EP4430079A1 - Cd20-pd1 binding molecules and methods of use thereof - Google Patents
Cd20-pd1 binding molecules and methods of use thereofInfo
- Publication number
- EP4430079A1 EP4430079A1 EP22822802.9A EP22822802A EP4430079A1 EP 4430079 A1 EP4430079 A1 EP 4430079A1 EP 22822802 A EP22822802 A EP 22822802A EP 4430079 A1 EP4430079 A1 EP 4430079A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- moiety
- protein
- agonist
- dimerization
- binding
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2887—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6803—General methods of protein analysis not limited to specific proteins or families of proteins
- G01N33/6845—Methods of identifying protein-protein interactions in protein mixtures
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
Definitions
- CD20-PD1 BINDING MOLECULESAND METHODS OF USE THEREOF
- the initial trigger for both systemic and organ-specific autoimmune disorders likely involves recognition of self or foreign molecules by innate sensors. This recognition triggers inflammatory responses and engagement of previously quiescent autoreactive T and B cells.
- Autoreactivity ranges from a low “physiologic” level of self-reactivity essential for lymphocyte selection and immune system homeostasis, to an intermediate level of autoimmunity that manifests as circulating autoantibodies and minor tissue infiltrates without clinical consequences, to pathogenic autoimmunity associated with immune-mediated organ injury.
- Autoimmune diseases are divided into organ-specific (e.g. type I diabetes (T1 D), multiple sclerosis (MS), inflammatory bowel diseases (IBDs), myasthenia gravis) and systemic (e.g. systemic lupus erythematosus (SLE), rheumatoid arthritis (RA), Sjogren’s syndrome) and can be mediated by autoantibodies or cytotoxic T cells, but in all instances helper T cells are required.
- T1 D type I diabetes
- MS multiple sclerosis
- IBDs inflammatory bowel diseases
- SLE systemic lupus erythematosus
- RA rheumatoid arthritis
- Sjogren’s syndrome helper T cells are required.
- autoimmune diseases exhibit clinical heterogeneity, a polygenic nature, and multifactorial contributions often requiring both genetic and environmental factors.
- Kono and Theofilopolous Kono, and Baccala, 2017, Nat Immunol, 18(17):716-724.
- Several inhibitory molecules e.g. CTLA-4, PD-1 , LAG-3, TIM3, VISTA, TIGIT, FcyRllb, certain Siglecs
- CTLA-4, PD-1 , LAG-3, TIM3, VISTA, TIGIT, FcyRllb, certain Siglecs are expressed on the surface of T and B cells to curtail excessive immune responses, both normal and anti-self.
- General immunosuppressive drug therapies such as chronic treatment with cyclosporin A, FK506 and rapamycin have also been unable to provide a cure for these diseases, and their use is accompanied by a host of deleterious side effects. Said effects include nephrotoxicity, increased predisposition to infectious diseases, and enhanced incidence of neoplasia.
- the present disclosure provides novel CD20-PD1 binding molecules.
- the CD20-PD1 binding molecules of the disclosure typically comprise or consist of CD20-PD1 monomers that include one or more CD20 targeting moieties and/or one or more PD1 agonist moieties.
- the CD20-PD1 binding molecules of the disclosure comprise a protein, the protein comprising at least one CD20 targeting moiety, at least one PD1 agonist moiety, at least one dimerization moiety, and optionally, one or more linker moieties separating one or more moieties in the protein.
- the CD20 targeting moiety is an anti-CD20 Fab
- the PD1 agonist moiety is the ectodomain of PDL1
- the dimerization moiety is an Fc domain
- the optionally i) the light chain of the Fab is not fused to the ectodomain of PDL1 or a PD1 -binding portion thereof; ii) the PD1 agonist moiety is not N-terminal to a VH of the anti-CD20 Fab; iii) the PD1 agonist moiety is not C- terminal to the Fc domain;
- the protein is monovalent for the CD20 targeting moiety and/or the PD1 agonist moiety; iv) the protein is asymmetrical; v) the protein comprises an Fc heterodimer; or any combination of two or more of the foregoing (i) through (vi).
- Exemplary CD20-PD1 binding molecules are disclosed in Section 6.2 and numbered embodiments 1 to 142.
- Exemplary CD20 targeting moieties are disclosed in Section 6.2.1 and numbered embodiments 2 to 6.
- Exemplary PD1 agonist moieties are disclosed in Section 6.4 and numbered embodiments 7 to 22.
- the disclosure further provides nucleic acids encoding the CD20-PD1 binding molecules, the CD20-PD1 monomers, and CD20 targeting moieties and PD1 agonist moieties.
- the nucleic acids encoding the CD20-PD1 binding molecules and CD20-PD1 monomers that are composed of two or more polypeptide chains can be a single nucleic acid (e.g., a vector encoding all polypeptide chains) or a plurality of nucleic acids (e.g., two or more vectors encoding the different polypeptide chains).
- the disclosure further provides host cells and cell lines engineered to express the nucleic acids and the CD20-PD1 binding molecules, the CD20-PD1 monomers, the CD20 targeting moieties, and the PD1 agonist moieties of the disclosure.
- the disclosure further provides methods of producing a CD20-PD1 binding molecule, a CD20-PD1 monomer, a CD20 targeting moiety and a PD1 agonist moiety of the disclosure.
- Exemplary nucleic acids, host cells, cell lines, and methods of producing the CD20-PD1 binding molecules, the CD20-PD1 monomers, the CD20 targeting moieties and the PD1 agonist moieties are described in Section 6.8 and numbered embodiments 150 to 152, infra.
- the disclosure further provides pharmaceutical compositions comprising the CD20-PD1 binding molecules, the CD20-PD1 monomers, the CD20 targeting moieties and the PD1 agonist moieties of the disclosure.
- Exemplary pharmaceutical compositions are described in Section 6.9 and numbered embodiment 153, infra.
- CD20-PD1 binding molecules e.g., for treating autoimmune diseases, repressing a cellular autoimmune response, or repressing the immune system of a subject.
- Exemplary methods are described in Section 6.10 and numbered embodiments 154 to 165, infra.
- FIGS. 1A-1L are a series of cartoons representing various formats of CD20-PD1 binding molecules according to certain embodiments. Heavy chain variable domains of the CD20 targeting moieties are shown in a striped pattern, light chain variable domains are shown in a dotted pattern, and PD1 agonist moieties (e.g., the ectodomain of PDL1 or PDL2 or a PD1 binding portion thereof) are shown as circles with dashed lines.
- PD1 agonist moieties e.g., the ectodomain of PDL1 or PDL2 or a PD1 binding portion thereof
- FIGS. 2A and 2B present a series of cartoons representing tested murine CD20-PD1 binding molecules PD1 (anti-mCD20 x mPDL1) (molecules A-L; FIG. 2A) and controls (molecules M-S; FIG. 2B).
- FIG. 3A depicts 3-dimensional models of hPDL1 (left) and mPDL1 (right), highlighting an unpaired cysteine residue (C113) at the surface of mPDL1 .
- FIG. 3B depicts a partial sequence alignment (78-137 aa) of mPDL1 (top sequence) and hPDL1 (bottom sequence).
- Figure discloses SEQ ID NOS: 54-55, respectively, in order of appearance.
- FIGS. 4A and 4B depict traces from flow binding studies and represent mPDL1 binding (top panels) or anti-mCD20 binding (bottom panels) by the indicated CD20-PD1 binding molecules (anti-mCD20 x mPDL1 ectodomain) on Jurkat/mPDI and MC38/mCD20 or HEK293/mCD20 cells, respectively.
- FIGS. 5A-5B depict the luciferase assay protocol.
- FIG. 5A is a schematic description of the luciferase reporter assay and
- FIG. 5B is a cartoon representation depicting the interactions between the key players described in FIG. 5A.
- FIGS. 6A-6E depict test molecules (FIG. 6A) and a series of traces using the same (FIGS. 6B-6E).
- the traces depict mPD1 agonism measured utilizing the bioassay depicted in FIG. 5. Cells and molecules used as indicated for each individual trace.
- FIG. 7 depicts the experimental design for a dose titration efficacy test in pre-diabetic Non- Obese Diabetic (NOD) mice.
- FIGS. 8A-8I present a series of traces depicting individual animal data demonstrating spontaneous diabetes onset in the presence of the indicated control or CD20-PD1 binding molecule (anti-mCD20 x mPDL1 ectodomain).
- FIGS. 9A and 9B depict graphs demonstrating the ability of CD20-PD1 binding molecule (anti-mCD20 x mPDL1 ectodomain) (top: molecule L of FIG. 2A; bottom: molecule G of FIG. 2B) to modulate diabetic onset in NOD mice.
- CD20-PD1 binding molecule anti-mCD20 x mPDL1 ectodomain
- FIGS. 10A-10C are box plots depicting the reduction of activated autoreactive islet-specific CD8+ T-cell infiltration into NOD mice pancreases following treatment with CD20-PD1 binding molecule (anti-mCD20 x mPDL1 ectodomain). * p ⁇ 0.05.
- FIGS. 11A-11C are box plots depicting the reduction of activated autoreactive CD3+, CD4+, and CD8+ T-cell infiltration into spinal cords of EAE-MS mice following treatment with CD20-PD1 binding molecule (anti-mCD20 x mPDL1 ectodomain) treatment. * p ⁇ 0.05, ** p ⁇ 0.01 , *** p ⁇ 0.001.
- an “or” conjunction is intended to be used in its correct sense as a Boolean logical operator, encompassing both the selection of features in the alternative (A or B, where the selection of A is mutually exclusive from B) and the selection of features in conjunction (A or B, where both A and B are selected).
- the term “and/or” is used for the same purpose, which shall not be construed to imply that “or” is used with reference to mutually exclusive alternatives.
- Antigen Binding Domain or ABD and Antigen Binding Fragment:
- the term “antigen binding domain” or “ABD”, and “Antigen Binding Fragment” as used herein refers to the portion of a targeting moiety that is capable of specific, non-covalent, and reversible binding to a target molecule.
- CD20-PD1 binding molecule or a component thereof refers to a functional relationship between two or more polypeptide chains or portions of a polypeptide chain.
- association means that two or more polypeptides are associated with one another, e.g., non-covalently through molecular interactions or covalently through one or more disulfide bridges or chemical cross-linkages, so as to produce a functional CD20-PD1 binding molecule.
- associations that might be present in a CD20-PD1 binding molecule of the disclosure include (but are not limited to) associations between homodimeric or heterodimeric Fc domains in an Fc region, associations between VH and VL regions in a Fab or scFv, associations between CH1 and CL in a Fab, and associations between CH3 and CH3 in a domain substituted Fab.
- bivalent means that the CD20-PD1 binding molecule has two CD20 targeting moieties (e.g., two antigen binding fragments of anti- CD20 antibodies) and/or two PD1 agonist moieties (e.g. two PDL1 agonist moieties, two PDL2 agonist moieties or a combination thereof), respectively.
- the CD20-PD1 binding molecule may be bivalent for one type of moiety (e.g., a CD20 targeting moiety) and monovalent for another type of moiety (e.g., a PD1 agonist moiety).
- CD20-PD1 Binding Molecule refers to a molecule comprising at least one CD20 targeting moiety and at least one PD1 agonist moiety.
- a CD20-PD1 binding molecule is a molecule composed of one or more polypeptide chains (e.g., one, two, three or four polypeptide chains) together comprising at least one CD20 targeting moiety and at least one PD1 agonist moiety.
- CD20-PD1 binding molecule sometimes refers to the core components of the molecule, namely the CD20 targeting moiety and the PD1 agonist moiety and sometimes also the dimerization moieties, such as Fc domains and any/or associated linker moieties. It is to be understood that the term “CD20- PD1 binding molecule” extends also to molecules comprising additional features, e.g., one or more stabilization moieties, one or more dimerization moieties, one or more linker moieties, and any combination of the foregoing, unless the context dictates otherwise.
- CD20 Targeting Moiety refers to any molecule or binding portion thereof (e.g., an immunoglobulin or an antigen binding fragment thereof) that can bind to CD20.
- the CD20 targeting moiety comprises an antigen binding fragment of an anti-CD20 antibody.
- the CD20-binding fragment of the anti-CD20 antibody can be in the form of a Fab, a Fv or an scFv.
- CD20 targeting moiety includes a molecule that can bind to any domain or region of CD20, including a topological domain or a transmembrane domain.
- a CD20 targeting moiety is a molecule that can bind to a region of CD20 displayed extracellularly on a surface of a cell (e.g., a B cell). CD20 targeting moieties are further described in Section 6.2.
- Complementarity Determining Region or CDR refers to the sequences of amino acids within antibody variable regions which confer antigen specificity and binding affinity. In general, there are three CDRs in each heavy chain variable region (CDR-H1 , CDR-H2, CDR-H3) and three CDRs in each light chain variable region (CDR1-L1 , CDR-L2, CDR-L3). Exemplary conventions that can be used to identify the boundaries of CDRs include, e.g., the Kabat definition, the Chothia definition, the ABM definition and the IMGT definition.
- dimerization moiety refers to a polypeptide chain or an amino acid sequence capable of facilitating an association between two polypeptide chains to form a dimer.
- a first dimerization moiety can associate with an identical second dimerization moiety, or can associate with a second dimerization moiety that is different from the first.
- a dimerization moiety is an Fc domain, with the association of two Fc domains forming an Fc region.
- the Fc region can be homodimeric or heterodimeric.
- EC50 refers to the half maximal effective concentration of a molecule, such as a CD20-PD1 binding molecule, which induces a response halfway between the baseline and maximum after a specified exposure time.
- the EC50 essentially represents the concentration of an antibody or CD20-PD1 binding molecule where 50% of its maximal effect is observed.
- the EC50 value equals the concentration of a CD20-PD1 binding molecule that gives half-maximal activation in an assay as described in Section 7.1.3.3.
- Epitope is a portion of an antigen (e.g., CD20) recognized by an antibody or other antigen-binding moiety as described herein.
- An epitope can be linear or conformational.
- Fab in the context of a CD20 targeting moiety of the disclosure refers to a pair of polypeptide chains, the first comprising a variable heavy (VH) domain of an antibody N- terminal to a first constant domain (referred to herein as C1), and the second comprising variable light (VL) domain of an antibody N-terminal to a second constant domain (referred to herein as C2) capable of pairing with the first constant domain.
- VH variable heavy
- VL variable light domain of an antibody N-terminal to a second constant domain
- C2 variable light domain capable of pairing with the first constant domain.
- the VH is N-terminal to the first constant domain (CH1) of the heavy chain
- VL is N-terminal to the constant domain of the light chain (CL).
- the Fabs of the disclosure can be arranged according to the native orientation or include domain substitutions or swaps that facilitate correct VH and VL pairings. For example, it is possible to replace the CH1 and CL domain pair in a Fab with a CH3-domain pair to facilitate correct modified Fab-chain pairing in heterodimeric molecules. It is also possible to reverse CH1 and CL, so that the CH1 is attached to VL and CL is attached to the VH, a configuration generally known as Crossmab, a type of “domain exchange”.
- Fc Domain and Fc Region refers to a portion of the heavy chain that pairs with the corresponding portion of another heavy chain.
- Fc region refers to the region of antibody-based binding molecules formed by association of two heavy chain Fc domains. The two Fc domains within the Fc region may be the same or different from one another. In a native antibody the Fc domains are typically identical, but one or both Fc domains might advantageously be modified to allow for heterodimerization, e.g., via a knob-in-hole interaction and/or for purification, e.g., via star mutations.
- Host Cell or Recombinant Host Cell refer to a cell that has been genetically engineered, e.g., through introduction of a heterologous nucleic acid. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications can occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term “host cell” as used herein.
- a host cell can carry the heterologous nucleic acid transiently, e.g., on an extrachromosomal heterologous expression vector, or stably, e.g., through integration of the heterologous nucleic acid into the host cell genome.
- a host cell can be a cell line of mammalian origin or mammalian-like characteristics, such as monkey kidney cells (COS, e.g., COS-1 , COS- 7), HEK293, baby hamster kidney (BHK, e.g., BHK21), Chinese hamster ovary (CHO), NSO, PerC6, BSC-1 , human hepatocellular carcinoma cells (e.g., Hep G2), SP2/0, HeLa, Madin-Darby bovine kidney (MDBK), myeloma and lymphoma cells, or derivatives and/or engineered variants thereof.
- the engineered variants include, e.g., glycan profile modified and/or site-specific integration site derivatives.
- Monomer and CD20-PD1 Monomer refer to a molecule comprising a first polypeptide chain which (a) comprises at least one CD20 targeting moiety and is capable of associating with a second polypeptide chain; (b) comprises at least one PD1 agonist moiety and is capable of associating with a second polypeptide chain; (c) comprises a dimerization moiety (e.g., an Fc domain) and is capable of associating with a corresponding dimerization moiety (e.g., another Fc domain) on a second polypeptide chain; or (d) any combination of (a), (b), and (c), above.
- a dimerization moiety e.g., an Fc domain
- a corresponding dimerization moiety e.g., another Fc domain
- Monomers are capable of associating with other monomers through a dimerization moiety (e.g., Fc domain) pairing.
- a dimerization moiety e.g., Fc domain
- one or more of associations between monomers are stabilized through hinge sequences or other portions of Fc domains.
- a monomer of the disclosure is capable of associating with another monomer to form a dimer.
- the dimers can be homodimeric, in which each constituent monomer is identical, or heterodimeric, in which case each constituent monomer is different.
- the reference to a “monomer” is for convenience and does not preclude the presence of a one or more additional polypeptide chains, for example one or more light chains of one or more Fab domains.
- a “dimer” of two monomers may include more than two polypeptide chains, e.g., may include three, four or more polypeptide chains and the reference to a monomer or dimer is not intended to imply any temporal order of association between polypeptide chains.
- Monovalent as used herein in reference to a CD20-PD1 binding molecule with respect to a CD20 targeting moiety and/or PD1 agonist moiety means that the CD20-PD1 binding molecule has one CD20 targeting moiety (e.g., one antigen binding domain of an anti-CD20 antibody) and/or one PD1 agonist moiety (e.g.
- the CD20-PD1 binding molecule may be monovalent for one type of moiety (e.g., a PD1 agonist moiety) and bivalent for another type of moiety (e.g., a CD20 targeting moiety).
- Multivalent means that the CD20-PD1 binding molecule has two or more CD20 targeting moieties (e.g., two antigen binding fragments of anti-CD20 antibodies) and/or two or more PD1 agonist moieties (e.g. two PDL1 agonist moieties, two PDL2 agonist moieties or a combination thereof), respectively.
- the CD20- PD1 binding molecule may be multivalent for one type of moiety (e.g., a CD20 targeting moiety) and monovalent for another type of moiety (e.g., a PD1 agonist moiety).
- Operably linked refers to a functional relationship between two or more regions of a polypeptide chain in which the two or more regions are linked so as to produce a functional polypeptide, or two or more nucleic acid sequences, e.g., to produce an in-frame fusion of two polypeptide components or to link a regulatory sequence to a coding sequence.
- PD1 Agonist Moiety refers to any molecule or portion thereof that can bind to and agonize PD1.
- the PD1 agonist moiety comprises an amino acid sequence having at least 70% sequence identity to the extracellular domain of programmed death-ligand 1 (PDL1) or a PD1-binding portion thereof, preferably a mammalian PDL1 (e.g., human or murine PDL1).
- the PD1 agonist moiety comprises an amino acid sequence having at least 70% sequence identity to the extracellular domain of programmed death-ligand (PDL2) or a PD1 -binding portion thereof, preferably a mammalian PDL2 (e.g., human or murine PDL2).
- PDL2 programmed death-ligand
- the extracellular domains of PDL1 and PDL2 are sometimes known as the “PDL1 ectodomain” and “PDL2 ectodomain,” respectively.
- the terms “PDL1 ectodomain” and “PDL2 ectodomain” are conveniently used in this specification to refer not only to the PDL1 and PDL2 ectodomains but additionally to fragments and variant sequences having PD1 binding activity.
- references to the terms “PDL1 ectodomain” and “PDL2 ectodomain” in the specification are intended to encompass PD1 binding portions of the PDL1 and PDL2 ectodomains as well as variants thereof having PD1 binding function, e.g., amino acid sequences having at least 70% or greater sequence identity to PD1 or PD2 and retention of PDL1 binding.
- a CD20-PD1 binding molecule can comprise a PD1 agonist moiety with one or more amino acid substitutions, deletions and/or insertions compared to a corresponding wild type sequence.
- the PD1 agonist moiety is murine PDL1 ectodomain comprising a C113S substitution.
- PD1 agonist moieties are further described in Section 6.2.1.
- Single Chain Fv or scFv refers to a polypeptide chain comprising the VH and VL domains of antibody, where these domains are present in a single polypeptide chain.
- Subject includes human and non-human animals.
- Non-human animals include all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, and reptiles. Except when noted, the terms “patient” or “subject” are used herein interchangeably.
- Treat, Treatment, Treating refers to the reduction or amelioration of the progression, severity and/or duration of a disorder as described herein, the amelioration of one or more symptoms (preferably, one or more discernible symptoms) of a condition or disorder as described herein, or prevention of a condition or disorder as described herein, e.g., an autoimmune or inflammatory condition or disorder, resulting from the administration of a molecule or composition (e.g., one or more CD20-PD1 binding molecules of the disclosure).
- a molecule or composition e.g., one or more CD20-PD1 binding molecules of the disclosure.
- the terms “treat”, “treatment” and “treating” refer to the amelioration of at least one measurable physical parameter of a disorder, e.g., an autoimmune disorder, not necessarily discernible by the patient.
- the terms “treat”, “treatment” and “treating” refer to the inhibition of the progression or onset of a disorder, either physically by, e.g., stabilization of a discernible symptom, physiologically by, e.g., stabilization of a physical parameter, or both.
- Universal Light Chain The term “universal light chain” as used herein in the context of a targeting moiety refers to a light chain polypeptide capable of pairing with the heavy chain region of the targeting moiety and also capable of pairing with other heavy chain regions. Universal light chains are also known as “common light chains.”
- VH refers to the variable region of an immunoglobulin heavy chain of an antibody, including the heavy chain of an scFv or a Fab.
- VL refers to the variable region of an immunoglobulin light chain, including the light chain of an scFv or a Fab.
- CD20-PD1 binding molecules comprising at least one CD20 targeting moiety and at least one PD1 agonist moiety.
- a CD20-PD1 binding molecule further comprises a dimerization moiety.
- the CD20-PD1 binding molecules of the disclosure typically comprise or consist of CD20- PD1 monomers that include one or more CD20 targeting moieties and/or one or more PD1 agonist moieties.
- the CD20-PD1 binding molecules of the disclosure comprise a protein, the protein comprising at least one CD20 targeting moiety, at least one PD1 agonist moiety, at least one dimerization moiety, and optionally, one or more linker moieties separating one or more moieties in the protein.
- the PD1 agonist moiety is positioned between the CD20 targeting moiety and the dimerization moiety of a CD20-PD1 monomer.
- the CD20-PD1 monomer thus has an N- to- C terminal orientation of CD20 targeting moiety - PD1 agonist moiety - dimerization moiety.
- the CD20-PD1 monomer when the CD20 targeting moiety and the PD1 agonist moiety are both C-terminal to the dimerization moiety, the CD20-PD1 monomer thus has an N- to- C terminal orientation of dimerization moiety - PD1 agonist moiety - CD20 targeting moiety.
- the CD20-PD1 binding molecules optionally have one or more of the following features i) the light chain of the Fab is not fused to the ectodomain of PDL1 or a PD1 -binding portion thereof; ii) the PD1 agonist moiety is not N-terminal to a VH of the anti-CD20 Fab; iii) the PD1 agonist moiety is not C-terminal to the Fc domain; iv) the protein is monovalent for the CD20 targeting moiety and/or the PD1 agonist moiety; v) the protein is asymmetrical; vi) the protein comprises an Fc heterodimer; or any combination of two or more of the foregoing (i) through (vi).
- the CD20-PD1 binding molecules have feature i) (i.e., the light chain of the Fab is not fused to the ectodomain of PDL1 or a PD1-binding portion thereof). In some embodiments, the CD20-PD1 binding molecules have feature ii) (i.e, the PD1 agonist moiety is not N-terminal to a VH of the anti-CD20 Fab). In some embodiments, the CD20-PD1 binding molecules have feature iii) (i.e., the PD1 agonist moiety is not C-terminal to the Fc domain).
- the CD20-PD1 binding molecules have feature iv) (i.e., the protein is monovalent for the CD20 targeting moiety and/or the PD1 agonist moiety). In some embodiments, the CD20-PD1 binding molecules have feature v) (i.e., the protein is asymmetrical). In some embodiments, the CD20-PD1 binding molecules have feature vi) (i.e., the protein comprises an Fc heterodimer).
- a CD20-PD1 binding molecule of the present disclosure may have any combination of two, three, four, five, or all of the preceding features.
- a CD20-PD1 binding molecule disclosed herein has feature ii) (i.e., the PD1 agonist moiety is not N- terminal to a VH of the anti-CD20 Fab) and feature iii) (i.e., the PD1 agonist moiety is not C- terminal to the Fc domain).
- a CD20-PD1 binding molecule can be composed of one or more polypeptides.
- the CD20-PD1 binding molecule is composed of a plurality of (e.g. two) monomers comprising at least one CD20 targeting moiety and/or at least one PD1 agonist moieties and in some embodiments also comprising dimerization moieties.
- the CD20-PD1 binding molecule of the disclosure is composed of two monomers, optionally in association with one or more additional polypeptide chains (e.g., a polypeptide chain comprising the light chain of an anti-CD20 Fab moiety).
- the monomers can be identical, thereby forming a homodimer, or different, thereby forming a heterodimer.
- the dimerization moieties of each monomer of a CD20- PD1 binding molecule can be configured to dimerize together. Exemplary dimerization moieties are described in Section 6.5.
- the one or more CD20 targeting moieties and the one or more PD1 agonist moieties can be included on the same arm of a CD20-PD1 binding molecule (e.g., wherein the CD20 targeting moiety comprises an anti-CD20 Fab and the PD1 agonist moiety comprises a PDL1-based PD1 agonist moiety, the variable heavy or variable light chain of the anti-CD20 Fab and the PDL1- based PD1 agonist moiety are on the same polypeptide chain), or can be included on different arms of a bispecific CD20-PD1 agonist (e.g., wherein the CD20 targeting moiety comprises an anti-CD20 Fab and the PD1 agonist moiety comprises a PDL1 -based PD1 agonist moiety, the variable heavy or variable light chain of the anti-CD20 Fab and the PDL1 -based PD1 agonist moiety are on different polypeptide chains).
- Exemplary configurations of the CD20-PD1 binding molecules of the disclosure are disclosed,
- the multiple CD20 targeting moieties can be the same or different from one another and/or the multiple PD1 agonist moieties can be the same or different from one another.
- a CD20-PD1 binding molecule can include one or more linker sequences connecting the various components of its one or more polypeptide chains, for example (1) the CD20 targeting moiety or a portion thereof (e.g., the heavy or light chain of an anti-CD20 Fab) and the PD1 agonist moiety or a portion thereof (e.g., PDL1 or PDL2) when present on the same polypeptide chain, (2) a CD20 targeting moiety and a dimerization domain e.g., an Fc domain), (3) a PD1 agonist moiety and a dimerization domain (e.g., an Fc domain), or (4) any combination of the foregoing.
- Exemplary linkers are described in Section 6.7.
- CD20-PD1 binding molecules are multimeric by virtue of association of dimerization moieties configured to associate with one another (e.g., Fc domains).
- the CD20-PD1 binding molecules may include two, three, four or more polypeptide chains, some associated through dimerization moieties and others through VH-VL interactions.
- the present disclosure generally refers to polypeptides containing a CD20 targeting moiety, a PD1 agonist moiety and/or a dimerization moiety (e.g., a first Fc domain) that is capable of associating with another polypeptide chain containing a CD20 targeting moiety, a PD1 agonist moiety and/or a corresponding dimerization moiety (e.g., a second Fc domain), respectively, as “monomers.”
- Monomers may include one, two, three or more polypeptide chains.
- Exemplary Monomer 1 CD20 targeting moiety - optional linker - dimerization moiety (see, e.g., FIGS. 1A, 1 E, 1 F, 1G, and 1 H, left monomers).
- Exemplary Monomer 2 PD1 agonist moiety - optional linker - dimerization moiety (see, e.g., FIG. 1A, right monomer).
- Exemplary Monomer 5 CD20 targeting moiety - optional linker - dimerization moiety - PD1 agonist moiety (see, e.g., FIGS. 1C and 1 F, right monomers; FIG. 1J, both monomers).
- Exemplary Monomer 6 CD20 targeting moiety - optional linker - PD1 agonist moiety - optional linker - dimerization moiety (see, e.g., FIGS. 1 D and 1G, right monomer; FIG. 1 L, both monomers).
- Exemplary Monomer 7 PD1 agonist moiety - optional linker - PD1 agonist moiety - optional linker - dimerization moiety (see, e.g., FIG. 1 H, right monomer).
- Exemplary Monomer 8 CD20 targeting moiety - optional linker - dimerization moiety - optional linker - CD20 targeting moiety (see, e.g., FIG. 1 K, left monomer).
- the present disclosure provides a CD20-PD1 binding molecule comprising Exemplary Monomer 1 and Exemplary Monomer 2 (see, e.g., FIG. 1A).
- the present disclosure provides a CD20-PD1 binding molecule comprising Exemplary Monomer s and Exemplary Monomer 4 (see, e.g., FIG. 1 B).
- the present disclosure provides a CD20-PD1 binding molecule comprising Exemplary Monomer 3 and Exemplary Monomer 5 (see, e.g., FIG. 1C).
- the present disclosure provides a CD20-PD1 binding molecule comprising Exemplary Monomer 3 and Exemplary Monomer 6 (see, e.g., FIG. 1 D).
- the present disclosure provides a CD20-PD1 binding molecule comprising Exemplary Monomer 1 and Exemplary Monomer 4 (see, e.g., FIG. 1 E).
- the present disclosure provides a CD20-PD1 binding molecule comprising Exemplary Monomer 1 and Exemplary Monomer 5 (see, e.g., FIG. 1 F).
- the present disclosure provides a CD20-PD1 binding molecule comprising Exemplary Monomer 1 and Exemplary Monomer 6 (see, e.g., FIG. 1G).
- the present disclosure provides a CD20-PD1 binding molecule comprising Exemplary Monomer 1 and Exemplary Monomer ? (see, e.g., FIG. 1 H).
- the present disclosure provides a CD20-PD1 binding molecule comprising two monomers according to Exemplary Monomer 4 (see, e.g., FIG. 11). [0082] In some embodiments, the present disclosure provides a CD20-PD1 binding molecule comprising two monomers according to Exemplary Monomer 5 (see, e.g., FIG. 1 J).
- the present disclosure provides a CD20-PD1 binding molecule comprising Exemplary Monomer 8 and Exemplary Monomer 9 (see, e.g., FIG. 1 K).
- the present disclosure provides a CD20-PD1 binding molecule comprising two monomers according to Exemplary Monomer 6 (see, e.g., FIG. 1L).
- each monomer when the CD20 targeting moiety is an antigen binding domain (“ABD”) of an antibody, each monomer can be composed of two or more polypeptide chains, one polypeptide chain bearing the heavy chain variable region and the other polypeptide chain(s) bearing the light chain variable region.
- the CD20 targeting moiety can comprise heavy and light chain variable domains on separate polypeptide chains.
- a monomer can be composed of a Polypeptide A and Polypeptide B.
- Polypeptide A can include, for example, from N-terminus to C-terminus: the heavy chain variable domain of a CD20 targeting moiety - optional linker - PD1 agonist moiety - optional linker - dimerization moiety; and Polypeptide B can comprise the light chain variable domain of the CD20 targeting moiety.
- the monomer can include a third polypeptide chain (Polypeptide C) comprising another light chain variable domain of the CD20 targeting moiety.
- a CD20 targeting moiety can be in the form of an scFv, in which the heavy and light chain variable regions of the CD20 targeting moiety are fused to one another in a single polypeptide.
- CD20-PD1 binding molecules of the disclosure can be less prone to aggregation, for example in vivo or ex vivo as compared to parental antibodies from which the CD20 targeting moieties were derived, and/or as compared to other antibody formats comprising a CD20 targeting moiety and a PD1 agonist moiety.
- the CD20-PD1 binding molecules of the disclosure have at least 50%, at least 60%, at least 70%, at least 80%, at least 95%, or at least 99% less aggregation during recombinant production in a mammalian cell line than a parental antibody.
- the oligomerization state of the CD20-PD1 binding molecules can be determined by, for example, size-exclusion ultra-performance liquid chromatography. Most of the CD20-PD1 binding molecules displayed greater than 85% monomeric species without additional size exclusion chromatography (SEC) (see Section 7.2.2). Column purification can then be employed to further purify monomeric species. For example, the monomer percentage of 2+2 m20_mPL_4 (molecule L of FIG. 2A) was increased to 99% following two column purification, including an SEC step (see Section 7.2.2).
- CD20-PD1 binding molecules of the disclosure also demonstrate good thermal stability. High thermostability and low aggregation propensity facilitate antibody manufacturing and storage, and promote long serum half-life. Carter and Merchant, 1997, Curr Opin Biotechnol, 8(4):449-454. Thermal stability can be measured by methods known in the art, including differential scanning fluorimetry (DSF) (see, e.g., Section 7.1.5). All tested CD20-PD1 molecules tested possessed a similar thermal stability as measured by DSF, with a melting temperature 1 (Tm1) - which represents the first unfolding midpoint of the protein - of about 60 °C (see Section 7.2.2).
- DSF differential scanning fluorimetry
- CD20 targeting moieties in the CD20-PD1 binding molecules of the disclosure provides, in some embodiments, the delivery of high concentrations of localized PD1 agonist moieties for the treatment of autoimmune disorders, including but not limited to type 1 diabetes, systemic lupus erythematosus, and Crohn’s disease, as well as for the treatment of graft-versus-host disease (GVHD).
- autoimmune disorders including but not limited to type 1 diabetes, systemic lupus erythematosus, and Crohn’s disease
- GVHD graft-versus-host disease
- an anti-CD20 moiety provides an additional therapeutic pathway against such autoimmune diseases.
- each CD20 targeting moiety of the CD20-PD1 binding molecules comprises an antigen binding domain of an anti-CD20 antibody.
- a CD20-PD1 binding molecule of the disclosure comprises a single CD20 targeting moiety (e.g., a CD20 targeting moiety on a first monomer or on a second monomer in embodiments where CD20-PD1 binding molecule is monovalent for the CD20 targeting moiety).
- a CD20-PD1 binding molecule of the disclosure comprises two CD20 targeting moieties (e.g., a first CD20 targeting moiety on a first monomer and a second CD20 targeting moiety on a second monomer in embodiments where the CD20-PD1 binding molecule is bivalent for the CD20 targeting moiety; or both a first and a second CD20 targeting moiety can be on either a first monomer or a second monomer).
- the two CD20 targeting moieties can be identical, or they can be different.
- the two CD20 targeting moieties can be orthogonal, bind to distinct epitopes of CD20, and/or be non-competing.
- the CD20 targeting moiety comprises an antigen binding domain of a known anti-CD20 antibody.
- known anti-CD20 antibodies include, but are not limited to rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab ituxetan, tositumomab, ublituximab, ocaratuzumab, TRU-015, and veltuzumab (each a “reference CD20 antibody”).
- the CD20 targeting moiety comprises CDRs having CDR sequences of a reference CD20 antibody.
- the CD20 targeting moiety comprises all 6 CDR sequences of a reference CD20 antibody. In other embodiments, the targeting moiety comprises at least the heavy chain CDR sequences (CDR-H1 , CDR-H2, CDR-H3) of a reference CD20 antibody and the light chain CDR sequences of a universal light chain. In further aspects, a CD20 targeting moiety comprises a VH comprising the amino acid sequence of the VH of a reference CD20 antibody. In some embodiments, the CD20 targeting moiety further comprises a VL comprising the amino acid sequence of the VL of the reference CD20 antibody. In other embodiments, the targeting moiety further comprises a universal light chain VL sequence.
- the CD20 targeting moiety comprises an antigen binding domain that binds to the same CD20 epitope as and/or competes for binding to CD20 with rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab ituxetan, tositumomab, ublituximab, ocaratuzumab, TRU-015, or veltuzumab.
- Assays for measuring antibody competition are known in the art. For example, a sample of CD20 can be bound to a solid support. Then, a first antibody and a second antibody are added. One of the two antibodies is labelled.
- a competing antibody is an antibody that decrease the binding of another antibody to CD20 by about 50%, about 60%, about 70%, about 80%, about 85%, about 90%, about 95%, or about 99%.
- competition for binding to a target molecule can be determined, for example, using a real time, label-free bio-layer interferometry assay on the Octet HTX biosensor platform (Pall ForteBio Corp.).
- Suitable CD20 targeting moiety formats are described in Section 6.3.1.
- the CD20 targeting moiety is preferably a CD20 binding fragment of an anti-CD20 antibody, e.g., a Fab, as described in Section 6.3.1 .1 , an Fv fragment, or an scFv, as described in Section 6.3.1 .2.
- the CD20 targeting moiety can be incorporated into a CD20-PD1 binding molecule having any of the configurations described herein.
- the CD20-PD1 binding molecules are typically composed of a plurality of polypeptide chains, for example as represented by the Exemplary Monomers described in Section 6.2.
- the CD20 targeting moiety can be incorporated into any one of Exemplary Monomers 1 , 4, 5, 6 and 8.
- Exemplary CD20-PD1 binding molecules that incorporate one or more of Exemplary Monomers 1 , 4, 5, 6 and 8 are detailed in Section 6.2.
- the CD20 targeting moiety can be any type of antibody or fragment thereof that retains specific binding to CD20.
- the antigen binding moiety is an immunoglobulin molecule, particularly an IgG class immunoglobulin molecule, more particularly an IgG 1 or lgG immunoglobulin molecule.
- Antibody fragments include, but are not limited to, VH (or V H ) fragments, VL (or V ) fragments, Fab fragments, F(ab') 2 fragments, scFv fragments, Fv fragments, minibodies, diabodies, triabodies, and tetrabodies.
- Fab domains were traditionally produced by proteolytic cleavage of immunoglobulin molecules using enzymes such as papain.
- the Fab domains are typically recombinantly expressed as part of the CD20-PD1 binding molecule.
- variable regions sequences and/or constant domain region sequences are derived from a known anti-CD20 antibody.
- known anti-CD20 antibodies include, but are not limited to rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab ituxetan, tositumomab, ublituximab, ocaratuzumab, TRU-015, and veltuzumab.
- the CD20 targeting moiety comprises a Fab that binds to the same CD20 epitope as and/or competes for binding to CD20 with a Fab of rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab ituxetan, tositumomab, ublituximab, ocaratuzumab, TRU-015, or veltuzumab (each a “reference CD20 antibody”).
- the CD20 targeting moiety comprises CDRs having CDR sequences of a reference CD20 antibody.
- the CD20 targeting moiety comprises all 6 CDR sequences of a reference CD20 antibody. In other embodiments, the targeting moiety comprises at least the heavy chain CDR sequences (CDR-H1 , CDR-H2, CDR-H3) of a reference CD20 antibody and the light chain CDR sequences of a universal light chain. In further aspects, a CD20 targeting moiety comprises a VH comprising the amino acid sequence of the VH of a reference CD20 antibody. In some embodiments, the CD20 targeting moiety further comprises a VL comprising the amino acid sequence of the VL of the reference CD20 antibody. In other embodiments, the targeting moiety further comprises a universal light chain VL sequence.
- Fab domains typically comprise a CH1 domain attached to a VH domain which pairs with a CL domain attached to a VL domain.
- VH domain is paired with the VL domain to constitute the Fv region
- CH1 domain is paired with the CL domain to further stabilize the binding module.
- a disulfide bond between the two constant domains can further stabilize the Fab domain.
- the CD20-PD1 binding molecules of the disclosure particularly when the light chain is not a common or universal light chain, it is advantageous to use Fab heterodimerization strategies to permit the correct association of Fab domains belonging to the same ABD and minimize aberrant pairing of Fab domains belonging to different ABDs.
- the Fab heterodimerization strategies shown in Table 1 below can be used:
- correct association between the two polypeptides of a Fab is promoted by exchanging the VL and VH domains of the Fab for each other or exchanging the CH1 and CL domains for each other, e.g., as described in WO 2009/080251 .
- Correct Fab pairing can also be promoted by introducing one or more amino acid modifications in the CH1 domain and one or more amino acid modifications in the CL domain of the Fab and/or one or more amino acid modifications in the VH domain and one or more amino acid modifications in the VL domain.
- the amino acids that are modified are typically part of the VH:VL and CH1 :CL interface such that the Fab components preferentially pair with each other rather than with components of other Fabs.
- the one or more amino acid modifications are limited to the conserved framework residues of the variable (VH, VL) and constant (CH1 , CL) domains as indicated by the Kabat numbering of residues.
- VH, VL variable
- CH1 , CL constant domains
- the modifications introduced in the VH and CH1 and/or VL and CL domains are complementary to each other.
- Complementarity at the heavy and light chain interface can be achieved on the basis of steric and hydrophobic contacts, electrostatic/charge interactions or a combination of the variety of interactions.
- the complementarity between protein surfaces is broadly described in the literature in terms of lock and key fit, knob into hole, protrusion and cavity, donor and acceptor etc., all implying the nature of structural and chemical match between the two interacting surfaces.
- the one or more introduced modifications introduce a new hydrogen bond across the interface of the Fab components. In one embodiment, the one or more introduced modifications introduce a new salt bridge across the interface of the Fab components. Exemplary substitutions are described in WO 2014/150973 and WO 2014/082179, the contents of which are hereby incorporated by reference.
- the Fab domain comprises a 192E substitution in the CH1 domain and 114A and 137K substitutions in the CL domain, which introduces a salt-bridge between the CH1 and CL domains (see, e.g., Golay et al., 2016, J Immunol 196:3199-211).
- the Fab domain comprises a 143Q and 188V substitutions in the CH1 domain and 113T and 176V substitutions in the CL domain, which serves to swap hydrophobic and polar regions of contact between the CH1 and CL domain (see, e.g., Golay et al., 2016, J Immunol 196:3199-211).
- the Fab domain can comprise modifications in some or all of the VH, CH1 , VL, CL domains to introduce orthogonal Fab interfaces which promote correct assembly of Fab domains (Lewis et al., 2014 Nature Biotechnology 32:191-198).
- 39K, 62E modifications are introduced in the VH domain
- H172A, F174G modifications are introduced in the CH1 domain
- 1 R, 38D, (36F) modifications are introduced in the VL domain
- L135Y, S176W modifications are introduced in the CL domain.
- a 39Y modification is introduced in the VH domain and a 38R modification is introduced in the VL domain.
- Fab domains can also be modified to replace the native CH1 :CL disulfide bond with an engineered disulfide bond, thereby increasing the efficiency of Fab component pairing.
- an engineered disulfide bond can be introduced by introducing a 126C in the CH1 domain and a 121 C in the CL domain (see, e.g., Mazor ef al., 2015, MAbs 7:377-89).
- Fab domains can also be modified by replacing the CH1 domain and CL domain with alternative domains that promote correct assembly.
- Wu et al., 2015, MAbs 7:364-76 describes substituting the CH1 domain with the constant domain of the T cell receptor and substituting the CL domain with the b domain of the T cell receptor, and pairing these domain replacements with an additional charge-charge interaction between the VL and VH domains by introducing a 38D modification in the VL domain and a 39K modification in the VH domain.
- the VL of common light chain (also referred to as a universal light chain) can be used for each Fab VL region of a CD20-PD1 binding molecule of the disclosure.
- employing a common light chain as described herein reduces the number of inappropriate species of CD20-PD1 binding molecules as compared to employing original cognate VLs.
- the VL domains of the CD20-PD1 binding molecules are identified from monospecific antibodies comprising a common light chain.
- the VH regions of the CD20-PD1 binding molecules comprise human heavy chain variable gene segments that are rearranged in vivo within mouse B cells that have been previously engineered to express a limited human light chain repertoire, or a single human light chain, cognate with human heavy chains and, in response to exposure with an antigen of interest, generate an antibody repertoire containing a plurality of human VHs that are cognate with one or one of two possible human VLs, wherein the antibody repertoire specific for the antigen of interest.
- Common light chains are those derived from a rearranged human VK1 -39JK5 sequence or a rearranged human VK3-20JK1 sequence, and include somatically mutated (e.g., affinity matured) versions. See, for example, U.S. Patent No. 10,412,940.
- Single chain Fv or “scFv” antibody fragments comprise the VH and VL domains of an antibody in a single polypeptide chain, are capable of being expressed as a single chain polypeptide, and retain the specificity of the intact antibodies from which they are derived.
- the scFv polypeptide further comprises a polypeptide linker between the VH and VL domain that enables the scFv to form the desired structure for target binding. Examples of linkers suitable for connecting the VH and VL chains of an scFv are the linkers identified in Section 6.7.
- an scFv may have the VL and VH variable regions in either order, e.g., with respect to the N-terminal and C-terminal ends of the polypeptide, the scFv may comprise VL-linker-VH or may comprise VH-linker-VL.
- the scFv can comprise VH and VL sequences from any suitable species, such as murine, human or humanized VH and VL sequences.
- the scFv can comprise VH and VL sequences from a known anti-CD20 antibody.
- known anti-CD20 antibodies include, but are not limited to rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab ituxetan, tositumomab, ublituximab, ocaratuzumab, TRU-015, and veltuzumab.
- the CD20 targeting moiety comprises an scFv that binds to the same CD20 epitope as and/or competes for binding to CD20 with an scFv derived from rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab ituxetan, tositumomab, ublituximab, ocaratuzumab, TRU-015, or veltuzumab.
- the VH and VL-encoding DNA fragments are operably linked to another fragment encoding a linker, e.g., encoding any of the linkers described in Section 6.7 (typically a repeat of a sequence containing the amino acids glycine and serine, such as the amino acid sequence (Gly4 ⁇ Ser) 3 (SEQ ID NO: 1), such that the VH and VL sequences can be expressed as a contiguous single-chain protein, with the VL and VH regions joined by the flexible linker (see, e.g., Bird et al., 1988, Science 242:423-426; Huston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; McCafferty et al., 1990, Nature 348:552-554).
- a linker e.g., encoding any of the linkers described in Section 6.7 (typically a repeat of a sequence containing the amino acids glycine
- the PD1 agonist moiety of the CD20-PD1 binding molecules comprises a wild type or variant PD1 -binding domain of programmed death-ligand 1 (PDL1) or programmed death-ligand 2 (PDL2).
- a CD20-PD1 binding molecule of the disclosure comprises a single PD1 agonist moiety (e.g., a PD1 agonist moiety on a first monomer or on a second monomer in embodiments where the CD20-PD1 binding molecule is monovalent for the PD1 agonist moiety).
- a CD20-PD1 binding molecule of the disclosure comprises two PD1 agonist moieties (e.g.
- the two PD1 agonist moieties can be identical, or they can be different.
- the two PD1 agonist moieties can interact with PD1 differentially (e.g., with different affinities).
- the PD1 agonist moiety can be incorporated into a CD20-PD1 binding molecule having any of the configurations described herein.
- the CD20-PD1 binding molecules are typically composed of a plurality of polypeptide chains, for example as represented by the Exemplary Monomers described in Section 6.2.
- the PD1 agonist moiety can be incorporated into any one of Exemplary Monomers 2, 4, 5, 6, 7 and 9.
- Exemplary CD20-PD1 binding molecules that incorporate one or more of Exemplary Monomers 2, 4, 5, 6, 7 and 9 are detailed in Section 6.2.
- the PD1 agonist moiety is a PDL1 -based agonist moiety.
- the PD1 agonist moisty is a PDL2-based agonist moiety.
- PDL1 plays a critical role in induction and maintenance of immune tolerance to self.
- PDL1 modulates the activation threshold of T-cells and limits T-cell effector response.
- the present disclosure provides CD20-PD1 binding molecules in which at least one PD1 agonist moiety comprises an amino acid sequence comprising or homologous to a PDL1 amino acid sequence as described herein.
- Such PD1 agonist moieties are referred to herein as “PDL1 -based PD1 agonist moieties” or like terms.
- the human PDL1 protein is synthesized as a precursor polypeptide of 290 amino acids, from which 18 amino acids are removed to generate mature hPDL1 , with amino acids 19-238 (numbering based on the precursor protein) forming the hPDL1 extracellular domain, or ectodomain.
- the sequence of human PDL1 has the Uniprot identifier Q9NZQ7 (uniprot.org/uniprot/Q9NZQ7).
- the sequence of murine PDL1 has the Uniprot identifier Q9EP73 (uniprot.org/uniprot/Q9EP73).
- the PDL1 -based PD1 agonist moiety is fused, either directly or indirectly, to a CD20 targeting moiety, optionally via a linker (e.g., as described in Section 6.7).
- a linker e.g., as described in Section 6.7.
- the PDL1 -based PD1 agonist moiety can be N-terminal or C-terminal to the CD20 targeting moiety.
- the PDL1-based PD1 agonist moiety is “directly” fused to the CD20 targeting moiety, the PDL1 -based PD1 agonist moiety and the CD20 targeting moiety are positioned adjacently on the same monomer, separated only by a linker, if present.
- the PDL1 -based PD1 agonist moiety is “indirectly” fused to the CD20 targeting moiety, the PDL1 -based PD1 agonist moiety and the CD20 targeting moiety are separated by one or more other domains (e.g., a dimerization moiety) on the same monomer, or are located on separate monomers.
- the PDL1 -based PD1 agonist moiety and the CD20 targeting moiety are separated by one or more other domains (e.g., a dimerization moiety) on the same monomer, or are located on separate monomers.
- the present disclosure provides CD20-PD1 binding molecules in which at least one PD1 agonist moiety comprises an amino acid sequence comprising or homologous to a PDL2 amino acid sequence described herein.
- PD1 agonist moieties are referred to herein as “PDL2-based PD1 agonist moieties” or like terms.
- the human PDL2 protein is synthesized as a precursor polypeptide of 273 amino acids, from which 19 amino acids are removed to generate mature hPDL2, with amino acids 20-220 (numbering based on the precursor protein) forming the hPDL2 extracellular domain, or ectodomain.
- the sequence of human PDL2 has the Uniprot identifier Q9BQ51 (uniprot.org/uniprot/ Q9BQ51).
- the sequence of murine PDL2 has the Uniprot identifier Q9WUL5 (u n i p rot . o rg/u n i p rot/Q 9 WU L5) .
- the murine PDL2 polypeptide is synthesized as a precursor polypeptide of 247 amino acids, from which 19 amino acids are removed to generate mature mPDL2. Amino acids 20-221 (numbering based on the precursor protein) form the mPDL2 extracellular domain, or ectodomain.
- a PD1 agonist moiety is a PDL2-based agonist moiety comprising an amino acid sequence comprising least 70% sequence identity, e.g., at least 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity, or 100% sequence identity, to a PD1-binding portion of a mammalian, e.g., human or murine, PDL2, or the entire ectodomain of a mammalian, e.g., human or murine, PDL1.
- the PD1-binding portion of PDL2 comprises the IgV domain of human or mouse PDL2. In certain embodiments, the PD1-binding portion of PDL2 comprises amino acids 20-121 of human PDL2 or amino acids 20- 121 of murine PDL2.
- a PDL2-based PD1 agonist moiety comprises an amino acid sequence having at least 70% (e.g., at least 80%, at least 90%, at least 95%, at least 97%, at least 98% or at least 99%) sequence identity to the ectodomain of PDL2 or a PD1 -binding portion thereof and one or more amino acid substitutions as compared to wild type PDL2.
- the PDL2-based PD1 agonist moiety is fused, either directly or indirectly, to a CD20 targeting moiety, optionally via a linker (e.g., as described in Section 6.7).
- a linker e.g., as described in Section 6.7.
- the PDL2-based PD1 agonist moiety can be N-terminal or C-terminal to the CD20 targeting moiety.
- the PDL2-based PD1 agonist moiety and the CD20 targeting moiety are positioned adjacently on the same monomer, separated only by a linker, if present.
- the PDL2-based PD1 agonist moiety is “indirectly” fused to the CD20 targeting moiety, the PDL2-based PD1 agonist moiety and the CD20 targeting moiety are separated by one or more other domains (e.g., a dimerization moiety) on the same monomer, or are located on separate monomers.
- the PDL2-based PD1 agonist moiety and the CD20 targeting moiety are separated by one or more other domains (e.g., a dimerization moiety) on the same monomer, or are located on separate monomers.
- the CD20-PD1 binding molecules and CD20-PD1 monomers of the disclosure include one or more dimerization moieties, for example one or more dimerization moieties that are or comprise an Fc domain.
- a CD20-PD1 monomer of the disclosure comprises a single dimerization moiety (e.g., a single Fc domain) and/or a CD20- PD1 binding molecule of the disclosure comprises two dimerization moieties (e.g., two Fc domains that can associate to form an Fc region).
- the CD20-PD1 binding molecules and CD20-PD1 monomers of the disclosure can include an Fc domain, or a pair of Fc domains that associate to form an Fc region, derived from any suitable species and operably linked to a CD20 targeting moiety and/or a PD1 agonist moiety.
- the Fc domain is derived from a human Fc domain.
- Fc domain is derived from a human IgG Fc domain.
- the CD20 targeting moiety and/or the PD1 agonist moiety may be fused to the N-terminus or the C-terminus of the IgG Fc domain.
- One embodiment of the present disclosure is directed to a dimer comprising two Fc-fusion polypeptides created by fusing one or more CD20 targeting moieties and/or PD1 agonist moieties to an Fc domain, e.g., by fusing both a CD20 targeting moiety and a PD1 agonist moiety to an Fc domain that can, upon expression, form a CD20-PD1 monomer capable of homodimerization, or by fusing one or more CD20 targeting moieties and/or one or more PD1 agonist moieties to a first Fc domain and one or more CD20 targeting moieties and/or one or more PD1 agonist moieties to a second Fc domain which upon expression form two different CD20-PD1 monomers that are capable of heterodimerizing.
- the dimer can be made by, for example, by inserting a gene fusion encoding the fusion protein(s) into an appropriate expression vector, expressing the gene fusion(s) in host cells transformed with the recombinant expression vector, and allowing the expressed fusion protein(s) to assemble much like antibody molecules, whereupon interchain bonds form between the Fc moieties to yield the dimer.
- the Fc domains that can be incorporated into CD20-PD1 monomers can be derived from any suitable class of antibody, including IgA (including subclasses lgA1 and lgA2), IgD, IgE, IgG (including subclasses lgG1 , lgG2, lgG3 and lgG4), and IgM.
- the Fc domain is derived from IgG 1 , lgG2, lgG3 or lgG4.
- the Fc domain is derived from IgG 1 .
- the Fc domain is derived from lgG4.
- the two Fc domains within the Fc region can be the same or different from one another.
- the Fc domains are typically identical, but for the purpose of producing multispecific binding molecules, e.g., the CD20-PD1 binding molecules of the disclosure, the Fc domains might advantageously be different to allow for heterodimerization, as described in Section 6.5.1 below.
- the heavy chain Fc domain of IgA, IgD and IgG is composed of two heavy chain constant domains (CH2 and CH3) and that of IgE and IgM is composed of three heavy chain constant domains (CH2, CH3 and CH4). These dimerize to create an Fc region.
- the Fc region, and/or the Fc domains within it can comprise heavy chain constant domains from one or more different classes of antibody, for example one, two or three different classes.
- the Fc region comprises CH2 and CH3 domains derived from IgG 1 .
- the Fc region comprises CH2 and CH3 domains derived from lgG2.
- the Fc region comprises CH2 and CH3 domains derived from lgG3.
- the Fc region comprises CH2 and CH3 domains derived from lgG4. [0147] In one embodiment the Fc region comprises a CH4 domain from IgM. The IgM CH4 domain is typically located at the C-terminus of the CH3 domain.
- the Fc region comprises CH2 and CH3 domains derived from IgG and a CH4 domain derived from IgM.
- the heavy chain constant domains for use in producing an Fc region for the CD20-PD1 binding molecules of the present disclosure may include variants of the naturally occurring constant domains described above. Such variants may comprise one or more amino acid variations compared to wild type constant domains.
- the Fc region of the present disclosure comprises at least one constant domain that varies in sequence from the wild type constant domain. It will be appreciated that the variant constant domains may be longer or shorter than the wild type constant domain.
- the variant constant domains are at least 60% identical or similar to a wild type constant domain.
- the variant constant domains are at least 70% identical or similar.
- the variant constant domains are at least 80% identical or similar.
- the variant constant domains are at least 90% identical or similar.
- the variant constant domains are at least 95% identical or similar.
- IgM and IgA occur naturally in humans as covalent multimers of the common H2L2 antibody unit.
- IgM occurs as a pentamer when it has incorporated a J-chain, or as a hexamer when it lacks a J-chain.
- IgA occurs as monomer and dimer forms.
- the heavy chains of IgM and IgA possess an 18 amino acid extension to the C-terminal constant domain, known as a tailpiece.
- the tailpiece includes a cysteine residue that forms a disulfide bond between heavy chains in the polymer, and is believed to have an important role in polymerization.
- the tailpiece also contains a glycosylation site.
- the CD20-PD1 binding molecules of the present disclosure do not comprise a tailpiece.
- the Fc domains that are incorporated into the CD20-PD1 binding molecules of the present disclosure may comprise one or more modifications that alter the functional properties of the proteins, for example, binding to Fc-receptors such as FcRn or leukocyte receptors, binding to complement, modified disulfide bond architecture, or altered glycosylation patterns. Exemplary Fc modifications that alter effector function are described in Section 6.5.1 .1 .
- the Fc domains can also be altered to include modifications that improve manufacturability of asymmetric CD20-PD1 binding molecules, for example by allowing heterodimerization, which is the preferential pairing of non-identical Fc domains over identical Fc domains. Heterodimerization permits the production of CD20-PD1 binding molecules in which different polypeptide components are connected to one another by an Fc region containing Fc domains that differ in sequence. Examples of heterodimerization strategies are exemplified in Section 6.5.1.2. [0153] It will be appreciated that any of the modifications mentioned above can be combined in any suitable manner to achieve the desired functional properties and/or combined with other modifications to alter the properties of the CD20-PD1 binding molecules.
- the Fc domain comprises one or more amino acid substitutions that reduces binding to an Fc receptor and/or effector function.
- the Fc receptor is an Fey receptor. In one embodiment the Fc receptor is a human Fc receptor. In one embodiment the Fc receptor is an activating Fc receptor. In a specific embodiment the Fc receptor is an activating human Fey receptor, more specifically human FcyRllla, FcyRI or FcyRlla, most specifically human FcyRllla.
- the effector function is one or more selected from the group of complement dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and cytokine secretion. In a particular embodiment, the effector function is ADCC.
- the Fc domain (e.g., an Fc domain of a CD20-PD1 monomer) or the Fc region (e.g., one or both Fc domains of a CD20-PD1 binding molecule that can associate to form an Fc region) comprises an amino acid substitution at a position selected from the group of E233, L234, L235, G237, N297, A330, P331 , and P329 (numberings according to Kabat EU index).
- the Fc domain or the Fc region comprises an amino acid substitution at a position selected from the group of L234, L235 and P329 (numberings according to Kabat EU index).
- the Fc domain or the Fc region comprises the amino acid substitutions L234A and L235A (numberings according to Kabat EU index).
- the Fc domain or region is an Igd Fc domain or region, particularly a human Igd Fc domain or region.
- the Fc domain or the Fc region comprises an amino acid substitution at position P329.
- the amino acid substitution is P329A or P329G, particularly P329G (numberings according to Kabat EU index).
- the Fc domain or the Fc region comprises an amino acid substitution at position P329 and a further amino acid substitution at a position selected from E233, L234, L235, N297 and P331 (numberings according to Kabat EU index).
- the further amino acid substitution is E233P, L234A, L235A, L235E, N297A, N297D or P331S.
- the Fc domain or the Fc region comprises amino acid substitutions at positions P329, L234 and L235 (numberings according to Kabat EU index).
- the Fc domain comprises the amino acid mutations L234A, L235A and P329G (“P329G LALA”, “PGLALA” or “LALAPG”). [0157] In some embodiments, the Fc domain or the Fc region comprises the amino acid substitutions at positions L234, L235, G237, A330, and P331 (numberings according to Kabat EU index). In a more specific embodiment, the amino acid substitutions are L234A, L235E, G237A, A330S, and P331S (numberings according to Kabat EU index).
- each Fc domain of the Fc region comprises the amino acid substitutions L234A, L235A and P329G (Kabat EU index numbering), i.e. in each of the first and the second Fc domains in the Fc region the leucine residue at position 234 is replaced with an alanine residue (L234A), the leucine residue at position 235 is replaced with an alanine residue (L235A) and the proline residue at position 329 is replaced by a glycine residue (P329G) (numbering according to Kabat EU index).
- each Fc domain of the Fc region comprises the amino acid substitutions L234A, L235E, G237A, A330S, and P331S (numberings according to Kabat EU index), i.e. in each of the first and the second Fc domains in the Fc region the leucine residue at position 234 is replaced with an alanine residue (L234A), the leucine residue at position 235 is replaced with an alanine residue (L235A), the glycine residue at position 237 is replace with an alanine residue (G237A), the alanine residue at position 330 is replaced with a serine residue (A330S), and the proline residue at position 331 is replaced with a serine residue (P331S) (numberings according to Kabat EU index).
- the Fc domain is an IgG 1 Fc domain, for example a human IgG 1 Fc domain.
- the IgG 1 Fc domain is a variant IgG 1 comprising D265A and N297A mutations (EU numbering) to reduce effector function.
- the IgG 1 Fc domain is a variant lgG1 comprising L234A, L235E, G237A, A330S, and P331S mutations (numberings according to Kabat EU index), providing for an effector null IgG 1 (IgG 1 EN). Amino acid substitutions L234A, L235E, and G237A reduce binding to FcyRI, FcyRlla, and FcyRIII, while substitutions A330S and P331S reduce C1q-mediated complement fixation.
- the Fc domain is an lgG4 Fc domain with reduced binding to Fc receptors.
- Exemplary lgG4 Fc domains with reduced binding to Fc receptors may comprise an amino acid sequence selected from Table 2 below:
- the Fc domain includes only the bolded portion of the sequences shown below:
- the lgG4 with reduced effector function comprises the bolded portion of the amino acid sequence of SEQ ID NO:31 of W02014/121087, sometimes referred to herein as lgG4s or hlgG4s.
- an Fc region comprising an Fc domain comprising the amino acid sequence of SEQ ID NO:30 of WQ2014/121087 (or the bolded portion thereof) and an Fc domain comprising the amino acid sequence of SEQ ID NO:37 of WQ2014/121087 (or the bolded portion thereof) or an Fc region comprising an Fc domain comprising the amino acid sequence of SEQ ID NO:31 of WQ2014/121087 (or the bolded portion thereof) and an Fc domain comprising the amino acid sequence of SEQ ID NO:38 of WQ2014/121087 (or the bolded portion thereof).
- Certain CD20-PD1 binding molecules entail dimerization between two Fc domains that, unlike a native immunoglobulin, are operably linked to non-identical N-terminal regions, e.g., one Fc domain connected to a Fab and the other Fc domain connected to a PD1 agonist moiety.
- Inadequate heterodimerization of two Fc domains to form an Fc region has can be an obstacle for increasing the yield of desired heterodimeric molecules and represents challenges for purification.
- a variety of approaches available in the art can be used in for enhancing dimerization of Fc domains that might be present in the CD20-PD1 binding molecules of the disclosure, for example as disclosed in EP 1870459A1 ; U.S. Patent No.
- each Fc domain in the Fc heterodimer comprises a CH3 domain of an antibody.
- the CH3 domains are derived from the constant region of an antibody of any isotype, class or subclass, and preferably of IgG (lgG1 , lgG2, lgG3 and lgG4) class, as described in the preceding section.
- the polypeptides that associate to form a CD20-PD1 binding molecule of the disclosure will contain CH3 domains with modifications that favor heterodimeric association relative to unmodified Fc domains.
- said modification promoting the formation of Fc heterodimers is a so-called “knob-into-hole” or “knob-in-hole” modification, comprising a “knob” modification in one of the Fc domains and a “hole” modification in the other Fc domain.
- the knob-into-hole technology is described e.g., in U.S. Patent No. 5,731 ,168; US 7,695,936; Ridgway et al., 1996, Prot Eng 9:617- 621 , and Carter, 2001 , Immunol Meth 248:7-15.
- the method involves introducing a protuberance (“knob”) at the interface of a first polypeptide and a corresponding cavity (“hole”) in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation.
- Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g., tyrosine or tryptophan).
- Compensatory cavities of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g., alanine or threonine).
- an amino acid residue in the CH3 domain of the first subunit of the Fc domain is replaced with an amino acid residue having a larger side chain volume, thereby generating a protuberance within the CH3 domain of the first subunit which is positionable in a cavity within the CH3 domain of the second subunit, and an amino acid residue in the CH3 domain of the second subunit of the Fc domain is replaced with an amino acid residue having a smaller side chain volume, thereby generating a cavity within the CH3 domain of the second subunit within which the protuberance within the CH3 domain of the first subunit is positionable.
- said amino acid residue having a larger side chain volume is selected from the group consisting of arginine (R), phenylalanine (F), tyrosine (Y), and tryptophan (W).
- said amino acid residue having a smaller side chain volume is selected from the group consisting of alanine (A), serine (S), threonine (T), and valine (V).
- the protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g., by site-specific mutagenesis, or by peptide synthesis.
- An exemplary substitution is Y470T.
- the threonine residue at position 366 is replaced with a tryptophan residue (T366W), and in the Fc domain the tyrosine residue at position 407 is replaced with a valine residue (Y407V) and optionally the threonine residue at position 366 is replaced with a serine residue (T366S) and the leucine residue at position 368 is replaced with an alanine residue (L368A) (numbering according to Kabat EU index).
- the serine residue at position 354 is replaced with a cysteine residue (S354C) or the glutamic acid residue at position 356 is replaced with a cysteine residue (E356C) (particularly the serine residue at position 354 is replaced with a cysteine residue), and in the second Fc domain additionally the tyrosine residue at position 349 is replaced by a cysteine residue (Y349C) (numbering according to Kabat EU index).
- the first Fc domain comprises the amino acid substitutions S354C and T366W
- the second Fc domain comprises the amino acid substitutions Y349C, T366S, L368A and Y407V (numbering according to Kabat EU index).
- electrostatic steering e.g., as described in Gunasekaran et al., 2010, J Biol Chem 285(25): 19637-466 can be used to promote the association of the first and the second Fc domains of the Fc region.
- an Fc domain can be modified to allow a purification strategy that enables selections of Fc heterodimers.
- one polypeptide comprises a modified Fc domain that abrogates its binding to Protein A, thus enabling a purification method that yields a heterodimeric protein. See, for example, U.S. Patent No. 8,586,713.
- the CD20-PD1 binding molecules comprise a first CH3 domain and a second Ig CH3 domain, wherein the first and second Ig CH3 domains differ from one another by at least one amino acid, and wherein at least one amino acid difference reduces binding of the CD20-PD1 binding molecule to Protein A as compared to a corresponding CD20-PD1 binding molecule lacking the amino acid difference.
- the first CH3 domain binds Protein A and the second CH3 domain contains a mutation/modification that reduces or abolishes Protein A binding such as an H95R modification (by IMGT exon numbering; H435R by EU numbering).
- the second CH3 may further comprise a Y96F modification (by IMGT; Y436F by EU). This class of modifications is referred to herein as “star” mutations.
- the Fc can contain one or more mutations (e.g., knob and hole mutations) to facilitate heterodimerization as well as star mutations to facilitate purification.
- mutations e.g., knob and hole mutations
- the CD20-PD1 binding molecules of the disclosure can comprise a stabilization moiety that can extend the molecule’s serum half-life in vivo. Serum half-life is often divided into an alpha phase and a beta phase. Either or both phases may be improved significantly by addition of an appropriate stabilization moiety.
- the stabilization moiety can increase the serum halflife of the CD20-PD1 binding molecule by more than 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 120, 150, 200, 400, 600, 800, 1000% or more relative to a corresponding CD20-PD1 binding molecule not containing the stabilization moiety.
- serum half-life can refer to the half-life in humans or other mammals (e.g., mice or non-human primates).
- Stabilization moieties include polyoxyalkylene moieties (e.g., polyethylene glycol), sugars (e.g., sialic acid), and well-tolerated protein moieties (e.g., Fc and fragments and variants thereof, transferrin, or serum albumin).
- polyoxyalkylene moieties e.g., polyethylene glycol
- sugars e.g., sialic acid
- well-tolerated protein moieties e.g., Fc and fragments and variants thereof, transferrin, or serum albumin.
- stabilization moieties that can be used in the CD20-PD1 binding molecules of the disclosure include those described in Kontermann et al., 2011 , Current Opinion in Biotechnology 22:868-76.
- Such Stabilization moieties include, but are not limited to, human serum albumin fusions, human serum albumin conjugates, human serum albumin binders (e.g., Adnectin PKE, AlbudAb, ABD), XTEN fusions, PAS fusions (/.e., recombinant PEG mimetics based on the three amino acids proline, alanine, and serine), carbohydrate conjugates (e.g., hydroxyethyl starch (HES)), glycosylation, polysialic acid conjugates, and fatty acid conjugates.
- human serum albumin fusions e.g., human serum albumin conjugates, human serum albumin binders (e.g., Adnectin PKE, AlbudAb, ABD), XTEN fusions
- the disclosure provides a CD20-PD1 binding molecule comprising a stabilization moiety that is a polymeric sugar.
- Serum albumin can also be engaged in half-life extension through modules with the capacity to non-covalently interact with albumin.
- the CD20-PD1 binding molecules of the disclosure can include as a stabilization moiety an albumin-binding protein.
- the albuminbinding protein can be either conjugated or genetically fused to one or more other components of the CD20-PD1 binding molecules of the disclosure. Proteins with albumin-binding activity are known from certain bacteria. For example, streptococcal protein G contains several small albuminbinding domains composed of roughly 50 amino acid residues (6 kDa). Additional examples of serum albumin binding proteins such as those described in U.S. Publication Nos. 2007/0178082 and 2007/0269422. Fusion of an albumin binding domain to a protein results in a strongly extended half-life (see Kontermann et al., 2011 , Current Opinion in Biotechnology 22:868-76).
- the stabilization moiety is human serum albumin. In other embodiments, the stabilization moiety is transferrin.
- the stabilization moiety is an Fc domain, for example any of the Fc domains described in Section 6.5.1 and subsections thereof, incorporated by reference herein.
- the Fc domains described in Section 6.5.1 are generally capable of dimerization. However, for the purpose of stabilization the Fc domain can be a soluble monomeric Fc domain that has a reduced ability to self-associate. See, e.g., Helm et al., 1996, J. Biol. Chem. 271 : 7494-7500 and Ying et al., 2012, J Biol Chem. 287(23):19399-19408.
- An example of a soluble monomeric Fc domain comprises amino acid substitutions in the positions corresponding to T366 and/or Y407 in CH3, as described in U.S. Patent Publication No. 2019/0367611.
- the monomeric Fc domains can be of any Ig subtype and can include additional substitutions that reduce effector function, as described in Section 6.5.1 and subsections thereof.
- the stabilization moiety is a polyethylene glycol moiety or another polymer, as described in Section 6.6.1 below.
- the stabilization moiety can be connected to one or more other components of the CD20- PD1 binding molecules of the disclosure via a linker, for example as described in Section 6.7 below.
- the CD20-PD1 binding molecule comprises polyethylene glycol (PEG) or another hydrophilic polymer as a stabilization moiety, for example a copolymer of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1 , 3-dioxolane, poly-1 , 3, 6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, a propropylene glycol homopolymer, a prolypropylene oxide/ethylene oxide co-polymer, a polyoxyethylated polyol (e.g., glycerol), polyvinyl alcohol, and mixtures thereof.
- the polymer may be of any molecular weight, and may be branched or un
- PEG is a well-known, water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161).
- the term “PEG” is used broadly to encompass any polyethylene glycol molecule, without regard to size or to modification at an end of the PEG, and can be represented by the formula: X-- O(CH2CH2O) n -1CH2CH 2 OH, where n is 20 to 2300 and X is H or a terminal modification, e.g., a Ci- 4 alkyl.
- PEG can contain further chemical groups which are necessary for binding reactions, which result from the chemical synthesis of the molecule; or which act as a spacer for optimal distance of parts of the molecule.
- a PEG can consist of one or more PEG side-chains which are linked together.
- PEGs with more than one PEG chain are called multiarmed or branched PEGs. Branched PEGs are described in, for example, European Application No. 473084A and U.S. Patent No. 5,932,462.
- One or more PEG molecules can be attached at different positions on the CD20-PD1 binding molecule, and such attachment may be achieved by reaction with amines, thiols or other suitable reactive groups.
- the amine moiety may be, for example, a primary amine found at the N- terminus of the CD20-PD1 binding molecule (or a component thereof) or an amine group present in an amino acid, such as lysine or arginine.
- PEGylation can be achieved by site-directed PEGylation, wherein a suitable reactive group is introduced into the protein to create a site where PEGylation preferentially occurs.
- the CD20-PD1 binding molecule is modified to introduce a cysteine residue at a desired position, permitting site-directed PEGylation on the cysteine.
- Mutations can be introduced into the coding sequence of a CD20-PD1 binding molecule of the disclosure to generate cysteine residues. This might be achieved, for example, by mutating one or more amino acid residues to cysteine.
- Preferred amino acids for mutating to a cysteine residue include serine, threonine, alanine and other hydrophilic residues.
- the residue to be mutated to cysteine is a surface-exposed residue.
- Algorithms are well-known in the art for predicting surface accessibility of residues based on primary sequence or three dimensional structure.
- PEGylation of cysteine residues may be carried out using, for example, PEG-maleimide, PEG-vinylsulfone, PEG- iodoacetamide, or PEG-orthopyridyl disulfide.
- the PEG is typically activated with a suitable activating group appropriate for coupling to a desired site on the polypeptide.
- PEGylation methods are well-known in the art and further described in Zalipsky et al., “Use of Functionalized Poly(Ethylene Glycols) for Modification of Polypeptides” in Polyethylene Glycol Chemistry: Biotechnical and Biomedical Applications, J. M. Harris, Plenus Press, New York (1992), and in Zalipsky, 1995, Advanced Drug Reviews 16: 157- 182.
- PEG moieties may vary widely in molecular weight and may be branched or linear. Typically, the weight-average molecular weight of PEG is from about 100 Daltons to about 150,000 Daltons. Exemplary weight-average molecular weights for PEG include about 20,000 Daltons, about 40,000 Daltons, about 60,000 Daltons and about 80,000 Daltons. In certain embodiments, the molecular weight of PEG is 40,000 Daltons. Branched versions of PEG having a total molecular weight of any of the foregoing can also be used. In some embodiments, the PEG has two branches. In other embodiments, the PEG has four branches. In another embodiment, the PEG is a bis-PEG (NOF Corporation, DE-200MA).
- the PEGylated CD20-PD1 binding molecule will preferably retain at least about 25%, 50%, 60%, 70%, 80%, 85%, 90%, 95% or 100% of the biological activity associated with the unmodified CD20-PD1 binding molecule.
- biological activity refers to its ability to bind to CD20, PD1 , or both CD20 and PD1 , as assessed by K D , kon, or k O ff.
- the present disclosure provides CD20-PD1 binding molecules in which two or more components of a CD20-PD1 binding molecules are connected to one another by a peptide linker.
- linkers can be used to connect (a) a CD20 targeting moiety and a dimerization moiety; (b) a CD20 targeting moiety and a PD1 agonist moiety; (c) a PD1 agonist moiety and a dimerization moiety; or (d) different domains within a CD20 targeting moiety (e.g., the VH and VL domains in an scFv).
- a peptide linker can range from 2 amino acids to 60 or more amino acids, and in certain aspects a peptide linker ranges from 3 amino acids to 50 amino acids, from 4 to 30 amino acids, from 5 to 25 amino acids, from 10 to 25 amino acids, 10 amino acids to 60 amino acids, from 12 amino acids to 20 amino acids, from 20 amino acids to 50 amino acids, or from 25 amino acids to 35 amino acids in length.
- a peptide linker is at least 5 amino acids, at least 6 amino acids or at least 7 amino acids in length and optionally is up to 30 amino acids, up to 40 amino acids, up to 50 amino acids or up to 60 amino acids in length.
- the linker ranges from 5 amino acids to 50 amino acids in length, e.g., ranges from 5 to 50, from 5 to 45, from 5 to 40, from 5 to 35, from 5 to 30, from 5 to 25, or from 5 to 20 amino acids in length.
- the linker ranges from 6 amino acids to 50 amino acids in length, e.g., ranges from 6 to 50, from 6 to 45, from 6 to 40, from 6 to 35, from 6 to 30, from 6 to 25, or from 6 to 20 amino acids in length.
- the linker ranges from 7 amino acids to 50 amino acids in length, e.g., ranges from 7 to 50, from 7 to 45, from 7 to 40, from 7 to 35, from 7 to 30, from 7 to 25, or from 7 to 20 amino acids in length.
- Charged (e.g., charged hydrophilic linkers) and/or flexible linkers are particularly preferred.
- Examples of flexible linkers that can be used in the CD20-PD1 binding molecules of the disclosure include those disclosed by Chen et al., 2013, Adv Drug Deliv Rev. 65(10): 1357-1369 and Klein et al., 2014, Protein Engineering, Design & Selection 27(10): 325-330.
- Particularly useful flexible linkers are or comprise repeats of glycines and serines, e.g., a monomer or multimer of G n S (SEQ ID NO: 12) or SG n (SEQ ID NO: 13), where n is an integer from 1 to 10, e.g., 1 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- the linker is or comprises a monomer or multimer of repeat of G 4 S e.g., (GGGGS)n (SEQ ID NO: 14).
- a peptide linker comprises two consecutive glycines (2Gly), three consecutive glycines (3Gly), four consecutive glycines (4Gly) (SEQ ID NO: 15), five consecutive glycines (5Gly) (SEQ ID NO: 16), six consecutive glycines (6Gly) (SEQ ID NO: 17), seven consecutive glycines (7Gly) (SEQ ID NO: 18), eight consecutive glycines (8Gly) (SEQ ID NO: 19) or nine consecutive glycines (9Gly) (SEQ ID NO: 20).
- the CD20-PD1 binding molecules of the disclosure comprise a linker that is a hinge region.
- the hinge can be used to connect the CD20 targeting moiety, e.g., a Fab domain, to a dimerization domain, e.g., an Fc domain.
- the hinge region can be a native or a modified hinge region. Hinge regions are typically found at the N-termini of Fc regions.
- hinge region refers to a naturally or non-naturally occurring hinge sequence that in the context of a single or monomeric polypeptide chain is a monomeric hinge domain and in the context of a dimeric polypeptide (e.g., a homodimeric or heterodimeric CD20-PD1 binding molecule formed by the association of two Fc domains) can comprise two associated hinge sequences on separate polypeptide chains.
- a native hinge region is the hinge region that would normally be found between Fab and Fc domains in a naturally occurring antibody.
- a modified hinge region is any hinge that differs in length and/or composition from the native hinge region. Such hinges can include hinge regions from other species, such as human, mouse, rat, rabbit, shark, pig, hamster, camel, llama or goat hinge regions. Other modified hinge regions may comprise a complete hinge region derived from an antibody of a different class or subclass from that of the heavy chain Fc domain or Fc region. Alternatively, the modified hinge region may comprise part of a natural hinge or a repeating unit in which each unit in the repeat is derived from a natural hinge region.
- the natural hinge region may be altered by converting one or more cysteine or other residues into neutral residues, such as serine or alanine, or by converting suitably placed residues into cysteine residues. By such means the number of cysteine residues in the hinge region may be increased or decreased.
- Other modified hinge regions may be entirely synthetic and may be designed to possess desired properties such as length, cysteine composition and flexibility.
- a CD20-PD1 binding molecule of the disclosure comprises an Fc region in which one or both Fc domains possesses an intact hinge region at its N-terminus.
- positions 233-236 within a hinge region may be G, G, G and unoccupied; G, G, unoccupied, and unoccupied; G, unoccupied, unoccupied, and unoccupied; or all unoccupied, with positions numbered by EU numbering.
- the CD20-PD1 binding molecules of the disclosure comprise a modified hinge region that reduces binding affinity for an Fey receptor relative to a wild-type hinge region of the same isotype (e.g., human lgG1 or human lgG4).
- the CD20-PD1 binding molecules of the disclosure comprise an Fc region in which each Fc domain possesses an intact hinge region at its N-terminus, where each Fc domain and hinge region is derived from lgG4 and each hinge region comprise the modified sequence CPPC (SEQ ID NO: 21).
- the core hinge region of human lgG4 contains the sequence CPSC (SEQ ID NO: 22) compared to IgG 1 that contains the sequence CPPC (SEQ ID NO: 29).
- the serine residue present in the lgG4 sequence leads to increased flexibility in this region, and therefore a proportion of molecules form disulfide bonds within the same protein chain (an intrachain disulfide) rather than bridging to the other heavy chain in the IgG molecule to form the interchain disulfide.
- an intrachain disulfide an intrachain disulfide
- Changing the serine residue to a proline to give the same core sequence as IgG 1 allows complete formation of inter-chain disulfides in the lgG4 hinge region, thus reducing heterogeneity in the purified product. This altered isotype is termed lgG4P.
- the hinge region can be a chimeric hinge region.
- a chimeric hinge may comprise an “upper hinge” sequence, derived from a human IgG 1 , a human lgG2 or a human lgG4 hinge region, combined with a “lower hinge” sequence, derived from a human lgG1 , a human lgG2 or a human lgG4 hinge region.
- a chimeric hinge region comprises the amino acid sequence EPKSCDKTHTCPPCPAPPVA (SEQ ID NO: 23) (previously disclosed as SEQ ID NO:8 of W02014/121087, which is incorporated by reference in its entirety herein) or ESKYGPPCPPCPAPPVA (SEQ ID NO: 24) (previously disclosed as SEQ ID NO:9 of W02014/121087).
- EPKSCDKTHTCPPCPAPPVA amino acid sequence
- ESKYGPPCPPCPAPPVA SEQ ID NO: 24
- Such chimeric hinge sequences can be suitably linked to an lgG4 CH2 region (for example by incorporation into an lgG4 Fc domain, for example a human or murine Fc domain, which can be further modified in the CH2 and/or CH3 domain to reduce effector function, for example as described in Section 6.5.1 .1).
- the hinge region can be modified to reduce effector function, for example as described in WQ2016161010A2, which is incorporated by reference in its entirety herein.
- the positions 233-236 of the modified hinge region are G, G, G and unoccupied; G, G, unoccupied, and unoccupied; G, unoccupied, unoccupied, and unoccupied; or all unoccupied, with positions numbered by EU numbering (as shown in FIG. 1 of WQ2016161010A2). These segments can be represented as GGG-, GG--, representing an unoccupied position.
- Position 236 is unoccupied in canonical human lgG2 but is occupied by in other canonical human IgG isotypes. Positions 233-235 are occupied by residues other than G in all four human isotypes (as shown in FIG. 1 of WQ2016161010A2).
- positions 233-236 can be combined with position 228 being occupied by P.
- Position 228 is naturally occupied by P in human IgG 1 and lgG2 but is occupied by S in human lgG4 and R in human lgG3.
- An S228P mutation in an lgG4 antibody is advantageous in stabilizing an lgG4 antibody and reducing exchange of heavy chain light chain pairs between exogenous and endogenous antibodies.
- positions 226-229 are occupied by C, P, P and C respectively (“CPPC” disclosed as SEQ ID NO: 21).
- Exemplary hinge regions have residues 226-236, sometimes referred to as middle (or core) and lower hinge, occupied by the modified hinge sequences designated GGG-(233-236), GG-- (233-236), G— (233-236) and no G(233-236).
- the hinge domain amino acid sequence comprises CPPCPAPGGG-GPSVF (SEQ ID NO: 25) (previously disclosed as SEQ ID NO:1 of W02016161010A2), CPPCPAPGG-GPSVF (SEQ ID NO: 26) (previously disclosed as SEQ ID NO:2 of W02016161010A2), CPPCPAPG— GPSVF (SEQ ID NO: 27) (previously disclosed as SEQ ID NO:3 of W02016161010A2), or CPPCPAP— -GPSVF (SEQ ID NO: 28) (previously disclosed as SEQ ID NO:4 of W02016161010A2).
- the modified hinge regions described above can be incorporated into a heavy chain constant region, which typically include CH2 and CH3 domains, and which may have an additional hinge segment (e.g., an upper hinge) flanking the designated region.
- additional constant region segments present are typically of the same isotype, preferably a human isotype, although can be hybrids of different isotypes.
- the isotype of such additional human constant regions segments is preferably human lgG4 but can also be human IgG 1 , lgG2, or lgG3 or hybrids thereof in which domains are of different isotypes. Exemplary sequences of human IgG 1 , lgG2 and lgG4 are shown in FIGS. 2-4 of W02016161010A2.
- the modified hinge sequences can be linked to an lgG4 CH2 region (for example by incorporation into an lgG4 Fc domain, for example a human or murine Fc domain, which can be further modified in the CH2 and/or CH3 domain to reduce effector function, for example as described in Section 6.5.1.1).
- the disclosure provides nucleic acids encoding the CD20-PD1 binding molecules of the disclosure.
- the CD20-PD1 binding molecules are encoded by a single nucleic acid.
- the CD20-PD1 binding molecules can be encoded by a plurality (e.g., two, three, four or more) nucleic acids.
- a single nucleic acid can encode a CD20-PD1 binding molecule that comprises a single polypeptide chain, a CD20-PD1 binding molecule that comprises two or more polypeptide chains, or a portion of a CD20-PD1 binding molecule that comprises more than two polypeptide chains (for example, a single nucleic acid can encode two polypeptide chains of a CD20-PD1 binding molecule comprising three, four or more polypeptide chains, or three polypeptide chains of a CD20-PD1 binding molecule comprising four or more polypeptide chains).
- the open reading frames encoding two or more polypeptide chains can be under the control of separate transcriptional regulatory elements (e.g., promoters and/or enhancers).
- the open reading frames encoding two or more polypeptides can also be controlled by the same transcriptional regulatory elements, and separated by internal ribosome entry site (IRES) sequences allowing for translation into separate polypeptides.
- IRS internal ribosome entry site
- a CD20-PD1 binding molecule comprising two or more polypeptide chains is encoded by two or more nucleic acids.
- the number of nucleic acids encoding a CD20- PD1 binding molecule can be equal to or less than the number of polypeptide chains in the CD20- PD1 binding molecule (for example, when more than one polypeptide chains are encoded by a single nucleic acid).
- the nucleic acids of the disclosure can be DNA or RNA (e.g., mRNA).
- the disclosure provides host cells and vectors containing the nucleic acids of the disclosure.
- the nucleic acids may be present in a single vector or separate vectors present in the same host cell or separate host cell, as described in more detail herein below.
- the disclosure provides vectors comprising nucleotide sequences encoding a CD20-PD1 binding molecule or a CD20-PD1 binding molecule component described herein, for example one or two of the polypeptide chains of a CD20-PD1 monomer.
- the vectors include, but are not limited to, a virus, plasmid, cosmid, lambda phage or a yeast artificial chromosome (YAC).
- vectors utilize DNA elements which are derived from animal viruses such as, for example, bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (Rous Sarcoma Virus, MMTV or MOMLV) or SV40 virus.
- DNA elements which are derived from animal viruses such as, for example, bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (Rous Sarcoma Virus, MMTV or MOMLV) or SV40 virus.
- RNA elements derived from RNA viruses such as Semliki Forest virus, Eastern Equine Encephalitis virus and Flaviviruses.
- cells which have stably integrated the DNA into their chromosomes can be selected by introducing one or more markers which allow for the selection of transfected host cells.
- the marker may provide, for example, prototropy to an auxotrophic host, biocide resistance (e.g., antibiotics), or resistance to heavy metals such as copper, or the like.
- the selectable marker gene can be either directly linked to the DNA sequences to be expressed, or introduced into the same cell by co-transformation. Additional elements may also be needed for optimal synthesis of mRNA. These elements may include splice signals, as well as transcriptional promoters, enhancers, and termination signals.
- the expression vectors can be transfected or introduced into an appropriate host cell.
- Various techniques may be employed to achieve this, such as, for example, protoplast fusion, calcium phosphate precipitation, electroporation, retroviral transduction, viral transfection, gene gun, lipid based transfection or other conventional techniques. Methods and conditions for culturing the resulting transfected cells and for recovering the expressed polypeptides are known to those skilled in the art, and may be varied or optimized depending upon the specific expression vector and mammalian host cell employed, based upon the present description.
- the disclosure also provides host cells comprising a nucleic acid of the disclosure.
- the host cells are genetically engineered to comprise one or more nucleic acids described herein.
- the host cells are genetically engineered by using an expression cassette.
- expression cassette refers to nucleotide sequences, which are capable of affecting expression of a gene in hosts compatible with such sequences.
- cassettes may include a promoter, an open reading frame with or without introns, and a termination signal. Additional factors necessary or helpful in effecting expression may also be used, such as, for example, an inducible promoter.
- the disclosure also provides host cells comprising the vectors described herein.
- the cell can be, but is not limited to, a eukaryotic cell, a bacterial cell, an insect cell, or a human cell.
- Suitable eukaryotic cells include, but are not limited to, Vero cells, HeLa cells, COS cells, CHO cells, HEK293 cells, BHK cells and MDCKII cells.
- Suitable insect cells include, but are not limited to, Sf9 cells.
- compositions Comprising CD20-PD1 Binding Molecules
- the CD20-PD1 binding molecules of the disclosure may be in the form of compositions comprising the CD20-PD1 binding molecule and one or more carriers, excipients and/or diluents.
- the compositions may be formulated for specific uses, such as for veterinary uses or pharmaceutical uses in humans.
- the form of the composition e.g., dry powder, liquid formulation, etc.
- the excipients, diluents and/or carriers used will depend upon the intended use of the CD20-PD1 binding molecule and, for therapeutic uses, the mode of administration.
- the compositions may be supplied as part of a sterile, pharmaceutical composition that includes a pharmaceutically acceptable carrier.
- This composition can be in any suitable form (depending upon the desired method of administering it to a patient).
- the pharmaceutical composition can be administered to a patient by a variety of routes such as orally, transdermally, subcutaneously, intranasally, intravenously, intramuscularly, intratumorally, intrathecally, topically or locally.
- routes for administration in any given case will depend on the particular antibody, the subject, and the nature and severity of the disease and the physical condition of the subject.
- the pharmaceutical composition will be administered intravenously or subcutaneously.
- compositions can be conveniently presented in unit dosage forms containing a predetermined amount of a CD20-PD1 binding molecule of the disclosure per dose.
- the quantity of CD20-PD1 binding molecule included in a unit dose will depend on the disease being treated, as well as other factors as are well known in the art.
- Such unit dosages may be in the form of a lyophilized dry powder containing an amount of CD20-PD1 binding molecule suitable for a single administration, or in the form of a liquid.
- Dry powder unit dosage forms may be packaged in a kit with a syringe, a suitable quantity of diluent and/or other components useful for administration.
- Unit dosages in liquid form may be conveniently supplied in the form of a syringe pre-filled with a quantity of CD20-PD1 binding molecule suitable for a single administration.
- compositions may also be supplied in bulk from containing quantities of CD20-PD1 binding molecule suitable for multiple administrations.
- compositions may be prepared for storage as lyophilized formulations or aqueous solutions by mixing a CD20-PD1 binding molecule having the desired degree of purity with optional pharmaceutically-acceptable carriers, excipients or stabilizers typically employed in the art (all of which are referred to herein as “carriers”), i.e., buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives.
- carriers i.e., buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives.
- carriers i.e., buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives.
- Buffering agents help to maintain the pH in the range which approximates physiological conditions. They may be present at a wide variety of concentrations, but will typically be present in concentrations ranging from about 2 mM to about 50 mM.
- Suitable buffering agents for use with the present disclosure include both organic and inorganic acids and salts thereof such as citrate buffers (e.g., monosodium citrate-disodium citrate mixture, citric acid-trisodium citrate mixture, citric acid-monosodium citrate mixture, etc.), succinate buffers (e.g., succinic acid-monosodium succinate mixture, succinic acid-sodium hydroxide mixture, succinic acid-disodium succinate mixture, etc.), tartrate buffers (e.g., tartaric acid-sodium tartrate mixture, tartaric acid-potassium tartrate mixture, tartaric acid-sodium hydroxide mixture, etc.), fumarate buffers (e.g., fumaric acid-
- Preservatives may be added to retard microbial growth, and can be added in amounts ranging from about 0.2%-1 % (w/v).
- Suitable preservatives for use with the present disclosure include phenol, benzyl alcohol, meta-cresol, methyl paraben, propyl paraben, octadecyldimethylbenzyl ammonium chloride, benzalconium halides (e.g., chloride, bromide, and iodide), hexamethonium chloride, and alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, and 3-pentanol.
- Isotonicifiers sometimes known as “stabilizers” can be added to ensure isotonicity of liquid compositions of the present disclosure and include polyhydric sugar alcohols, for example trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol and mannitol.
- Stabilizers refer to a broad category of excipients which can range in function from a bulking agent to an additive which solubilizes the therapeutic agent or helps to prevent denaturation or adherence to the container wall.
- Typical stabilizers can be polyhydric sugar alcohols (enumerated above); amino acids such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2-phenylalanine, glutamic acid, threonine, etc., organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myoinisitol, galactitol, glycerol and the like, including cyclitols such as inositol; polyethylene glycol; amino acid polymers; sulfur containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, a-monothioglycerol and sodium thio sulfate; low
- Non-ionic surfactants or detergents may be added to help solubilize the glycoprotein as well as to protect the glycoprotein against agitation-induced aggregation, which also permits the formulation to be exposed to shear surface stressed without causing denaturation of the protein.
- Suitable non-ionic surfactants include polysorbates (20, 80, etc.), polyoxamers (184, 188 etc.), and pluronic polyols.
- Non-ionic surfactants may be present in a range of about 0.05 mg/mL to about 1 .0 mg/mL, for example about 0.07 mg/mL to about 0.2 mg/ml_.
- Additional miscellaneous excipients include bulking agents (e.g., starch), chelating agents (e.g., EDTA), antioxidants (e.g., ascorbic acid, methionine, vitamin E), and cosolvents.
- bulking agents e.g., starch
- chelating agents e.g., EDTA
- antioxidants e.g., ascorbic acid, methionine, vitamin E
- cosolvents e.g., ascorbic acid, methionine, vitamin E
- a CD20-PD1 binding molecule of the disclosure can be delivered by any method useful for gene therapy, for example as mRNA or through viral vectors encoding the CD20-PD1 binding molecule under the control of a suitable promoter.
- Exemplary gene therapy vectors include adenovirus- or AAV-based therapeutics.
- adenovirus-based or AAV-based therapeutics for use in the methods, uses or compositions herein include, but are not limited to: rAd-p53, which is a recombinant adenoviral vector encoding the wild-type human tumor suppressor protein p53, for example, for the use in treating a cancer (also known as Gendicine®, Genkaxin®, Qi et al., 2006, Modern Oncology, 14:1295-1297); Ad5_d11520, which is an adenovirus lacking the E1 B gene for inactivating host p53 (also called H101 or ONYX-015; see, e.g., Russell et al., 2012, Nature Biotechnology 30:658- 670); AD5-D24-GM-CSF, an adenovirus containing the cytokine GM-CSF, for example, for the use
- rAd-HSVtk a replication deficient adenovirus with HSV thymidine kinase gene, for example, for the treatment of cancer
- Cerepro® a replication deficient adenovirus with HSV thymidine kinase gene
- ProstAtakTM a replication deficient adenovirus with HSV thymidine kinase gene
- rAd-TNFa a replication-deficient adenoviral vector expressing human tumor necrosis factor alpha (TNFa) under the control of the chemoradiation-inducible EGR-1 promoter, for example, for the treatment of cancer (TNFeradeTM, GenVec; Rasmussen et al., 2002, Cancer Gene Ther.
- Ad-IFNp an adenovirus serotype 5 vector from which the E1 and E3 genes have been deleted expressing the human interferon-beta gene under the direction of the cytomegalovirus (CMV) immediate-early promoter, for example for treating cancers (BG00001 and H5.110CMVhlFN-
- CMV cytomegalovirus
- the nucleic acid molecule (e.g., mRNA) or virus can be formulated as the sole pharmaceutically active ingredient in a pharmaceutical composition or can be combined with other active agents for the particular disease to be treated.
- other medicinal agents, pharmaceutical agents, carriers, adjuvants, diluents can be included in the compositions provided herein.
- any one or more of a wetting agents, emulsifiers and lubricants, such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, release agents, coating agents, sweetening, flavoring and perfuming agents, preservatives, antioxidants, chelating agents and inert gases also can be present in the compositions.
- Exemplary other agents and excipients that can be included in the compositions include, for example, water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite; oilsoluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, a-tocopherol; and metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid and phosphoric acid.
- water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite
- oilsoluble antioxidants such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecit
- the cell therapies e.g., CAR-expressing cells
- the cell therapies can be engineered to express the CD20-PD1 binding molecule of the disclosure.
- the CD20-PD1 binding molecule can be targeted to a specific genomic locus, e.g., a locus that is active in activated or dysfunctional lymphocytes, e.g., the PD-1 locus, or inserted into a non-specific genomic locus.
- Targeting a specific genomic locus can be achieved through gene editing, e.g., using zinc finger proteins, the CRISPR/Cas9 system, and the like. 6.10.
- CD20-PD1 binding molecules of the disclosure are useful in treating disease states where modulation of the immune system of the host is beneficial, in particular conditions where repression of a cellular immune response is desirable.
- the CD20-PD1 binding molecules of the disclosure can be used to repress the immune response in a variety of applications.
- the conditions for which the repression of a cellular immune response is desirable may include disease states resulting from an autoimmune response.
- Disease states for which the CD20-PD1 binding molecules of the disclosure can be administered comprise, for example, an autoimmune disease where repression of a cellular autoimmune response would be an important mechanism.
- Specific disease states for which CD20-PD1 binding molecules of the present disclosure can be employed include type 1 diabetes (T1 D), systemic lupus erythematosus, Crohn’s disease, and graft-versus-host disease (GVHD).
- T1 D type 1 diabetes
- GVHD graft-versus-host disease
- the CD20-PD1 binding molecules of the disclosure may be administered per se or in any suitable pharmaceutical composition.
- CD20-PD1 binding molecules of the disclosure for use as a medicament are provided.
- CD20-PD1 binding molecules of the disclosure for use in treating a disease are provided.
- CD20-PD1 binding molecules of the disclosure for use in a method of treatment are provided.
- the disclosure provides a CD20- PD1 binding molecule as described herein for use in the treatment of a disease in a subject in need thereof.
- the disclosure provides a CD20-PD1 binding molecules for use in a method of treating a subject having an autoimmune disease comprising administering to the individual a therapeutically effective amount of the CD20-PD1 binding molecule.
- the disease to be treated is an autoimmune disease.
- the disease is T1 D. In other embodiments the disease is systemic lupus erythematosus. In other embodiments the disease is Crohn’s disease. In yet other embodiments the disease is GVHD. In certain embodiments the method further comprises administering to the individual a therapeutically effective amount of at least one additional therapeutic agent. In further embodiments, the disclosure provides a CD20-PD1 binding molecules agonist for use in repressing the immune system. In certain embodiments, the disclosure provides a CD20-PD1 binding molecule for use in a method of repressing the immune system in a subject comprising administering to the individual an effective amount of the CD20-PD1 binding molecule to repress the immune system.
- an “individual” according to any of the above embodiments is a mammal, for example a human.
- “Repression of the immune system” according to any of the above embodiments may include any one or more of a general decrease in immune function, a decrease in T cell function, a decrease in B cell function, a decrease in T cell responsiveness, and the like.
- “Repression of a cellular autoimmune response” according to any of the above embodiments may include, for example, a decrease in immune signal (e.g., secretion of immune activating cytokines), a decrease in function of an immune cell targeting an autoantigen, and the like.
- the present disclosure further provides a method of localized PD1 agonism, comprising administering to a subject a CD20-PD1 binding molecule or pharmaceutical composition as described herein.
- a method of localized PD1 agonism comprising administering to a subject a CD20-PD1 binding molecule or pharmaceutical composition as described herein.
- the term “locally delivered” does not require local administration but rather indicates that the CD20-PD1 binding molecule is selectively or preferentially localized at the intended site of immune modulation, e.g., site of autoimmune activity and/or an intended cell type, e.g., B cells.
- the present disclosure further provides a method of administering to the subject PD1 agonist therapy with reduced systemic exposure and/or reduced systemic toxicity, comprising administering to a subject the PD1 agonist therapy in the form of a CD20-PD1 binding molecule or pharmaceutical composition as described herein, for example where CD20 is expressed by a tissue for which PD1 agonist therapy is desirable and/or intended.
- the foregoing methods permit PD1 agonist therapy with reduced off-target side effects by virtue of preferential delivery a CD20-PD1 binding molecule at a locale intended for PD1 agonist treatment.
- the present disclosure further provides method of locally modulating (e.g., inhibiting) an immune response in a target tissue that expresses CD20, comprising administering to a subject CD20-PD1 binding molecule or pharmaceutical composition as described herein.
- the administration is not local to the tissue.
- the disclosure provides for the use of a CD20-PD1 binding molecule of the disclosure in the manufacture or preparation of a medicament for the treatment of a disease in a subject in need thereof.
- the medicament is for use in a method of treating a disease comprising administering to a subject having the disease a therapeutically effective amount of the medicament.
- the disease to be treated is an autoimmune disease.
- the disease is T1 D.
- the disease is systemic lupus erythematosus.
- the disease is Crohn’s disease.
- the disease is GVHD.
- the method further comprises administering to the individual a therapeutically effective amount of at least one additional therapeutic agent.
- the medicament is for repressing the immune system.
- the medicament is for use in a method of repressing the immune system in a subject comprising administering to the individual an amount effective of the medicament to repress the immune system.
- An “individual” according to any of the above embodiments may be a mammal, for example a human. “Repression of the immune system” according to any of the above embodiments may include any one or more of a general decrease in immune function, a decrease in T cell function, a decrease in B cell function, a decrease in T cell responsiveness, and the like.
- the disclosure provides a method of clustering PD1 and/or enhancing PD1 activity in a subject, comprising administering to said subject an effective amount of a CD20- PD1 binding molecule of the disclosure.
- the CD20-PD1 binding molecules of the disclosure can induce PD1 clustering at the interface of a CD20-presenting cell and a T cell. This provides for targeted immunosuppression, where the CD20-presenting cells and surrounding cells and tissues are protected from T cell killing. High levels of CD20 can be found on B cells, which are abundant in draining lymph nodes and in autoimmune tissues (e.g., the pancreas in type 1 diabetes (T1 D)).
- the CD20-PD1 binding molecules of the disclosure can agonize PD1 in a cell and/or tissue specific manner, inhibiting autoreactive T cell activation.
- T1 D the abundance of CD20+ B cells provides for the clustering of PD1 on autoreactive T cells, inhibiting autoreactive cytotoxic T cells from killing islet cells.
- a composition is administered to said subject, comprising the CD20-PD1 binding molecule of the disclosure in a pharmaceutically acceptable form.
- the disclosure provides a method for treating an autoimmune disease in a subject, comprising administering to said individual a therapeutically effective amount of a CD20- PD1 binding molecule of the disclosure.
- a composition is administered to said individual, comprising the CD20-PD1 binding molecule of the disclosure in a pharmaceutically acceptable form.
- the disease to be treated is an autoimmune disease.
- Autoimmune diseases treatable by the CD20-PD1 binding molecules of the disclosure can include type 1 diabetes, primary biliary cholangitis (PBC), Goodpasture’s syndrome, amyloidosis, ankylosing spondylitis, anti-glomerular basement membrane nephritis, anti-tubular basement membrane nephritis, antiphospholipid syndrome, autoimmune hepatitis, autoimmune oophoritis, graft vs.
- PBC primary biliary cholangitis
- Goodpasture’s syndrome amyloidosis
- ankylosing spondylitis anti-glomerular basement membrane nephritis
- anti-tubular basement membrane nephritis antiphospholipid syndrome
- autoimmune hepatitis autoimmune oophoritis
- graft vs graft vs.
- GVHD host disease
- autoimmune pancreatitis autoimmune pancreatitis
- autoimmune retinopathy Behcet’s disease, Crohn’s disease
- Devic’s disease systemic lupus erythematosus (SLE), Dressier’s syndrome, fibrosing alveolitis, glomerulonephritis, Graves’ disease, Guillain-Barre syndrome, IgA Nephropathy, lgG4-related sclerosing disease, immune thrombocytopenic purpura (ITP), microscopic polyangiitis (MPA), mixed connective tissue disease (MCTD), multiple sclerosis, polyneuropathy, organomegaly, endocrinopathy, monoclonal syndrome (POEMS), polyarteritis nodosa, rheumatoid arthritis, Schmidt syndrome, scleritis, scleroderma, Sjogren’s syndrome, sperm or testicular autoimmunity, stiff person syndrome (SPS),
- the disease is T1 D.
- the disease is systemic lupus erythematosus.
- the disease is Crohn’s disease.
- the disease is GVHD.
- the method further comprises administering to the individual a therapeutically effective amount of at least one additional therapeutic agent.
- the disclosure provides a method for repressing the immune system in a subject, comprising administering to the individual an effective amount of a CD20-PD1 binding molecule to repress the immune system.
- the disease to be treated is an autoimmune disease.
- the CD20- PD1 binding molecules may be used in eliminating cells involved in immune cell-mediated disorders, autoimmunity, transplantation rejection, and graft-versus-host disease.
- a skilled artisan readily recognizes that in many cases the CD20-PD1 binding molecules may not provide a cure but may only provide partial benefit.
- a physiological change having some benefit is also considered therapeutically beneficial.
- an amount of CD20-PD1 binding molecule that provides a physiological change is considered an "effective amount" or a “therapeutically effective amount”.
- the subject, patient, or individual in need of treatment is typically a mammal, more specifically a human.
- the appropriate dosage of a CD20-PD1 binding molecule of the disclosure (when used alone or in combination with one or more other additional therapeutic agents) will depend on the type of disease to be treated, the route of administration, the body weight of the patient, the particular CD20-PD1 binding molecule, the severity and course of the disease, whether the antibody is administered for preventive or therapeutic purposes, previous or concurrent therapeutic interventions, the patient's clinical history and response to the CD20-PD1 binding molecule, and the discretion of the attending physician.
- the practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject.
- Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
- the CD20-PD1 binding molecule is suitably administered to the patient at one time or over a series of treatments.
- about 1 pg/kg to 15 mg/kg (e.g., 0.1 mg/kg-10 mg/kg) of CD20-PD1 binding molecule can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion.
- One typical daily dosage might range from about 1 pg/kg to 100 mg/kg or more, depending on the factors mentioned above.
- the treatment would generally be sustained until a desired suppression of disease symptoms occurs.
- One exemplary dosage of the CD20-PD1 binding molecule would be in the range from about 0.005 mg/kg to about 10 mg/kg.
- a dose may also comprise from about 1 pg/kg/body weight, about 5 pg/kg/body weight, about 10 pg/kg/body weight, about 50 pg/kg/body weight, about 100 pg/kg/body weight, about 200 pg/kg/body weight, about 350 pg/kg/body weight, about 500 pg/kg/body weight, about 1 mg/kg/body weight, about 5 mg/kg/body weight, about 10 mg/kg/body weight, about 50 mg/kg/body weight, about 100 mg/kg/body weight, about 200 mg/kg/body weight, about 350 mg/kg/body weight, about 500 mg/kg/body weight, to about 1000 mg/kg/body weight or more per administration, and any range derivable therein.
- a range of about 5 mg/kg/body weight to about 100 mg/kg/body weight, about 5 pg/kg/body weight to about 500 mg/kg/body weight, etc. can be administered, based on the numbers described above.
- one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 5.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the patient.
- Such doses may be administered intermittently, e.g., every week or every three weeks (e.g., such that the patient receives from about two to about twenty, or e.g., about six doses of the CD20-PD1 binding molecule).
- An initial higher loading dose, followed by one or more lower doses may be administered.
- other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
- the CD20-PD1 binding molecules of the disclosure will generally be used in an amount effective to achieve the intended purpose.
- the CD20-PD1 binding molecules of the disclosure, or pharmaceutical compositions thereof are administered or applied in a therapeutically effective amount. Determination of a therapeutically effective amount is well within the capabilities of those skilled in the art, especially in light of the detailed disclosure provided herein.
- a therapeutically effective dose can be estimated initially from in vitro assays, such as cell culture assays.
- a dose can then be formulated in animal models to achieve a circulating concentration range that includes the EC 5 o as determined in cell culture. Such information can be used to more accurately determine useful doses in humans.
- Initial dosages can also be estimated from in vivo data, e.g., animal models, using techniques that are well known in the art. One having ordinary skill in the art could readily optimize administration to humans based on animal data.
- Dosage amount and interval may be adjusted individually to provide plasma levels of the CD20-PD1 binding molecules which are sufficient to maintain therapeutic effect. Usual patient dosages for administration by injection range from about 0.1 to 50 mg/kg/day, typically from about 0.5 to 1 mg/kg/day. Therapeutically effective plasma levels may be achieved by administering multiple doses each day. Levels in plasma may be measured, for example, by ELISA HPLC.
- the effective local concentration of the CD20-PD1 binding molecules may not be related to plasma concentration.
- One having skill in the art will be able to optimize therapeutically effective local dosages without undue experimentation.
- a therapeutically effective dose of the CD20-PD1 binding molecules described herein will generally provide therapeutic benefit without causing substantial toxicity.
- Toxicity and therapeutic efficacy of a CD20-PD1 binding molecule can be determined by standard pharmaceutical procedures in cell culture or experimental animals. Cell culture assays and animal studies can be used to determine the LD 5 o (the dose lethal to 50% of a population) and the ED 5 o (the dose therapeutically effective in 50% of a population). The dose ratio between toxic and therapeutic effects is the therapeutic index, which can be expressed as the ratio LD50/ED50.
- CD20-PD1 binding molecules that exhibit large therapeutic indices are preferred. In one embodiment, the CD20-PD1 binding molecule according to the present disclosure exhibits a high therapeutic index.
- the data obtained from cell culture assays and animal studies can be used in formulating a range of dosages suitable for use in humans.
- the dosage lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
- the dosage may vary within this range depending upon a variety of factors, e.g., the dosage form employed, the route of administration utilized, the condition of the subject, and the like.
- the exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition. (See, e.g., Fingl et al., 1975, In: The Pharmacological Basis of Therapeutics, Ch. 1 , p. 1 , incorporated herein by reference in its entirety).
- the attending physician for patients treated with CD20-PD1 binding molecules of the disclosure would know how and when to terminate, interrupt, or adjust administration due to toxicity, organ dysfunction, and the like. Conversely, the attending physician would also know to adjust treatment to higher levels if the clinical response were not adequate (precluding toxicity).
- the magnitude of an administered dose in the management of the disorder of interest will vary with the severity of the condition to be treated, with the route of administration, and the like. The severity of the condition may, for example, be evaluated, in part, by standard prognostic evaluation methods. Further, the dose and perhaps dose frequency will also vary according to the age, body weight, and response of the individual patient. 6.10.1. Type 1 Diabetes
- CD20-PD1 binding molecules according to the disclosure can prevent or slow the development or progression of Type 1 Diabetes.
- the CD20-PD1 binding molecules, nucleic acids, and/or pharmaceutical compositions of the disclosure can be administered to a subject having T1 D or at risk of developing T 1 D.
- Risk factors for developing T1 D include, but are not limited to, genetic markers (e.g., human leukocyte antigen (HLA) complexes; see, Flemming and Pociot, 2016, Lancet, 387(10035):2331-2339), viral infection (e.g., German measles, coxsackie virus, and mumps), race/ethnicity (e.g., in the United States, Caucasians are more susceptible to type 1 diabetes), family history, early diet, and presence of other autoimmune conditions (e.g., Grave’s disease, multiple sclerosis, pernicious anemia).
- genetic markers e.g., human leukocyte antigen (HLA) complexes; see, Flemming and Pociot, 2016, Lancet, 387(10035):2331-233
- viral infection e.g., German measles, coxsackie virus, and mumps
- race/ethnicity e.g., in the United States, Cau
- a patient at risk of developing T1D is treated with CD20-PD1 binding molecules, nucleic acids, and/or pharmaceutical compositions of the disclosure in accordance with the methods of the disclosure.
- the CD20-PD1 binding molecules according to the disclosure may be administered in combination with one or more other agents in therapy.
- a CD20-PD1 binding molecule of the disclosure may be co-administered with at least one additional therapeutic agent.
- therapeutic agent encompasses any agent administered to treat a symptom or disease in a subject in need of such treatment.
- additional therapeutic agent may comprise any active ingredients suitable for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
- an additional therapeutic agent is an immunomodulatory agent, a cytostatic agent, an inhibitor of cell adhesion, a cytotoxic agent, an activator of cell apoptosis, or an agent that increases the sensitivity of cells to apoptotic inducers.
- Such other agents are suitably present in combination in amounts that are effective for the purpose intended.
- the effective amount of such other agents depends on the amount of CD20- PD1 binding molecule used, the type of disorder or treatment, and other factors discussed above.
- the CD20-PD1 binding molecules are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
- Such combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate compositions), and separate administration, in which case, administration of the CD20-PD1 binding molecule of the disclosure can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent and/or adjuvant.
- the CD20-PD1 binding molecules of the disclosure can be advantageously used in combination with chimeric antigen receptor (“CAR”)-expressing cells, e.g., CAR-expressing Treg (“CAR-Treg”) cells, for example CAR-Treg in the treatment of autoimmune diseases.
- CAR-Treg cells are recognized by a CD20 targeting moiety in the CD20-PD1 binding molecule.
- the CD20 targeting moiety can recognize a Treg cell receptor or another cell surface molecule on the CAR-Treg cells.
- a CD20 targeting moiety in the CD20-PD1 binding molecule is capable of binding to an extracellular domain of the CAR, for example the antigen binding domain.
- CAR-Treg cells are described in Fritsche et al., 2020, Trends Biotechnol, 38(10):1099-1112; Zhang et al., 2018, Front Immunol, 9:2359; and Mohseni et al., Front Immunol, 11 :1608, each of which is incorporated by reference herein in its entirety.
- aspects of the present disclosure relate to a luciferase-based reporter bioassay to evaluate the ability of CD20-PD1 binding molecules disclosed herein to agonize PD1 on Jurkat cells in the presence of CD20 presented on HEK293 cells.
- HEK293 cells are transduced with CD22 as well as with CD20.
- a bioassay disclosed herein includes the use of a bispecific antibody (such as CD3xCD22) in the presence of the HEK293 cells to elicit an immune response from a Jurkat cell line that has been transduced with AP1 (activator-protein 1)-luciferase reporter, CD3 and PD1 using lentivirus.
- AP1 activator-protein 1
- PD1 lentivirus
- the CD20-PD1 binding molecules are added to the wells in the presence of the Jurkat and HEK293 cells as well as the anti-CD3xCD22 bispecific antibody.
- the molecules that best agonize PD1 have the ability to reduce the amount of the immune response stimulated by the anti-CD3xCD22 bispecific antibody as measured by the AP1 driven luciferase activity.
- the bispecific CD20-PD1 agonists included different configurations of murine anti-CD20 and a modified murine PDL1 ectodomain, an lgG1 effector null (EN) (L234A, L235E, G237A, A330S and P331S, EU numbering) domain, and linkers of different lengths from different repeats of G S (SEQ ID NO: 14).
- a 29-amino acid signal sequence from murine inactive tyrosine-protein kinase transmembrane receptor ROR1 (mROR1) was added to the N-termini of the constructs. All bispecific CD20-PD1 agonists were expressed as preproteins containing the signal sequence. The signal sequence was cleaved by intracellular processing to produce a mature protein.
- Proteins in Expi293F supernatant were purified using the ProteinMaker system (Protein BioSolutions, Gaithersburg, MD) with either HiTrapTM Protein G HP or MabSelect SuRe pcc columns (Cytiva). After single step elution, the antibodies were neutralized, dialyzed into a final buffer of phosphate buffered saline (PBS) with 5% glycerol, aliquoted and stored at -80 °C. For some constructs, an additional step of size-exclusion chromatography with HiPrep 26/60 Sephacryl S-200 column was used.
- PBS phosphate buffered saline
- FIG. 3B Alignments and a selected mutated position in mPDL1 are depicted in FIG. 3B. Alignments between mPDL1 and hPDL1 were generated using MacVector.
- FIG. 3A depicts the 3-dimensional structure of mPDL1 and hPDL1 , including a residue that was changed in mPDL1 to improve the yield and stability.
- Cells (HEK 293, MC38 over-expressing mCD20 or Jurkat over-expressing mPD1) were resuspended in FACS wash (PBS with 1% FBS ) at 1 xi o 6 cells/mL. The staining was performed in 1 xio 5 cells per well. The antibodies were diluted with a ratio of 1 :5 from a starting concentration of 1.3 x 10’ 07 M. The diluted antibodies were then added into the wells containing cells. Cells were stained for 30 min at 2-8°C and washed twice with FACS wash buffer.
- APC-conjugated goat antihuman IgG (Jackson Immuno Research, 109-607-003, 1 :400) was added to stain the cells for 30 min at 2-8°C. Following washing, cells were fixed in 2% paraformaldehyde for 30 min at 2-8°C. After two washes, stained cells were analyzed using BD LSRFortessaTM FACS instrument. The results were analyzed by FlowJo. FSC/SSC gates were used to select mononuclear cells.
- a luciferase-based reporter assay was used to evaluate the ability of anti-mCD20 x mPDL1 ectodomain molecules to agonize mouse PD1 (mPD1) on Jurkat cells in the presence of mouse CD20 (mCD20) presented on HEK293 cells.
- the overall design of the reporter assay is depicted in FIG. 5A and B.
- AP1 is a transcription factor involved in the regulation of gene expression during T cell activation (Samelson 2002, PMID: 11861607).
- a bispecific antibody (bsAb) binding to human CD3 and CD22, CD3 bsAb (REGN10551), is used to stimulate T cell activation through engagement of antigen on target cells and receptor on T cells, similar to a previously described CD3 x CD20 bsAb (Smith et al. 2015, PMID: 26659273). Engagement of mPD1 on Jurkat cells via mCD20-anchored mCD20xmPDL1 results in PD1 agonism-driven inhibition of luciferase signal.
- Jurkat/AP1-luc/mPD1 cells were generated by sequential transduction of Jurkat E6-1 cells (ATCC#TIB-152) with AP1 (activator-protein 1)-luciferase reporter lentivirus (QIAGEN CLS-011 L) followed by mPD1 ORF-containing lentivirus (mPD1 NM_008798).
- AP1 activator-protein 1-luciferase reporter lentivirus
- mPD1 ORF-containing lentivirus mPD1 NM_008798.
- HEK293/hCD22/mCD20 cells were generated by sequential lentiviral transduction using human CD22 ORF-encoding lentivirus ( P_001762.2), followed by mCD20 ORF-encoding lentivirus (NP_031667.1).
- HEK293/CD22/mCD20 target cells were seeded at 10,000 or 20,000 cells/well into 96-well plates in assay media (RPMI1640 supplemented with 10% fetal bovine serum and L-glutamine-penicillin-streptomycin) and incubated overnight at 37°C in 5% CO 2 .
- assay media RPMI1640 supplemented with 10% fetal bovine serum and L-glutamine-penicillin-streptomycin
- Jurkat/AP1-luc/mPD1 reporter cells were added at 30,000 or 50,000 cells/well to wells containing the cultured target cells.
- Molecules of the present disclosure or control antibodies were then serially diluted in assay media 1 :3 to final concentrations ranging from 100nM to 1 pM (with an additional condition without test molecule) and added to the cells along with 1 nM or 2.5nM of CD3 bsAb.
- CD3 bsAb was serially diluted 1 :3 to final concentrations ranging from 100nM to 1.69pM (with an additional condition without bispecific mAb) and added to cells. After 5 hours of incubation at 37°C 15% CO 2 , luciferase activity was detected on an Envision multilabel plate reader (PerkinElmer) after the addition of ONE-GloTM (Promega) reagent. All conditions were tested in duplicate.
- RLUBaseline is the luminescence value from the cells treated with constant amount of CD3 bsAb without test molecule
- RLU I nhibition is the luminescence value at the highest concentration of test molecule with constant amount of CD3 bsAb
- RLUBackground is the luminescence value from cells without any CD3 bsAb or test molecules.
- SE-UPLC Size-exclusion ultra-performance liquid chromatography
- DSF Differential Scanning Fluorimetry
- the assembly of the bifunctional fusion molecules was assayed by high-throughput analysis on a Cliper LabChip GX as per the manufacturer’s protocol (Perkin Elmer, Waltham, MA). Briefly, the sample buffer was prepared by mixing 7 ml of HT protein express sample buffer with either 240 pl BME (reducing) or 25 mM iodoacetamide (IAM, for non-reducing assay). Samples were normalized to 0.5 mg/ml with sample buffer and then heated at 70 °C for 10 minutes. 70 pl of water was added to each sample before loading onto the instrument. The chip was prepared according to the manufacturer’s instruction. Electropherogram of the samples were analyzed using the LabChip GX software. Peaks from non-reduced electropherogram indicate the % intact antibody.
- EAE was induced in wildtype C57BL/6 mice (10 ⁇ 12 week, male, The Jackson Laboratory) by s.c. delivery of 200 mg MOG35-55 in CFA on day 1 .
- the mice were also i.p. injected with 200 ng pertussis toxin on day 1 and day 2.
- Body weight and EAE development was monitored on days 1 , 2, 7, 10, 14, 18, and 20.
- EAE monitoring scores were recorded on a scale of 0-5 as follows: 0: healthy; 1 : limp tail; 2: abnormal gait and/or righting reflex defect; 3: partial hindleg paralysis; 4: complete hindleg paralysis; and 5:complete hindleg and partial front leg paralysis or moribund.
- mice were dosed with i.p. injections of select anti-mCD20 x mPDL1 ectodomain molecules or appropriate control molecules twice per week.
- the endpoint tissue harvest was carried out at the peak of disease on day 20.
- Spinal cord infiltrates were used for flow cytometry and spleen MOG-specific T cell response was assessed with ELISPOT.
- Mammalian expression vectors for individual heavy chains and light chains were created by DNA synthesis and cloning in ready to use constructs in pcDNA3.4 Topo expression system from Life Technologies (Carlsbad, CA).
- DNAs of heavy chains and universal light chain were co-transfected into Expi293 cells (ThermoFisher Scientific) following the manufacturer’s protocol.
- 50 ml of cell culture medium was harvested and processed for purification via a HiTrap Protein A FF or Mab Select SuRe column (GE Healthcare).
- selected MBMs were scaled up to 2L and subject to a series of purification procedures including size exclusion chromatography as the final step.
- Binding curves are shown in FIGS. 4A and 4B. Higher potency and maximal MFI in binding were observed with bivalent molecules relative to monovalent molecules of similar format for both mPD1 and mCD20 binding.
- 2+2 m20_mPL_4 (L) shared similar binding as 2+1 m20_mPL_3 (G) (FIGS. 4A and 4B; Table 6) to HEK293/mCD20 cells
- 2+2 m20_mPL_4 (L) demonstrated stronger binding to Jurkat/mPDI cells than 2+1 m20_mPL_3 (G) as a result of increased valency for mPD1 binding.
- binding signal appeared to be orientation-dependent, with N-terminal anti-mCD20 and hPDL1 ectodomain orientation relative to Fc domain having generally higher potency and maximal MFI.
- Anti-mCD20 or mPDL1 ectodomain demonstrated reduced binding when positioned between an N-terminal moiety and the hinge region before Fc (FIGS. 4A and 4B; Table 6).
- Example 3 mPDL1 agonism by anti-mCD20 x mPDL1 ectodomain molecules [0295] Utilizing the bioassay depicted in FIG. 5 and described in Section 7.1.3, mPD1 agonism by anti-mCD20 x mPDL1 ectodomain molecules was studied.
- Results from the luciferase assay are depicted in FIG. 6 and Table 6.
- Nineteen molecules of the present disclosure were tested for PD1 agonism and regulation of T-cell signaling thereof using HEK293/CD22/mCD20 and Jurkat/AP1-luc/mPD1 reporter cells with CD3 bsAb.
- Table 6 four out of nineteen molecules of the present disclosure showed inhibition of T cell signaling with IC50 values ranging 65 - 770pM with maximum inhibition ranging 27 - 84%.
- Molecules 2+2 m20_MPL_4 and 2+1 m20_MPL_3 (G and L, respectively; Table 6) exhibited strongest PD1 agonism with maximum inhibition of 74% to 84% (FIGS.
- CD3 bsAb showed activation of T cell signaling with EC50 values of 627pM and 1.15nM.
- Example 4 Data Summary for in vitro Assays with Anti-mCD20 x mPDL1 Ectodomain Molecules
- Table 6 provides a summary of the in vitro data collected with the various anti-mCD20 x mPDL1 ectodomain molecules including cell-based flow binding and in vitro bioassay results. Results from the luciferase assay are depicted in FIGS. 6A-6E. Molecules 2+2 m20_mPL_4 and 2+1 m20_mPL_3 (G and L, respectively, in Table 6) exhibited strongest PD1 agonism.
- Example 5 In vivo Efficacy of Anti-mCD20 x mPDL1 Ectodomain Molecules [0298] The ability of selected 2+2 and 2+1 anti-mCD20 x mPDL1 ectodomain molecules to prevent the onset of type 1 diabetes (T1D) was assessed in pre-diabetic NOD mice. The experimental design is depicted in FIG. 7 and described in Section 7.1.7.
- FIGS. 9A and 9B depict the percent of diabetes-free mice at each indicated timepoint. Normally, 80-90% of NOD mice develop diabetes around age 25 weeks. In this experiment, however, only about 30% of mice developed diabetes by 27 weeks. While there was a lower diabetes incidence in control NOD mice, there was a clear trend of protection with higher doses of the (2+2) anti-mCD20 x mPDL1 ectodomain molecule, 2+2 m20_mPL_4 (molecule L in FIG. 2A) but not with the (2+1 anti-mCD20 x mPDL1 ectodomain molecule, 2+1 m20_mPL_3 (molecule G in FIG. 2A) (FIG. 9A and 9B).
- populations of proliferating (activated) and less-activated islet specific CD8+ T cells were analyzed in of NOD mice described in Section 7.1.7 that were dosed with 0.1 or 1 mg/kg 2+2 m20_mPL_4 or a control molecule. Treatment with 1 mg/kg 2+2 m20_mPL_4 was associated with a marked percent increase of the less activated cluster of CD8+ T cells (FIG.
- a protein comprising
- moieties of the protein are arranged, from N- to C-terminus, in the order of CD20 targeting moiety - PD1 agonist moiety - dimerization moiety;
- moieties of the protein are arranged, from N- to C-terminus, in the order of dimerization moiety - PD1 agonist moiety - CD20 targeting moiety;
- the CD20 targeting moiety is an anti-CD20 Fab
- the PD1 agonist moiety is the ectodomain of PDL1 or a PD1 -binding portion thereof
- the dimerization moiety is an Fc domain
- the light chain of the Fab is not fused to the ectodomain of PDL1 or a PD1- binding portion thereof;
- the CD20 targeting moiety is an anti-CD20 Fab
- the PD1 agonist moiety is the ectodomain of PDL1 or a PD1 -binding portion thereof
- the dimerization moiety is an Fc domain
- the PD1 agonist moiety is not N-terminal to a VH of the anti-CD20 Fab
- the CD20 targeting moiety is an anti-CD20 Fab
- the PD1 agonist moiety is the ectodomain of PDL1 or a PD1 -binding portion thereof
- the dimerization moiety is an Fc domain
- the PD1 agonist moiety is not C-terminal to the Fc domain
- the CD20 targeting moiety is an anti-CD20 Fab
- the PD1 agonist moiety is the ectodomain of PDL1 or a PD1 -binding portion thereof
- the dimerization moiety is an Fc domain
- the protein is monovalent for the CD20 targeting moiety and/or the PD1 agonist moiety
- the protein comprises an Fc heterodimer; or (ix) any combination of two or more of the foregoing (i) through (viii).
- CDRs complementarity-determining regions having CDR sequences of rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab ituxetan, tositumomab, ublituximab, ocaratuzumab, TRU-015, or veltuzumab;
- VH comprising the amino acid sequence of the VH of rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab ituxetan, tositumomab, ublituximab, ocaratuzumab, TRU-015, or veltuzumab and a VL comprising the amino acid sequence of the same antibody; or
- VH comprising the amino acid sequence of the VH of rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab ituxetan, tositumomab, ublituximab, ocaratuzumab, TRU-015, or veltuzumab and a VL comprising a universal light chain VL sequence.
- a region of CD20 displayed extracellularly on a surface of a cell e.g., a B cell.
- anti-CD20 antibody (a) is selected from rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab ituxetan, tositumomab, ublituximab, ocaratuzumab, TRU-015, and veltuzumab
- (b) competes for binding to CD20 with and/or binds to the same epitope as an anti-CD20 antibody selected from rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab ituxetan, tositumomab, ublituximab, ocaratuzumab, TRU-015, and veltuzumab.
- an anti-CD20 antibody selected from rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab ituxetan, tositumomab, ublituximab, ocaratuzumab, TRU-015, and veltuzumab.
- the at least one PD1 agonist moiety comprises an amino acid sequence having at least 90% sequence identity to a PD1- binding portion of the extracellular domain of PDL1 , optionally wherein PDL1 is human or murine PDL1.
- the PD1 agonist moiety comprises an amino acid sequence having at least 95% sequence identity to a PD1 -binding portion of the extracellular domain of PDL1 , optionally wherein PDL1 is human or murine PDL1 .
- the PD1 agonist moiety comprises an amino acid sequence having at least 97% sequence identity to a PD1 -binding portion of the extracellular domain of PDL1 , optionally wherein PDL1 is human or murine PDL1 .
- the PD1 agonist moiety comprises an amino acid sequence having at least 98% sequence identity to a PD1 -binding portion of the extracellular domain of PDL1 , optionally wherein PDL1 is human or murine PDL1 .
- the PD1 agonist moiety comprises an amino acid sequence having at least 99% sequence identity to a PD1 -binding portion of the extracellular domain of PDL1 , optionally wherein PDL1 is human or murine PDL1 .
- the PD1 agonist moiety comprises the amino acid sequence of a PD1 -binding portion of the extracellular domain of PDL1 , optionally wherein PDL1 is human or murine PDL1 .
- the at least one PD1 agonist moiety comprises an amino acid sequence having at least 90% sequence identity to a PD1- binding portion of the extracellular domain of PDL2, optionally wherein PDL2 is human or murine PDL2.
- the PD1 agonist moiety comprises an amino acid sequence having at least 95% sequence identity to a PD1 -binding portion of the extracellular domain of PDL2, optionally wherein PDL2 is human or murine PDL2.
- the PD1 agonist moiety comprises an amino acid sequence having at least 97% sequence identity to a PD1 -binding portion of the extracellular domain of PDL2, optionally wherein PDL2 is human or murine PDL2.
- the PD1 agonist moiety comprises an amino acid sequence having at least 98% sequence identity to a PD1 -binding portion of the extracellular domain of PDL2, optionally wherein PDL1 is human or murine PDL2.
- the PD1 agonist moiety comprises an amino acid sequence having at least 99% sequence identity to a PD1 -binding portion of the extracellular domain of PDL2, optionally wherein PDL2 is human or murine PDL2.
- the PD1 agonist moiety comprises the amino acid sequence of a PD1 -binding portion of the extracellular domain of PDL2, optionally wherein PDL2 is human or murine PDL2.
- the protein of any one of embodiments 15 to 20, wherein the PD1-binding portion of the extracellular domain of PDL2 comprises amino acids 20-121 of human PDL2 or amino acids 20-121 of murine PDL2.
- each linker moiety is (a) at least 5 or at least 10 amino acids in length, (b) up to 20, up to 25 or up to 30 amino acids in length and/or (c) is 5-15 amino acids or 5-20 amino acids in length.
- the protein of any one of embodiments 1 to 30 which comprises a monomer according to Exemplary Monomer 1 and a monomer according to Exemplary Monomer 2.
- Exemplary Monomer 1 comprises or consists of, in an N- to C-terminal orientation, a CD20 targeting moiety (e.g., anti-CD20 Fab, Fv or scFV), an optional linker moiety and a dimerization moiety.
- a CD20 targeting moiety e.g., anti-CD20 Fab, Fv or scFV
- an optional linker moiety e.g., an optional linker moiety and a dimerization moiety.
- Exemplary Monomer 2 comprises or consists of, in an N- to C-terminal orientation, a PD1 agonist moiety (e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)), an optional linker moiety, and a dimerization moiety.
- a PD1 agonist moiety e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)
- an optional linker moiety e.g., an amino acid sequence which has at least 90% sequence identity to (i) or (ii
- Exemplary Monomer 3 comprises or consists of, in an N- to C-terminal orientation, an optional linker moiety and a dimerization moiety.
- Exemplary Monomer 4 comprises or consists of, in an N- to C-terminal orientation, a PD1 agonist moiety (e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)), an optional linker moiety, a CD20 targeting moiety (e.g., anti-CD20 Fab, Fv or scFV), an optional linker moiety and a dimerization moiety.
- a PD1 agonist moiety e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (i
- Exemplary Monomer 5 comprises or consists of, in an N- to C-terminal orientation, a CD20 targeting moiety (e.g., anti- CD20 Fab, Fv or scFV), an optional linker moiety, a dimerization moiety, and a PD1 agonist moiety (e.g. , a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)).
- a CD20 targeting moiety e.g., anti- CD20 Fab, Fv or scFV
- an optional linker moiety e.g., an optional linker moiety
- a dimerization moiety e.g. a PD1 agonist moiety
- a PD1 agonist moiety e.g. , a moiety
- Exemplary Monomer 3 comprises or consists of, in an N- to C-terminal orientation, an optional linker moiety and a dimerization moiety.
- Exemplary Monomer 6 comprises or consists of, in an N- to C-terminal orientation, a CD20 targeting moiety (e.g., anti- CD20 Fab, Fv or scFV), an optional linker moiety, a PD1 agonist moiety (e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)), an optional linker moiety and a dimerization moiety.
- a CD20 targeting moiety e.g., anti- CD20 Fab, Fv or scFV
- a PD1 agonist moiety e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding
- Exemplary Monomer 1 comprises or consists of, in an N- to C-terminal orientation, a CD20 targeting moiety (e.g., anti-CD20 Fab, Fv or scFV), an optional linker moiety and a dimerization moiety.
- a CD20 targeting moiety e.g., anti-CD20 Fab, Fv or scFV
- an optional linker moiety e.g., an optional linker moiety and a dimerization moiety.
- Exemplary Monomer 4 comprises or consists of, in an N- to C-terminal orientation, a PD1 agonist moiety (e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)), an optional linker moiety, a CD20 targeting moiety (e.g., anti-CD20 Fab, Fv or scFV), an optional linker moiety and a dimerization moiety.
- a PD1 agonist moiety e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (i
- the protein of any one of embodiments 55 to 61 which has the configuration depicted in FIG. 1 E. 63.
- the protein of any one of embodiments 1 to 30 which comprises a monomer according to Exemplary Monomer 1 and a monomer according to Exemplary Monomer 5.
- Exemplary Monomer 1 comprises or consists of, in an N- to C-terminal orientation, a CD20 targeting moiety (e.g., anti-CD20 Fab, Fv or scFV), an optional linker moiety and a dimerization moiety.
- a CD20 targeting moiety e.g., anti-CD20 Fab, Fv or scFV
- an optional linker moiety e.g., an optional linker moiety and a dimerization moiety.
- Exemplary Monomer 5 comprises or consists of, in an N- to C-terminal orientation, a CD20 targeting moiety (e.g., anti- CD20 Fab, Fv or scFV), an optional linker moiety, a dimerization moiety, and a PD1 agonist moiety (e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)).
- a CD20 targeting moiety e.g., anti- CD20 Fab, Fv or scFV
- an optional linker moiety e.g., an optional linker moiety
- a dimerization moiety e.g., a PD1 agonist moiety
- a PD1 agonist moiety e.g., a moiety compris
- Exemplary Monomer 1 comprises or consists of, in an N- to C-terminal orientation, a CD20 targeting moiety (e.g., anti-CD20 Fab, Fv or scFV), an optional linker moiety and a dimerization moiety.
- a CD20 targeting moiety e.g., anti-CD20 Fab, Fv or scFV
- an optional linker moiety e.g., an optional linker moiety
- a dimerization moiety e.g., dimerization moiety.
- Exemplary Monomer 6 comprises or consists of, in an N- to C-terminal orientation, a CD20 targeting moiety (e.g., anti- CD20 Fab, Fv or scFV), an optional linker moiety, a PD1 agonist moiety (e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)), an optional linker moiety and a dimerization moiety.
- a CD20 targeting moiety e.g., anti- CD20 Fab, Fv or scFV
- a PD1 agonist moiety e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding
- Exemplary Monomer 1 comprises or consists of, in an N- to C-terminal orientation, a CD20 targeting moiety (e.g., anti-CD20 Fab, Fv or scFV), an optional linker moiety and a dimerization moiety.
- a CD20 targeting moiety e.g., anti-CD20 Fab, Fv or scFV
- an optional linker moiety e.g., an optional linker moiety and a dimerization moiety.
- Exemplary Monomer 7 comprises or consists of, in an N- to C-terminal orientation, a PD1 agonist moiety (e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)), an optional linker moiety, a PD1 agonist moiety (e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)),
- a PD1 agonist moiety e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2
- each Exemplary Monomer 4 comprises or consists of, in an N- to C-terminal orientation, a PD1 agonist moiety (e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)), an optional linker moiety, a CD20 targeting moiety (e.g., anti-CD20 Fab, Fv or scFV), an optional linker moiety and a dimerization moiety.
- a PD1 agonist moiety e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (
- each Exemplary Monomer 5 comprises or consists of, in an N- to C-terminal orientation, a CD20 targeting moiety (e.g., anti-CD20 Fab, Fv or scFV), an optional linker moiety, a dimerization moiety, and a PD1 agonist moiety (e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)).
- a CD20 targeting moiety e.g., anti-CD20 Fab, Fv or scFV
- an optional linker moiety e.g., an optional linker moiety
- a dimerization moiety e.g., a PD1 agonist moiety
- a PD1 agonist moiety e.g., a moiety
- Exemplary Monomer 8 comprises or consists of, in an N- to C-terminal orientation, a CD20 targeting moiety (e.g., anti-CD20 Fab, Fv or scFV), an optional linker moiety, a dimerization moiety, an optional linker moiety, and a CD20 targeting moiety (e.g., anti-CD20 Fab, Fv or scFV).
- a CD20 targeting moiety e.g., anti-CD20 Fab, Fv or scFV
- an optional linker moiety e.g., anti-CD20 Fab, Fv or scFV
- a dimerization moiety e.g., dimerization moiety
- an optional linker moiety e.g., anti-CD20 Fab, Fv or scFV
- each Exemplary Monomer 8 is composed of two polypeptide chains.
- Exemplary Monomer 9 comprises or consists of, in an N- to C-terminal orientation, a PD1 agonist moiety (e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)), an optional linker moiety, a dimerization moiety, an optional linker moiety, a PD1 agonist moiety (e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)).
- a PD1 agonist moiety e.g., a moiety comprising (i) the amino
- each Exemplary Monomer 6 comprises or consists of, in an N- to C-terminal orientation, a CD20 targeting moiety (e.g., anti-CD20 Fab, Fv or scFV), an optional linker moiety, a PD1 agonist moiety (e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of binding to PD1 ; or (iii) an amino acid sequence which has at least 90% sequence identity to (i) or (ii)), an optional linker moiety and a dimerization moiety.
- a CD20 targeting moiety e.g., anti-CD20 Fab, Fv or scFV
- a PD1 agonist moiety e.g., a moiety comprising (i) the amino acid sequence of the extracellular domain of PDL1 or PDL2; (ii) a fragment of (i) which is capable of
- invention 107 The protein of embodiment 107, which comprises one PD1 agonist moiety.
- the Fc domain comprises the amino acid sequence ESKYGPPCPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVWDVSQEDPEVQFNWYVDGVE VHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQV YTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 32) or a portion thereof.
- the CD20 targeting moiety is an anti-CD20 Fab
- the PD1 agonist moiety is the ectodomain of PDL1
- the dimerization moiety is an Fc domain
- the light chain of the Fab is not fused to the ectodomain of PDL1 or PD1-binding portion thereof.
- the CD20 targeting moiety is an anti-CD20 Fab
- the PD1 agonist moiety is the ectodomain of PDL1
- the dimerization moiety is an Fc domain
- the PD1 agonist moiety is not N-terminal to a VH of the anti-CD20 Fab.
- the CD20 targeting moiety is an anti-CD20 Fab
- the PD1 agonist moiety is the ectodomain of PDL1
- the dimerization moiety is an Fc domain
- the PD1 agonist moiety is not C-terminal to the Fc domain.
- the CD20 targeting moiety is an anti-CD20 Fab
- the PD1 agonist moiety is the ectodomain of PDL1
- the dimerization moiety is an Fc domain
- the protein is monovalent for the CD20 targeting moiety and/or the PD1 agonist moiety.
- a pharmaceutical composition comprising the protein of any one of embodiments 1 to 149 and an excipient.
- a method of treating a subject suffering from an immune disorder or condition associated with T cell dysregulation comprising administering to the subject an effective amount of the protein of any one of embodiments 1 to 149 or the pharmaceutical composition of embodiment 153.
- the immune disorder or condition is type 1 diabetes, primary biliary cholangitis (PBC), Goodpasture’s syndrome, amyloidosis, ankylosing spondylitis, anti-glomerular basement membrane nephritis, anti-tubular basement membrane nephritis, antiphospholipid syndrome, autoimmune hepatitis, autoimmune oophoritis, graft vs.
- PBC primary biliary cholangitis
- Goodpasture’s syndrome amyloidosis
- ankylosing spondylitis anti-glomerular basement membrane nephritis
- anti-tubular basement membrane nephritis antiphospholipid syndrome
- autoimmune hepatitis autoimmune oophoritis
- graft vs graft vs.
- GVHD host disease
- autoimmune pancreatitis autoimmune pancreatitis
- autoimmune retinopathy Behcet’s disease, Crohn’s disease
- Devic’s disease systemic lupus erythematosus (SLE), Dressier’s syndrome, fibrosing alveolitis, glomerulonephritis, Graves’ disease, Guillain-Barre syndrome, IgA Nephropathy, lgG4- related sclerosing disease, immune thrombocytopenic purpura (ITP), microscopic polyangiitis (MPA), mixed connective tissue disease (MCTD), multiple sclerosis, polyneuropathy, organomegaly, endocrinopathy, monoclonal syndrome (POEMS), polyarteritis nodosa, rheumatoid arthritis, Schmidt syndrome, scleritis, scleroderma, Sjogren’s syndrome, sperm or testicular autoimmunity, stiff person syndrome (SPS),
- a method of repressing a cellular autoimmune response in a subject comprising administering to the subject an effective amount of the protein of any one of embodiments 1 to 149 or the pharmaceutical composition of embodiment 153.
- the additional therapeutic agent is or comprises an immunomodulatory agent, a cytostatic agent, an inhibitor of cell adhesion, a cytotoxic agent, an activator of cell apoptosis, or an agent that increases the sensitivity of cells to apoptotic inducers.
- the additional therapeutic agent is or comprises CAR-expressing cells.
- a method of localized PD1 agonism comprising administering to a subject an effective amount of the protein of any one of embodiments 1 to 149 or the pharmaceutical composition of embodiment 153.
- a method of locally modulating an immune response in a target tissue or cell that expresses CD20 comprising administering to a subject an effective amount of the protein of any one of embodiments 1 to 149 or the pharmaceutical composition of embodiment 153.
- a method of characterizing the ability of a molecule type I to agonize PD1 comprising:
- step a) incubating the cultured cells of step a) in the presence or absence of the molecule type I and a molecule type II;
- step b) measuring luciferase activity in the cultured cells, wherein the molecule type I is a multi-specific antigen-binding molecule comprising: i) a first binding specificity that binds to an ectodomain of CD20; and ii) a second binding specificity that binds to PD1 , wherein the molecule type II is a multi-specific antigen-binding molecule comprising :i) a first binding specificity that binds to an ectodomain of CD3; and ii) a second binding specificity that binds to an ectodomain of CD22, and wherein the presence of the molecule type II causes an increase in luciferase activity and the presence of the molecule type I causes a reduction in the luciferase activity caused by the molecule type II and wherein the amount of reduction in luciferase activity is indicative of the ability of the molecule type I to agonize PD1.
- the molecule type I is a multi
Landscapes
- Health & Medical Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Diabetes (AREA)
- Hematology (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- General Chemical & Material Sciences (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Physics & Mathematics (AREA)
- Emergency Medicine (AREA)
- Transplantation (AREA)
- Endocrinology (AREA)
- Obesity (AREA)
- Cell Biology (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Food Science & Technology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Computational Biology (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
Description
Claims
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163278374P | 2021-11-11 | 2021-11-11 | |
| US202163278454P | 2021-11-11 | 2021-11-11 | |
| PCT/US2022/079530 WO2023086812A1 (en) | 2021-11-11 | 2022-11-09 | Cd20-pd1 binding molecules and methods of use thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP4430079A1 true EP4430079A1 (en) | 2024-09-18 |
Family
ID=84488718
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP22822802.9A Pending EP4430079A1 (en) | 2021-11-11 | 2022-11-09 | Cd20-pd1 binding molecules and methods of use thereof |
Country Status (8)
| Country | Link |
|---|---|
| US (2) | US20240425609A1 (en) |
| EP (1) | EP4430079A1 (en) |
| JP (1) | JP2024544534A (en) |
| KR (1) | KR20240099460A (en) |
| AU (1) | AU2022383847A1 (en) |
| CA (1) | CA3238029A1 (en) |
| TW (1) | TW202334223A (en) |
| WO (1) | WO2023086812A1 (en) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20240099460A (en) | 2021-11-11 | 2024-06-28 | 리제너론 파아마슈티컬스, 인크. | CD20-PD1 binding molecule and methods of use thereof |
| EP4709756A1 (en) * | 2023-05-10 | 2026-03-18 | Regeneron Pharmaceuticals, Inc. | Cd20-pd1 binding molecules and methods of use thereof |
Family Cites Families (54)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
| JP3051145B2 (en) | 1990-08-28 | 2000-06-12 | 住友製薬株式会社 | Novel polyethylene glycol derivative modified peptide |
| US5582996A (en) | 1990-12-04 | 1996-12-10 | The Wistar Institute Of Anatomy & Biology | Bifunctional antibodies and method of preparing same |
| US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
| DE69309472T2 (en) | 1992-01-23 | 1997-10-23 | Merck Patent Gmbh, 64293 Darmstadt | FUSION PROTEINS OF MONOMERS AND DIMERS OF ANTIBODY FRAGMENTS |
| US5932462A (en) | 1995-01-10 | 1999-08-03 | Shearwater Polymers, Inc. | Multiarmed, monofunctional, polymer for coupling to molecules and surfaces |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| GB9625640D0 (en) | 1996-12-10 | 1997-01-29 | Celltech Therapeutics Ltd | Biological products |
| US20020062010A1 (en) | 1997-05-02 | 2002-05-23 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| GB9720054D0 (en) | 1997-09-19 | 1997-11-19 | Celltech Therapeutics Ltd | Biological products |
| GB9824437D0 (en) | 1998-11-06 | 1999-01-06 | Ylo Herttuala Seppo | Gene therapy |
| US20030180309A1 (en) | 2001-01-08 | 2003-09-25 | Baum Peter R. | Human B7 polypeptides |
| US6833441B2 (en) | 2001-08-01 | 2004-12-21 | Abmaxis, Inc. | Compositions and methods for generating chimeric heteromultimers |
| EP1900753B1 (en) | 2002-11-08 | 2017-08-09 | Ablynx N.V. | Method of administering therapeutic polypeptides, and polypeptides therefor |
| CN101899114A (en) * | 2002-12-23 | 2010-12-01 | 惠氏公司 | Anti-PD-1 antibody and uses thereof |
| GB0315457D0 (en) | 2003-07-01 | 2003-08-06 | Celltech R&D Ltd | Biological products |
| GB0315450D0 (en) | 2003-07-01 | 2003-08-06 | Celltech R&D Ltd | Biological products |
| ES2551439T5 (en) | 2003-07-01 | 2018-11-08 | Ucb Biopharma Sprl | Fab fragments of modified antibodies |
| WO2005049094A1 (en) | 2003-11-13 | 2005-06-02 | Advantagene, Inc. | A mixed complementary viral vector for gene therapy |
| WO2006028936A2 (en) | 2004-09-02 | 2006-03-16 | Genentech, Inc. | Heteromultimeric molecules |
| AU2006232287B2 (en) | 2005-03-31 | 2011-10-06 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
| WO2007064911A1 (en) * | 2005-12-02 | 2007-06-07 | Biogen Idec Inc. | Anti-mouse cd20 antibodies and uses thereof |
| US20070269422A1 (en) | 2006-05-17 | 2007-11-22 | Ablynx N.V. | Serum albumin binding proteins with long half-lives |
| US9266967B2 (en) | 2007-12-21 | 2016-02-23 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
| JP6157046B2 (en) | 2008-01-07 | 2017-07-05 | アムジェン インコーポレイテッド | Method for generating antibody Fc heterodimer molecules using electrostatic steering effect |
| MY192182A (en) | 2009-06-26 | 2022-08-04 | Regeneron Pharma | Readily isolated bispecific antibodies with native immunoglobulin format |
| US9796788B2 (en) | 2010-02-08 | 2017-10-24 | Regeneron Pharmaceuticals, Inc. | Mice expressing a limited immunoglobulin light chain repertoire |
| CA3253628A1 (en) * | 2010-03-05 | 2025-11-29 | The Johns Hopkins University | Compositions and methods for targeted immunomodulatory antibodies and fusion proteins |
| PL3489254T3 (en) | 2012-04-30 | 2023-01-30 | Biocon Limited | Targeted/immunomodulatory fusion proteins and methods for making same |
| CN105026430B (en) | 2012-11-28 | 2025-03-25 | 酵活英属哥伦比亚有限公司 | Engineered immunoglobulin heavy chain-light chain pairs and uses thereof |
| TWI635098B (en) | 2013-02-01 | 2018-09-11 | 再生元醫藥公司 | Antibody containing chimeric constant region |
| ES2821753T3 (en) | 2013-03-15 | 2021-04-27 | Lilly Co Eli | Fab and bispecific antibody production procedures |
| AU2014364593A1 (en) | 2013-12-17 | 2016-07-07 | Genentech, Inc. | Methods of treating cancer using PD-1 axis binding antagonists and an anti-CD20 antibody |
| TWI681969B (en) | 2014-01-23 | 2020-01-11 | 美商再生元醫藥公司 | Human antibodies to pd-1 |
| WO2016161010A2 (en) | 2015-03-30 | 2016-10-06 | Regeneron Pharmaceuticals, Inc. | Heavy chain constant regions with reduced binding to fc gamma receptors |
| LT3394103T (en) | 2015-12-22 | 2023-09-11 | Regeneron Pharmaceuticals, Inc. | COMBINATION OF ANTI-PD-1 ANTIBODIES AND BISPECIFIC ANTIBODIES AGAINST CD20/CD3 FOR THE TREATMENT OF CANCER |
| AU2016378573A1 (en) | 2015-12-22 | 2018-07-19 | Regeneron Pharmaceuticals, Inc. | Bispecific anti-CD20/anti-CD3 antibodies to treat acute lymphoblastic leukemia |
| WO2017134592A1 (en) | 2016-02-03 | 2017-08-10 | Biocon Limited | Anti-cd20/immunomodulatory fusion proteins and methods for making same |
| WO2018220099A1 (en) | 2017-06-02 | 2018-12-06 | F. Hoffmann-La Roche Ag | Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer |
| WO2018014260A1 (en) * | 2016-07-20 | 2018-01-25 | Nanjing Legend Biotech Co., Ltd. | Multispecific antigen binding proteins and methods of use thereof |
| US20190225701A1 (en) | 2016-09-26 | 2019-07-25 | The Brigham And Women's Hospital, Inc. | Regulators of b cell-mediated immunosuppression |
| WO2018144784A1 (en) | 2017-02-01 | 2018-08-09 | Smet Pharmaceutical Inc. | MONOMERIC HUMAN IgG1 Fc AND BISPECIFIC ANTIBODIES |
| EP3596116B1 (en) * | 2017-03-16 | 2023-09-06 | Alpine Immune Sciences, Inc. | Pd-l1 variant immunomodulatory proteins and uses thereof |
| CN107043425B (en) | 2017-03-27 | 2019-05-10 | 顺昊细胞生物技术(天津)股份有限公司 | anti-PD 1 and CD20 bispecific antibodies and uses thereof |
| EP3615564A1 (en) * | 2017-04-24 | 2020-03-04 | Alexion Pharmaceuticals, Inc. | Antibody immune cell inhibitor fusion proteins |
| WO2018223004A1 (en) | 2017-06-01 | 2018-12-06 | Xencor, Inc. | Bispecific antibodies that bind cd20 and cd3 |
| JP7230819B2 (en) | 2017-10-06 | 2023-03-01 | 小野薬品工業株式会社 | Bispecific antibody |
| CN109954138A (en) | 2017-12-26 | 2019-07-02 | 天津耀辰实业发展有限公司 | A kind of anti-PD-1 and CD20 bispecific antibody drug |
| SG11202008474QA (en) | 2018-03-27 | 2020-10-29 | Systimmune Inc | Guidance and navigation control proteins and method of making and using thereof |
| KR20210010896A (en) | 2018-05-14 | 2021-01-28 | 이뮤노코어 리미티드 | Bifunctional binding polypeptide |
| JP7511542B2 (en) | 2018-08-30 | 2024-07-05 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Methods for characterizing protein complexes |
| WO2021062184A1 (en) | 2019-09-26 | 2021-04-01 | Orionis Biosciences, Inc. | Pd-l1 targeted chimeric proteins and uses thereof |
| KR20230029611A (en) | 2020-05-27 | 2023-03-03 | 다나-파버 캔서 인스티튜트 인크. | Bispecific molecules for selectively regulating T cells |
| KR20240099460A (en) | 2021-11-11 | 2024-06-28 | 리제너론 파아마슈티컬스, 인크. | CD20-PD1 binding molecule and methods of use thereof |
-
2022
- 2022-11-09 KR KR1020247019276A patent/KR20240099460A/en active Pending
- 2022-11-09 TW TW111142862A patent/TW202334223A/en unknown
- 2022-11-09 US US18/708,256 patent/US20240425609A1/en active Pending
- 2022-11-09 US US18/053,868 patent/US12559576B2/en active Active
- 2022-11-09 EP EP22822802.9A patent/EP4430079A1/en active Pending
- 2022-11-09 WO PCT/US2022/079530 patent/WO2023086812A1/en not_active Ceased
- 2022-11-09 AU AU2022383847A patent/AU2022383847A1/en active Pending
- 2022-11-09 JP JP2024527569A patent/JP2024544534A/en active Pending
- 2022-11-09 CA CA3238029A patent/CA3238029A1/en active Pending
Also Published As
| Publication number | Publication date |
|---|---|
| TW202334223A (en) | 2023-09-01 |
| US20240425609A1 (en) | 2024-12-26 |
| KR20240099460A (en) | 2024-06-28 |
| WO2023086812A1 (en) | 2023-05-19 |
| US12559576B2 (en) | 2026-02-24 |
| US20230279153A1 (en) | 2023-09-07 |
| AU2022383847A1 (en) | 2024-06-20 |
| CA3238029A1 (en) | 2023-05-19 |
| JP2024544534A (en) | 2024-12-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240360217A1 (en) | Multivalent antibody | |
| US20230277662A1 (en) | Antibodies binding to cd3 | |
| KR102562519B1 (en) | Bispecific Heterodimeric Fusion Proteins Comprising IL-15/IL-15Rα FC-Fusion Proteins and PD-1 Antibody Fragments | |
| US20230192795A1 (en) | Immunoconjugates | |
| US20230416411A1 (en) | Antibodies binding to cd3 and folr1 | |
| WO2023051727A1 (en) | Antibody binding to cd3, and use thereof | |
| CN117751144A (en) | anti-CD 38 antibodies, anti-CD 3 antibodies and bispecific antibodies and uses thereof | |
| US12559576B2 (en) | CD20-PD1 binding molecules and methods of use thereof | |
| KR20240046251A (en) | Novel IL27 receptor agonists and methods of use thereof | |
| US20240376229A1 (en) | Interferon receptor antagonists and uses thereof | |
| US20250109207A1 (en) | Chimeric heavy chain constant domains with reduced binding to fc gamma receptors and uses thereof | |
| CN118510802A (en) | CD20-PD1 binding molecules and methods of use thereof | |
| US20240400687A1 (en) | Cd20-pd1 binding molecules and methods of use thereof | |
| HK40114772A (en) | Cd20-pd1 binding molecules and methods of use thereof | |
| US20250361279A1 (en) | New Interleukin-7 Immunoconjugates | |
| CN121873202A (en) | IL-2 mutant, PD1 antibody X IL-2 mutant fusion protein and application thereof | |
| HK40007765A (en) | Bispecific heterodimeric fusion proteins containing il-15/il-15ralpha fc-fusion proteins and pd-1 antibody fragments |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20240610 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) | ||
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 40116328 Country of ref document: HK |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: EXAMINATION IS IN PROGRESS |
|
| 17Q | First examination report despatched |
Effective date: 20260309 |