additional nucleotides or amino acids, or combinations thereof.
- FIG. 1 A strategy employed for identifying antigen mimicry occurring following immunization with the BNT162b2 mRNA vaccine against COVID-19 is illustrated in FIG. 1.
- peptide sharing analysis between the BNT162b2 spike protein sequence and human proteins was conducted to identify human proteins with similarity to the COVID-19 spike protein.
- FIG. 2 in a preferred analysis, hundreds of protein “hits” corresponding to similarity between an antigenic peptide sequence comprising 9 and 15 consecutive amino acids from the BNT162b2 spike protein sequence and an endogenously- expressed human protein were obtained.
- mRNA and protein expression profiles in various tissues were also assessed to determine whether the human proteins identified as similar to the BNT162b2 spike protein sequence are enriched in the heart. Out of the proteins that comprise of at least one of the 2236 peptides, only 103 were determined to be predominantly expressed in the heart. The results were further narrowed using a rank-based approach to account for the cellular location of the proteins and additional evidence (e.g., disease association, genetic linkage, immune function, known epitopes) supporting a role for the human protein in pericarditis and/or myocarditis, as well as algorithmic immunogenicity predictions (http:// tools.iedb.org/main/tcell).
- additional evidence e.g., disease association, genetic linkage, immune function, known epitopes
- % identity means the percentage of human peptide sequence that is similar to the vaccine sequence (including antigen and non-coding regions) or spike protein sequence as referenced in the table. 100% means vaccine peptide sequence perfectly matches with a human peptide sequence.
- RYR2 (ryanodine receptor 2) and NEBL (nebulette) were the top candidates identified due to the fact that they are plasma membrane proteins and they have heart-specific protein expression profiles.
- the RYR2 protein profile is similar in humans compared to preclinical species, and RYR2 has been associated with cardiomyopathies (considered to be a rare genetic variant).
- RYR2 is important in fetal heart development, and auto-antibodies against RYR2 have been found in myasthenia gravis patients. Additionally, RYR2 is important in mechanical stretch and TGFb-1 signaling during exertion.
- the NEBL protein profile is distinct in humans compared to preclinical species.
- NEBL binds actin and interacts with thin filaments and Z-line associated proteins in striated muscle.
- NEBL may be involved in cardiac myofibril assembly and is a component of extracellular vesicular exosomes; I bands; stress fibers; and Z discs in the heart. Additionally, NEBL is known to play a role in familial isolated dilated cardiomyopathy.
- Kelch like family member 41 was identified as a top hit using the rank-based strategy. KLHL41 is involved in skeletal muscle development and differentiation, and it regulates proliferation and differentiation of myoblasts and plays a role in myofibril assembly by promoting lateral fusion of adjacent thin fibrils into mature, wide myofibrils.
- KLHL41 is also associated with an autosomal recessive form of nemaline myopathy.
- Nemaline myopathies are muscular disorders characterized by muscle weakness of varying severity and onset, and abnormal thread-like or rod-shaped structures in muscle fibers on histologic examination.
- data are generated to demonstrate cross-reactivity of host peptide sequences with antibodies (e.g., spike protein antibodies).
- specific regions of the spike protein are conserved in MHC presentation and are important for cellular immune responses.
- the antigenic sequence responsible for antibody production against the spike protein and the host peptide sequences is determined. Additionally, or alternatively, in some such embodiments, the region of the spike protein comprising the peptide sequences is determined.
- overlapping region(s) of the antigenic peptide sequence e.g. , spike protein sequence
- host peptide sequences e.g., NEBL and RYR2
- SARS-CoV-2 virus is a member of a large family of viruses called coronaviruses that causes a respiratory disease COVID-19. While there are short-term effects of SARS-CoV- 2 infection such as fever, fatigue, headache and loss of taste/smell, the long-term effects can be very serious, including organ damage. In some people, lasting health effects may include, heart complications, chronic kidney impairment, stroke, and Guillain-Barre syndrome. This study focused on determining if these long-term effects/multi-organ failures that have been observed after infection are occurring due to molecular mimicry. Initially, we identified -2500 human peptides (9 and 15 amino acids) with at least 50% similarity within the SARS-CoV-2 spike protein sequences.
- the proteins that these peptides are a part of were triaged to 26 human endogenous proteins highly expressed in heart, kidney and brain tissues that could potentially lead to immune-mediated adverse events.
- the present example will describe our computational approach that can be used by infectious disease, vaccine and drug safety scientists for molecular mimicry risk assessment.
- Step B Peptide Homology Search a. Blasting spike protein sequences against human proteome b. 9-aa with >75% similarity (for MHC I predictions) c. 15-aa with >50% similarity (for MHC II predictions)
- Step C) Antigenicity Predictions Determining binding capability of human peptides to MHC Class I and II molecules using Immune epitope database (IEDB)
- the method includes steps in the following order: (B) Peptide homology search followed by (A) Ranking strategy. In some embodiments, the method includes steps in the following order: (B) Peptide homology search followed by (C) Antigenicity predictions. In some embodiments, the method further includes in the following order the step of (C) Antigenicity predictions followed by (A) Ranking strategy.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Communicable Diseases (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Oncology (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Description
Claims
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163282170P | 2021-11-22 | 2021-11-22 | |
| PCT/IB2022/061148 WO2023089556A1 (en) | 2021-11-22 | 2022-11-18 | Reducing risk of antigen mimicry in immunogenic medicaments |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP4436595A1 true EP4436595A1 (en) | 2024-10-02 |
Family
ID=84366892
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP22814525.6A Withdrawn EP4436595A1 (en) | 2021-11-22 | 2022-11-18 | Reducing risk of antigen mimicry in immunogenic medicaments |
Country Status (2)
| Country | Link |
|---|---|
| EP (1) | EP4436595A1 (en) |
| WO (1) | WO2023089556A1 (en) |
Family Cites Families (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
| NL8200523A (en) | 1982-02-11 | 1983-09-01 | Univ Leiden | METHOD FOR TRANSFORMING IN VITRO PLANT PROTOPLASTS WITH PLASMIDE DNA. |
| US4952500A (en) | 1988-02-01 | 1990-08-28 | University Of Georgia Research Foundation, Inc. | Cloning systems for Rhodococcus and related bacteria |
| US5703055A (en) | 1989-03-21 | 1997-12-30 | Wisconsin Alumni Research Foundation | Generation of antibodies through lipid mediated DNA delivery |
| US5302523A (en) | 1989-06-21 | 1994-04-12 | Zeneca Limited | Transformation of plant cells |
| US7705215B1 (en) | 1990-04-17 | 2010-04-27 | Dekalb Genetics Corporation | Methods and compositions for the production of stably transformed, fertile monocot plants and cells thereof |
| US5550318A (en) | 1990-04-17 | 1996-08-27 | Dekalb Genetics Corporation | Methods and compositions for the production of stably transformed, fertile monocot plants and cells thereof |
| US5322783A (en) | 1989-10-17 | 1994-06-21 | Pioneer Hi-Bred International, Inc. | Soybean transformation by microparticle bombardment |
| US5484956A (en) | 1990-01-22 | 1996-01-16 | Dekalb Genetics Corporation | Fertile transgenic Zea mays plant comprising heterologous DNA encoding Bacillus thuringiensis endotoxin |
| US5384253A (en) | 1990-12-28 | 1995-01-24 | Dekalb Genetics Corporation | Genetic transformation of maize cells by electroporation of cells pretreated with pectin degrading enzymes |
| US5475085A (en) | 1991-02-07 | 1995-12-12 | Molecumetics, Ltd. | Conformationally restricted mimetics of beta turns and beta bulges and peptides containing the same |
| WO1992013878A2 (en) | 1991-02-07 | 1992-08-20 | Board Of Trustees Of The University Of Illinois | Conformationally restricted mimetics of beta turns and beta bulges and peptides containing the same |
| WO1993004169A1 (en) | 1991-08-20 | 1993-03-04 | Genpharm International, Inc. | Gene targeting in animal cells using isogenic dna constructs |
| US5610042A (en) | 1991-10-07 | 1997-03-11 | Ciba-Geigy Corporation | Methods for stable transformation of wheat |
| DE69233046T2 (en) | 1991-10-24 | 2004-03-04 | Isis Pharmaceuticals, Inc., Carlsfeld | DERIVATIZED OLIGONUCLEOTIDS WITH IMPROVED CAPACITY |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| ATE398679T1 (en) | 1992-07-07 | 2008-07-15 | Japan Tobacco Inc | METHOD FOR TRANSFORMING A MONOCOTYLEDON PLANT |
| US5702932A (en) | 1992-07-20 | 1997-12-30 | University Of Florida | Microinjection methods to transform arthropods with exogenous DNA |
| JP2952041B2 (en) | 1992-07-27 | 1999-09-20 | パイオニア ハイ−ブレッド インターナショナル,インコーポレイテッド | Improved method for AGROBACTERIUM-mediated transformation of cultured soybean cells |
| GB9222888D0 (en) | 1992-10-30 | 1992-12-16 | British Tech Group | Tomography |
| US5446128A (en) | 1993-06-18 | 1995-08-29 | The Board Of Trustees Of The University Of Illinois | Alpha-helix mimetics and methods relating thereto |
| US5656610A (en) | 1994-06-21 | 1997-08-12 | University Of Southern California | Producing a protein in a mammal by injection of a DNA-sequence into the tongue |
| US5736524A (en) | 1994-11-14 | 1998-04-07 | Merck & Co.,. Inc. | Polynucleotide tuberculosis vaccine |
| US5929237A (en) | 1995-10-27 | 1999-07-27 | Molecumetics Ltd. | Reverse-turn mimetics and methods relating thereto |
| US5840833A (en) | 1995-10-27 | 1998-11-24 | Molecumetics, Ltd | Alpha-helix mimetics and methods relating thereto |
| US5780448A (en) | 1995-11-07 | 1998-07-14 | Ottawa Civic Hospital Loeb Research | DNA-based vaccination of fish |
| US5945100A (en) | 1996-07-31 | 1999-08-31 | Fbp Corporation | Tumor delivery vehicles |
| US5981274A (en) | 1996-09-18 | 1999-11-09 | Tyrrell; D. Lorne J. | Recombinant hepatitis virus vectors |
| CA2277278A1 (en) | 1997-01-10 | 1998-07-16 | Life Technologies, Inc. | Embryonic stem cell serum replacement |
| US5994624A (en) | 1997-10-20 | 1999-11-30 | Cotton Incorporated | In planta method for the production of transgenic plants |
| CZ298364B6 (en) | 1998-02-05 | 2007-09-05 | Smithkline Beecham Biologicals S. A. | Antigen derivatives associated with tumors of MAGE family a nucleic acid sequence encoding these derivatives, their use for preparing fusion proteins and preparations for vaccination |
| PT1187629E (en) | 1999-04-19 | 2005-02-28 | Glaxosmithkline Biolog Sa | ADJUVANT COMPOSITION THAT UNDERSTANDS SAPONIN AND AN IMMUNOSTIMULATOR OLIGONUCLEOTIDE |
| HK1047109A1 (en) | 1999-10-15 | 2003-02-07 | University Of Massachusetts | Rna interference pathway genes as tools for targeted genetic interference |
| US6326193B1 (en) | 1999-11-05 | 2001-12-04 | Cambria Biosciences, Llc | Insect control agent |
| AU2001275474A1 (en) | 2000-06-12 | 2001-12-24 | Akkadix Corporation | Materials and methods for the control of nematodes |
| WO2021163365A1 (en) | 2020-02-11 | 2021-08-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Sars-cov-2 vaccine |
-
2022
- 2022-11-18 EP EP22814525.6A patent/EP4436595A1/en not_active Withdrawn
- 2022-11-18 WO PCT/IB2022/061148 patent/WO2023089556A1/en not_active Ceased
Also Published As
| Publication number | Publication date |
|---|---|
| WO2023089556A1 (en) | 2023-05-25 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10967057B2 (en) | Zika viral antigen constructs | |
| US20230242593A1 (en) | Zika viral antigen constructs | |
| JP6305925B2 (en) | Recombinant self-replicating polycistronic RNA molecules | |
| JP2023534900A (en) | Self-amplified SARS-COV-2 RNA vaccine | |
| US20110300205A1 (en) | Self replicating rna molecules and uses thereof | |
| JP2015522580A (en) | Immunological compositions and uses thereof | |
| BR112013000391B1 (en) | COMPOSITION OF CATIONIC EMULSION OF OIL IN WATER AND ITS USE | |
| US20230364219A1 (en) | Sars cov-2 spike protein construct | |
| US20240009296A1 (en) | Self-amplifying rna encoding an influenza virus antigen | |
| WO2023057930A1 (en) | Immunogenic lnp compositions and methods thereof | |
| US20230256090A1 (en) | Adjuvants | |
| EP4436595A1 (en) | Reducing risk of antigen mimicry in immunogenic medicaments | |
| WO2022175815A1 (en) | Methods of protecting rna | |
| AU2024218431A1 (en) | Nucleic acids and uses thereof | |
| EP4665390A1 (en) | Immunogenic composition against influenza | |
| WO2024194756A1 (en) | Modulating the innate immunity of rna | |
| WO2025163460A2 (en) | Vaccines against respiratory diseases | |
| HK40073646A (en) | Zika viral antigen constructs | |
| AU2024357274A1 (en) | Immunogenic compositions | |
| WO2025027492A1 (en) | Coronavirus antigen variants | |
| CN121941506A (en) | Anti-influenza immunogenic composition |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20240624 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) | ||
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION HAS BEEN WITHDRAWN |
|
| 18W | Application withdrawn |
Effective date: 20250225 |